Polyadenylate-binding protein

Overview
NamePolyadenylate-binding protein
Smed IDSMED30009858
Length (bp)1509
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Polyadenylate-binding protein (SMED30009858) t-SNE clustered cells

Violin plots show distribution of expression levels for Polyadenylate-binding protein (SMED30009858) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Polyadenylate-binding protein (SMED30009858) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Polyadenylate-binding protein (SMED30009858) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30009858

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 22

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30009858SMESG000044671.1 SmedASXL_006385SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30009858SMESG000044671.1 SmedASXL_006385SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
nervous systemSMED30009858SMESG000044671.1 dd_Smed_v4_2139_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30009858SMESG000044671.1 dd_Smed_v4_2139_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30009858SMESG000044671.1 dd_Smed_v4_2139_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30009858SMESG000044671.1 dd_Smed_v4_2139_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30009858SMESG000044671.1 dd_Smed_v4_2139_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30009858SMESG000044671.1 dd_Smed_v4_2139_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009858SMESG000044671.1 Contig48828uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009858SMESG000044671.1 Contig48828newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
gutSMED30009858SMESG000044671.1 SMED30009858smed_20140614PMID:28807897
Bansal et al., 2017
whole organism asexual adult fluorescence in situ hybridization evidence
gutSMED30009858SMESG000044671.1 SMED30009858smed_20140614PMID:28807897
Bansal et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30009858SMESG000044671.1 SMED30009858smed_20140614PMID:28807897
Bansal et al., 2017
whole organism asexual adult fluorescence in situ hybridization evidence
muscle cellSMED30009858SMESG000044671.1 SMED30009858smed_20140614PMID:28807897
Bansal et al., 2017
whole organism asexual adult fluorescence in situ hybridization evidence
head regionSMED30009858SMESG000044671.1 SMED30009858smed_20140614PMID:28807897
Bansal et al., 2017
whole organism asexual adult fluorescence in situ hybridization evidence
prepharyngeal regionSMED30009858SMESG000044671.1 SMED30009858smed_20140614PMID:28807897
Bansal et al., 2017
whole organism asexual adult fluorescence in situ hybridization evidence
parapharyngeal regionSMED30009858SMESG000044671.1 SMED30009858smed_20140614PMID:28807897
Bansal et al., 2017
whole organism asexual adult fluorescence in situ hybridization evidence
tail regionSMED30009858SMESG000044671.1 SMED30009858smed_20140614PMID:28807897
Bansal et al., 2017
whole organism asexual adult fluorescence in situ hybridization evidence
neoblastSMED30009858SMESG000044671.1 SMED30009858smed_20140614PMID:28807897
Bansal et al., 2017
whole organism asexual adult fluorescence in situ hybridization evidence
neoblastSMED30009858SMESG000044671.1 SMED30009858smed_20140614PMID:28807897
Bansal et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal progenitor cellSMED30009858SMESG000044671.1 SMED30009858smed_20140614PMID:28807897
Bansal et al., 2017
whole organism asexual adult fluorescence in situ hybridization evidence
epidermal progenitor cellSMED30009858SMESG000044671.1 SMED30009858smed_20140614PMID:28807897
Bansal et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Polyadenylate-binding protein vs. Ensembl Human
Match: TIA1 (TIA1 cytotoxic granule associated RNA binding protein [Source:HGNC Symbol;Acc:HGNC:11802])

HSP 1 Score: 138.658 bits (348), Expect = 7.453e-36
Identity = 93/345 (26.96%), Postives = 171/345 (49.57%), Query Frame = 2
Query:  101 MESKNKKTIYISSLPKSVTEEDLLSIFENYGLCVSCSLDPETCT----AYVEF-DNENSANNSLSMNGVEMGTTKIEISIAYI--EQEHNIKRESSLKQEASEDCKPAQIFVGNIGTKVDETILKGGFEHLGTIIEAKVIRD-ADGKHKGYGFVTFSNEYEARSAIDKMNETFFHDEKIKCSWGKNKSNLAVVASKNASKTL--EEIFNETPKSYTNVFVTG--DNVTKELLEPHFEVFGKIKNIKAFPRNNQAFINYFSHESAGNAIHQMNGFVVNNIELNCSWAIKTEKSXXXXXXXXXXXXXXXXANVGAPRKYLANQINQYNGRQQPYESYDETGYGLPQF 1099
            ME +  KT+Y+ +L + VTE  +L +F   G C +C +  +T       +VEF ++ ++A    +MNG ++   +++++ A     Q+ +    + +  + S+D     +FVG++  ++    +K  F   G I +A+V++D A GK KGYGFV+F N+++A +AI +M   +    +I+ +W   K        ++ +K L  +E+ N++  S   V+  G    +T++L+   F  FG+I  I+ FP    +F+ + SHESA +AI  +NG  +    + C W  +T                 +   +G P+ Y   Q  Q+ G  Q    Y   G+ +P +
Sbjct:    1 MEDEMPKTLYVGNLSRDVTEALILQLFSQIGPCKNCKMIMDTAGNDPYCFVEFHEHRHAAAALAAMNGRKIMGKEVKVNWATTPSSQKKDTSSSTVVSTQRSQD--HFHVFVGDLSPEITTEDIKAAFAPFGRISDARVVKDMATGKSKGYGFVSFFNKWDAENAIQQMGGQWLGGRQIRTNWATRKPPAPKSTYESNTKQLSYDEVVNQSSPSNCTVYCGGVTSGLTEQLMRQTFSPFGQIMEIRVFPDKGYSFVRFNSHESAAHAIVSVNGTTIEGHVVKCYWGKET---------LDMINPVQQQNQIGYPQPY--GQWGQWYGNAQQIGQYMPNGWQVPAY 332          
BLAST of Polyadenylate-binding protein vs. Ensembl Human
Match: TIA1 (TIA1 cytotoxic granule associated RNA binding protein [Source:HGNC Symbol;Acc:HGNC:11802])

HSP 1 Score: 138.658 bits (348), Expect = 7.463e-36
Identity = 93/345 (26.96%), Postives = 173/345 (50.14%), Query Frame = 2
Query:  101 MESKNKKTIYISSLPKSVTEEDLLSIFENYGLCVSCSLDPETCT----AYVEF-DNENSANNSLSMNGVEMGTTKIEISIAYI--EQEHNIKRESSLKQEASEDCKPAQIFVGNIGTKVDETILKGGFEHLGTIIEAKVIRD-ADGKHKGYGFVTFSNEYEARSAIDKMNETFFHDEKIKCSWGKNKSNLAVVASKNASKTL--EEIFNETPKSYTNVFVTG--DNVTKELLEPHFEVFGKIKNIKAFPRNNQAFINYFSHESAGNAIHQMNGFVVNNIELNCSWAIKTEKSXXXXXXXXXXXXXXXXANVGAPRKYLANQINQYNGRQQPYESYDETGYGLPQF 1099
            ME +  KT+Y+ +L + VTE  +L +F   G C +C +  +T       +VEF ++ ++A    +MNG ++   +++++ A     Q+ +    + +  + S+D     +FVG++  ++    +K  F   G I +A+V++D A GK KGYGFV+F N+++A +AI +M   +    +I+ +W   K        ++ +K L  +E+ N++  S   V+  G    +T++L+   F  FG+I  I+ FP    +F+ + SHESA +AI  +NG  +    + C W  +T             +  ++   +G P+ Y   Q  Q+ G  Q    Y   G+ +P +
Sbjct:    1 MEDEMPKTLYVGNLSRDVTEALILQLFSQIGPCKNCKMIMDTAGNDPYCFVEFHEHRHAAAALAAMNGRKIMGKEVKVNWATTPSSQKKDTSSSTVVSTQRSQD--HFHVFVGDLSPEITTEDIKAAFAPFGRISDARVVKDMATGKSKGYGFVSFFNKWDAENAIQQMGGQWLGGRQIRTNWATRKPPAPKSTYESNTKQLSYDEVVNQSSPSNCTVYCGGVTSGLTEQLMRQTFSPFGQIMEIRVFPDKGYSFVRFNSHESAAHAIVSVNGTTIEGHVVKCYWGKET----------LDMINPVQQNQIGYPQPY--GQWGQWYGNAQQIGQYMPNGWQVPAY 331          
BLAST of Polyadenylate-binding protein vs. Ensembl Human
Match: TIA1 (TIA1 cytotoxic granule associated RNA binding protein [Source:HGNC Symbol;Acc:HGNC:11802])

HSP 1 Score: 136.346 bits (342), Expect = 4.532e-35
Identity = 94/343 (27.41%), Postives = 168/343 (48.98%), Query Frame = 2
Query:  101 MESKNKKTIYISSLPKSVTEEDLLSIFENYGLCVSCSLDPETCT----AYVEF-DNENSANNSLSMNGVEMGTTKIEISIAYIEQEHNIKRESSLKQEASEDCKPAQIFVGNIGTKVDETILKGGFEHLGTIIEAKVIRD-ADGKHKGYGFVTFSNEYEARSAIDKMNETFFHDEKIKCSWGKNKSNLAVVASKNASKTL--EEIFNETPKSYTNVFVTG--DNVTKELLEPHFEVFGKIKNIKAFPRNNQAFINYFSHESAGNAIHQMNGFVVNNIELNCSWAIKTEKSXXXXXXXXXXXXXXXXANVGAPRKYLANQINQYNGRQQPYESYDETGYGLPQF 1099
            ME +  KT+Y+ +L + VTE  +L +F   G C +C +  +T       +VEF ++ ++A    +MNG ++   +++++ A           SS K++ S       +FVG++  ++    +K  F   G I +A+V++D A GK KGYGFV+F N+++A +AI +M   +    +I+ +W   K        ++ +K L  +E+ N++  S   V+  G    +T++L+   F  FG+I  I+ FP    +F+ + SHESA +AI  +NG  +    + C W  +T                 +   +G P+ Y   Q  Q+ G  Q    Y   G+ +P +
Sbjct:    1 MEDEMPKTLYVGNLSRDVTEALILQLFSQIGPCKNCKMIMDTAGNDPYCFVEFHEHRHAAAALAAMNGRKIMGKEVKVNWA--------TTPSSQKKDTSNHF---HVFVGDLSPEITTEDIKAAFAPFGRISDARVVKDMATGKSKGYGFVSFFNKWDAENAIQQMGGQWLGGRQIRTNWATRKPPAPKSTYESNTKQLSYDEVVNQSSPSNCTVYCGGVTSGLTEQLMRQTFSPFGQIMEIRVFPDKGYSFVRFNSHESAAHAIVSVNGTTIEGHVVKCYWGKET---------LDMINPVQQQNQIGYPQPY--GQWGQWYGNAQQIGQYMPNGWQVPAY 321          
BLAST of Polyadenylate-binding protein vs. Ensembl Human
Match: TIAL1 (TIA1 cytotoxic granule associated RNA binding protein like 1 [Source:HGNC Symbol;Acc:HGNC:11804])

HSP 1 Score: 127.102 bits (318), Expect = 1.091e-31
Identity = 93/341 (27.27%), Postives = 166/341 (48.68%), Query Frame = 2
Query:  119 KTIYISSLPKSVTEEDLLSIFENYGLCVSCSLDPETCT----AYVEF-DNENSANNSLSMNGVEMGTTKIEISIAYIEQEHNIKRESSLKQEASEDCKPAQIFVGNIGTKVDETILKGGFEHLGTIIEAKVIRD-ADGKHKGYGFVTFSNEYEARSAIDKMNETFFHDEKIKCSWGKNKSNLAVVASKNASKTL--EEIFNETPKSYTNVFVTG--DNVTKELLEPHFEVFGKIKNIKAFPRNNQAFINYFSHESAGNAIHQMNGFVVNNIELNCSWAIKTEKSXXXXXXXXXXXXXXXXANVGAPR---KYLAN--QINQYNGRQQPYESYDETGYGLPQ 1096
            +T+Y+ +L + VTE  +L +F   G C SC +  E  +     +VEF ++ ++A    +MNG ++   +++++ A           SS K++ S       +FVG++  ++    +K  F   G I +A+V++D A GK KGYGFV+F N+ +A +AI  M   +    +I+ +W   K        +N +K L  E++ N++      V+  G    +T +L+   F  FG+I  I+ FP    +F+ + +HESA +AI  +NG  +    + C W  ++    K                 G P+   +Y+AN  Q+  Y    QP   +++ G+G+ Q
Sbjct:    9 RTLYVGNLSRDVTEVLILQLFSQIGPCKSCKMITEHTSNDPYCFVEFYEHRDAAAALAAMNGRKILGKEVKVNWA--------TTPSSQKKDTSNHF---HVFVGDLSPEITTEDIKSAFAPFGKISDARVVKDMATGKSKGYGFVSFYNKLDAENAIVHMGGQWLGGRQIRTNWATRKPPAPKSTQENNTKQLRFEDVVNQSSPKNCTVYCGGIASGLTDQLMRQTFSPFGQIMEIRVFPEKGYSFVRFSTHESAAHAIVSVNGTTIEGHVVKCYWGKESPDMTKNFQQVDYSQWGQWSQVYGNPQQYGQYMANGWQVPPYGVYGQP---WNQQGFGVDQ 335          
BLAST of Polyadenylate-binding protein vs. Ensembl Human
Match: TIAL1 (TIA1 cytotoxic granule associated RNA binding protein like 1 [Source:HGNC Symbol;Acc:HGNC:11804])

HSP 1 Score: 119.398 bits (298), Expect = 7.682e-29
Identity = 93/358 (25.98%), Postives = 166/358 (46.37%), Query Frame = 2
Query:  119 KTIYISSLPKSVTEEDLLSIFENYGLCVSCSLDPETCTA---------------------YVEF-DNENSANNSLSMNGVEMGTTKIEISIAYIEQEHNIKRESSLKQEASEDCKPAQIFVGNIGTKVDETILKGGFEHLGTIIEAKVIRD-ADGKHKGYGFVTFSNEYEARSAIDKMNETFFHDEKIKCSWGKNKSNLAVVASKNASKTL--EEIFNETPKSYTNVFVTG--DNVTKELLEPHFEVFGKIKNIKAFPRNNQAFINYFSHESAGNAIHQMNGFVVNNIELNCSWAIKTEKSXXXXXXXXXXXXXXXXANVGAPR---KYLAN--QINQYNGRQQPYESYDETGYGLPQ 1096
            +T+Y+ +L + VTE  +L +F   G C SC +  E   +                     +VEF ++ ++A    +MNG ++   +++++ A           SS K++ S       +FVG++  ++    +K  F   G I +A+V++D A GK KGYGFV+F N+ +A +AI  M   +    +I+ +W   K        +N +K L  E++ N++      V+  G    +T +L+   F  FG+I  I+ FP    +F+ + +HESA +AI  +NG  +    + C W  ++    K                 G P+   +Y+AN  Q+  Y    QP   +++ G+G+ Q
Sbjct:    9 RTLYVGNLSRDVTEVLILQLFSQIGPCKSCKMITEQPDSRRVNSSVGFSVLQHTSNDPYCFVEFYEHRDAAAALAAMNGRKILGKEVKVNWA--------TTPSSQKKDTSNHF---HVFVGDLSPEITTEDIKSAFAPFGKISDARVVKDMATGKSKGYGFVSFYNKLDAENAIVHMGGQWLGGRQIRTNWATRKPPAPKSTQENNTKQLRFEDVVNQSSPKNCTVYCGGIASGLTDQLMRQTFSPFGQIMEIRVFPEKGYSFVRFSTHESAAHAIVSVNGTTIEGHVVKCYWGKESPDMTKNFQQVDYSQWGQWSQVYGNPQQYGQYMANGWQVPPYGVYGQP---WNQQGFGVDQ 352          
BLAST of Polyadenylate-binding protein vs. Ensembl Celegans
Match: tiar-2 (TIA-1/TIAL RNA binding protein homolog [Source:UniProtKB/TrEMBL;Acc:Q9U2F5])

HSP 1 Score: 120.553 bits (301), Expect = 1.966e-29
Identity = 82/296 (27.70%), Postives = 143/296 (48.31%), Query Frame = 2
Query:  107 SKNKKTIYISSLPKSVTEEDLLSIFENYGLCVSCSLDPETCT---AYVEFDNENSANNSL-SMNGVEMGTTKIEISIAYIEQEHNIKRESSLKQEASEDCKPAQIFVGNIGTKVDETILKGGFEHLGTIIEAKVIRDAD-GKHKGYGFVTFSNEYEARSAIDKMNETFFHDEKIKCSWGKNKSNLAVVASK------------------NASKTLEEIFNETPKSYTNVFVTG-DNVTKELLEPHFEVFGKIKNIKAFPRNNQAFINYFSHESAGNAIHQMNGFVVNNIELNCSWA 922
            S++ +T+++++L  ++T+E L ++F   G  +   +  E      A+VEF + N A  +L S NG E+   ++ ++ A+        RE    +   E  +   +FVG++ +++D T L+  F   G + EAK+IRD +  K KGYGFV++    +A  AID+MN  +     I+ +W   K +                          + KT +EIFN+     T+V+V    N+ ++ +   F+ FG I  ++ F     AF+ + + ESA  AI QMN   +    + CSW 
Sbjct:   36 SEDPRTLFVANLDPAITDEFLATLFNQIGAVMKAKIIFEGLNDPYAFVEFSDHNQATLALQSHNGRELLEKEMHVTWAFE------PREPGENRSKPETSRHFHVFVGDLCSEIDSTKLREAFVKFGEVSEAKIIRDNNTNKGKGYGFVSYPRREDAERAIDEMNGAWLGRRTIRTNWATRKPDEDGERGGDRGDRRGGGGGGRDRYHNQSEKTYDEIFNQAAADNTSVYVGNIANLGEDEIRRAFDRFGPINEVRTFKIQGYAFVKFETKESAARAIVQMNNADIGGQIVRCSWG 325          

HSP 2 Score: 52.373 bits (124), Expect = 4.504e-7
Identity = 53/208 (25.48%), Postives = 88/208 (42.31%), Query Frame = 2
Query:  353 KRESSLKQEASEDCKPAQIFVGNIGTKVDETILKGGFEHLGTIIEAKVIRDADGKHKGYGFVTFSNEYEARSAIDKMNETFFHDEKIKCSW-------GKNKSNLAVVASKNASKTLEEIFNETPKSYTNVFVTGD---NVTKELLEPHFEVFGKIKNIKAFPRNNQ------AFINYFSHESAGNAIHQMNGFVVNNIELNCSWAIK 928
            +RE       SED  P  +FV N+   + +  L   F  +G +++AK+I   +G +  Y FV FS+  +A  A+   N     ++++  +W       G+N+S                   ET + + +VFV GD    +    L   F  FG++   K    NN        F++Y   E A  AI +MNG  +    +  +WA +
Sbjct:   26 EREGFQLASGSED--PRTLFVANLDPAITDEFLATLFNQIGAVMKAKII--FEGLNDPYAFVEFSDHNQATLALQSHNGRELLEKEMHVTWAFEPREPGENRSKP-----------------ETSRHF-HVFV-GDLCSEIDSTKLREAFVKFGEVSEAKIIRDNNTNKGKGYGFVSYPRREDAERAIDEMNGAWLGRRTIRTNWATR 210          
BLAST of Polyadenylate-binding protein vs. Ensembl Celegans
Match: tiar-1 (TIA-1/TIAL RNA binding protein homolog [Source:UniProtKB/TrEMBL;Acc:Q95QV8])

HSP 1 Score: 118.242 bits (295), Expect = 7.406e-29
Identity = 79/277 (28.52%), Postives = 140/277 (50.54%), Query Frame = 2
Query:  119 KTIYISSLPKSVTEEDLLSIFENYG------LCVSCSLDPETCTAYVEFDNENSANNSL-SMNGVEMGTTKIEISIAYIEQEHNIKRESSLKQEASEDCKPAQIFVGNIGTKVDETILKGGFEHLGTIIEAKVIRDADG-KHKGYGFVTFSNEYEARSAIDKMNETFFHDEKIKCSWGKNKSNLAVVASKNASKTLEEIFNETPKSYTNVFVTG-DNVTKELLEPHFEVFGKIKNIKAFPRNNQAFINYFSHESAGNAIHQMNGFVVNNIELNCSWA 922
            +T+Y+ +L  +VTE+ + ++F   G      +    S DP    A+VEF +   A+ +L +MN   +   +++++ A          E   +Q   +  +   +FVG++ ++VD   L+  F+  G + +AKVIRD +  K KGYGFV++    EA  AI++MN  +     I+ +W   K       S    K+ +EI+N+T    T+V+V    ++T++ +   F  FG+I  ++ F     AF+ + + ++A  AI QMN   V    + CSW 
Sbjct:   46 RTLYVGNLDSTVTEDFIATLFNQIGSVTKTKVIFDGSNDP---YAFVEFSDHGQASQALQTMNKRLLLDREMKVNWAV---------EPGQQQSKIDTTRHFHVFVGDLSSEVDNQKLREAFQPFGDVSDAKVIRDTNTTKSKGYGFVSYPKREEAERAIEQMNGQWLGRRTIRTNWATRKPGDQEKPSHYNEKSYDEIYNQTSGDNTSVYVGNIASLTEDEIRQGFASFGRITEVRIFKMQGYAFVKFDNKDAAAKAIVQMNNQDVGGQLVRCSWG 310          

HSP 2 Score: 70.8626 bits (172), Expect = 5.529e-13
Identity = 54/187 (28.88%), Postives = 87/187 (46.52%), Query Frame = 2
Query:  395 KPAQIFVGNIGTKVDETILKGGFEHLGTIIEAKVIRDADGKHKGYGFVTFSNEYEARSAIDKMNETFFHDEKIKCSWGKNKSNLAVVASKNASKTLEEIFNETPKSYTNVFVTGD---NVTKELLEPHFEVFGKIKNIKAFPRNNQ------AFINYFSHESAGNAIHQMNGFVVNNIELNCSWAIK 928
            +P  ++VGN+ + V E  +   F  +G++ + KVI   DG +  Y FV FS+  +A  A+  MN+    D ++K +W       AV   +  SK       +T + + +VFV GD    V  + L   F+ FG + + K     N        F++Y   E A  AI QMNG  +    +  +WA +
Sbjct:   44 EPRTLYVGNLDSTVTEDFIATLFNQIGSVTKTKVI--FDGSNDPYAFVEFSDHGQASQALQTMNKRLLLDREMKVNW-------AVEPGQQQSKI------DTTRHF-HVFV-GDLSSEVDNQKLREAFQPFGDVSDAKVIRDTNTTKSKGYGFVSYPKREEAERAIEQMNGQWLGRRTIRTNWATR 213          

HSP 3 Score: 61.2326 bits (147), Expect = 6.825e-10
Identity = 54/211 (25.59%), Postives = 90/211 (42.65%), Query Frame = 2
Query:   77 LIDNEM------------SKMESKNKKTIYISSLPKSVTEEDLLSIFENYGLCVSCSLDPETCT------AYVEFDNENSANNSL-SMNGVEMGTTKIEISIAYI---EQE----HNIKRESSLKQEASEDCKPAQIFVGNIGTKVDETILKGGFEHLGTIIEAKVIRDADGKHKGYGFVTFSNEYEARSAIDKMNETFFHDEKIKCSWGK 631
            L+D EM            SK+++     +++  L   V  + L   F+ +G      +  +T T       +V +     A  ++  MNG  +G   I  + A     +QE    +N K    +  + S D     ++VGNI +  ++ I + GF   G I E ++      K +GY FV F N+  A  AI +MN      + ++CSWGK
Sbjct:  109 LLDREMKVNWAVEPGQQQSKIDTTRHFHVFVGDLSSEVDNQKLREAFQPFGDVSDAKVIRDTNTTKSKGYGFVSYPKREEAERAIEQMNGQWLGRRTIRTNWATRKPGDQEKPSHYNEKSYDEIYNQTSGDN--TSVYVGNIASLTEDEI-RQGFASFGRITEVRIF-----KMQGYAFVKFDNKDAAAKAIVQMNNQDVGGQLVRCSWGK 311          
BLAST of Polyadenylate-binding protein vs. Ensembl Celegans
Match: tiar-1 (TIA-1/TIAL RNA binding protein homolog [Source:UniProtKB/TrEMBL;Acc:Q95QV8])

HSP 1 Score: 103.99 bits (258), Expect = 5.085e-24
Identity = 69/270 (25.56%), Postives = 122/270 (45.19%), Query Frame = 2
Query:  119 KTIYISSLPKSVTEEDLLSIFENYGLCVSCSLDPETCTAYVEFDNENSANNSLSMNGVEMGTTKIEISIAYIEQEHNIKRESSLKQEASEDCKPAQIFVGNIGTKVDETILKGGFEHLGTIIEAKVIRDADG-KHKGYGFVTFSNEYEARSAIDKMNETFFHDEKIKCSWGKNKSNLAVVASKNASKTLEEIFNETPKSYTNVFVTG-DNVTKELLEPHFEVFGKIKNIKAFPRNNQAFINYFSHESAGNAIHQMNGFVVNNIELNCSWA 922
            +T+Y+ +L  +VTE+ + ++F   G                                        +  + + E + N   E   +Q   +  +   +FVG++ ++VD   L+  F+  G + +AKVIRD +  K KGYGFV++    EA  AI++MN  +     I+ +W   K       S    K+ +EI+N+T    T+V+V    ++T++ +   F  FG+I  ++ F     AF+ + + ++A  AI QMN   V    + CSW 
Sbjct:   46 RTLYVGNLDSTVTEDFIATLFNQIGSVT-------------------------------------KTKVIFDEMKVNWAVEPGQQQSKIDTTRHFHVFVGDLSSEVDNQKLREAFQPFGDVSDAKVIRDTNTTKSKGYGFVSYPKREEAERAIEQMNGQWLGRRTIRTNWATRKPGDQEKPSHYNEKSYDEIYNQTSGDNTSVYVGNIASLTEDEIRQGFASFGRITEVRIFKMQGYAFVKFDNKDAAAKAIVQMNNQDVGGQLVRCSWG 278          

HSP 2 Score: 60.8474 bits (146), Expect = 8.455e-10
Identity = 50/195 (25.64%), Postives = 86/195 (44.10%), Query Frame = 2
Query:   89 EMSKMESKNKKTIYISSLPKSVTEEDLLSIFENYGLCVSCSLDPETCT------AYVEFDNENSANNSL-SMNGVEMGTTKIEISIAYI---EQE----HNIKRESSLKQEASEDCKPAQIFVGNIGTKVDETILKGGFEHLGTIIEAKVIRDADGKHKGYGFVTFSNEYEARSAIDKMNETFFHDEKIKCSWGK 631
            + SK+++     +++  L   V  + L   F+ +G      +  +T T       +V +     A  ++  MNG  +G   I  + A     +QE    +N K    +  + S D     ++VGNI +  ++ I +G F   G I E ++      K +GY FV F N+  A  AI +MN      + ++CSWGK
Sbjct:   93 QQSKIDTTRHFHVFVGDLSSEVDNQKLREAFQPFGDVSDAKVIRDTNTTKSKGYGFVSYPKREEAERAIEQMNGQWLGRRTIRTNWATRKPGDQEKPSHYNEKSYDEIYNQTSGDN--TSVYVGNIASLTEDEIRQG-FASFGRITEVRIF-----KMQGYAFVKFDNKDAAAKAIVQMNNQDVGGQLVRCSWGK 279          
BLAST of Polyadenylate-binding protein vs. Ensembl Celegans
Match: tiar-1 (TIA-1/TIAL RNA binding protein homolog [Source:UniProtKB/TrEMBL;Acc:Q95QV8])

HSP 1 Score: 102.449 bits (254), Expect = 5.410e-24
Identity = 61/198 (30.81%), Postives = 102/198 (51.52%), Query Frame = 2
Query:  335 EQEHNIKRESSLKQEASEDCKPAQIFVGNIGTKVDETILKGGFEHLGTIIEAKVIRDADG-KHKGYGFVTFSNEYEARSAIDKMNETFFHDEKIKCSWGKNKSNLAVVASKNASKTLEEIFNETPKSYTNVFVTG-DNVTKELLEPHFEVFGKIKNIKAFPRNNQAFINYFSHESAGNAIHQMNGFVVNNIELNCSWA 922
            E + N   E   +Q   +  +   +FVG++ ++VD   L+  F+  G + +AKVIRD +  K KGYGFV++    EA  AI++MN  +     I+ +W   K       S    K+ +EI+N+T    T+V+V    ++T++ +   F  FG+I  ++ F     AF+ + + ++A  AI QMN   V    + CSW 
Sbjct:   10 EMKVNWAVEPGQQQSKIDTTRHFHVFVGDLSSEVDNQKLREAFQPFGDVSDAKVIRDTNTTKSKGYGFVSYPKREEAERAIEQMNGQWLGRRTIRTNWATRKPGDQEKPSHYNEKSYDEIYNQTSGDNTSVYVGNIASLTEDEIRQGFASFGRITEVRIFKMQGYAFVKFDNKDAAAKAIVQMNNQDVGGQLVRCSWG 207          

HSP 2 Score: 60.8474 bits (146), Expect = 4.935e-10
Identity = 54/211 (25.59%), Postives = 90/211 (42.65%), Query Frame = 2
Query:   77 LIDNEM------------SKMESKNKKTIYISSLPKSVTEEDLLSIFENYGLCVSCSLDPETCT------AYVEFDNENSANNSL-SMNGVEMGTTKIEISIAYI---EQE----HNIKRESSLKQEASEDCKPAQIFVGNIGTKVDETILKGGFEHLGTIIEAKVIRDADGKHKGYGFVTFSNEYEARSAIDKMNETFFHDEKIKCSWGK 631
            L+D EM            SK+++     +++  L   V  + L   F+ +G      +  +T T       +V +     A  ++  MNG  +G   I  + A     +QE    +N K    +  + S D     ++VGNI +  ++ I + GF   G I E ++      K +GY FV F N+  A  AI +MN      + ++CSWGK
Sbjct:    6 LLDREMKVNWAVEPGQQQSKIDTTRHFHVFVGDLSSEVDNQKLREAFQPFGDVSDAKVIRDTNTTKSKGYGFVSYPKREEAERAIEQMNGQWLGRRTIRTNWATRKPGDQEKPSHYNEKSYDEIYNQTSGDN--TSVYVGNIASLTEDEI-RQGFASFGRITEVRIF-----KMQGYAFVKFDNKDAAAKAIVQMNNQDVGGQLVRCSWGK 208          
BLAST of Polyadenylate-binding protein vs. Ensembl Celegans
Match: tiar-1 (TIA-1/TIAL RNA binding protein homolog [Source:UniProtKB/TrEMBL;Acc:Q95QV8])

HSP 1 Score: 102.064 bits (253), Expect = 6.482e-24
Identity = 60/194 (30.93%), Postives = 100/194 (51.55%), Query Frame = 2
Query:  347 NIKRESSLKQEASEDCKPAQIFVGNIGTKVDETILKGGFEHLGTIIEAKVIRDADG-KHKGYGFVTFSNEYEARSAIDKMNETFFHDEKIKCSWGKNKSNLAVVASKNASKTLEEIFNETPKSYTNVFVTG-DNVTKELLEPHFEVFGKIKNIKAFPRNNQAFINYFSHESAGNAIHQMNGFVVNNIELNCSWA 922
            N   E   +Q   +  +   +FVG++ ++VD   L+  F+  G + +AKVIRD +  K KGYGFV++    EA  AI++MN  +     I+ +W   K       S    K+ +EI+N+T    T+V+V    ++T++ +   F  FG+I  ++ F     AF+ + + ++A  AI QMN   V    + CSW 
Sbjct:    4 NWAVEPGQQQSKIDTTRHFHVFVGDLSSEVDNQKLREAFQPFGDVSDAKVIRDTNTTKSKGYGFVSYPKREEAERAIEQMNGQWLGRRTIRTNWATRKPGDQEKPSHYNEKSYDEIYNQTSGDNTSVYVGNIASLTEDEIRQGFASFGRITEVRIFKMQGYAFVKFDNKDAAAKAIVQMNNQDVGGQLVRCSWG 197          

HSP 2 Score: 60.8474 bits (146), Expect = 4.735e-10
Identity = 50/195 (25.64%), Postives = 86/195 (44.10%), Query Frame = 2
Query:   89 EMSKMESKNKKTIYISSLPKSVTEEDLLSIFENYGLCVSCSLDPETCT------AYVEFDNENSANNSL-SMNGVEMGTTKIEISIAYI---EQE----HNIKRESSLKQEASEDCKPAQIFVGNIGTKVDETILKGGFEHLGTIIEAKVIRDADGKHKGYGFVTFSNEYEARSAIDKMNETFFHDEKIKCSWGK 631
            + SK+++     +++  L   V  + L   F+ +G      +  +T T       +V +     A  ++  MNG  +G   I  + A     +QE    +N K    +  + S D     ++VGNI +  ++ I +G F   G I E ++      K +GY FV F N+  A  AI +MN      + ++CSWGK
Sbjct:   12 QQSKIDTTRHFHVFVGDLSSEVDNQKLREAFQPFGDVSDAKVIRDTNTTKSKGYGFVSYPKREEAERAIEQMNGQWLGRRTIRTNWATRKPGDQEKPSHYNEKSYDEIYNQTSGDN--TSVYVGNIASLTEDEIRQG-FASFGRITEVRIF-----KMQGYAFVKFDNKDAAAKAIVQMNNQDVGGQLVRCSWGK 198          
BLAST of Polyadenylate-binding protein vs. Ensembl Fly
Match: Rox8 (gene:FBgn0005649 transcript:FBtr0084592)

HSP 1 Score: 110.538 bits (275), Expect = 1.002e-25
Identity = 72/302 (23.84%), Postives = 134/302 (44.37%), Query Frame = 2
Query:  101 MESKNKKTIYISSLPKSVTEEDLLSIFENYGLCVSCSLDPETCT---AYVEFDNENSANNSLSMNGVEMGTTKIEISIAYIEQEHNIKRESSLKQEASEDCKPAQ-IFVGNIGTKVDETILKGGFEHLGTIIEAKVIRDADG-KHKGYGFVTFSNEYEARSAIDKMNETFFHDEKIKCSWGKNK--------------------SNLAVVASKNASKTLEEIFNETPKSYTNVFVTG---DNVTKELLEPHFEVFGKIKNIKAFPRNNQAFINYFSHESAGNAIHQMNGFVVNNIELNCSWA 922
            M+    KT+Y+ +L  SV+E+ L+++F   G   SC +  E      A++E+ N  +A  +L+     +          ++E+E  +   +S   +   D      IFVG++  +++   L+  F   G I   +++RD    K KGY FV+F  + EA +AI  MN  +     I+ +W   K                             +   T EE++N++  + T V+  G   + ++ +L+  HF  FG I++++ F     +FI + + E+A +AI   +   V+   + C W 
Sbjct:    1 MDESQPKTLYVGNLDSSVSEDLLIALFSTMGPVKSCKIIREPGNDPYAFIEYSNYQAATTALTAMNKRL----------FLEKEIKVNWATSPGNQPKTDISSHHHIFVGDLSPEIETETLREAFAPFGEISNCRIVRDPHTMKSKGYAFVSFVKKAEAENAIQAMNGQWIGSRSIRTNWSTRKLPPPREPSKGGGQGGGMGGGPGNGSGVKGSQRHTFEEVYNQSSPTNTTVYCGGFPPNVISDDLMHKHFVQFGPIQDVRVFKDKGFSFIKFVTKEAAAHAIEHTHNSEVHGNLVKCFWG 292          

HSP 2 Score: 70.0922 bits (170), Expect = 1.465e-12
Identity = 48/190 (25.26%), Postives = 88/190 (46.32%), Query Frame = 2
Query:  386 EDCKPAQIFVGNIGTKVDETILKGGFEHLGTIIEAKVIRDADGKHKGYGFVTFSNEYEARSAIDKMNETFFHDEKIKCSWGKNKSNLAVVASKNASKTLEEIFNETPKSYTNVFVTGD---NVTKELLEPHFEVFGKIKNIK------AFPRNNQAFINYFSHESAGNAIHQMNGFVVNNIELNCSWAIK 928
            ++ +P  ++VGN+ + V E +L   F  +G +   K+IR+    +  Y F+ +SN   A +A+  MN+  F +++IK +W  +  N          +   +I      S+ ++FV GD    +  E L   F  FG+I N +             AF+++     A NAI  MNG  + +  +  +W+ +
Sbjct:    2 DESQPKTLYVGNLDSSVSEDLLIALFSTMGPVKSCKIIREPG--NDPYAFIEYSNYQAATTALTAMNKRLFLEKEIKVNWATSPGN----------QPKTDI-----SSHHHIFV-GDLSPEIETETLREAFAPFGEISNCRIVRDPHTMKSKGYAFVSFVKKAEAENAIQAMNGQWIGSRSIRTNWSTR 173          
BLAST of Polyadenylate-binding protein vs. Ensembl Fly
Match: Rox8 (gene:FBgn0005649 transcript:FBtr0084594)

HSP 1 Score: 110.538 bits (275), Expect = 1.002e-25
Identity = 72/302 (23.84%), Postives = 134/302 (44.37%), Query Frame = 2
Query:  101 MESKNKKTIYISSLPKSVTEEDLLSIFENYGLCVSCSLDPETCT---AYVEFDNENSANNSLSMNGVEMGTTKIEISIAYIEQEHNIKRESSLKQEASEDCKPAQ-IFVGNIGTKVDETILKGGFEHLGTIIEAKVIRDADG-KHKGYGFVTFSNEYEARSAIDKMNETFFHDEKIKCSWGKNK--------------------SNLAVVASKNASKTLEEIFNETPKSYTNVFVTG---DNVTKELLEPHFEVFGKIKNIKAFPRNNQAFINYFSHESAGNAIHQMNGFVVNNIELNCSWA 922
            M+    KT+Y+ +L  SV+E+ L+++F   G   SC +  E      A++E+ N  +A  +L+     +          ++E+E  +   +S   +   D      IFVG++  +++   L+  F   G I   +++RD    K KGY FV+F  + EA +AI  MN  +     I+ +W   K                             +   T EE++N++  + T V+  G   + ++ +L+  HF  FG I++++ F     +FI + + E+A +AI   +   V+   + C W 
Sbjct:    1 MDESQPKTLYVGNLDSSVSEDLLIALFSTMGPVKSCKIIREPGNDPYAFIEYSNYQAATTALTAMNKRL----------FLEKEIKVNWATSPGNQPKTDISSHHHIFVGDLSPEIETETLREAFAPFGEISNCRIVRDPHTMKSKGYAFVSFVKKAEAENAIQAMNGQWIGSRSIRTNWSTRKLPPPREPSKGGGQGGGMGGGPGNGSGVKGSQRHTFEEVYNQSSPTNTTVYCGGFPPNVISDDLMHKHFVQFGPIQDVRVFKDKGFSFIKFVTKEAAAHAIEHTHNSEVHGNLVKCFWG 292          

HSP 2 Score: 70.0922 bits (170), Expect = 1.465e-12
Identity = 48/190 (25.26%), Postives = 88/190 (46.32%), Query Frame = 2
Query:  386 EDCKPAQIFVGNIGTKVDETILKGGFEHLGTIIEAKVIRDADGKHKGYGFVTFSNEYEARSAIDKMNETFFHDEKIKCSWGKNKSNLAVVASKNASKTLEEIFNETPKSYTNVFVTGD---NVTKELLEPHFEVFGKIKNIK------AFPRNNQAFINYFSHESAGNAIHQMNGFVVNNIELNCSWAIK 928
            ++ +P  ++VGN+ + V E +L   F  +G +   K+IR+    +  Y F+ +SN   A +A+  MN+  F +++IK +W  +  N          +   +I      S+ ++FV GD    +  E L   F  FG+I N +             AF+++     A NAI  MNG  + +  +  +W+ +
Sbjct:    2 DESQPKTLYVGNLDSSVSEDLLIALFSTMGPVKSCKIIREPG--NDPYAFIEYSNYQAATTALTAMNKRLFLEKEIKVNWATSPGN----------QPKTDI-----SSHHHIFV-GDLSPEIETETLREAFAPFGEISNCRIVRDPHTMKSKGYAFVSFVKKAEAENAIQAMNGQWIGSRSIRTNWSTR 173          
BLAST of Polyadenylate-binding protein vs. Ensembl Fly
Match: Rox8 (gene:FBgn0005649 transcript:FBtr0333200)

HSP 1 Score: 110.153 bits (274), Expect = 1.274e-25
Identity = 72/302 (23.84%), Postives = 134/302 (44.37%), Query Frame = 2
Query:  101 MESKNKKTIYISSLPKSVTEEDLLSIFENYGLCVSCSLDPETCT---AYVEFDNENSANNSLSMNGVEMGTTKIEISIAYIEQEHNIKRESSLKQEASEDCKPAQ-IFVGNIGTKVDETILKGGFEHLGTIIEAKVIRDADG-KHKGYGFVTFSNEYEARSAIDKMNETFFHDEKIKCSWGKNK--------------------SNLAVVASKNASKTLEEIFNETPKSYTNVFVTG---DNVTKELLEPHFEVFGKIKNIKAFPRNNQAFINYFSHESAGNAIHQMNGFVVNNIELNCSWA 922
            M+    KT+Y+ +L  SV+E+ L+++F   G   SC +  E      A++E+ N  +A  +L+     +          ++E+E  +   +S   +   D      IFVG++  +++   L+  F   G I   +++RD    K KGY FV+F  + EA +AI  MN  +     I+ +W   K                             +   T EE++N++  + T V+  G   + ++ +L+  HF  FG I++++ F     +FI + + E+A +AI   +   V+   + C W 
Sbjct:    1 MDESQPKTLYVGNLDSSVSEDLLIALFSTMGPVKSCKIIREPGNDPYAFIEYSNYQAATTALTAMNKRL----------FLEKEIKVNWATSPGNQPKTDISSHHHIFVGDLSPEIETETLREAFAPFGEISNCRIVRDPHTMKSKGYAFVSFVKKAEAENAIQAMNGQWIGSRSIRTNWSTRKLPPPREPSKGGGQGGGMGGGPGNGSGVKGSQRHTFEEVYNQSSPTNTTVYCGGFPPNVISDDLMHKHFVQFGPIQDVRVFKDKGFSFIKFVTKEAAAHAIEHTHNSEVHGNLVKCFWG 292          

HSP 2 Score: 70.0922 bits (170), Expect = 1.671e-12
Identity = 48/190 (25.26%), Postives = 88/190 (46.32%), Query Frame = 2
Query:  386 EDCKPAQIFVGNIGTKVDETILKGGFEHLGTIIEAKVIRDADGKHKGYGFVTFSNEYEARSAIDKMNETFFHDEKIKCSWGKNKSNLAVVASKNASKTLEEIFNETPKSYTNVFVTGD---NVTKELLEPHFEVFGKIKNIK------AFPRNNQAFINYFSHESAGNAIHQMNGFVVNNIELNCSWAIK 928
            ++ +P  ++VGN+ + V E +L   F  +G +   K+IR+    +  Y F+ +SN   A +A+  MN+  F +++IK +W  +  N          +   +I      S+ ++FV GD    +  E L   F  FG+I N +             AF+++     A NAI  MNG  + +  +  +W+ +
Sbjct:    2 DESQPKTLYVGNLDSSVSEDLLIALFSTMGPVKSCKIIREPG--NDPYAFIEYSNYQAATTALTAMNKRLFLEKEIKVNWATSPGN----------QPKTDI-----SSHHHIFV-GDLSPEIETETLREAFAPFGEISNCRIVRDPHTMKSKGYAFVSFVKKAEAENAIQAMNGQWIGSRSIRTNWSTR 173          
BLAST of Polyadenylate-binding protein vs. Ensembl Fly
Match: Rox8 (gene:FBgn0005649 transcript:FBtr0333202)

HSP 1 Score: 110.153 bits (274), Expect = 1.274e-25
Identity = 72/302 (23.84%), Postives = 134/302 (44.37%), Query Frame = 2
Query:  101 MESKNKKTIYISSLPKSVTEEDLLSIFENYGLCVSCSLDPETCT---AYVEFDNENSANNSLSMNGVEMGTTKIEISIAYIEQEHNIKRESSLKQEASEDCKPAQ-IFVGNIGTKVDETILKGGFEHLGTIIEAKVIRDADG-KHKGYGFVTFSNEYEARSAIDKMNETFFHDEKIKCSWGKNK--------------------SNLAVVASKNASKTLEEIFNETPKSYTNVFVTG---DNVTKELLEPHFEVFGKIKNIKAFPRNNQAFINYFSHESAGNAIHQMNGFVVNNIELNCSWA 922
            M+    KT+Y+ +L  SV+E+ L+++F   G   SC +  E      A++E+ N  +A  +L+     +          ++E+E  +   +S   +   D      IFVG++  +++   L+  F   G I   +++RD    K KGY FV+F  + EA +AI  MN  +     I+ +W   K                             +   T EE++N++  + T V+  G   + ++ +L+  HF  FG I++++ F     +FI + + E+A +AI   +   V+   + C W 
Sbjct:    1 MDESQPKTLYVGNLDSSVSEDLLIALFSTMGPVKSCKIIREPGNDPYAFIEYSNYQAATTALTAMNKRL----------FLEKEIKVNWATSPGNQPKTDISSHHHIFVGDLSPEIETETLREAFAPFGEISNCRIVRDPHTMKSKGYAFVSFVKKAEAENAIQAMNGQWIGSRSIRTNWSTRKLPPPREPSKGGGQGGGMGGGPGNGSGVKGSQRHTFEEVYNQSSPTNTTVYCGGFPPNVISDDLMHKHFVQFGPIQDVRVFKDKGFSFIKFVTKEAAAHAIEHTHNSEVHGNLVKCFWG 292          

HSP 2 Score: 70.0922 bits (170), Expect = 1.671e-12
Identity = 48/190 (25.26%), Postives = 88/190 (46.32%), Query Frame = 2
Query:  386 EDCKPAQIFVGNIGTKVDETILKGGFEHLGTIIEAKVIRDADGKHKGYGFVTFSNEYEARSAIDKMNETFFHDEKIKCSWGKNKSNLAVVASKNASKTLEEIFNETPKSYTNVFVTGD---NVTKELLEPHFEVFGKIKNIK------AFPRNNQAFINYFSHESAGNAIHQMNGFVVNNIELNCSWAIK 928
            ++ +P  ++VGN+ + V E +L   F  +G +   K+IR+    +  Y F+ +SN   A +A+  MN+  F +++IK +W  +  N          +   +I      S+ ++FV GD    +  E L   F  FG+I N +             AF+++     A NAI  MNG  + +  +  +W+ +
Sbjct:    2 DESQPKTLYVGNLDSSVSEDLLIALFSTMGPVKSCKIIREPG--NDPYAFIEYSNYQAATTALTAMNKRLFLEKEIKVNWATSPGN----------QPKTDI-----SSHHHIFV-GDLSPEIETETLREAFAPFGEISNCRIVRDPHTMKSKGYAFVSFVKKAEAENAIQAMNGQWIGSRSIRTNWSTR 173          
BLAST of Polyadenylate-binding protein vs. Ensembl Fly
Match: Rox8 (gene:FBgn0005649 transcript:FBtr0333201)

HSP 1 Score: 110.153 bits (274), Expect = 1.274e-25
Identity = 72/302 (23.84%), Postives = 134/302 (44.37%), Query Frame = 2
Query:  101 MESKNKKTIYISSLPKSVTEEDLLSIFENYGLCVSCSLDPETCT---AYVEFDNENSANNSLSMNGVEMGTTKIEISIAYIEQEHNIKRESSLKQEASEDCKPAQ-IFVGNIGTKVDETILKGGFEHLGTIIEAKVIRDADG-KHKGYGFVTFSNEYEARSAIDKMNETFFHDEKIKCSWGKNK--------------------SNLAVVASKNASKTLEEIFNETPKSYTNVFVTG---DNVTKELLEPHFEVFGKIKNIKAFPRNNQAFINYFSHESAGNAIHQMNGFVVNNIELNCSWA 922
            M+    KT+Y+ +L  SV+E+ L+++F   G   SC +  E      A++E+ N  +A  +L+     +          ++E+E  +   +S   +   D      IFVG++  +++   L+  F   G I   +++RD    K KGY FV+F  + EA +AI  MN  +     I+ +W   K                             +   T EE++N++  + T V+  G   + ++ +L+  HF  FG I++++ F     +FI + + E+A +AI   +   V+   + C W 
Sbjct:    1 MDESQPKTLYVGNLDSSVSEDLLIALFSTMGPVKSCKIIREPGNDPYAFIEYSNYQAATTALTAMNKRL----------FLEKEIKVNWATSPGNQPKTDISSHHHIFVGDLSPEIETETLREAFAPFGEISNCRIVRDPHTMKSKGYAFVSFVKKAEAENAIQAMNGQWIGSRSIRTNWSTRKLPPPREPSKGGGQGGGMGGGPGNGSGVKGSQRHTFEEVYNQSSPTNTTVYCGGFPPNVISDDLMHKHFVQFGPIQDVRVFKDKGFSFIKFVTKEAAAHAIEHTHNSEVHGNLVKCFWG 292          

HSP 2 Score: 70.0922 bits (170), Expect = 1.671e-12
Identity = 48/190 (25.26%), Postives = 88/190 (46.32%), Query Frame = 2
Query:  386 EDCKPAQIFVGNIGTKVDETILKGGFEHLGTIIEAKVIRDADGKHKGYGFVTFSNEYEARSAIDKMNETFFHDEKIKCSWGKNKSNLAVVASKNASKTLEEIFNETPKSYTNVFVTGD---NVTKELLEPHFEVFGKIKNIK------AFPRNNQAFINYFSHESAGNAIHQMNGFVVNNIELNCSWAIK 928
            ++ +P  ++VGN+ + V E +L   F  +G +   K+IR+    +  Y F+ +SN   A +A+  MN+  F +++IK +W  +  N          +   +I      S+ ++FV GD    +  E L   F  FG+I N +             AF+++     A NAI  MNG  + +  +  +W+ +
Sbjct:    2 DESQPKTLYVGNLDSSVSEDLLIALFSTMGPVKSCKIIREPG--NDPYAFIEYSNYQAATTALTAMNKRLFLEKEIKVNWATSPGN----------QPKTDI-----SSHHHIFV-GDLSPEIETETLREAFAPFGEISNCRIVRDPHTMKSKGYAFVSFVKKAEAENAIQAMNGQWIGSRSIRTNWSTR 173          
BLAST of Polyadenylate-binding protein vs. Ensembl Zebrafish
Match: tia1l (cytotoxic granule-associated RNA binding protein 1, like [Source:ZFIN;Acc:ZDB-GENE-030131-2167])

HSP 1 Score: 139.043 bits (349), Expect = 1.854e-36
Identity = 87/290 (30.00%), Postives = 150/290 (51.72%), Query Frame = 2
Query:  101 MESKNKKTIYISSLPKSVTEEDLLSIFENYGLCVSCSLDPETCT----AYVEF-DNENSANNSLSMNGVEMGTTKIEISIAYIEQEHNIKRESSLKQEASEDCKPAQIFVGNIGTKVDETILKGGFEHLGTIIEAKVIRD-ADGKHKGYGFVTFSNEYEARSAIDKMNETFFHDEKIKCSWGKNK-----SNLAVVASKNASKTLEEIFNETPKSYTNVFVTG--DNVTKELLEPHFEVFGKIKNIKAFPRNNQAFINYFSHESAGNAIHQMNGFVVNNIELNCSWAIKT 931
            M+    +T+Y+ +L + VTE  +L +F   G C SC +  +T       +VEF +N ++A    +MNG ++    ++++ A           SS K++ S       +FVG++  ++    ++  F   G I +A+V+RD A GK KGYGF++F N+++A SAI +MN  +    +I+ +W   K     SN    +SK+ S   EE+ N++  S   V+  G    ++ +L+   F  FG+I  I+ FP    +F+ + SHE A +AI  +NG  +    + C W  +T
Sbjct:    3 MDEDQPRTLYVGNLSRDVTEALILQVFSQIGPCKSCKMILDTTGNDPYCFVEFYENRHAAAALAAMNGRKILGKDMKVNWA--------STPSSQKKDTSNH---FHVFVGDLSPEISTDDVRAAFAPFGKISDARVVRDLATGKSKGYGFISFINKWDAESAIQQMNGQWLGGRQIRTNWATRKPSAPKSNNEGASSKHLS--YEEVLNQSSPSNCTVYCGGIASGLSDQLMRQTFSPFGQIMEIRVFPEKGYSFVRFDSHEGAAHAIVSVNGTCIEGHTVKCYWGKET 279          

HSP 2 Score: 65.4698 bits (158), Expect = 4.076e-11
Identity = 53/260 (20.38%), Postives = 108/260 (41.54%), Query Frame = 2
Query:   98 KMESKNKKTIYISSLPKSVTEEDLLSIFENYGLCVSCSLDPETCTA------YVEFDNENSANNSLS-MNGVEMGTTKIEISIAYIE-----------QEHNIKRESSLKQEASEDCKPAQIFVGNIGTKVDETILKGGFEHLGTIIEAKVIRDADGKHKGYGFVTFSNEYEARSAIDKMNETFFHDEKIKCSWGKNKSNLAVVA-----SKNASKTLEEIFNETPKSYTNVFVTGDNVTKELLEPHFEVFGKIKNIKAF 808
            K ++ N   +++  L   ++ +D+ + F  +G      +  +  T       ++ F N+  A +++  MNG  +G  +I  + A  +              ++  E  L Q +  +C    ++ G I + + + +++  F   G I+E +V  +     KGY FV F +   A  AI  +N T      +KC WGK  +++  +       +N      + + +  +SY N    G  V      P + V+G+  N + +
Sbjct:   90 KKDTSNHFHVFVGDLSPEISTDDVRAAFAPFGKISDARVVRDLATGKSKGYGFISFINKWDAESAIQQMNGQWLGGRQIRTNWATRKPSAPKSNNEGASSKHLSYEEVLNQSSPSNCT---VYCGGIASGLSDQLMRQTFSPFGQIMEIRVFPE-----KGYSFVRFDSHEGAAHAIVSVNGTCIEGHTVKCYWGKETADMRSMQQMPMPQQNKPTYAAQPYGQWGQSYGNGQQMGQYVPNGWQMPTYGVYGQAWNQQGY 341          
BLAST of Polyadenylate-binding protein vs. Ensembl Zebrafish
Match: tia1l (cytotoxic granule-associated RNA binding protein 1, like [Source:ZFIN;Acc:ZDB-GENE-030131-2167])

HSP 1 Score: 137.117 bits (344), Expect = 8.251e-36
Identity = 86/290 (29.66%), Postives = 150/290 (51.72%), Query Frame = 2
Query:  101 MESKNKKTIYISSLPKSVTEEDLLSIFENYGLCVSCSLDPETCT----AYVEF-DNENSANNSLSMNGVEMGTTKIEISIAYIEQEHNIKRESSLKQEASEDCKPAQIFVGNIGTKVDETILKGGFEHLGTIIEAKVIRD-ADGKHKGYGFVTFSNEYEARSAIDKMNETFFHDEKIKCSWGKNK-----SNLAVVASKNASKTLEEIFNETPKSYTNVFVTG--DNVTKELLEPHFEVFGKIKNIKAFPRNNQAFINYFSHESAGNAIHQMNGFVVNNIELNCSWAIKT 931
            M+    +T+Y+ +L + VTE  +L +F   G C SC +  +T       +VEF +N ++A    +MNG ++    ++++ A           SS K++ S       +FVG++  ++    ++  F   G I +A+V++D A GK KGYGF++F N+++A SAI +MN  +    +I+ +W   K     SN    +SK+ S   EE+ N++  S   V+  G    ++ +L+   F  FG+I  I+ FP    +F+ + SHE A +AI  +NG  +    + C W  +T
Sbjct:    3 MDEDQPRTLYVGNLSRDVTEALILQVFSQIGPCKSCKMILDTTGNDPYCFVEFYENRHAAAALAAMNGRKILGKDMKVNWA--------STPSSQKKDTSNH---FHVFVGDLSPEISTDDVRAAFAPFGKISDARVVKDLATGKSKGYGFISFINKWDAESAIQQMNGQWLGGRQIRTNWATRKPSAPKSNNEGASSKHLS--YEEVLNQSSPSNCTVYCGGIASGLSDQLMRQTFSPFGQIMEIRVFPEKGYSFVRFDSHEGAAHAIVSVNGTCIEGHTVKCYWGKET 279          

HSP 2 Score: 65.4698 bits (158), Expect = 3.896e-11
Identity = 53/260 (20.38%), Postives = 108/260 (41.54%), Query Frame = 2
Query:   98 KMESKNKKTIYISSLPKSVTEEDLLSIFENYGLCVSCSLDPETCTA------YVEFDNENSANNSLS-MNGVEMGTTKIEISIAYIE-----------QEHNIKRESSLKQEASEDCKPAQIFVGNIGTKVDETILKGGFEHLGTIIEAKVIRDADGKHKGYGFVTFSNEYEARSAIDKMNETFFHDEKIKCSWGKNKSNLAVVA-----SKNASKTLEEIFNETPKSYTNVFVTGDNVTKELLEPHFEVFGKIKNIKAF 808
            K ++ N   +++  L   ++ +D+ + F  +G      +  +  T       ++ F N+  A +++  MNG  +G  +I  + A  +              ++  E  L Q +  +C    ++ G I + + + +++  F   G I+E +V  +     KGY FV F +   A  AI  +N T      +KC WGK  +++  +       +N      + + +  +SY N    G  V      P + V+G+  N + +
Sbjct:   90 KKDTSNHFHVFVGDLSPEISTDDVRAAFAPFGKISDARVVKDLATGKSKGYGFISFINKWDAESAIQQMNGQWLGGRQIRTNWATRKPSAPKSNNEGASSKHLSYEEVLNQSSPSNCT---VYCGGIASGLSDQLMRQTFSPFGQIMEIRVFPE-----KGYSFVRFDSHEGAAHAIVSVNGTCIEGHTVKCYWGKETADMRSMQQMPMPQQNKPTYAAQPYGQWGQSYGNGQQMGQYVPNGWQMPTYGVYGQAWNQQGY 341          
BLAST of Polyadenylate-binding protein vs. Ensembl Zebrafish
Match: tial1 (TIA1 cytotoxic granule-associated RNA binding protein-like 1 [Source:ZFIN;Acc:ZDB-GENE-040426-1547])

HSP 1 Score: 134.806 bits (338), Expect = 8.795e-35
Identity = 97/356 (27.25%), Postives = 171/356 (48.03%), Query Frame = 2
Query:  119 KTIYISSLPKSVTEEDLLSIFENYGLCVSCSLDPETCT----AYVEF-DNENSANNSLSMNGVEMGTTKIEISIAYIEQEHNIKRESSLKQEASEDCKPAQIFVGNIGTKVDETILKGGFEHLGTIIEAKVIRD-ADGKHKGYGFVTFSNEYEARSAIDKMNETFFHDEKIKCSWGKNKSNLAVVASKNASKTL--EEIFNETPKSYTNVFVTG--DNVTKELLEPHFEVFGKIKNIKAFPRNNQAFINYFSHESAGNAIHQMNGFVVNNIELNCSWAIKTEKSXXXXXXXXXXXXXXXXANVGAPRKYLANQINQY--NGRQQPY-----ESYDETGYGLPQFQQPSFTDDYTDQ 1135
            KT+Y+ +L + VTE  +L +F   G C SC +  E  +     +VEF ++ ++A    +MNG ++   +++++ A           SS K++ S       +FVG++  ++    ++  F   G I +A+V++D   GK KGYGFV+F N+ +A +AI  M   +    +I+ +W   K         N++K L  +E+ N++      V+  G    +T+ L+   F  FG+I  I+ FP    +FI + SHESA +AI  +NG  +    + C W  ++    K                 G P++Y      QY  NG Q P      +++++ G+G+ Q Q P++   +  Q
Sbjct:    8 KTLYVGNLSRDVTENLILQLFTQIGPCKSCKMITEHTSNDPYCFVEFFEHRDAAAALAAMNGRKILGKEVKVNWA--------TTPSSQKKDTSNHF---HVFVGDLSPEITTDDIRAAFAPFGKISDARVVKDMTTGKSKGYGFVSFYNKLDAENAIVHMGGQWLGGRQIRTNWATRKPPAPKSVQDNSAKQLRFDEVVNQSSPQNCTVYCGGIQSGLTEHLMRQTFSPFGQIMEIRVFPEKGYSFIRFSSHESAAHAIVSVNGTTIEGHVVKCYWGKESPDMAKNVQPMEYGQWGQWNQMYGNPQQY-----GQYMTNGWQVPSYGMYGQTWNQQGFGVEQSQSPAWVGGFGTQ 347          
BLAST of Polyadenylate-binding protein vs. Ensembl Zebrafish
Match: tia1 (TIA1 cytotoxic granule-associated RNA binding protein [Source:ZFIN;Acc:ZDB-GENE-030131-1506])

HSP 1 Score: 131.724 bits (330), Expect = 1.806e-33
Identity = 82/287 (28.57%), Postives = 148/287 (51.57%), Query Frame = 2
Query:  101 MESKNKKTIYISSLPKSVTEEDLLSIFENYGLCVSCSLDPETCT----AYVEFDNENSANNSLS-MNGVEMGTTKIEISIAYIEQEHNIKRESSLKQEASEDCKPAQIFVGNIGTKVDETILKGGFEHLGTIIEAKVIRD-ADGKHKGYGFVTFSNEYEARSAIDKMNETFFHDEKIKCSWGKNK--SNLAVVASKNASKTLEEIFNETPKSYTNVFVTG--DNVTKELLEPHFEVFGKIKNIKAFPRNNQAFINYFSHESAGNAIHQMNGFVVNNIELNCSWAIKT 931
            M+ +  KT+Y+ +L + VTE  ++ +F   G C SC +  +T       +VEF     A  SL+ MNG ++   +++++ A           SS K++ S       +FVG++  ++    ++  F   G I +A+V++D A GK KGYGFV+F N+++A +AI +M   +    +I+ +W   K  +  A   +     + +E+ N++  S   V+  G    +T++L+   F  FG+I  ++ FP    +F+ + SHESA +AI  +NG  +    + C W  +T
Sbjct:    2 MDDEQPKTLYVGNLSRDVTEALIMQLFGQIGPCKSCKMIVDTAGNDPYCFVEFFEHRHAAASLAAMNGRKIMGKEVKVNWA--------TSPSSQKKDTSNHF---HVFVGDLSPEITTDDIRAAFAPFGRISDARVVKDMATGKSKGYGFVSFFNKWDAENAIQQMGGQWLGGRQIRTNWATRKPPAPKATYETNTKHLSFDEVVNQSSPSNCTVYCGGVTTGLTEQLMRQTFSPFGQIMEVRVFPDKGYSFVRFNSHESAAHAIVSVNGTSLEGHIVKCYWGKET 277          
BLAST of Polyadenylate-binding protein vs. Ensembl Zebrafish
Match: tial1 (TIA1 cytotoxic granule-associated RNA binding protein-like 1 [Source:ZFIN;Acc:ZDB-GENE-040426-1547])

HSP 1 Score: 126.716 bits (317), Expect = 9.524e-32
Identity = 97/375 (25.87%), Postives = 171/375 (45.60%), Query Frame = 2
Query:  119 KTIYISSLPKSVTEEDLLSIFENYGLCVSCSLDPETCTA-----------------------YVEF-DNENSANNSLSMNGVEMGTTKIEISIAYIEQEHNIKRESSLKQEASEDCKPAQIFVGNIGTKVDETILKGGFEHLGTIIEAKVIRD-ADGKHKGYGFVTFSNEYEARSAIDKMNETFFHDEKIKCSWGKNKSNLAVVASKNASKTL--EEIFNETPKSYTNVFVTG--DNVTKELLEPHFEVFGKIKNIKAFPRNNQAFINYFSHESAGNAIHQMNGFVVNNIELNCSWAIKTEKSXXXXXXXXXXXXXXXXANVGAPRKYLANQINQY--NGRQQPY-----ESYDETGYGLPQFQQPSFTDDYTDQ 1135
            KT+Y+ +L + VTE  +L +F   G C SC +  E   +                       +VEF ++ ++A    +MNG ++   +++++ A           SS K++ S       +FVG++  ++    ++  F   G I +A+V++D   GK KGYGFV+F N+ +A +AI  M   +    +I+ +W   K         N++K L  +E+ N++      V+  G    +T+ L+   F  FG+I  I+ FP    +FI + SHESA +AI  +NG  +    + C W  ++    K                 G P++Y      QY  NG Q P      +++++ G+G+ Q Q P++   +  Q
Sbjct:    8 KTLYVGNLSRDVTENLILQLFTQIGPCKSCKMITEQSDSSRKMNSSSIGFSVLQHTSNDPYCFVEFFEHRDAAAALAAMNGRKILGKEVKVNWA--------TTPSSQKKDTSNHF---HVFVGDLSPEITTDDIRAAFAPFGKISDARVVKDMTTGKSKGYGFVSFYNKLDAENAIVHMGGQWLGGRQIRTNWATRKPPAPKSVQDNSAKQLRFDEVVNQSSPQNCTVYCGGIQSGLTEHLMRQTFSPFGQIMEIRVFPEKGYSFIRFSSHESAAHAIVSVNGTTIEGHVVKCYWGKESPDMAKNVQPMEYGQWGQWNQMYGNPQQY-----GQYMTNGWQVPSYGMYGQTWNQQGFGVEQSQSPAWVGGFGTQ 366          
BLAST of Polyadenylate-binding protein vs. Ensembl Xenopus
Match: tia1 (TIA1 cytotoxic granule-associated RNA binding protein [Source:NCBI gene;Acc:394890])

HSP 1 Score: 140.198 bits (352), Expect = 2.650e-36
Identity = 85/289 (29.41%), Postives = 148/289 (51.21%), Query Frame = 2
Query:  101 MESKNKKTIYISSLPKSVTEEDLLSIFENYGLCVSCSLDPETCT----AYVEFDNENSANNSLS-MNGVEMGTTKIEISIAYI--EQEHNIKRESSLKQEASEDCKPAQIFVGNIGTKVDETILKGGFEHLGTIIEAKVIRD-ADGKHKGYGFVTFSNEYEARSAIDKMNETFFHDEKIKCSWGKNK--SNLAVVASKNASKTLEEIFNETPKSYTNVFVTG--DNVTKELLEPHFEVFGKIKNIKAFPRNNQAFINYFSHESAGNAIHQMNGFVVNNIELNCSWAIKT 931
            ME    +T+Y+ +L + VTE  +L +F   G C SC +  +T       +VEF     A  SL+ MNG ++   +++++ A     Q+ +    S +    S+D     +FVG++  ++    +K  F   G I +A+V++D   GK KGYGFV+F N+++A +AI +M   +    +I+ +W   K  +  +   S     T EE+ N++  S   V+  G    +T++L+   F  FG+I  ++ FP    +F+ + SHESA +AI  +NG  +    + C W  +T
Sbjct:    1 MEEDLPRTLYVGNLSRDVTEPLILQVFSQLGPCKSCKMIMDTAGNDPYCFVEFFEHRHAAASLAAMNGRKIMGKEVKVNWATTPSSQKKDANSSSVVSTLRSQD--HFHVFVGDLSPEITTDDIKAAFAPFGRISDARVVKDMTTGKSKGYGFVSFFNKWDAENAIAQMGGQWLGGRQIRTNWATRKPPAPKSTYESNTKQLTYEEVVNQSSPSNCTVYCGGVTSGLTEQLMRQTFSPFGQIMEVRVFPDKGYSFVRFSSHESAAHAIVSVNGTTIEGHVVKCYWGKET 287          
BLAST of Polyadenylate-binding protein vs. Ensembl Xenopus
Match: tia1 (TIA1 cytotoxic granule-associated RNA binding protein [Source:NCBI gene;Acc:394890])

HSP 1 Score: 138.272 bits (347), Expect = 8.846e-36
Identity = 85/287 (29.62%), Postives = 147/287 (51.22%), Query Frame = 2
Query:  101 MESKNKKTIYISSLPKSVTEEDLLSIFENYGLCVSCSLDPETCT----AYVEFDNENSANNSLS-MNGVEMGTTKIEISIAYIEQEHNIKRESSLKQEASEDCKPAQIFVGNIGTKVDETILKGGFEHLGTIIEAKVIRD-ADGKHKGYGFVTFSNEYEARSAIDKMNETFFHDEKIKCSWGKNK--SNLAVVASKNASKTLEEIFNETPKSYTNVFVTG--DNVTKELLEPHFEVFGKIKNIKAFPRNNQAFINYFSHESAGNAIHQMNGFVVNNIELNCSWAIKT 931
            ME    +T+Y+ +L + VTE  +L +F   G C SC +  +T       +VEF     A  SL+ MNG ++   +++++ A           SS K++A+       +FVG++  ++    +K  F   G I +A+V++D   GK KGYGFV+F N+++A +AI +M   +    +I+ +W   K  +  +   S     T EE+ N++  S   V+  G    +T++L+   F  FG+I  ++ FP    +F+ + SHESA +AI  +NG  +    + C W  +T
Sbjct:    1 MEEDLPRTLYVGNLSRDVTEPLILQVFSQLGPCKSCKMIMDTAGNDPYCFVEFFEHRHAAASLAAMNGRKIMGKEVKVNWA--------TTPSSQKKDANNHF---HVFVGDLSPEITTDDIKAAFAPFGRISDARVVKDMTTGKSKGYGFVSFFNKWDAENAIAQMGGQWLGGRQIRTNWATRKPPAPKSTYESNTKQLTYEEVVNQSSPSNCTVYCGGVTSGLTEQLMRQTFSPFGQIMEVRVFPDKGYSFVRFSSHESAAHAIVSVNGTTIEGHVVKCYWGKET 276          
BLAST of Polyadenylate-binding protein vs. Ensembl Xenopus
Match: tia1 (TIA1 cytotoxic granule-associated RNA binding protein [Source:NCBI gene;Acc:394890])

HSP 1 Score: 134.42 bits (337), Expect = 2.956e-34
Identity = 82/280 (29.29%), Postives = 143/280 (51.07%), Query Frame = 2
Query:  128 YISSLPKSVTEEDLLSIFENYGLCVSCSLDPETCT----AYVEFDNENSANNSLS-MNGVEMGTTKIEISIAYI--EQEHNIKRESSLKQEASEDCKPAQIFVGNIGTKVDETILKGGFEHLGTIIEAKVIRD-ADGKHKGYGFVTFSNEYEARSAIDKMNETFFHDEKIKCSWGKNK--SNLAVVASKNASKTLEEIFNETPKSYTNVFVTG--DNVTKELLEPHFEVFGKIKNIKAFPRNNQAFINYFSHESAGNAIHQMNGFVVNNIELNCSWAIKT 931
            Y+ +L + VTE  +L +F   G C SC +  +T       +VEF     A  SL+ MNG ++   +++++ A     Q+ +    S +    S+D     +FVG++  ++    +K  F   G I +A+V++D   GK KGYGFV+F N+++A +AI +M   +    +I+ +W   K  +  +   S     T EE+ N++  S   V+  G    +T++L+   F  FG+I  ++ FP    +F+ + SHESA +AI  +NG  +    + C W  +T
Sbjct:   19 YVGNLSRDVTEPLILQVFSQLGPCKSCKMIMDTAGNDPYCFVEFFEHRHAAASLAAMNGRKIMGKEVKVNWATTPSSQKKDANSSSVVSTLRSQD--HFHVFVGDLSPEITTDDIKAAFAPFGRISDARVVKDMTTGKSKGYGFVSFFNKWDAENAIAQMGGQWLGGRQIRTNWATRKPPAPKSTYESNTKQLTYEEVVNQSSPSNCTVYCGGVTSGLTEQLMRQTFSPFGQIMEVRVFPDKGYSFVRFSSHESAAHAIVSVNGTTIEGHVVKCYWGKET 296          
BLAST of Polyadenylate-binding protein vs. Ensembl Xenopus
Match: tia1 (TIA1 cytotoxic granule-associated RNA binding protein [Source:NCBI gene;Acc:394890])

HSP 1 Score: 133.65 bits (335), Expect = 5.000e-34
Identity = 82/279 (29.39%), Postives = 143/279 (51.25%), Query Frame = 2
Query:  125 IYISSLPKSVTEEDLLSIFENYGLCVSCSLDPETCT----AYVEFDNENSANNSLS-MNGVEMGTTKIEISIAYIEQEHNIKRESSLKQEASEDCKPAQIFVGNIGTKVDETILKGGFEHLGTIIEAKVIRD-ADGKHKGYGFVTFSNEYEARSAIDKMNETFFHDEKIKCSWGKNK--SNLAVVASKNASKTLEEIFNETPKSYTNVFVTG--DNVTKELLEPHFEVFGKIKNIKAFPRNNQAFINYFSHESAGNAIHQMNGFVVNNIELNCSWAIKT 931
            +Y+ +L + VTE  +L +F   G C SC +  +T       +VEF     A  SL+ MNG ++   +++++ A           SS K++A+       +FVG++  ++    +K  F   G I +A+V++D   GK KGYGFV+F N+++A +AI +M   +    +I+ +W   K  +  +   S     T EE+ N++  S   V+  G    +T++L+   F  FG+I  ++ FP    +F+ + SHESA +AI  +NG  +    + C W  +T
Sbjct:   11 LYVGNLSRDVTEPLILQVFSQLGPCKSCKMIMDTAGNDPYCFVEFFEHRHAAASLAAMNGRKIMGKEVKVNWA--------TTPSSQKKDANNHF---HVFVGDLSPEITTDDIKAAFAPFGRISDARVVKDMTTGKSKGYGFVSFFNKWDAENAIAQMGGQWLGGRQIRTNWATRKPPAPKSTYESNTKQLTYEEVVNQSSPSNCTVYCGGVTSGLTEQLMRQTFSPFGQIMEVRVFPDKGYSFVRFSSHESAAHAIVSVNGTTIEGHVVKCYWGKET 278          
BLAST of Polyadenylate-binding protein vs. Ensembl Xenopus
Match: tia1 (TIA1 cytotoxic granule-associated RNA binding protein [Source:NCBI gene;Acc:394890])

HSP 1 Score: 126.716 bits (317), Expect = 1.776e-31
Identity = 80/272 (29.41%), Postives = 138/272 (50.74%), Query Frame = 2
Query:  146 KSVTEEDLLSIFENYGLCVSCSLDPETCT----AYVEFDNENSANNSLS-MNGVEMGTTKIEISIAYIEQEHNIKRESSLKQEASEDCKPAQIFVGNIGTKVDETILKGGFEHLGTIIEAKVIRD-ADGKHKGYGFVTFSNEYEARSAIDKMNETFFHDEKIKCSWGKNK--SNLAVVASKNASKTLEEIFNETPKSYTNVFVTG--DNVTKELLEPHFEVFGKIKNIKAFPRNNQAFINYFSHESAGNAIHQMNGFVVNNIELNCSWAIKT 931
            + VTE  +L +F   G C SC +  +T       +VEF     A  SL+ MNG ++   +++++ A           SS K++A+       +FVG++  ++    +K  F   G I +A+V++D   GK KGYGFV+F N+++A +AI +M   +    +I+ +W   K  +  +   S     T EE+ N++  S   V+  G    +T++L+   F  FG+I  ++ FP    +F+ + SHESA +AI  +NG  +    + C W  +T
Sbjct:   29 RDVTEPLILQVFSQLGPCKSCKMIMDTAGNDPYCFVEFFEHRHAAASLAAMNGRKIMGKEVKVNWA--------TTPSSQKKDANNH---FHVFVGDLSPEITTDDIKAAFAPFGRISDARVVKDMTTGKSKGYGFVSFFNKWDAENAIAQMGGQWLGGRQIRTNWATRKPPAPKSTYESNTKQLTYEEVVNQSSPSNCTVYCGGVTSGLTEQLMRQTFSPFGQIMEVRVFPDKGYSFVRFSSHESAAHAIVSVNGTTIEGHVVKCYWGKET 289          
BLAST of Polyadenylate-binding protein vs. Ensembl Mouse
Match: Tia1 (cytotoxic granule-associated RNA binding protein 1 [Source:MGI Symbol;Acc:MGI:107914])

HSP 1 Score: 135.576 bits (340), Expect = 7.176e-35
Identity = 103/406 (25.37%), Postives = 184/406 (45.32%), Query Frame = 2
Query:  101 MESKNKKTIYISSLPKSVTEEDLLSIFENYGLCVSCSLDPETCT----AYVEF-DNENSANNSLSMNGVEMGTTKIEISIAYI--EQEHNIKRESSLKQEASEDCKPAQIFVGNIGTKVDETILKGGFEHLGTIIEAKVIRD-ADGKHKGYGFVTFSNEYEARSAIDKMNETFFHDEKIKCSWGKNKSNLAVVASKNASKTL--EEIFNETPKSYTNVFVTG--DNVTKELLEPHFEVFGKIKNIKAFPRNNQAFINYFSHESAGNAIHQMNGFVVNNIELNCSWAIKTEKSXXXXXXXXXXXXXXXXANVGAPRKYLANQINQYNGRQQPYESYDETGYGLPQFQQPSFTDDYTDQSFYNPVAMPTYQDDYNSYNVYPPSVPAPLIRNPPLGQPKPYLNVQPKPF 1282
            ME +  KT+Y+ +L + VTE  +L +F   G C +C +  +T       +VEF ++ ++A    +MNG ++   +++++ A     Q+ +    + +  + S+D     +FVG++  ++    +K  F   G I +A+V++D A GK KGYGFV+F N+++A +AI +M   +    +I+ +W   K        ++ +K L  +E+ +++  +   V+  G    +T++L+   F  FG+I  I+ FP    +F+ + SHESA +AI  +NG  +    + C W  +T                 +   +G P  Y   Q  Q+ G  Q    Y   G+ +P                Y     P  Q  +N      P +       PP GQ    L  QP  +
Sbjct:    1 MEDEMPKTLYVGNLSRDVTEALILQLFSQIGPCKNCKMIMDTAGNDPYCFVEFHEHRHAAAALAAMNGRKIMGKEVKVNWATTPSSQKKDTSSSTVVSTQRSQD--HFHVFVGDLSPEITTEDIKAAFAPFGRISDARVVKDMATGKSKGYGFVSFFNKWDAENAIQQMGGQWLGGRQIRTNWATRKPPAPKSTYESNTKQLSYDEVVSQSSPNNCTVYCGGVTSGLTEQLMRQTFSPFGQIMEIRVFPDKGYSFVRFSSHESAAHAIVSVNGTTIEGHVVKCYWGKET---------LDMINPVQQQNQIGYPPTY--GQWGQWYGNAQQIGQYVPNGWQVPA---------------YGVYGQPWSQQGFNQTQSSAPWMGPNYSVPPPQGQNGSMLPSQPAGY 378          
BLAST of Polyadenylate-binding protein vs. Ensembl Mouse
Match: Tia1 (cytotoxic granule-associated RNA binding protein 1 [Source:MGI Symbol;Acc:MGI:107914])

HSP 1 Score: 135.576 bits (340), Expect = 7.916e-35
Identity = 103/406 (25.37%), Postives = 184/406 (45.32%), Query Frame = 2
Query:  101 MESKNKKTIYISSLPKSVTEEDLLSIFENYGLCVSCSLDPETCT----AYVEF-DNENSANNSLSMNGVEMGTTKIEISIAYI--EQEHNIKRESSLKQEASEDCKPAQIFVGNIGTKVDETILKGGFEHLGTIIEAKVIRD-ADGKHKGYGFVTFSNEYEARSAIDKMNETFFHDEKIKCSWGKNKSNLAVVASKNASKTL--EEIFNETPKSYTNVFVTG--DNVTKELLEPHFEVFGKIKNIKAFPRNNQAFINYFSHESAGNAIHQMNGFVVNNIELNCSWAIKTEKSXXXXXXXXXXXXXXXXANVGAPRKYLANQINQYNGRQQPYESYDETGYGLPQFQQPSFTDDYTDQSFYNPVAMPTYQDDYNSYNVYPPSVPAPLIRNPPLGQPKPYLNVQPKPF 1282
            ME +  KT+Y+ +L + VTE  +L +F   G C +C +  +T       +VEF ++ ++A    +MNG ++   +++++ A     Q+ +    + +  + S+D     +FVG++  ++    +K  F   G I +A+V++D A GK KGYGFV+F N+++A +AI +M   +    +I+ +W   K        ++ +K L  +E+ +++  +   V+  G    +T++L+   F  FG+I  I+ FP    +F+ + SHESA +AI  +NG  +    + C W  +T                 +   +G P  Y   Q  Q+ G  Q    Y   G+ +P                Y     P  Q  +N      P +       PP GQ    L  QP  +
Sbjct:    1 MEDEMPKTLYVGNLSRDVTEALILQLFSQIGPCKNCKMIMDTAGNDPYCFVEFHEHRHAAAALAAMNGRKIMGKEVKVNWATTPSSQKKDTSSSTVVSTQRSQD--HFHVFVGDLSPEITTEDIKAAFAPFGRISDARVVKDMATGKSKGYGFVSFFNKWDAENAIQQMGGQWLGGRQIRTNWATRKPPAPKSTYESNTKQLSYDEVVSQSSPNNCTVYCGGVTSGLTEQLMRQTFSPFGQIMEIRVFPDKGYSFVRFSSHESAAHAIVSVNGTTIEGHVVKCYWGKET---------LDMINPVQQQNQIGYPPTY--GQWGQWYGNAQQIGQYVPNGWQVPA---------------YGVYGQPWSQQGFNQTQSSAPWMGPNYSVPPPQGQNGSMLPSQPAGY 378          
BLAST of Polyadenylate-binding protein vs. Ensembl Mouse
Match: Tia1 (cytotoxic granule-associated RNA binding protein 1 [Source:MGI Symbol;Acc:MGI:107914])

HSP 1 Score: 133.265 bits (334), Expect = 4.175e-34
Identity = 107/407 (26.29%), Postives = 184/407 (45.21%), Query Frame = 2
Query:  101 MESKNKKTIYISSLPKSVTEEDLLSIFENYGLCVSCSLDPETCT----AYVEF-DNENSANNSLSMNGVEMGTTKIEISIAYIEQEHNIKRESSLKQEASEDCKPAQIFVGNIGTKVDETILKGGFEHLGTIIEAKVIRD-ADGKHKGYGFVTFSNEYEARSAIDKMNETFFHDEKIKCSWGKNKSNLAVVASKNASKTL--EEIFNETPKSYTNVFVTG--DNVTKELLEPHFEVFGKIKNIKAFPRNNQAFINYFSHESAGNAIHQMNGFVVNNIELNCSWAIKTEKSXXXXXXXXXXXXXXXXANVGAPRKYLANQINQYNGRQQPYESYDETGYGLPQ---FQQPSFTDDYTDQSFYNPVAMPTYQDDYNSYNVYPPSVPAPLIRNPPLGQPKPYLNVQPKPF 1282
            ME +  KT+Y+ +L + VTE  +L +F   G C +C +  +T       +VEF ++ ++A    +MNG ++   +++++ A           SS K++ S       +FVG++  ++    +K  F   G I +A+V++D A GK KGYGFV+F N+++A +AI +M   +    +I+ +W   K        ++ +K L  +E+ +++  +   V+  G    +T++L+   F  FG+I  I+ FP    +F+ + SHESA +AI  +NG  +    + C W  +T                 +   +G P  Y   Q  Q+ G  Q    Y   G+ +P    + QP     +       P   P Y            SVP      PP GQ    L  QP  +
Sbjct:    1 MEDEMPKTLYVGNLSRDVTEALILQLFSQIGPCKNCKMIMDTAGNDPYCFVEFHEHRHAAAALAAMNGRKIMGKEVKVNWA--------TTPSSQKKDTSNHF---HVFVGDLSPEITTEDIKAAFAPFGRISDARVVKDMATGKSKGYGFVSFFNKWDAENAIQQMGGQWLGGRQIRTNWATRKPPAPKSTYESNTKQLSYDEVVSQSSPNNCTVYCGGVTSGLTEQLMRQTFSPFGQIMEIRVFPDKGYSFVRFSSHESAAHAIVSVNGTTIEGHVVKCYWGKET---------LDMINPVQQQNQIGYPPTY--GQWGQWYGNAQQIGQYVPNGWQVPAYGVYGQPWSQQGFNQTQSSAPWMGPNY------------SVP------PPQGQNGSMLPSQPAGY 367          
BLAST of Polyadenylate-binding protein vs. Ensembl Mouse
Match: Tia1 (cytotoxic granule-associated RNA binding protein 1 [Source:MGI Symbol;Acc:MGI:107914])

HSP 1 Score: 133.265 bits (334), Expect = 4.598e-34
Identity = 108/409 (26.41%), Postives = 185/409 (45.23%), Query Frame = 2
Query:  101 MESKNKKTIYISSLPKSVTEEDLLSIFENYGLCVSCSLDPETCTA------YVEF-DNENSANNSLSMNGVEMGTTKIEISIAYIEQEHNIKRESSLKQEASEDCKPAQIFVGNIGTKVDETILKGGFEHLGTIIEAKVIRD-ADGKHKGYGFVTFSNEYEARSAIDKMNETFFHDEKIKCSWGKNKSNLAVVASKNASKTL--EEIFNETPKSYTNVFVTG--DNVTKELLEPHFEVFGKIKNIKAFPRNNQAFINYFSHESAGNAIHQMNGFVVNNIELNCSWAIKTEKSXXXXXXXXXXXXXXXXANVGAPRKYLANQINQYNGRQQPYESYDETGYGLPQ---FQQPSFTDDYTDQSFYNPVAMPTYQDDYNSYNVYPPSVPAPLIRNPPLGQPKPYLNVQPKPF 1282
            ME +  KT+Y+ +L + VTE  +L +F   G C +C +  +  TA      +VEF ++ ++A    +MNG ++   +++++ A           SS K++ S       +FVG++  ++    +K  F   G I +A+V++D A GK KGYGFV+F N+++A +AI +M   +    +I+ +W   K        ++ +K L  +E+ +++  +   V+  G    +T++L+   F  FG+I  I+ FP    +F+ + SHESA +AI  +NG  +    + C W  +T                 +   +G P  Y   Q  Q+ G  Q    Y   G+ +P    + QP     +       P   P Y            SVP      PP GQ    L  QP  +
Sbjct:    1 MEDEMPKTLYVGNLSRDVTEALILQLFSQIGPCKNCKMIMDVRTAGNDPYCFVEFHEHRHAAAALAAMNGRKIMGKEVKVNWA--------TTPSSQKKDTSNHF---HVFVGDLSPEITTEDIKAAFAPFGRISDARVVKDMATGKSKGYGFVSFFNKWDAENAIQQMGGQWLGGRQIRTNWATRKPPAPKSTYESNTKQLSYDEVVSQSSPNNCTVYCGGVTSGLTEQLMRQTFSPFGQIMEIRVFPDKGYSFVRFSSHESAAHAIVSVNGTTIEGHVVKCYWGKET---------LDMINPVQQQNQIGYPPTY--GQWGQWYGNAQQIGQYVPNGWQVPAYGVYGQPWSQQGFNQTQSSAPWMGPNY------------SVP------PPQGQNGSMLPSQPAGY 369          
BLAST of Polyadenylate-binding protein vs. Ensembl Mouse
Match: Tial1 (Tia1 cytotoxic granule-associated RNA binding protein-like 1 [Source:MGI Symbol;Acc:MGI:107913])

HSP 1 Score: 125.176 bits (313), Expect = 3.455e-31
Identity = 92/341 (26.98%), Postives = 165/341 (48.39%), Query Frame = 2
Query:  119 KTIYISSLPKSVTEEDLLSIFENYGLCVSCSLDPETCT----AYVEF-DNENSANNSLSMNGVEMGTTKIEISIAYIEQEHNIKRESSLKQEASEDCKPAQIFVGNIGTKVDETILKGGFEHLGTIIEAKVIRD-ADGKHKGYGFVTFSNEYEARSAIDKMNETFFHDEKIKCSWGKNKSNLAVVASKNASKTL--EEIFNETPKSYTNVFVTG--DNVTKELLEPHFEVFGKIKNIKAFPRNNQAFINYFSHESAGNAIHQMNGFVVNNIELNCSWAIKTEKSXXXXXXXXXXXXXXXXANVGAPR---KYLAN--QINQYNGRQQPYESYDETGYGLPQ 1096
            +T+Y+ +L + VTE  +L +F   G C SC +  E  +     +VEF ++ ++A    +MNG ++   +++++ A           SS K++ S       +FVG++  ++    +K  F   G I +A+V++D A GK KGYGFV+F N+ +A +AI  M   +    +I+ +W   K        +  +K L  E++ N++      V+  G    +T +L+   F  FG+I  I+ FP    +F+ + +HESA +AI  +NG  +    + C W  ++    K                 G P+   +Y+AN  Q+  Y    QP   +++ G+G+ Q
Sbjct:    9 RTLYVGNLSRDVTEVLILQLFSQIGPCKSCKMITEHTSNDPYCFVEFYEHRDAAAALAAMNGRKILGKEVKVNWA--------TTPSSQKKDTSNHF---HVFVGDLSPEITTEDIKSAFAPFGKISDARVVKDMATGKSKGYGFVSFYNKLDAENAIVHMGGQWLGGRQIRTNWATRKPPAPKSTQETNTKQLRFEDVVNQSSPKNCTVYCGGIASGLTDQLMRQTFSPFGQIMEIRVFPEKGYSFVRFSTHESAAHAIVSVNGTTIEGHVVKCYWGKESPDMTKNFQQVDYSQWGQWSQVYGNPQQYGQYMANGWQVPPYGVYGQP---WNQQGFGVDQ 335          
BLAST of Polyadenylate-binding protein vs. UniProt/SwissProt
Match: sp|P31483|TIA1_HUMAN (Nucleolysin TIA-1 isoform p40 OS=Homo sapiens OX=9606 GN=TIA1 PE=1 SV=3)

HSP 1 Score: 138.658 bits (348), Expect = 3.579e-35
Identity = 93/345 (26.96%), Postives = 171/345 (49.57%), Query Frame = 2
Query:  101 MESKNKKTIYISSLPKSVTEEDLLSIFENYGLCVSCSLDPETCT----AYVEF-DNENSANNSLSMNGVEMGTTKIEISIAYI--EQEHNIKRESSLKQEASEDCKPAQIFVGNIGTKVDETILKGGFEHLGTIIEAKVIRD-ADGKHKGYGFVTFSNEYEARSAIDKMNETFFHDEKIKCSWGKNKSNLAVVASKNASKTL--EEIFNETPKSYTNVFVTG--DNVTKELLEPHFEVFGKIKNIKAFPRNNQAFINYFSHESAGNAIHQMNGFVVNNIELNCSWAIKTEKSXXXXXXXXXXXXXXXXANVGAPRKYLANQINQYNGRQQPYESYDETGYGLPQF 1099
            ME +  KT+Y+ +L + VTE  +L +F   G C +C +  +T       +VEF ++ ++A    +MNG ++   +++++ A     Q+ +    + +  + S+D     +FVG++  ++    +K  F   G I +A+V++D A GK KGYGFV+F N+++A +AI +M   +    +I+ +W   K        ++ +K L  +E+ N++  S   V+  G    +T++L+   F  FG+I  I+ FP    +F+ + SHESA +AI  +NG  +    + C W  +T                 +   +G P+ Y   Q  Q+ G  Q    Y   G+ +P +
Sbjct:    1 MEDEMPKTLYVGNLSRDVTEALILQLFSQIGPCKNCKMIMDTAGNDPYCFVEFHEHRHAAAALAAMNGRKIMGKEVKVNWATTPSSQKKDTSSSTVVSTQRSQD--HFHVFVGDLSPEITTEDIKAAFAPFGRISDARVVKDMATGKSKGYGFVSFFNKWDAENAIQQMGGQWLGGRQIRTNWATRKPPAPKSTYESNTKQLSYDEVVNQSSPSNCTVYCGGVTSGLTEQLMRQTFSPFGQIMEIRVFPDKGYSFVRFNSHESAAHAIVSVNGTTIEGHVVKCYWGKET---------LDMINPVQQQNQIGYPQPY--GQWGQWYGNAQQIGQYMPNGWQVPAY 332          
BLAST of Polyadenylate-binding protein vs. UniProt/SwissProt
Match: sp|P52912|TIA1_MOUSE (Nucleolysin TIA-1 OS=Mus musculus OX=10090 GN=Tia1 PE=1 SV=1)

HSP 1 Score: 135.576 bits (340), Expect = 5.537e-34
Identity = 103/406 (25.37%), Postives = 184/406 (45.32%), Query Frame = 2
Query:  101 MESKNKKTIYISSLPKSVTEEDLLSIFENYGLCVSCSLDPETCT----AYVEF-DNENSANNSLSMNGVEMGTTKIEISIAYI--EQEHNIKRESSLKQEASEDCKPAQIFVGNIGTKVDETILKGGFEHLGTIIEAKVIRD-ADGKHKGYGFVTFSNEYEARSAIDKMNETFFHDEKIKCSWGKNKSNLAVVASKNASKTL--EEIFNETPKSYTNVFVTG--DNVTKELLEPHFEVFGKIKNIKAFPRNNQAFINYFSHESAGNAIHQMNGFVVNNIELNCSWAIKTEKSXXXXXXXXXXXXXXXXANVGAPRKYLANQINQYNGRQQPYESYDETGYGLPQFQQPSFTDDYTDQSFYNPVAMPTYQDDYNSYNVYPPSVPAPLIRNPPLGQPKPYLNVQPKPF 1282
            ME +  KT+Y+ +L + VTE  +L +F   G C +C +  +T       +VEF ++ ++A    +MNG ++   +++++ A     Q+ +    + +  + S+D     +FVG++  ++    +K  F   G I +A+V++D A GK KGYGFV+F N+++A +AI +M   +    +I+ +W   K        ++ +K L  +E+ +++  +   V+  G    +T++L+   F  FG+I  I+ FP    +F+ + SHESA +AI  +NG  +    + C W  +T                 +   +G P  Y   Q  Q+ G  Q    Y   G+ +P                Y     P  Q  +N      P +       PP GQ    L  QP  +
Sbjct:    1 MEDEMPKTLYVGNLSRDVTEALILQLFSQIGPCKNCKMIMDTAGNDPYCFVEFHEHRHAAAALAAMNGRKIMGKEVKVNWATTPSSQKKDTSSSTVVSTQRSQD--HFHVFVGDLSPEITTEDIKAAFAPFGRISDARVVKDMATGKSKGYGFVSFFNKWDAENAIQQMGGQWLGGRQIRTNWATRKPPAPKSTYESNTKQLSYDEVVSQSSPNNCTVYCGGVTSGLTEQLMRQTFSPFGQIMEIRVFPDKGYSFVRFSSHESAAHAIVSVNGTTIEGHVVKCYWGKET---------LDMINPVQQQNQIGYPPTY--GQWGQWYGNAQQIGQYVPNGWQVPA---------------YGVYGQPWSQQGFNQTQSSAPWMGPNYSVPPPQGQNGSMLPSQPAGY 378          
BLAST of Polyadenylate-binding protein vs. UniProt/SwissProt
Match: sp|Q01085|TIAR_HUMAN (Nucleolysin TIAR OS=Homo sapiens OX=9606 GN=TIAL1 PE=1 SV=1)

HSP 1 Score: 127.102 bits (318), Expect = 5.239e-31
Identity = 93/341 (27.27%), Postives = 166/341 (48.68%), Query Frame = 2
Query:  119 KTIYISSLPKSVTEEDLLSIFENYGLCVSCSLDPETCT----AYVEF-DNENSANNSLSMNGVEMGTTKIEISIAYIEQEHNIKRESSLKQEASEDCKPAQIFVGNIGTKVDETILKGGFEHLGTIIEAKVIRD-ADGKHKGYGFVTFSNEYEARSAIDKMNETFFHDEKIKCSWGKNKSNLAVVASKNASKTL--EEIFNETPKSYTNVFVTG--DNVTKELLEPHFEVFGKIKNIKAFPRNNQAFINYFSHESAGNAIHQMNGFVVNNIELNCSWAIKTEKSXXXXXXXXXXXXXXXXANVGAPR---KYLAN--QINQYNGRQQPYESYDETGYGLPQ 1096
            +T+Y+ +L + VTE  +L +F   G C SC +  E  +     +VEF ++ ++A    +MNG ++   +++++ A           SS K++ S       +FVG++  ++    +K  F   G I +A+V++D A GK KGYGFV+F N+ +A +AI  M   +    +I+ +W   K        +N +K L  E++ N++      V+  G    +T +L+   F  FG+I  I+ FP    +F+ + +HESA +AI  +NG  +    + C W  ++    K                 G P+   +Y+AN  Q+  Y    QP   +++ G+G+ Q
Sbjct:    9 RTLYVGNLSRDVTEVLILQLFSQIGPCKSCKMITEHTSNDPYCFVEFYEHRDAAAALAAMNGRKILGKEVKVNWA--------TTPSSQKKDTSNHF---HVFVGDLSPEITTEDIKSAFAPFGKISDARVVKDMATGKSKGYGFVSFYNKLDAENAIVHMGGQWLGGRQIRTNWATRKPPAPKSTQENNTKQLRFEDVVNQSSPKNCTVYCGGIASGLTDQLMRQTFSPFGQIMEIRVFPEKGYSFVRFSTHESAAHAIVSVNGTTIEGHVVKCYWGKESPDMTKNFQQVDYSQWGQWSQVYGNPQQYGQYMANGWQVPPYGVYGQP---WNQQGFGVDQ 335          
BLAST of Polyadenylate-binding protein vs. UniProt/SwissProt
Match: sp|P70318|TIAR_MOUSE (Nucleolysin TIAR OS=Mus musculus OX=10090 GN=Tial1 PE=1 SV=1)

HSP 1 Score: 117.472 bits (293), Expect = 1.760e-27
Identity = 92/358 (25.70%), Postives = 165/358 (46.09%), Query Frame = 2
Query:  119 KTIYISSLPKSVTEEDLLSIFENYGLCVSCSLDPETCTA---------------------YVEF-DNENSANNSLSMNGVEMGTTKIEISIAYIEQEHNIKRESSLKQEASEDCKPAQIFVGNIGTKVDETILKGGFEHLGTIIEAKVIRD-ADGKHKGYGFVTFSNEYEARSAIDKMNETFFHDEKIKCSWGKNKSNLAVVASKNASKTL--EEIFNETPKSYTNVFVTG--DNVTKELLEPHFEVFGKIKNIKAFPRNNQAFINYFSHESAGNAIHQMNGFVVNNIELNCSWAIKTEKSXXXXXXXXXXXXXXXXANVGAPR---KYLAN--QINQYNGRQQPYESYDETGYGLPQ 1096
            +T+Y+ +L + VTE  +L +F   G C SC +  E   +                     +VEF ++ ++A    +MNG ++   +++++ A           SS K++ S       +FVG++  ++    +K  F   G I +A+V++D A GK KGYGFV+F N+ +A +AI  M   +    +I+ +W   K        +  +K L  E++ N++      V+  G    +T +L+   F  FG+I  I+ FP    +F+ + +HESA +AI  +NG  +    + C W  ++    K                 G P+   +Y+AN  Q+  Y    QP   +++ G+G+ Q
Sbjct:    9 RTLYVGNLSRDVTEVLILQLFSQIGPCKSCKMITEQPDSRRVNSSVGFSVLQHTSNDPYCFVEFYEHRDAAAALAAMNGRKILGKEVKVNWA--------TTPSSQKKDTSNHF---HVFVGDLSPEITTEDIKSAFAPFGKISDARVVKDMATGKSKGYGFVSFYNKLDAENAIVHMGGQWLGGRQIRTNWATRKPPAPKSTQETNTKQLRFEDVVNQSSPKNCTVYCGGIASGLTDQLMRQTFSPFGQIMEIRVFPEKGYSFVRFSTHESAAHAIVSVNGTTIEGHVVKCYWGKESPDMTKNFQQVDYSQWGQWSQVYGNPQQYGQYMANGWQVPPYGVYGQP---WNQQGFGVDQ 352          
BLAST of Polyadenylate-binding protein vs. UniProt/SwissProt
Match: sp|Q9M427|UBP1_NICPL (Oligouridylate-binding protein 1 OS=Nicotiana plumbaginifolia OX=4092 GN=UBP1 PE=2 SV=1)

HSP 1 Score: 98.2117 bits (243), Expect = 7.595e-21
Identity = 76/299 (25.42%), Postives = 140/299 (46.82%), Query Frame = 2
Query:  101 MESKNKKTIYISSLPKSVTEEDLLSIFENYGLCVSCSLDPETCTAY--VE-FDNENSANNSLSMNGVEMGTTKIEISIAYIEQEHNIKRESSLKQEASEDCKPAQIFVGNIGTKVDETILKGGFEHLGTIIEAKVIRDAD-GKHKGYGFVTFSNEYEARSAIDKMNETFFHDEKIKCSWG-----------KNKSNLAVVASKNASKTLEEIFNE-TPKS---YTNVFV--TGDNVTKELLEPHFEVFGK--IKNIKAFPRNNQAFINYFSHESAGNAIHQMNGFVVNNIELNCSWAIK 928
             +S   +++Y+ ++   VTE  L  +F + G    C L  +  ++Y  V+ FD  ++A   +++NG  +    I+++ AY          S+ +++ S       IFVG++  +V +  L   F    +  +A+V+ D   G+ +G+GFV+F N+ EA+SAI+ +N  +    +I+C+W             +  ++  + S  +    E++ NE  P++   YT V+V      VT   L  HF   G   I++++        F+ Y SH  A  AI   N  ++    + CSW  K
Sbjct:   43 FDSSTCRSVYVGNIHPQVTEPLLQEVFASTGPLEGCKLIRKDKSSYGFVDYFDRRSAALAIVTLNGRHLFGQPIKVNWAY---------ASAQREDTSNHYN---IFVGDLSPEVTDATLFACFSVYTSCSDARVMWDQKTGRSRGFGFVSFRNQQEAQSAINDLNGKWLGSRQIRCNWAAKGAGAVGEQNSDAKSVVELTSGTSDDGQEKVVNEDAPENNPQYTTVYVGNLAPEVTSVDLHRHFHALGAGVIEDVRIQRDKGFGFVRYSSHAEAARAIQLGNARLLFGKPVKCSWGSK 329          
BLAST of Polyadenylate-binding protein vs. TrEMBL
Match: D5JG76 (TIA1-like protein (Fragment) OS=Dugesia japonica OX=6161 GN=TIAL-2 PE=2 SV=1)

HSP 1 Score: 475.322 bits (1222), Expect = 1.002e-161
Identity = 264/471 (56.05%), Postives = 324/471 (68.79%), Query Frame = 2
Query:   86 NEMSKMESKNKKTIYISSLPKSVTEEDLLSIFENYGLCVSCSLDPETCTAYVEFDNENSANNSLSMNGVEMGTTKIEISIAY-----IEQEHNIKRESSLKQEASEDCKPAQIFVGNIGTKVDETILKGGFEHLGTIIEAKVIRDADGKHKGYGFVTFSNEYEARSAIDKMNETFFHDEKIKCSWGKNKSNLAVVASKNASKTLEEIFNETPKSYTNVFVTGDNVTKELLEPHFEVFGKIKNIKAFPRNNQAFINYFSHESAGNAIHQMNGFVVNNIELNCSWAIKTEKSXXXXXXXXXXXXXXXXANVGAPRKYLA-NQINQYNGRQQPYES-YDETGYG----LPQFQQPSFTDDYTDQSFYNPVAMPT-------YQDDYNSYNVYPPSVPAPLIRNPPLGQPKPYLNVQPKPFGPAQPKPYGNVQSKPF-NVQPLMGIPAQPKPRLNRVA-QPFKKPILGNPGKYIG 1438
            ++MSKME++N KTIYIS LP SVTEEDLLSIFENYGLCVSC L+ E CTAYVEFDNE SA N+LSMNG+EMG T+I+I IAY      EQE+ +  ++ L +  ++D  P QIFVGNIG+ VDE IL+GGFEHLG II+ KVIRD DGK KGYGFVTFS+E+EA++AID+MNETFFHDEKIKCSWGKNK+N+ V  +KNA ++L++I +ETPKSYTNVFVTG+NVT+E+LEPHF  FG IKNIKAFP+NNQ+FINY+SHE+A NAIHQMNGF++NN+EL CSWAIK+EK  KK        +      +  PRK+L     +     +Q YES YD    G    L QFQQ S T+ Y +Q F+ P ++P        Y D+YN                                F  A+      +QSK   NVQPLMGI AQPKP LNRVA  P++KPIL  PGK++ 
Sbjct:   13 SKMSKMENRNTKTIYISCLPNSVTEEDLLSIFENYGLCVSCELNSEECTAYVEFDNETSARNALSMNGIEMGATRIQIIIAYDYTSAFEQEYQMNSKNFLGK--TDDSTPTQIFVGNIGSNVDEAILEGGFEHLGKIIDTKVIRDPDGKPKGYGFVTFSSEFEAKNAIDRMNETFFHDEKIKCSWGKNKTNVTVTLNKNAVRSLQDILSETPKSYTNVFVTGENVTQEMLEPHFVKFGTIKNIKAFPKNNQSFINYYSHEAAANAIHQMNGFLLNNVELKCSWAIKSEKPGKKIKFTRQQQQPP----IKKPRKHLLPKTFSNVTTTRQAYESKYDSGYGGIGGGLSQFQQ-SLTNPYQEQPFH-PYSLPAVYPNEYQYDDNYN--------------------------------FSTARSH---FIQSKSVPNVQPLMGILAQPKPALNRVATNPYRKPILNKPGKFMS 440          
BLAST of Polyadenylate-binding protein vs. TrEMBL
Match: D5JG75 (TIA1-like protein (Fragment) OS=Dugesia japonica OX=6161 GN=TIAL-1 PE=2 SV=1)

HSP 1 Score: 307.375 bits (786), Expect = 3.909e-96
Identity = 189/460 (41.09%), Postives = 249/460 (54.13%), Query Frame = 2
Query:  119 KTIYISSLPKSVTEEDLLSIFENYGLCVSCSLDPETCTAYVEFDNENSANNSLSMNGVEMGTTKIEISIAYIEQEHNIKRESSLKQEASEDCKPAQIFVGNIGTKVDETILKGGFEHLGTIIEAKVIRDADGKHKGYGFVTFSNEYEARSAIDKMNETFFHDEKIKCSWG-KNK-SNLAVVASK----NASKTLEEIFNETPKSYTNVFVTGDNVTKELLEPHFEVFGKIKNIKAFPRNNQAFINYFSHESAGNAIHQMNGFVVNNIELNCSWAIKTEKSXXXXXXXXXXXXXXXXANVGAPRKYLANQINQYNGRQQPYESYDETGYGLPQ------------FQQPSFTDDYTDQSFYNPVAMPTYQDDYNSY-----------NVYPPSVPAPLIRNPPL-GQPKPYLNVQPKPFGPAQPKPYGNVQSKPFNVQPLMGIPAQPKPRLNRVAQPFKKP 1408
            KTIYIS+LP  ++EEDLLSIF ++G CVSC L+ ET TAY+EFDNE+SA  +L+MN   M + ++ + IAY++         +L  +  +  +  QIFVG IG  +DE ILK GF H G +++ KV+R  DG+HKG+ FV+FSNE +A SAI KMN T FH+ KI+C+W  KNK SN A    K      +KTLE+I  E P+S T+V+V G+++T+ELL P FE FGKIKN+KAFP  N AF+NY +H++A  AI Q+NG+ +NNIEL C+W  K                     N         +  NQY  +  PY  YD T                  +Q P + ++    SFYNP  MP Y    N Y           N YP       +  P L GQPK     QPK    A PK                G P +PKPR+NR   P+ KP
Sbjct:    1 KTIYISNLPSPISEEDLLSIFGSFGACVSCELNLETLTAYIEFDNESSAEKALAMNNTPMESNQMSVEIAYVDNVVQNVTSYTLASKKVDYSQSVQIFVGGIGFDIDEAILKEGFAHCGQVLDTKVVRSNDGQHKGFAFVSFSNESDANSAIQKMNNTMFHNRKIQCNWATKNKNSNGAPFNPKFNPTKFNKTLEDISYEAPESNTSVYVLGESLTEELLRPIFERFGKIKNVKAFPEKNHAFVNYDTHDAAAYAIQQLNGYKINNIELKCNWGKK---------------------NAALGNANNQSMGNQYGNQMNPY--YDNTQANFYNYQQQFDQYYQAGYQVPQYFNNTQMGSFYNP--MPNYPQFQNPYGGQQNFINPNQNNYPAPNQGNFVAQPNLLGQPKGSYGAQPKNNFKAGPK----------------GFPGEPKPRMNRAPHPYNKP 419          
BLAST of Polyadenylate-binding protein vs. TrEMBL
Match: A4V6J5 (Polyadenylate-binding protein (Fragment) OS=Dugesia japonica OX=6161 PE=2 SV=1)

HSP 1 Score: 291.967 bits (746), Expect = 3.495e-93
Identity = 141/207 (68.12%), Postives = 170/207 (82.13%), Query Frame = 2
Query:   89 EMSKMESKNKKTIYISSLPKSVTEEDLLSIFENYGLCVSCSLDPETCTAYVEFDNENSANNSLSMNGVEMGTTKIEISIAY-----IEQEHNIKRESSLKQEASEDCKPAQIFVGNIGTKVDETILKGGFEHLGTIIEAKVIRDADGKHKGYGFVTFSNEYEARSAIDKMNETFFHDEKIKCSWGKNKSNLAVVASKNASKTLEEIF 694
            EMSKME++N KTIYIS LP SVTEEDLLSIFENYGLCVSC L+ E CTAYVEFDNE SA N+LSMNG+EMG T+I+I IAY      EQE+ +  ++ L +  ++D  P QIFVGNIG+ VDE IL+GGFEHLG II+ KVIRD DGK KGYGFVTFS+E+EA++AID+MNETFFHDEKIKCSWGKNK+N+ V  +KNA ++L++I 
Sbjct:    4 EMSKMENRNTKTIYISCLPNSVTEEDLLSIFENYGLCVSCELNSEECTAYVEFDNETSARNALSMNGIEMGATRIQIIIAYDYTSAFEQEYQMNSKNFLGK--TDDSTPTQIFVGNIGSNVDEAILEGGFEHLGKIIDTKVIRDPDGKPKGYGFVTFSSEFEAKNAIDRMNETFFHDEKIKCSWGKNKTNVTVTLNKNAVRSLQDIL 208          
BLAST of Polyadenylate-binding protein vs. TrEMBL
Match: D5JG77 (TIA1-like protein OS=Dugesia japonica OX=6161 GN=TIAL-3 PE=2 SV=1)

HSP 1 Score: 206.838 bits (525), Expect = 9.081e-59
Identity = 103/280 (36.79%), Postives = 170/280 (60.71%), Query Frame = 2
Query:  101 MESKNKKTIYISSLPKSVTEEDLLSIFENYGLCVSCSLDPE-TCT----AYVEFDNENSANNSLS-MNGVEMGTTKIEISIAYIEQEHNIKRESSLKQEASEDCKPAQIFVGNIGTKVDETILKGGFEHLGTIIEAKVIRDADGKHKGYGFVTFSNEYEARSAIDKMNETFFHDEKIKCSWGKNKSNLAVVASKNASKTLEEIFNETPKSYTNVFVTGDNVTKELLEPHFEVFGKIKNIKAFPRNNQAFINYFSHESAGNAIHQMNGFVVNNIELNCSWA 922
            M  KN +TIY+ +LP +V ++ L+ IF N+G C+SC +  + +C     A++E+ + +SA+ +LS M+G+ M   +I+++  +      +   +++     +     QIFVG+IG  VDE +LK GF   G +I+AKV+R  DG+ +G+ FV+FSN  EA  AI  M++T+FH+  IKC+W            K   +  E ++ E P + TNV+V G+N+T+ELL  HF+ FG+I ++K +P    AFIN+ +HE+A  AI Q +G+ +N+  + C+W 
Sbjct:    1 MSFKNNRTIYVGNLPDAVNDQLLIRIFGNFGQCISCHIIRDFSCQTNPYAFIEYTDHSSASLALSAMDGIYMWNNQIKVN--WSSGPSAVPGPAAVASAKIDYSNSVQIFVGDIGLDVDEPMLKEGFSQFGQLIDAKVVRYPDGQSRGFAFVSFSNRDEAERAIQSMHKTWFHNRTIKCNWATRNGLDGEQFIKYTPRPYELVYKEAPLTNTNVYVAGENLTEELLNCHFQEFGRIDSVKVYPEKGHAFINFVTHEAAARAISQRHGYKINDNVIKCNWG 278          

HSP 2 Score: 62.7734 bits (151), Expect = 5.184e-7
Identity = 45/184 (24.46%), Postives = 87/184 (47.28%), Query Frame = 2
Query:  407 IFVGNIGTKVDETILKGGFEHLGTIIEAKVIRDADGKHKGYGFVTFSNEYEARSAIDKMNETFFHDEKIKCSWGKNKSNLAVVASKNASKTLEEIFNETPKSYTN---VFV--TGDNVTKELLEPHFEVFGKIKNIKA--FPRNNQ---AFINYFSHESAGNAIHQMNGFVVNNIELNCSWAIK 928
            I+VGN+   V++ +L   F + G  I   +IRD   +   Y F+ +++   A  A+  M+  +  + +IK +W    S +   A+  ++K            Y+N   +FV   G +V + +L+  F  FG++ + K   +P       AF+++ + + A  AI  M+    +N  + C+WA +
Sbjct:    9 IYVGNLPDAVNDQLLIRIFGNFGQCISCHIIRDFSCQTNPYAFIEYTDHSSASLALSAMDGIYMWNNQIKVNWSSGPSAVPGPAAVASAKI----------DYSNSVQIFVGDIGLDVDEPMLKEGFSQFGQLIDAKVVRYPDGQSRGFAFVSFSNRDEAERAIQSMHKTWFHNRTIKCNWATR 182          
BLAST of Polyadenylate-binding protein vs. TrEMBL
Match: D5JG78 (TIA1-like protein (Fragment) OS=Dugesia japonica OX=6161 GN=TIAL-4 PE=2 SV=1)

HSP 1 Score: 189.119 bits (479), Expect = 1.825e-52
Identity = 103/283 (36.40%), Postives = 169/283 (59.72%), Query Frame = 2
Query:  101 MESKNKKTIYISSLPKSVTEEDLLSIFENYGLCVSCSLDPE-TCT----AYVEFDNENSANNSLS-MNGVEMGTTKIEISIAYIEQEHNIKRESSLKQEASED-CKPAQIFVGNIGTKVDETILKGGFEHLGTIIEAKVIRDADGKHKGYGFVTFSNEYEARSAIDKMNETFFHDEKIKCSWGKNKSNLAVVASKNASKTLEEIFNETPKSYTNVFVTG--DNVTKELLEPHFEVFGKIKNIKAFPRNNQAFINYFSHESAGNAIHQMNGFVVNNIELNCSWA 922
            M+ +N +TIY+ +LP ++T+  LL IF N+G CV C +  + +C     A++E+ N ++A+ +L+ M+G+ M   +I+++ +     + +   SSL      D     QIFVG+IG  VDE +LK GF   G +++AKV+R  DG+ +G+ FV FS   +A  AI+KM++T+FH+  IKC+W            K   +  E ++ E P + TNV++ G  + +T+EL+  HFE FG+I  +K +P    AFIN+ +HESA  AI Q +G+ +N+  + C+W 
Sbjct:    1 MDIRNNRTIYVGNLPDAITDHLLLRIFGNFGQCVGCHIIRDFSCQTNPYAFIEYTNHSAASLALAAMDGIFMWNNQIKVNWSSGNSVNTVA--SSLPSSNKIDYSNTIQIFVGDIGLDVDEAMLKEGFSEFGPVVDAKVVRYQDGQSRGFAFVAFSKRDDAEKAIEKMHKTWFHNRTIKCNWATRNGLDGDQFIKYTPRPYELVYKEAPLTNTNVYIAGIPEGLTEELIRVHFEEFGRIDAVKVYPEKAHAFINFVTHESAARAISQRHGYKINDNVIKCNWG 281          
BLAST of Polyadenylate-binding protein vs. Ensembl Cavefish
Match: tia1l (TIA1 cytotoxic granule associated RNA binding protein [Source:NCBI gene;Acc:103030565])

HSP 1 Score: 135.191 bits (339), Expect = 3.098e-35
Identity = 86/290 (29.66%), Postives = 148/290 (51.03%), Query Frame = 2
Query:  101 MESKNKKTIYISSLPKSVTEEDLLSIFENYGLCVSCSLDPETCT----AYVEFDNENSANNSL-SMNGVEMGTTKIEISIAYIEQEHNIKRESSLKQEASEDCKPAQIFVGNIGTKVDETILKGGFEHLGTIIEAKVIRD-ADGKHKGYGFVTFSNEYEARSAIDKMNETFFHDEKIKCSWGKNK-----SNLAVVASKNASKTLEEIFNETPKSYTNVFVTG--DNVTKELLEPHFEVFGKIKNIKAFPRNNQAFINYFSHESAGNAIHQMNGFVVNNIELNCSWAIKT 931
            M+    KT+Y+ +L + VTE  +L +F   G C SC +  +T       +VEF     A  +L +MNG ++    ++++ A +         SS K++ S       +FVG++  ++    +K  F   G I +A+V++D A GK KGYGF++F N+++A +AI +MN  +    +I+ +W   K     SN     +K+ S   EE+ +++  S   V+  G    +T +L+   F  FG+I  I+ FP    +F+ + SHE A +AI  +NG  +    + C W  +T
Sbjct:    2 MDDDQPKTLYVGNLSRDVTEALILQVFTQIGPCKSCKMIIDTAGNDPYCFVEFYEHMHAAAALGAMNGRKILGKDMKVNWASMP--------SSQKKDTSNH---FHVFVGDLSPEISTDDVKAAFAPFGKISDARVVKDLATGKSKGYGFISFINKWDAENAIQQMNGQWLGGRQIRTNWATRKPPAPKSNYETGNTKHLS--YEEVLSQSSPSNCTVYCGGVTSGLTDQLMRQTFSPFGQIMEIRVFPDKGYSFVRFDSHEGAAHAIVSVNGTCIEGHTVKCYWGKET 278          

HSP 2 Score: 66.6254 bits (161), Expect = 1.284e-11
Identity = 53/259 (20.46%), Postives = 108/259 (41.70%), Query Frame = 2
Query:   98 KMESKNKKTIYISSLPKSVTEEDLLSIFENYGLCVSCSLDPETCTA------YVEFDNENSANNSLS-MNGVEMGTTKIEISIAYIE-----------QEHNIKRESSLKQEASEDCKPAQIFVGNIGTKVDETILKGGFEHLGTIIEAKVIRDADGKHKGYGFVTFSNEYEARSAIDKMNETFFHDEKIKCSWGKNKSNLAVVASKNASKT----LEEIFNETPKSYTNVFVTGDNVTKELLEPHFEVFGKIKNIKAF 808
            K ++ N   +++  L   ++ +D+ + F  +G      +  +  T       ++ F N+  A N++  MNG  +G  +I  + A  +              ++  E  L Q +  +C    ++ G + + + + +++  F   G I+E +V  D     KGY FV F +   A  AI  +N T      +KC WGK  +++  +      ++      + + +  +SY N    G  V      P + V+G+  N + +
Sbjct:   89 KKDTSNHFHVFVGDLSPEISTDDVKAAFAPFGKISDARVVKDLATGKSKGYGFISFINKWDAENAIQQMNGQWLGGRQIRTNWATRKPPAPKSNYETGNTKHLSYEEVLSQSSPSNCT---VYCGGVTSGLTDQLMRQTFSPFGQIMEIRVFPD-----KGYSFVRFDSHEGAAHAIVSVNGTCIEGHTVKCYWGKETADMRAMQQMPMPQSNPGYAAQPYGQWGQSYGNGQQMGQYVPNGWQMPTYGVYGQAWNQQGY 339          
BLAST of Polyadenylate-binding protein vs. Ensembl Cavefish
Match: tia1l (TIA1 cytotoxic granule associated RNA binding protein [Source:NCBI gene;Acc:103030565])

HSP 1 Score: 135.191 bits (339), Expect = 3.098e-35
Identity = 86/290 (29.66%), Postives = 148/290 (51.03%), Query Frame = 2
Query:  101 MESKNKKTIYISSLPKSVTEEDLLSIFENYGLCVSCSLDPETCT----AYVEFDNENSANNSL-SMNGVEMGTTKIEISIAYIEQEHNIKRESSLKQEASEDCKPAQIFVGNIGTKVDETILKGGFEHLGTIIEAKVIRD-ADGKHKGYGFVTFSNEYEARSAIDKMNETFFHDEKIKCSWGKNK-----SNLAVVASKNASKTLEEIFNETPKSYTNVFVTG--DNVTKELLEPHFEVFGKIKNIKAFPRNNQAFINYFSHESAGNAIHQMNGFVVNNIELNCSWAIKT 931
            M+    KT+Y+ +L + VTE  +L +F   G C SC +  +T       +VEF     A  +L +MNG ++    ++++ A +         SS K++ S       +FVG++  ++    +K  F   G I +A+V++D A GK KGYGF++F N+++A +AI +MN  +    +I+ +W   K     SN     +K+ S   EE+ +++  S   V+  G    +T +L+   F  FG+I  I+ FP    +F+ + SHE A +AI  +NG  +    + C W  +T
Sbjct:    2 MDDDQPKTLYVGNLSRDVTEALILQVFTQIGPCKSCKMIIDTAGNDPYCFVEFYEHMHAAAALGAMNGRKILGKDMKVNWASMP--------SSQKKDTSNH---FHVFVGDLSPEISTDDVKAAFAPFGKISDARVVKDLATGKSKGYGFISFINKWDAENAIQQMNGQWLGGRQIRTNWATRKPPAPKSNYETGNTKHLS--YEEVLSQSSPSNCTVYCGGVTSGLTDQLMRQTFSPFGQIMEIRVFPDKGYSFVRFDSHEGAAHAIVSVNGTCIEGHTVKCYWGKET 278          

HSP 2 Score: 66.6254 bits (161), Expect = 1.284e-11
Identity = 53/259 (20.46%), Postives = 108/259 (41.70%), Query Frame = 2
Query:   98 KMESKNKKTIYISSLPKSVTEEDLLSIFENYGLCVSCSLDPETCTA------YVEFDNENSANNSLS-MNGVEMGTTKIEISIAYIE-----------QEHNIKRESSLKQEASEDCKPAQIFVGNIGTKVDETILKGGFEHLGTIIEAKVIRDADGKHKGYGFVTFSNEYEARSAIDKMNETFFHDEKIKCSWGKNKSNLAVVASKNASKT----LEEIFNETPKSYTNVFVTGDNVTKELLEPHFEVFGKIKNIKAF 808
            K ++ N   +++  L   ++ +D+ + F  +G      +  +  T       ++ F N+  A N++  MNG  +G  +I  + A  +              ++  E  L Q +  +C    ++ G + + + + +++  F   G I+E +V  D     KGY FV F +   A  AI  +N T      +KC WGK  +++  +      ++      + + +  +SY N    G  V      P + V+G+  N + +
Sbjct:   89 KKDTSNHFHVFVGDLSPEISTDDVKAAFAPFGKISDARVVKDLATGKSKGYGFISFINKWDAENAIQQMNGQWLGGRQIRTNWATRKPPAPKSNYETGNTKHLSYEEVLSQSSPSNCT---VYCGGVTSGLTDQLMRQTFSPFGQIMEIRVFPD-----KGYSFVRFDSHEGAAHAIVSVNGTCIEGHTVKCYWGKETADMRAMQQMPMPQSNPGYAAQPYGQWGQSYGNGQQMGQYVPNGWQMPTYGVYGQAWNQQGY 339          
BLAST of Polyadenylate-binding protein vs. Ensembl Cavefish
Match: tial1 (TIA1 cytotoxic granule associated RNA binding protein like 1 [Source:NCBI gene;Acc:103030475])

HSP 1 Score: 128.642 bits (322), Expect = 1.950e-32
Identity = 98/365 (26.85%), Postives = 178/365 (48.77%), Query Frame = 2
Query:  119 KTIYISSLPKSVTEEDLLSIFENYGLCVSCSLDPETCT----AYVEF-DNENSANNSLSMNGVEMGTTKIEISIAYIEQEHNIKRESSLKQEASEDCKPAQIFVGNIGTKVDETILKGGFEHLGTIIEAKVIRD-ADGKHKGYGFVTFSNEYEARSAIDKMNETFFHDEKIKCSWGKNK-------SNLAVVASKNASKTL--EEIFNETPKSYTNVFVTG--DNVTKELLEPHFEVFGKIKNIKAFPRNNQAFINYFSHESAGNAIHQMNGFVVNNIELNCSWAIKT---EKSXXXXXXXXXXXXXXXXANV-GAPRKYLANQINQYNGRQQPY-----ESYDETGYGLPQFQQPSFTDDYTDQ 1135
            KT+Y+ +L + VTE  +L +F   G C SC +  E  +     +VEF ++ ++A    +MNG ++   +++++ A           SS K++ S       +FVG++  ++    ++  F   G I +A+V++D   GK KGYGFV+F N+ +A +AI  M   +    +I+ +W   K        +   +A   +SK L  E++ N++      V+  G    +++ L+   F  FG+I  I+ FP    +FI + SHESA +AI  +NG  + +  + C W  ++    KS++         +      V G P++Y   Q    NG Q P      +++++ G+G+ Q Q P++   +  Q
Sbjct:    8 KTLYVGNLSRDVTENLILQLFTQIGPCKSCKMITEHTSNDPYCFVEFFEHRDAAAALAAMNGRKILGKEVKVNWA--------TTPSSQKKDTSNH---FHVFVGDLSPEITTDDIRAAFAPFGKISDARVVKDMTTGKSKGYGFVSFYNKLDAENAIVHMGGQWLGGRQIRTNWATRKPPAPKSVQDSKQIAHLGSSKQLRFEDVVNQSSPQNCTVYCGGIQSGLSEHLIRQTFSPFGQIMEIRVFPEKGYSFIRFSSHESAAHAIVSVNGTTIESHIVKCYWGKESPDMAKSVQPVTEQVDYGQWGHWNQVYGNPQQY--GQYMTTNGWQLPSYGMYGQTWNQQGFGVEQSQSPAWMGGFGTQ 359          
BLAST of Polyadenylate-binding protein vs. Ensembl Cavefish
Match: tia1l (TIA1 cytotoxic granule associated RNA binding protein [Source:NCBI gene;Acc:103030565])

HSP 1 Score: 110.538 bits (275), Expect = 1.029e-26
Identity = 73/255 (28.63%), Postives = 130/255 (50.98%), Query Frame = 2
Query:  101 MESKNKKTIYISSLPKSVTEEDLLSIFENYGLCVSCSLDPETCT----AYVEFDNENSANNSL-SMNGVEMGTTKIEISIAYIEQEHNIKRESSLKQEASEDCKPAQIFVGNIGTKVDETILKGGFEHLGTIIEAKVIRD-ADGKHKGYGFVTFSNEYEARSAIDKMNETFFHDEKIKCSWGKNKSNLAVVASKNASKTL--EEIFNETPKSYTNVFVTG--DNVTKELLEPHFEVFGKIKNIKAFPRNNQAFIN 835
            M+    KT+Y+ +L + VTE  +L +F   G C SC +  +T       +VEF     A  +L +MNG ++    ++++ A +         SS K++ S       +FVG++  ++    +K  F   G I +A+V++D A GK KGYGF++F N+++A +AI +MN  +    +I+ +W   K        ++ +K L  EE+ +++  S   V+  G    +T +L+   F  FG+I  I+ FP    +F+ 
Sbjct:    1 MDDDQPKTLYVGNLSRDVTEALILQVFTQIGPCKSCKMIIDTAGNDPYCFVEFYEHMHAAAALGAMNGRKILGKDMKVNWASMP--------SSQKKDTSNH---FHVFVGDLSPEISTDDVKAAFAPFGKISDARVVKDLATGKSKGYGFISFINKWDAENAIQQMNGQWLGGRQIRTNWATRKPPAPKSNYESNTKHLSYEEVLSQSSPSNCTVYCGGVTSGLTDQLMRQTFSPFGQIMEIRVFPDKGYSFVR 244          

HSP 2 Score: 56.9954 bits (136), Expect = 1.295e-8
Identity = 49/190 (25.79%), Postives = 84/190 (44.21%), Query Frame = 2
Query:  386 EDCKPAQIFVGNIGTKVDETILKGGFEHLGTIIEAKVIRDADGKHKGYGFVTFSNEYEARSAIDKMNETFFHDEKIKCSWGKNKSNLAVVASKNASKTLEEIFNETPKSYTNVFVTGD---NVTKELLEPHFEVFGKI------KNIKAFPRNNQAFINYFSHESAGNAIHQMNGFVVNNIELNCSWAIK 928
            +D +P  ++VGN+   V E ++   F  +G     K+I D  G +  Y FV F     A +A+  MN      + +K +W    S+      K+ S            ++ +VFV GD    ++ + ++  F  FGKI      K++         FI++ +   A NAI QMNG  +   ++  +WA +
Sbjct:    2 DDDQPKTLYVGNLSRDVTEALILQVFTQIGPCKSCKMIIDTAG-NDPYCFVEFYEHMHAAAALGAMNGRKILGKDMKVNWASMPSS----QKKDTS------------NHFHVFV-GDLSPEISTDDVKAAFAPFGKISDARVVKDLATGKSKGYGFISFINKWDAENAIQQMNGQWLGGRQIRTNWATR 173          
BLAST of Polyadenylate-binding protein vs. Ensembl Cavefish
Match: ENSAMXT00000035946.1 (polyadenylate-binding protein 1-like [Source:NCBI gene;Acc:103030422])

HSP 1 Score: 90.1225 bits (222), Expect = 9.002e-19
Identity = 71/284 (25.00%), Postives = 126/284 (44.37%), Query Frame = 2
Query:  125 IYISSLPKSVTEEDLLSIFENYGLCVSCSL--DPETCTAY--VEFDNENSANNSL-SMNGVEMGTTKIEISIAYIEQEHNIKRESSLKQEASEDCKPAQIFVGNIGTKVDETILKGGFEHLGTIIEAKVIRDADGKHKGYGFVTFSNEYEARSAIDKMNETFFHDEKIKCSWGKNKSNLAVVASKNASKTLEEIFNETPKSY--TNVFVTG--DNVTKELLEPHFEVFGKIKNIKAFPRNNQA----FINYFSHESAGNAIHQMNGFVVNNIELNCSWAIKTEK 937
            I+I +L KS+  + L   F  +G  +SC +  D      Y  V F+   +A  ++  MNG+ +   K+ +      +E    RE+ +   A E      +++ N G  +D+  LK  F   G  +  +V+ D  GK KG+GFV+F    +A+ A+D+MN    + +++     + K            +  E++  +    Y   N++V    D +  E L   F  FG I + K      ++    F+ + S E A  A+ +MNG +V    L  + A + E+
Sbjct:  101 IFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDENGSKGYGFVHFETHEAAERAIEKMNGMLLNDRKVFVGRFKSRKE----REAEMGARAKEFTN---VYIKNFGEDMDDEKLKDVFGKYGPALSIRVMTDESGKSKGFGFVSFERHEDAQRAVDEMNGKELNGKQVYVGRAQKKGE----RQTELKRKFEQMKQDRMTRYQGVNLYVKNLDDGLDDERLRKEFSPFGTITSAKVMMEGGRSKGFGFVCFSSPEEATKAVTEMNGRIVATKPLYVALAQRKEE 373          

HSP 2 Score: 61.6178 bits (148), Expect = 1.043e-9
Identity = 46/176 (26.14%), Postives = 76/176 (43.18%), Query Frame = 2
Query:  401 AQIFVGNIGTKVDETILKGGFEHLGTIIEAKVIRDADGKHK-GYGFVTFSNEYEARSAIDKMNETFFHDEKIKCSWGK-----NKSNLAVVASKNASKTLEEIFNETPKSYTNVFVTGDNVTKELLEPHFEVFGKIKNIKAFPRNNQA----FINYFSHESAGNAIHQMNGFVVNN 898
            A ++VG++   V E +L   F   G I+  +V RD   +   GY +V F    +A  A+D MN        ++  W +      KS +  +  KN  K++                  DN   + L   F  FG I + K     N +    F+++ +HE+A  AI +MNG ++N+
Sbjct:   11 ASLYVGDLHQDVTEAMLYEKFSPAGPILSIRVCRDMMTRRSLGYAYVNFQQPADAERALDTMNFDVIKGRPVRIMWSQRDPSLRKSGVGNIFIKNLDKSI------------------DN---KALYDTFSAFGNILSCKVVCDENGSKGYGFVHFETHEAAERAIEKMNGMLLND 165          
BLAST of Polyadenylate-binding protein vs. Ensembl Sea Lamprey
Match: tia1l (cytotoxic granule-associated RNA binding protein 1, like [Source:ZFIN;Acc:ZDB-GENE-030131-2167])

HSP 1 Score: 105.145 bits (261), Expect = 6.799e-26
Identity = 65/236 (27.54%), Postives = 115/236 (48.73%), Query Frame = 2
Query:  407 IFVGNIGTKVDETILKGGFEHLGTIIEAKVIRD-ADGKHKGYGFVTFSNEYEARSAIDKMNETFFHDEKIKCSWGKNKSNLAVVASKNASKTL--EEIFNETPKSYTNVFVTG--DNVTKELLEPHFEVFGKIKNIKAFPRNNQAFINYFSHESAGNAIHQMNGFVVNNIELNCSWAIKTEKSXXXXXXXXXXXXXXXXANVGAPRKYLANQINQYNGRQQPYESYDETGYGLPQF 1099
            +FVG++  ++    L+  F   G I +A+V++D A GK KGYGFV+F  + +A +AI +M   +    +I+ +W   K      +     K L  EE+ N++  +   V+  G    +T++L+   F +FG+I  I+ FP    +FI + +HESA +AI  +NG  +    + C W  +                + + + VG  ++        Y G QQ Y+ +   G+ +PQ+
Sbjct:    5 VFVGDLSPEISTDDLRAAFAPFGKISDARVVKDLATGKSKGYGFVSFFQKLDAENAIQQMGGQWLGGRQIRTNWATRKPPAPKGSQDTDPKHLSFEEVLNQSSPTNCTVYCGGITQGLTEQLMRQTFLLFGQILEIRVFPDKGYSFIRFATHESAAHAIVSVNGSTIEGFSVKCFWGKEASDP--------VNQFQQQFSQVGYTQQPWTQWGPWYGGSQQ-YQQFINNGWQVPQY 231          
BLAST of Polyadenylate-binding protein vs. Ensembl Sea Lamprey
Match: pabpc4 (poly(A) binding protein, cytoplasmic 4 (inducible form) [Source:ZFIN;Acc:ZDB-GENE-030131-9663])

HSP 1 Score: 80.8777 bits (198), Expect = 1.494e-16
Identity = 67/288 (23.26%), Postives = 125/288 (43.40%), Query Frame = 2
Query:  125 IYISSLPKSVTEEDLLSIFENYGLCVSCSL--DPETCTAY--VEFDNENSANNSL-SMNGVEMGTTKIEISIAYIEQEHNIKRESSLKQEASEDCKPAQ----IFVGNIGTKVDETILKGGFEHLGTIIEAKVIRDADGKHKGYGFVTFSNEYEARSAIDKMNETFFHDEKIKCSWGKNKSNLAVVASKNASKTLEEIFNETPKSY--TNVFVTG--DNVTKELLEPHFEVFGKIKNIKAFPRNNQA----FINYFSHESAGNAIHQMNGFVVNNIELNCSWAIKTEK 937
            ++I +L KS+  + +   F  +G  +SC +  D      Y  V F+ + +A+ ++  MNG+ +           + +   + R  S K+   E    A+    +++ N G  +DE  L+  F   G  +   V+ D  GK +G+GFV+F    +A+ A+++MN    +   +     + K            +  E +  E    Y   N++V    DN+  E L   F  +G I + K      ++    F+ + S E A  A+ +MNG +V +  L  + A + E+
Sbjct:  101 VFIKNLDKSIDNKAMYDTFSAFGNILSCKVVCDENGSRGYGFVHFETQEAADRAIEKMNGMLLNDR--------LARRRFVGRFKSRKEREQEMGARAKEFTNVYIKNFGDDMDEDKLREFFGKFGKALSVCVMSDECGKSRGFGFVSFEQHEDAQRAVNEMNGKELNGRTVFVGRAQKKGERQA----ELKRKFEMLKQERISRYQGVNLYVKNLDDNIDDEQLRKEFAPYGTITSTKVMSEEGRSKGFGFVCFSSPEEATKAVTEMNGRIVGSKPLYVALAQRKEE 376          

HSP 2 Score: 56.9954 bits (136), Expect = 5.633e-9
Identity = 45/176 (25.57%), Postives = 76/176 (43.18%), Query Frame = 2
Query:  401 AQIFVGNIGTKVDETILKGGFEHLGTIIEAKVIRDADGKHK-GYGFVTFSNEYEARSAIDKMNETFFHDEKIKCSWGK-----NKSNLAVVASKNASKTLEEIFNETPKSYTNVFVTGDNVTKELLEPHFEVFGKIKNIKAFPRNNQA----FINYFSHESAGNAIHQMNGFVVNN 898
            A ++VG++   V E +L   F   G ++  +V RD   +   GY +V F    +A  A+D MN      + I+  W +      KS +  V  KN  K++                  DN   + +   F  FG I + K     N +    F+++ + E+A  AI +MNG ++N+
Sbjct:   11 ASLYVGDLHPDVTEAMLYEKFSPAGPVLSIRVCRDMITRRSLGYAYVNFQQPADAERALDTMNFDVIKGKPIRIMWSQRDPSLRKSGVGNVFIKNLDKSI------------------DN---KAMYDTFSAFGNILSCKVVCDENGSRGYGFVHFETQEAADRAIEKMNGMLLND 165          
BLAST of Polyadenylate-binding protein vs. Ensembl Sea Lamprey
Match: pabpc4 (poly(A) binding protein, cytoplasmic 4 (inducible form) [Source:ZFIN;Acc:ZDB-GENE-030131-9663])

HSP 1 Score: 80.4925 bits (197), Expect = 1.714e-16
Identity = 62/245 (25.31%), Postives = 113/245 (46.12%), Query Frame = 2
Query:  233 AYVEFDNENSANNSL-SMNGVEMGTTKIEISIAYIEQEHNIKRESSLKQEASEDCKPAQIFVGNIGTKVDETILKGGFE-HLGTIIEAKVIRDADGKHKGYGFVTFSNEYEARSAIDKMNETFFHDEKIKCSWGKNKSNLAVVASKNASKTLEEIFNETPKSY--TNVFVTG--DNVTKELLEPHFEVFGKIKNIKAFPRNNQA----FINYFSHESAGNAIHQMNGFVVNNIELNCSWAIKTEK 937
             +V F+ + +A+ ++  MNG+ +   K+ +      +E    RE+    +A E      +++ N G  +D+  L+  FE ++G  +  KV+ D  GK KG+GFV+F    +A+ A+D+MN    +   I     + K+           +  E +  E    Y   N++V    DN+  E L   F  FG I + K      ++    F+ + S E A  A+ +MNG ++ +  L  + A + E+
Sbjct:    1 GFVHFETQEAADKAIEKMNGMLLNDRKVFVGRFKSRKE----REAEFGAKAREFTN---VYIKNFGDDMDDERLREYFEQYVGKTLSVKVMMDEGGKSKGFGFVSFERHEDAQKAVDEMNTKELNGRAIYVGRAQKKAE----RQTELKRKFEMLKQERMSKYQGVNLYVKNLDDNINDERLWKEFSPFGTITSAKVMMEEGRSRGFGFVCFSSPEEATKAVTEMNGRIIGSKPLYVALAQRKEE 234          
BLAST of Polyadenylate-binding protein vs. Ensembl Sea Lamprey
Match: sf3b4 (splicing factor 3b, subunit 4 [Source:ZFIN;Acc:ZDB-GENE-020419-22])

HSP 1 Score: 67.3958 bits (163), Expect = 2.586e-12
Identity = 50/189 (26.46%), Postives = 86/189 (45.50%), Query Frame = 2
Query:  104 ESKNKKTIYISSLPKSVTEEDLLSIFENYGLCVSCSLDPETCT------AYVEFDNENSANNSLS-MNGVEMGTTKIEISIAYIEQEHNIKRESSLKQEASEDCKPAQIFVGNIGTKVDETILKGGFEHLGTIIEA-KVIRDAD-GKHKGYGFVTFSNEYEARSAIDKMNETFFHDEKIKCSWGKNKSN 643
            E     T+Y+  L   V+E  L  +F   G  V+  +  +  T       +VEF  E  A+ ++  MN +++    I ++ A     HN   +             A IF+GN+ T++DE +L   F   G I++  K +RD + G  KGY F+ F++   + +AI+ MN  +  +  I  S+   K +
Sbjct:    8 ERNQDATVYVGGLDDKVSEALLWELFLQAGPVVNTHMPKDRITQQHQGYGFVEFLGEEDADYAIKIMNMIKLYGKPIRVNKA---SAHNKNLDVG-----------ANIFIGNLDTEIDEKLLYDTFSAFGVILQTPKTMRDPETGNSKGYAFINFASFEASDAAIEAMNGQYLCNRPISVSYAFKKDS 182          

HSP 2 Score: 61.2326 bits (147), Expect = 1.967e-10
Identity = 54/194 (27.84%), Postives = 85/194 (43.81%), Query Frame = 2
Query:  383 SEDCKPAQIFVGNIGTKVDETILKGGFEHLGTIIEAKVIRD-ADGKHKGYGFVTFSNEYEARSAIDKMNETFFHDEKIKCSWGKNKSNLAVVASKNASKTLEEIFNETPKSYTNVFV--TGDNVTKELLEPHFEVFGKIKNIKAFPRNNQ-------AFINYFSHESAGNAIHQMNGFVVNNIELNCSWAIKTE 934
            SE  + A ++VG +  KV E +L   F   G ++   + +D    +H+GYGFV F  E +A  AI  MN    + + I+        N A   +KN                 N+F+      + ++LL   F  FG I       R+ +       AFIN+ S E++  AI  MNG  + N  ++ S+A K +
Sbjct:    7 SERNQDATVYVGGLDDKVSEALLWELFLQAGPVVNTHMPKDRITQQHQGYGFVEFLGEEDADYAIKIMNMIKLYGKPIRV-------NKASAHNKNLDVG------------ANIFIGNLDTEIDEKLLYDTFSAFGVILQTPKTMRDPETGNSKGYAFINFASFEASDAAIEAMNGQYLCNRPISVSYAFKKD 181          
BLAST of Polyadenylate-binding protein vs. Ensembl Sea Lamprey
Match: RBM39 (RNA binding motif protein 39 [Source:HGNC Symbol;Acc:HGNC:15923])

HSP 1 Score: 66.2402 bits (160), Expect = 6.124e-12
Identity = 40/168 (23.81%), Postives = 80/168 (47.62%), Query Frame = 2
Query:  104 ESKNKKTIYISSLPKSVTEEDLLSIFENYGLCVSCSLDPETCT------AYVEFDNENSANNSLSMNGVEMGTTKIEISIAYIEQEHNIKRESSLKQEASEDCKPAQIFVGNIGTKVDETILKGGFEHLGTIIEAKVIRDAD-GKHKGYGFVTFSNEYEARSAIDKMN 586
            E ++ +T++   L   +   DL   F   G      +  +  +      AY+EF   +S + ++ + G  +    I +  +  E+       ++          P +++VG++   + E +LKG FE  G I   +++ D+D G+ +GYGFVTF++   AR A++++N
Sbjct:  154 EERDARTVFCMQLAARIRPRDLEEFFSAVGKVRDVRMISDRNSRRSKGIAYIEFVEVDSVSLAIGLTGQRLLGVPIIVQASQAEKNRAAAAAAAAATMQKSTAGPMRLYVGSLHFNITEDMLKGIFEPFGKIENCQLMMDSDTGRSRGYGFVTFADAECARKALEQLN 321          
BLAST of Polyadenylate-binding protein vs. Ensembl Yeast
Match: PAB1 (Poly(A) binding protein; part of the 3'-end RNA-processing complex, mediates interactions between the 5' cap structure and the 3' mRNA poly(A) tail, involved in control of poly(A) tail length, interacts with translation factor eIF-4G; stimulates, but is not required for the deadenylation activity of the Pan2p-Pan3p poly(A)-ribonuclease complex [Source:SGD;Acc:S000000967])

HSP 1 Score: 85.8853 bits (211), Expect = 2.776e-18
Identity = 77/287 (26.83%), Postives = 121/287 (42.16%), Query Frame = 2
Query:  122 TIYISSLPKSVTEEDLLSIFENYGLCVSCSLDPETCT------AYVEFDNENSANNSLSMNGVEMGTTKIEISIAYIEQEHNIKRESSLKQEASEDCKPAQIFVGNIGTKVDETILKGGFEHLGTIIEAKVIRDADGKHKGYGFVTFSNEYEARSAIDKMNETFFHDEKIKCSWGKNKSNLAVVASKNASKTLEEIFNETPKSYTNVFVTGDN--VTKELLEPHFEVFGKI----------KNIKAFPRNNQAFINYFSHESAGNAIHQMNGFVVNNIELNCSWAIK 928
            ++Y+  L  SV+E  L  IF   G   S  +  +  T      AYV F++  +   ++     ++  T I+  +  I      +R+ SL+++ S       IF+ N+   +D   L   F   G I+ +K+  D +GK KG+GFV F  E  A+ AID +N    + ++I             VA   + K  +    ET   YTN++V   N   T E  +  F  FG I            +K F      F+NY  HE A  A+  +N   +N  +L    A K
Sbjct:   39 SLYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIE----QLNYTPIKGRLCRIMWS---QRDPSLRKKGS-----GNIFIKNLHPDIDNKALYDTFSVFGDILSSKIATDENGKSKGFGFVHFEEEGAAKEAIDALNGMLLNGQEI------------YVAPHLSRKERDSQLEETKAHYTNLYVKNINSETTDEQFQELFAKFGPIVSASLEKDADGKLKGF-----GFVNYEKHEDAVKAVEALNDSELNGEKLYVGRAQK 296          

HSP 2 Score: 72.7886 bits (177), Expect = 4.184e-14
Identity = 72/306 (23.53%), Postives = 138/306 (45.10%), Query Frame = 2
Query:   59 CE*MINLIDNEMSKMESKNKKTIYISSLPKSVTEEDLLSIFENYGLCVSCSLDPE-----TCTAYVEFDNENSANNSL-SMNGVEMGTTKIEISIAYIEQEHNIKRESSLKQEASEDCKPAQIFVGNIGTKVDETILKGGFEHLGTIIEAKVIRDADGKHKGYGFVTFSNEYEARSAIDKMNETFFHDEKIKCSWGKNKS-NLAVVASKNASKTLEEIFNETPKSYTNVFVTG--DNVTKELLEPHFEVFGKIKNIKAFPRNNQ-----AFINYFSHESAGNAIHQMNGFVVNNIELNCSWAIKTE 934
            C  M +  D  + K  S N   I+I +L   +  + L   F  +G  +S  +  +         +V F+ E +A  ++ ++NG+ +   +I ++     +E    R+S L++  +       ++V NI ++  +   +  F   G I+ A + +DADGK KG+GFV +    +A  A++ +N++  + EK+     + K+  + V+  +  +  LE++         N+FV    D+V  E LE  F  +G I + K     N       F+ + + E A  AI + N  +V    L  + A + +
Sbjct:  109 CRIMWSQRDPSLRKKGSGN---IFIKNLHPDIDNKALYDTFSVFGDILSSKIATDENGKSKGFGFVHFEEEGAAKEAIDALNGMLLNGQEIYVAPHLSRKE----RDSQLEETKAHYTN---LYVKNINSETTDEQFQELFAKFGPIVSASLEKDADGKLKGFGFVNYEKHEDAVKAVEALNDSELNGEKLYVGRAQKKNERMHVLKKQYEAYRLEKM---AKYQGVNLFVKNLDDSVDDEKLEEEFAPYGTITSAKVMRTENGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRKD 401          

HSP 3 Score: 52.373 bits (124), Expect = 1.017e-7
Identity = 51/212 (24.06%), Postives = 87/212 (41.04%), Query Frame = 2
Query:  314 EISIAYIEQEHNIKRESSLKQEA------SEDCKPAQIFVGNIGTKVDETILKGGFEHLGTIIEAKVIRDADGKHK-GYGFVTFSNEYEARSAIDKMNETFFHDEKIKCSWGKNKSNLAVVASKNASKTLEEIFNETPKSYTNVFVTG--DNVTKELLEPHFEVFGKIKNIKAFPRNNQ-----AFINYFSHESAGNAIHQMNGFVVNNIEL 907
            +I+    EQ  N+  +   KQ A      S +   A ++VG++   V E  L   F  +G++   +V RDA  K   GY +V F++    R AI+++N T       +  W +   +L                    K   N+F+     ++  + L   F VFG I + K     N       F+++    +A  AI  +NG ++N  E+
Sbjct:    3 DITDKTAEQLENLNIQDDQKQAATGSESQSVENSSASLYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIEQLNYTPIKGRLCRIMWSQRDPSL------------------RKKGSGNIFIKNLHPDIDNKALYDTFSVFGDILSSKIATDENGKSKGFGFVHFEEEGAAKEAIDALNGMLLNGQEI 196          
BLAST of Polyadenylate-binding protein vs. Ensembl Yeast
Match: PUB1 (Poly (A)+ RNA-binding protein; abundant mRNP-component protein that binds mRNA and is required for stability of many mRNAs; component of glucose deprivation induced stress granules, involved in P-body-dependent granule assembly; implicated in regulation of translation; carries Q/N-rich domain at C- terminus, identified as candidate prion; human homolog Tia1 is critical for normal synaptic plasticity; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000004961])

HSP 1 Score: 68.5514 bits (166), Expect = 6.827e-13
Identity = 44/191 (23.04%), Postives = 95/191 (49.74%), Query Frame = 2
Query:   86 NEMSKMESKNKKTIYISSLPKSVTEEDLLSIFENYGLCVSCSL-----DPETCTAYVEFDNENSANNSL-SMNGVEMGTTKIEISIAYIEQEHNIKRESSLKQEASEDCKPAQIFVGNIGTKVDETILKGGFEHLGTIIEAKVIRDAD-GKHKGYGFVTFSNEYEARSAIDKMNETFFHDEKIKCSWGKNK 637
            N ++     + + +Y+ +L K++TE+ L   F+  G   +  +     +     A+VE+   + AN +L ++NG ++    ++I+ A+  Q           Q +S+D     +FVG++   VD+  L+  F+   + +   V+ D   G  +GYGFV+F+++ +A++A+D M     +   ++ +W   +
Sbjct:   64 NAITGGRETSDRVLYVGNLDKAITEDILKQYFQVGGPIANIKIMIDKNNKNVNYAFVEYHQSHDANIALQTLNGKQIENNIVKINWAFQSQ-----------QSSSDDT--FNLFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQNAMDSMQGQDLNGRPLRINWAAKR 241          

HSP 2 Score: 55.8398 bits (133), Expect = 7.096e-9
Identity = 47/185 (25.41%), Postives = 83/185 (44.86%), Query Frame = 2
Query:  407 IFVGNIGTKVDETILKGGFEHLGTIIEAKVIRDADGKHKGYGFVTFSNEYEARSAIDKMNETFFHDEKIKCSWGKNKSNLAVVASKNASKTLEEIFNETPKSYTNVFVTGD---NVTKELLEPHFEVF-----GKIK-NIKAFPRNNQAFINYFSHESAGNAIHQMNGFVVNNIELNCSWAIKTE 934
            ++VGN+   + E ILK  F+  G I   K++ D + K+  Y FV +   ++A  A+  +N     +  +K +W          A ++   + ++ F        N+FV GD   NV  E L   F+ F     G +  +++        F+++ S + A NA+  M G  +N   L  +WA K +
Sbjct:   77 LYVGNLDKAITEDILKQYFQVGGPIANIKIMIDKNNKNVNYAFVEYHQSHDANIALQTLNGKQIENNIVKINW----------AFQSQQSSSDDTF--------NLFV-GDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQNAMDSMQGQDLNGRPLRINWAAKRD 242          
BLAST of Polyadenylate-binding protein vs. Ensembl Yeast
Match: NSR1 (Nucleolar protein that binds nuclear localization sequences; required for pre-rRNA processing and ribosome biogenesis; binds to single stranded telomeric DNA and mRNA; methylated by Hmt1p; interaction with Top1p and nucleolar localization are negatively regulated by polyphosphorylation [Source:SGD;Acc:S000003391])

HSP 1 Score: 62.7734 bits (151), Expect = 4.101e-11
Identity = 50/187 (26.74%), Postives = 87/187 (46.52%), Query Frame = 2
Query:  371 KQEASEDCKPAQIFVGNIGTKVDETILKGGFEHLGTIIEAKVI--RDADGKHKGYGFVTFSNEYEARSAIDKMNETFFHDEKIKCSWGKNKSNLAVVASKNASKTLEEIFNETPKSYTNVFVTGD---NVTKELLEPHFEVFGKIKNIK--AFPRNNQ----AFINYFSHESAGNAIHQMNGFVVNN 898
            KQ+  E  +PA IFVG +   +D+  LK  FEH+G +I A+VI  R  D + +GYG+V F N+  A  AI +M         I C    +K       + + +K     F +TP   ++    G+   N  ++ +   F   G++ +++    P   Q     ++ + + E A  A+  + G  ++N
Sbjct:  158 KQKNEETEEPATIFVGRLSWSIDDEWLKKEFEHIGGVIGARVIYERGTD-RSRGYGYVDFENKSYAEKAIQEMQGKEIDGRPINCDMSTSKP----AGNNDRAKK----FGDTPSEPSDTLFLGNLSFNADRDAIFELFAKHGEVVSVRIPTHPETEQPKGFGYVQFSNMEDAKKALDALQGEYIDN 335          

HSP 2 Score: 49.6766 bits (117), Expect = 6.920e-7
Identity = 41/182 (22.53%), Postives = 81/182 (44.51%), Query Frame = 2
Query:  104 ESKNKKTIYISSLPKSVTEEDLLSIFENYGLCVSCSLDPETCT------AYVEFDNENSANNSLS-MNGVEMGTTKIEISIAYIEQEHNIKRESSLKQEASEDCKPAQIFVGNIGTKVDETILKGGFEHLGTIIEAKVIRDADGKH-KGYGFVTFSNEYEARSAIDKMNETFFHDEKIKCSW 625
            E++   TI++  L  S+ +E L   FE+ G  +   +  E  T       YV+F+N++ A  ++  M G E+    I   ++  +   N  R        SE      +F+GN+    D   +   F   G ++  ++    + +  KG+G+V FSN  +A+ A+D +   +  +  ++  +
Sbjct:  163 ETEEPATIFVGRLSWSIDDEWLKKEFEHIGGVIGARVIYERGTDRSRGYGYVDFENKSYAEKAIQEMQGKEIDGRPINCDMSTSKPAGNNDRAKKFGDTPSEPSD--TLFLGNLSFNADRDAIFELFAKHGEVVSVRIPTHPETEQPKGFGYVQFSNMEDAKKALDALQGEYIDNRPVRLDF 342          
BLAST of Polyadenylate-binding protein vs. Ensembl Yeast
Match: HRP1 (Subunit of cleavage factor I; cleavage factor I is a five-subunit complex required for the cleavage and polyadenylation of pre-mRNA 3' ends; RRM-containing heteronuclear RNA binding protein and hnRNPA/B family member that binds to poly (A) signal sequences; required for genome stability [Source:SGD;Acc:S000005483])

HSP 1 Score: 57.3806 bits (137), Expect = 2.916e-9
Identity = 52/184 (28.26%), Postives = 86/184 (46.74%), Query Frame = 2
Query:   89 EMSKME-SKNKKTIYISSLPKSVTEEDLLSIFENYGLCVSCSL--DPETCTA----YVEFDNENSANNSLSMNGVEMGTTKIEISIAYIEQEHNIKRESSLKQEASEDCKPAQIFVGNIGTKVDETILKGGFEHLGTIIEAKVIRDAD-GKHKGYGFVTFSNEYEARSAIDKMNETFFHDEKIK 616
            E SK + SK    ++I  L    TE++L   F  YG      +  DP T  +    ++ F+  +S +        E+  T+  +    I+ +  I R+        E  K  +IFVG IG  V     +  F   GTII+A+++ D D G+ +G+GFVT    Y++  A+D++ +  F D K +
Sbjct:  148 ERSKADLSKESCKMFIGGLNWDTTEDNLREYFGKYGTVTDLKIMKDPATGRSRGFGFLSFEKPSSVD--------EVVKTQHILDGKVIDPKRAIPRD--------EQDKTGKIFVGGIGPDVRPKEFEEFFSQWGTIIDAQLMLDKDTGQSRGFGFVT----YDSADAVDRVCQNKFIDFKDR 311          
BLAST of Polyadenylate-binding protein vs. Ensembl Yeast
Match: NAM8 (RNA binding protein, component of the U1 snRNP protein; mutants are defective in meiotic recombination and in formation of viable spores, involved in the formation of DSBs through meiosis-specific splicing of REC107 pre-mRNA; Nam8p regulon embraces the meiotic pre-mRNAs of REC107, HFM1, AMA1 SPO22 and PCH2; the putative RNA binding domains RRM2 and RRM3 are required for Nam8p meiotic function [Source:SGD;Acc:S000001128])

HSP 1 Score: 52.373 bits (124), Expect = 9.067e-8
Identity = 69/286 (24.13%), Postives = 116/286 (40.56%), Query Frame = 2
Query:  233 AYVEFDNENSANNSLSMNGV---EMGTTKIEISIAYIEQEHNIKRESSLKQEASEDCKPAQIFVGNIGTKVDETILKGGF-EHLGTIIEAKVIRD-ADGKHKGYGFVTFSNEYEARSAIDKMNETFFHDEKIKCS--------------WGKNKSNL--AVVASKNASKTLEEIFNE---------------------------TPKSYTNVFVTGDN--VTKELLEPHFEVFGKIKNIKAFPRNNQAFINYFSHESAGNAIHQMNGFVVNNIELNCSWAIKTEKS 940
             +V+F +   A N+L  NG+        K++++ A     ++    +++K  +  +C    IFVG++   V E+ L   F     +   AK++ D   G  KGYGFV F+N  E + A+ +M   F +   IK                + ++ S+L    V S+  SK    + N                            T  + T VF+ G +  VT++ L  +F+ FG I  +K        F+ Y    SA  AI  M GF + N  +  SW    +++
Sbjct:  109 CFVDFPSSTHAANALLKNGMLIPNFPNKKLKLNWATSSYSNSNNSLNNVK--SGNNCS---IFVGDLAPNVTESQLFELFINRYASTSHAKIVHDQVTGMSKGYGFVKFTNSDEQQLALSEMQGVFLNGRAIKVGPTSGQQQHVSGNNDYNRSSSSLNNENVDSRFLSKGQSFLSNGNNNMGFKRNHMSQFIYPVQQQPSLNHFTDPNNTTVFIGGLSSLVTEDELRAYFQPFGTIVYVKIPVGKCCGFVQYVDRLSAEAAIAGMQGFPIANSRVRLSWGRSAKQT 389          
BLAST of Polyadenylate-binding protein vs. Ensembl Nematostella
Match: EDO33206 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SSV8])

HSP 1 Score: 83.1889 bits (204), Expect = 6.003e-17
Identity = 62/282 (21.99%), Postives = 124/282 (43.97%), Query Frame = 2
Query:  125 IYISSLPKSVTEEDLLSIFENYGLCVSCSLDPETCT-----AYVEFDNENSANNSLS-MNGVEMGTTKIEISIAYIEQEHNIKRESSLKQEASEDCKPAQIFVGNIGTKVDETILKGGFEHLGTIIEAKVIRDADGKHKGYGFVTFSNEYEARSAIDKMNETFFHDEKIKCSWGKNKSNLAVVASKNASKTLEEIFNETPKSYTNVFVTGDNVTKELLEPHFEVFGKIKNIKAFPRNNQ-----AFINYFSHESAGNAIHQMNGFVVNNIELNCSWAIKTEK 937
            I+I +L KS+  + L   F  +G  +SC +  +         +V F+ E++A  +++ ++G+ +   K+ +          + ++  +++  ++  K   ++V N G  +D+  +K      G I+  KV+ D +GK KG+GFV+F    EA  A++ +N       ++     K ++  A        K  +E  N        +    D +  E L   F  +G I + K    +        F+ + S E A  A+ +MNG ++ +  L  + A + E+
Sbjct:  103 IFIKNLDKSIDNKSLYDTFSAFGNILSCKIAQDELGNPKGYGFVHFETEDAALEAIARVDGMLLNDKKVFVG-------RWMSKKERIEKMGTQPKKFTNVYVKNFGDDMDDEQMKEICAEAGKIVSLKVMTDPEGKSKGFGFVSFETPEEAEEAVNVLNGKEIGGRRLWAGRAKKRAERAAEVKAEIEKKRQERINRFQGVNLYIKNLDDPIDDERLREEFSPYGTISSAKVMKDDKGNSKGFGFVCFSSPEEATKAVTEMNGRILISKPLYVALAQRREE 377          

HSP 2 Score: 65.855 bits (159), Expect = 1.858e-11
Identity = 48/177 (27.12%), Postives = 88/177 (49.72%), Query Frame = 2
Query:   89 EMSKMESKNKK--TIYISSLPKSVTEEDLLSIFENYGLCVSCSL--DPETCT---AYVEFDNENSANNSLS-MNGVEMGTTKIEISIAYIEQEHNIKRESSLKQEASEDCKPAQ---IFVGNIGTKVDETILKGGFEHLGTIIEAKVIRDADGKHKGYGFVTFSNEYEARSAIDKMN 586
             + KM ++ KK   +Y+ +    + +E +  I    G  VS  +  DPE  +    +V F+    A  +++ +NG E+G  ++    A    E   + ++ ++++  E     Q   +++ N+   +D+  L+  F   GTI  AKV++D  G  KG+GFV FS+  EA  A+ +MN
Sbjct:  182 RIEKMGTQPKKFTNVYVKNFGDDMDDEQMKEICAEAGKIVSLKVMTDPEGKSKGFGFVSFETPEEAEEAVNVLNGKEIGGRRLWAGRAKKRAERAAEVKAEIEKKRQERINRFQGVNLYIKNLDDPIDDERLREEFSPYGTISSAKVMKDDKGNSKGFGFVCFSSPEEATKAVTEMN 358          

HSP 3 Score: 47.7506 bits (112), Expect = 7.988e-6
Identity = 41/186 (22.04%), Postives = 81/186 (43.55%), Query Frame = 2
Query:  401 AQIFVGNIGTKVDETILKGGFEHLGTIIEAKVIRDADGKHK-GYGFVTFSNEYEARSAIDKMNETFFHDEKIKCSWGK-----NKSNLAVVASKNASKTLEEIFNETPKSYTNVFVTGDNVTKELLEPHFEVFGKIKNIKAFPRNNQAFINYFSHESAGNAIHQMNGFVVNNIELNCS-WAIKTEK 937
            A ++VG++   V E +L   F   G+++  +V RD   +   GY +V F     A  A+D MN         +  W +      KS +  +  KN  K+++       KS  + F    N+    +        ++ N K +      F+++ + ++A  AI +++G ++N+ ++    W  K E+
Sbjct:   13 ASLYVGDLAPDVTEAMLYEKFSTAGSVLSIRVCRDLVTRRSLGYAYVNFQQPGHAEKALDTMNFDPIKGRPCRIMWQQRDPSLRKSGVGNIFIKNLDKSIDN------KSLYDTFSAFGNILSCKIAQD-----ELGNPKGY-----GFVHFETEDAALEAIARVDGMLLNDKKVFVGRWMSKKER 182          
BLAST of Polyadenylate-binding protein vs. Ensembl Nematostella
Match: EDO34879 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SN30])

HSP 1 Score: 77.0258 bits (188), Expect = 1.735e-15
Identity = 49/184 (26.63%), Postives = 88/184 (47.83%), Query Frame = 2
Query:   92 MSKMESKNKKTIYISSLPKSVTEEDLLSIFENYGLCVSCSLDPETCT------AYVEFDNENSANNSLS-MNGVEMGTTKIEISIAYIEQEHNIKRESSLKQEASEDCKPAQIFVGNIGTKVDETILKGGFEHLGTIIEAKVIRDADGKHKGYGFVTFSNEYEARSAIDKMNETFFHDEKIKCS 622
            M    S  +  + I+ +P S+++ED+  IF   G   SC L  +  T      A+V +DN + AN ++  MNG  +    +++S A               + +S + K A +++  +   + E  ++  F+  G II +KV++D  G+ +G GFV F    EA++AID +N        +K +
Sbjct:    1 MENGTSDERTNLIINYVPPSMSQEDIKKIFGTVGNVTSCKLIRDRATGQSLGYAFVNYDNPDDANKAVREMNGARLQNKTLKVSFA---------------RPSSTEIKNANLYISGLPKDMKEEEVEALFKPFGKIITSKVLKDVSGEGRGTGFVRFDKRCEAQTAIDDLNNKTLPGTNVKLT 169          
BLAST of Polyadenylate-binding protein vs. Ensembl Nematostella
Match: EDO32492 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SUY1])

HSP 1 Score: 74.3294 bits (181), Expect = 3.437e-15
Identity = 66/246 (26.83%), Postives = 111/246 (45.12%), Query Frame = 2
Query:  128 YISSLPKSVTEEDLLSIFENYGLCVSC----SLDPETCTAYVEFDNENSANNS-LSMNGVEMGTTKIEISIAYIEQEHNIKRESSLKQEASEDCKPAQIFVGNIGTKVDETILKGGFEHLGTIIEAKVIRD-ADGKHKGYGFVTFSNEYEARSAIDKMNETFFHDEKIKCSWGKNKSN---LAVVASKNASKTLEEIFNETPKSYTNVFVTGD--NVTKELLEPHFEVFGKIKNIKAFPRNNQAFI 832
            Y+ +L    T+E + SIF      V C    S+  +    +VEF+    A  +   M+   +   K++++ A       +KR  +             IFVG++   VD  +L+  FE  G I E +V++D A  K KG+GFV+F    +A  AI +M+      +++K +W   K+N      V  KN     +++F+++ +  T V+V     +V    L+  F  +G I   K F     AFI
Sbjct:    1 YVGNLDPKCTQELICSIFNKIAKVVRCKMINSVSYKGPYCFVEFETHADAQEAKFRMDQRTVMDKKLKVNWA--TNHPGMKRGDTNNH--------FHIFVGDLAENVDNALLRKTFEPFGEISEVRVVKDPAKNKSKGFGFVSFVRREDAAKAIAEMDSVTIGGKQVKTNWAARKNNPTQSKYVCVKNL--LWDDVFHQSSQLNTTVYVGNLPPDVKDYELQQMFSQYGSILETKVFADKGYAFI 234          
BLAST of Polyadenylate-binding protein vs. Ensembl Nematostella
Match: EDO42417 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S1S3])

HSP 1 Score: 67.0106 bits (162), Expect = 4.236e-12
Identity = 50/187 (26.74%), Postives = 88/187 (47.06%), Query Frame = 2
Query:  104 ESKNKKTIYISSLPKSVTEEDLLSIFENYGLCVSCSLDPETCT------AYVEFDNENSANNSLS-MNGVEMGTTKIEISIAYIEQEHNIKRESSLKQEASEDCKPAQIFVGNIGTKVDETILKGGFEHLGTIIEA-KVIRDAD-GKHKGYGFVTFSNEYEARSAIDKMNETFFHDEKIKCSWGKNK 637
            E     TIY+  L + V+E  +  +F   G  V+  +  +  T       +VEF  E  A+ ++  MN +++    I ++ A     HN   +             A +F+GN+ T+VDE +L   F   G I++  K++RD+D G  KG+ F+ F++   + +AI+ MN  +  +  I  S+   K
Sbjct:    8 ERNQDATIYVGGLDEKVSEALIWELFLQSGPVVNVHMPKDRITQLHQGYGFVEFLGEEDADYAIKVMNMIKVYGKPIRVNKA---SAHNKNLDVG-----------ANLFIGNLDTEVDEKLLYDTFSAFGVILQTPKIMRDSDTGNSKGFAFINFASFDASDAAIEAMNGQYLCNRPITVSYAFKK 180          

HSP 2 Score: 57.7658 bits (138), Expect = 4.202e-9
Identity = 54/194 (27.84%), Postives = 84/194 (43.30%), Query Frame = 2
Query:  383 SEDCKPAQIFVGNIGTKVDETILKGGFEHLGTIIEAKVIRDADGK-HKGYGFVTFSNEYEARSAIDKMNETFFHDEKIKCSWGKNKSNLAVVASKNASKTLEEIFNETPKSYTNVFV--TGDNVTKELLEPHFEVFGKIKNIKAFPRNNQ-------AFINYFSHESAGNAIHQMNGFVVNNIELNCSWAIKTE 934
            +E  + A I+VG +  KV E ++   F   G ++   + +D   + H+GYGFV F  E +A  AI  MN    + + I+        N A   +KN                 N+F+      V ++LL   F  FG I       R++        AFIN+ S +++  AI  MNG  + N  +  S+A K E
Sbjct:    7 AERNQDATIYVGGLDEKVSEALIWELFLQSGPVVNVHMPKDRITQLHQGYGFVEFLGEEDADYAIKVMNMIKVYGKPIRV-------NKASAHNKNLDVG------------ANLFIGNLDTEVDEKLLYDTFSAFGVILQTPKIMRDSDTGNSKGFAFINFASFDASDAAIEAMNGQYLCNRPITVSYAFKKE 181          
BLAST of Polyadenylate-binding protein vs. Ensembl Nematostella
Match: EDO33926 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQW0])

HSP 1 Score: 66.6254 bits (161), Expect = 8.106e-12
Identity = 40/168 (23.81%), Postives = 83/168 (49.40%), Query Frame = 2
Query:  104 ESKNKKTIYISSLPKSVTEEDLLSIFENYGLCVSCSLDPETCT------AYVEFDNENSANNSLSMNGVEMGTTKIEISIAYIEQEHNIKRESSLKQEASEDCKPAQIFVGNIGTKVDETILKGGFEHLGTIIEAKVIRDAD-GKHKGYGFVTFSNEYEARSAIDKMN 586
            E K+++T++   L +++   DL   F   G      +  +  +      AY+EF ++++   ++ ++G ++    I + +   E+         LKQ       P +++VG++   + E ++K  FE  GT+   ++I D++  + KGYGFV F     A+ A+++MN
Sbjct:  114 EEKDQRTVFCMQLARNIRPRDLEEFFSKVGQVSDVRIISDRNSRRSKGIAYIEFTDKSAVPLAIGLSGQKLLGAPIMVMLTQAEKNRLAAEAERLKQP----LGPTRLYVGSLHFNITEAMVKAVFEPFGTVDSVQLIYDSETNRSKGYGFVQFREAEAAKRAMEQMN 277          
BLAST of Polyadenylate-binding protein vs. Ensembl Medaka
Match: ENSORLT00000019582.2 (nucleolysin TIA-1 [Source:NCBI gene;Acc:101158614])

HSP 1 Score: 139.043 bits (349), Expect = 2.927e-36
Identity = 84/287 (29.27%), Postives = 151/287 (52.61%), Query Frame = 2
Query:  101 MESKNKKTIYISSLPKSVTEEDLLSIFENYGLCVSCSLDPETCT----AYVEF-DNENSANNSLSMNGVEMGTTKIEISIAYIEQEHNIKRESSLKQEASEDCKPAQIFVGNIGTKVDETILKGGFEHLGTIIEAKVIRD-ADGKHKGYGFVTFSNEYEARSAIDKMNETFFHDEKIKCSWGKNKSNLAVVASKNASKTL--EEIFNETPKSYTNVFVTG--DNVTKELLEPHFEVFGKIKNIKAFPRNNQAFINYFSHESAGNAIHQMNGFVVNNIELNCSWAIKT 931
            ME    +T+Y+ +L + VTE  +L +F   G C SC +  +T       +VEF D+ ++A +  +MNG ++   +++++ A           +S K++ S       +FVG++  ++    +K  F   G I +A+V++D A GK KGYGFV+F N+++A +AI  M   +    +I+ +W   K        ++ SK L  EE+ +++  S   V+  G    +T++L+   F  FG+I  ++ FP    +F+ + SHESA +AI  +NG  ++   + C W  +T
Sbjct:    1 MEDDQPRTLYVGNLSRDVTEPLILQVFTQIGPCKSCKMIVDTAGNDPYCFVEFYDHRHAAASLAAMNGRKIMGKEVKVNWA--------TTPTSQKKDTSNHF---HVFVGDLSPEITTEDVKAAFAPFGRISDARVVKDMATGKSKGYGFVSFFNKWDAENAIQHMGGQWLGGRQIRTNWATRKPPAPKTTYESNSKHLSFEEVMSQSSPSNCTVYCGGVSSGLTEQLMRQTFSAFGQIMEVRVFPDKGYSFVRFNSHESAAHAIVSVNGTSIDGHVVKCYWGKET 276          
BLAST of Polyadenylate-binding protein vs. Ensembl Medaka
Match: ENSORLT00000003147.2 (nucleolysin TIA-1 [Source:NCBI gene;Acc:101155125])

HSP 1 Score: 133.65 bits (335), Expect = 2.808e-34
Identity = 93/343 (27.11%), Postives = 169/343 (49.27%), Query Frame = 2
Query:  101 MESKNKKTIYISSLPKSVTEEDLLSIFENYGLCVSCSLDPETCT----AYVEFDNENSANNSLS-MNGVEMGTTKIEISIAYIEQEHNIKRESSLKQEASEDCKPAQIFVGNIGTKVDETILKGGFEHLGTIIEAKVIRD-ADGKHKGYGFVTFSNEYEARSAIDKMNETFFHDEKIKCSWGKNKSNLAVVASKNASKTL--EEIFNETPKSYTNVFVTG--DNVTKELLEPHFEVFGKIKNIKAFPRNNQAFINYFSHESAGNAIHQMNGFVVNNIELNCSWAIKTEKSXXXXXXXXXXXXXXXXANVGAPRKYLANQINQYNGRQQPYESYDETGYGLPQF 1099
            M+ +  KT+Y+ +L + VTE  +L +F   G C SC +  +T       +VEF     A  +++ MNG ++   +++++ A           +S K++ S       +FVG++  ++    +K  F   G I + +V++D A GK KGYGFV+F N+++A +AI +M   +    +I+ +W   K         ++SK L  +E+ N++  S   V+  G    +T++++   F  FG+I  I+ FP    +F+ + SHE+A +AI  +NG  +    + C W  +T   ++ PI   P  ++  +     P     NQ  Q+ G  Q    Y   G+ +P +
Sbjct:    1 MDDEQPKTLYVGNLSRDVTEALILELFGQIGPCKSCKMIVDTAGHDPYCFVEFYEHRHATATIAAMNGRKILGKEVKVNWA--------TTPTSQKKDTSSHF---HVFVGDLSPEITTDDIKAAFAPFGKISDCRVVKDMATGKSKGYGFVSFFNKWDAENAIQQMGGQWLGGRQIRTNWATRKPAPKTTNESSSSKQLSFDEVVNQSSPSNCTVYCGGVTTGLTEQIMRQTFSPFGQIMEIRVFPEKGYSFVRFNSHEAAAHAIVSVNGTSIEGYVVKCYWGKETTDMVQGPIQQVPMAQQSTLGFAAQPY----NQWGQWYGNTQQIGQYVPNGWQVPSY 328          
BLAST of Polyadenylate-binding protein vs. Ensembl Medaka
Match: ENSORLT00000019586.2 (nucleolysin TIA-1 [Source:NCBI gene;Acc:101158614])

HSP 1 Score: 117.857 bits (294), Expect = 1.389e-29
Identity = 76/276 (27.54%), Postives = 141/276 (51.09%), Query Frame = 2
Query:  101 MESKNKKTIYISSLPKSVTEEDLLSIFENYGLCVSCSLDPETCT----AYVEF-DNENSANNSLSMNGVEMGTTKIEISIAYIEQEHNIKRESSLKQEASEDCKPAQIFVGNIGTKVDETILKGGFEHLGTIIEAKVIRD-ADGKHKGYGFVTFSNEYEARSAIDKMNETFFHDEKIKCSWGKNKSNLAVVASKNASKTL--EEIFNETPKSYTNVFVTG--DNVTKELLEPHFEVFGKIKNIKAFPRNNQAFINYFSHESAGNAIHQMNGFVVNN 898
            ME    +T+Y+ +L + VTE  +L +F   G C SC +  +T       +VEF D+ ++A +  +MNG ++   +++++ A           +S K++ S       +FVG++  ++    +K  F   G I +A+V++D A GK KGYGFV+F N+++A +AI  M   +    +I+ +W   K        ++ SK L  EE+ +++  S   V+  G    +T++L+   F  FG+I  ++ FP    +F++  S+         +NG ++ N
Sbjct:    1 MEDDQPRTLYVGNLSRDVTEPLILQVFTQIGPCKSCKMIVDTAGNDPYCFVEFYDHRHAAASLAAMNGRKIMGKEVKVNWA--------TTPTSQKKDTSNHF---HVFVGDLSPEITTEDVKAAFAPFGRISDARVVKDMATGKSKGYGFVSFFNKWDAENAIQHMGGQWLGGRQIRTNWATRKPPAPKTTYESNSKHLSFEEVMSQSSPSNCTVYCGGVSSGLTEQLMRQTFSAFGQIMEVRVFPDKGYSFVSAISNGGVMEPTQGLNGSMLAN 265          

HSP 2 Score: 56.6102 bits (135), Expect = 1.844e-8
Identity = 47/190 (24.74%), Postives = 84/190 (44.21%), Query Frame = 2
Query:  386 EDCKPAQIFVGNIGTKVDETILKGGFEHLGTIIEAKVIRDADGKHKGYGFVTFSNEYEARSAIDKMNETFFHDEKIKCSWGKNKSNLAVVASKNASKTLEEIFNETPKSYTNVFVTGD---NVTKELLEPHFEVFGKI------KNIKAFPRNNQAFINYFSHESAGNAIHQMNGFVVNNIELNCSWAIK 928
            ED +P  ++VGN+   V E ++   F  +G     K+I D  G    Y FV F +   A +++  MN      +++K +W    ++      K+ S            ++ +VFV GD    +T E ++  F  FG+I      K++         F+++F+   A NAI  M G  +   ++  +WA +
Sbjct:    2 EDDQPRTLYVGNLSRDVTEPLILQVFTQIGPCKSCKMIVDTAGNDP-YCFVEFYDHRHAAASLAAMNGRKIMGKEVKVNWATTPTS----QKKDTS------------NHFHVFV-GDLSPEITTEDVKAAFAPFGRISDARVVKDMATGKSKGYGFVSFFNKWDAENAIQHMGGQWLGGRQIRTNWATR 173          
BLAST of Polyadenylate-binding protein vs. Ensembl Medaka
Match: tial1 (TIA1 cytotoxic granule associated RNA binding protein like 1 [Source:NCBI gene;Acc:101155294])

HSP 1 Score: 118.242 bits (295), Expect = 7.819e-29
Identity = 78/278 (28.06%), Postives = 138/278 (49.64%), Query Frame = 2
Query:  119 KTIYISSLPKSVTEEDLLSIFENYGLCVSCSLDPETCT----AYVEF-DNENSANNSLSMNGVEMGTTKIEISIAYIEQEHNIKRESSLKQEASEDCKPAQIFVGNIGTKVDETILKGGFEHLGTIIEAKVIRD-ADGKHKGYGFVTFSNEYEARSAIDKMNETFFHDEKIKCSWGKNKSNLAVVASKNASKTL--EEIFNETPKSYTNVFVTG--DNVTKELLEPHFEVFGKIKNIKAFPRNNQAFINYFSHESAGNAIHQMNGFVVNNIELNCSWA 922
            +T+Y+ +L + VTE  +L +F   G C SC +  E  +     +VEF ++ ++A    +MNG ++   +++++ A           SS K++ S       +FVG++   +    ++  F   G I +A+V++D   GK KGYGFV+F N+ +A +AI  M   +    +I+ +W   K         + SK L  EE+  ++      V+  G    +++ L+   F  FG+I  I+ FP    +FI + SH+SA +AI  +NG  +    + C W 
Sbjct:    8 RTLYVGNLSRDVTEILILQLFTQIGPCKSCKMITEHTSNDPYCFVEFFEHRDAAAALAAMNGRKILGKEVKVNWA--------TTPSSQKKDTSNHF---HVFVGDLNPDISTEDVRAAFTPFGKISDARVVKDLTTGKSKGYGFVSFYNKLDAENAIVHMAGQWLGGRQIRTNWATRKPPAPKSLQDSVSKQLRFEEVVTQSSPQNCTVYCGGIQSELSEHLMRQTFSPFGQIMEIRVFPEKGYSFIRFSSHDSAAHAIVSVNGTSIEGHAVKCYWG 274          
BLAST of Polyadenylate-binding protein vs. Ensembl Medaka
Match: ENSORLT00000003149.2 (nucleolysin TIA-1 [Source:NCBI gene;Acc:101155125])

HSP 1 Score: 110.538 bits (275), Expect = 6.628e-27
Identity = 75/276 (27.17%), Postives = 138/276 (50.00%), Query Frame = 2
Query:  101 MESKNKKTIYISSLPKSVTEEDLLSIFENYGLCVSCSLDPETCT----AYVEFDNENSANNSLS-MNGVEMGTTKIEISIAYIEQEHNIKRESSLKQEASEDCKPAQIFVGNIGTKVDETILKGGFEHLGTIIEAKVIRD-ADGKHKGYGFVTFSNEYEARSAIDKMNETFFHDEKIKCSWGKNKSNLAVVASKNASKTL--EEIFNETPKSYTNVFVTG--DNVTKELLEPHFEVFGKIKNIKAFPRNNQAFINYFSHESAGNAIHQMNGFVVNN 898
            M+ +  KT+Y+ +L + VTE  +L +F   G C SC +  +T       +VEF     A  +++ MNG ++   +++++ A           +S K++ S       +FVG++  ++    +K  F   G I + +V++D A GK KGYGFV+F N+++A +AI +M   +    +I+ +W   K         ++SK L  +E+ N++  S   V+  G    +T++++   F  FG+I  I+ FP    +F++       G  +   NG V+ N
Sbjct:    1 MDDEQPKTLYVGNLSRDVTEALILELFGQIGPCKSCKMIVDTAGHDPYCFVEFYEHRHATATIAAMNGRKILGKEVKVNWA--------TTPTSQKKDTSSH---FHVFVGDLSPEITTDDIKAAFAPFGKISDCRVVKDMATGKSKGYGFVSFFNKWDAENAIQQMGGQWLGGRQIRTNWATRKPAPKTTNESSSSKQLSFDEVVNQSSPSNCTVYCGGVTTGLTEQIMRQTFSPFGQIMEIRVFPEKGYSFVSNGGMVEPGQGV---NGTVLTN 262          

HSP 2 Score: 60.4622 bits (145), Expect = 9.508e-10
Identity = 50/190 (26.32%), Postives = 84/190 (44.21%), Query Frame = 2
Query:  386 EDCKPAQIFVGNIGTKVDETILKGGFEHLGTIIEAKVIRDADGKHKGYGFVTFSNEYEARSAIDKMNETFFHDEKIKCSWGKNKSNLAVVASKNASKTLEEIFNETPKSYTNVFVTGD---NVTKELLEPHFEVFGKI------KNIKAFPRNNQAFINYFSHESAGNAIHQMNGFVVNNIELNCSWAIK 928
            +D +P  ++VGN+   V E ++   F  +G     K+I D  G H  Y FV F     A + I  MN      +++K +W    ++      K+ S            S+ +VFV GD    +T + ++  F  FGKI      K++         F+++F+   A NAI QM G  +   ++  +WA +
Sbjct:    2 DDEQPKTLYVGNLSRDVTEALILELFGQIGPCKSCKMIVDTAG-HDPYCFVEFYEHRHATATIAAMNGRKILGKEVKVNWATTPTS----QKKDTS------------SHFHVFV-GDLSPEITTDDIKAAFAPFGKISDCRVVKDMATGKSKGYGFVSFFNKWDAENAIQQMGGQWLGGRQIRTNWATR 173          
BLAST of Polyadenylate-binding protein vs. Planmine SMEST
Match: SMESG000044671.1 (SMESG000044671.1)

HSP 1 Score: 904.82 bits (2337), Expect = 0.000e+0
Identity = 457/460 (99.35%), Postives = 457/460 (99.35%), Query Frame = 2
Query:   68 MINLIDNEMSKMESKNKKTIYISSLPKSVTEEDLLSIFENYGLCVSCSLDPETCTAYVEFDNENSANNSLSMNGVEMGTTKIEISIAYIEQEHNIKRESSLKQEASEDCKPAQIFVGNIGTKVDETILKGGFEHLGTIIEAKVIRDADGKHKGYGFVTFSNEYEARSAIDKMNETFFHDEKIKCSWGKNKSNLAVVASKNASKTLEEIFNETPKSYTNVFVTGDNVTKELLEPHFEVFGKIKNIKAFPRNNQAFINYFSHESAGNAIHQMNGFVVNNIELNCSWAIKTEKSXXXXXXXXXXXXXXXXANVGAPRKYLANQINQYNGRQQPYESYDETGYGLPQFQQPSFTDDYTDQSFYNPVAMPTYQDDYNSYNVYPPSVPAPLIRNPPLGQPKPYLNVQPKPFGPAQPKPYGNVQSKPFNVQPLMGIPAQPKPRLNRVAQPFKKPILGNPGKYIGKNQ 1447
            MINLIDNEMSKMESKNKKTIYISSLPKSVTEEDLLSIFENYGLCVSCSLDPETCTAYVEFDNENSANNSLSMNGVEMGTTKIEISIAYIEQEHNIKRESSLKQE SEDCKPAQIFVGNIGTKVDETILKGGFEHLGTIIEAKVIRDADGKHKGYGFVTFSNEYEARSAIDKMNETFFHDEKIKCSWGKNKSNLAVVASKNASKTLEEIFNETPKSYTNVFVTGDNVTKELLEPHFEVFGKIKNIKAFPRNNQAFINYFSHESAGNAIHQMNGFVVNNIELNCSWAIKTEKSIKK ILPPPPMRKMRIANVGA RKYLANQINQYNGRQQPYESYDETGYGLPQFQQPSFTDDYTDQSFYNPVAMPTYQDDYNSYNVYPPSVPAPLIRNPPLGQPKPYLNVQPKPFGPAQPKPYGNVQSKPFNVQPLMGIPAQPKPRLNRVAQPFKKPILGNPGKYIGKNQ
Sbjct:    1 MINLIDNEMSKMESKNKKTIYISSLPKSVTEEDLLSIFENYGLCVSCSLDPETCTAYVEFDNENSANNSLSMNGVEMGTTKIEISIAYIEQEHNIKRESSLKQETSEDCKPAQIFVGNIGTKVDETILKGGFEHLGTIIEAKVIRDADGKHKGYGFVTFSNEYEARSAIDKMNETFFHDEKIKCSWGKNKSNLAVVASKNASKTLEEIFNETPKSYTNVFVTGDNVTKELLEPHFEVFGKIKNIKAFPRNNQAFINYFSHESAGNAIHQMNGFVVNNIELNCSWAIKTEKSIKKLILPPPPMRKMRIANVGATRKYLANQINQYNGRQQPYESYDETGYGLPQFQQPSFTDDYTDQSFYNPVAMPTYQDDYNSYNVYPPSVPAPLIRNPPLGQPKPYLNVQPKPFGPAQPKPYGNVQSKPFNVQPLMGIPAQPKPRLNRVAQPFKKPILGNPGKYIGKNQ 460          
BLAST of Polyadenylate-binding protein vs. Planmine SMEST
Match: SMESG000044671.1 (SMESG000044671.1)

HSP 1 Score: 888.641 bits (2295), Expect = 0.000e+0
Identity = 449/452 (99.34%), Postives = 449/452 (99.34%), Query Frame = 2
Query:   92 MSKMESKNKKTIYISSLPKSVTEEDLLSIFENYGLCVSCSLDPETCTAYVEFDNENSANNSLSMNGVEMGTTKIEISIAYIEQEHNIKRESSLKQEASEDCKPAQIFVGNIGTKVDETILKGGFEHLGTIIEAKVIRDADGKHKGYGFVTFSNEYEARSAIDKMNETFFHDEKIKCSWGKNKSNLAVVASKNASKTLEEIFNETPKSYTNVFVTGDNVTKELLEPHFEVFGKIKNIKAFPRNNQAFINYFSHESAGNAIHQMNGFVVNNIELNCSWAIKTEKSXXXXXXXXXXXXXXXXANVGAPRKYLANQINQYNGRQQPYESYDETGYGLPQFQQPSFTDDYTDQSFYNPVAMPTYQDDYNSYNVYPPSVPAPLIRNPPLGQPKPYLNVQPKPFGPAQPKPYGNVQSKPFNVQPLMGIPAQPKPRLNRVAQPFKKPILGNPGKYIGKNQ 1447
            MSKMESKNKKTIYISSLPKSVTEEDLLSIFENYGLCVSCSLDPETCTAYVEFDNENSANNSLSMNGVEMGTTKIEISIAYIEQEHNIKRESSLKQE SEDCKPAQIFVGNIGTKVDETILKGGFEHLGTIIEAKVIRDADGKHKGYGFVTFSNEYEARSAIDKMNETFFHDEKIKCSWGKNKSNLAVVASKNASKTLEEIFNETPKSYTNVFVTGDNVTKELLEPHFEVFGKIKNIKAFPRNNQAFINYFSHESAGNAIHQMNGFVVNNIELNCSWAIKTEKSIKK ILPPPPMRKMRIANVGA RKYLANQINQYNGRQQPYESYDETGYGLPQFQQPSFTDDYTDQSFYNPVAMPTYQDDYNSYNVYPPSVPAPLIRNPPLGQPKPYLNVQPKPFGPAQPKPYGNVQSKPFNVQPLMGIPAQPKPRLNRVAQPFKKPILGNPGKYIGKNQ
Sbjct:    1 MSKMESKNKKTIYISSLPKSVTEEDLLSIFENYGLCVSCSLDPETCTAYVEFDNENSANNSLSMNGVEMGTTKIEISIAYIEQEHNIKRESSLKQETSEDCKPAQIFVGNIGTKVDETILKGGFEHLGTIIEAKVIRDADGKHKGYGFVTFSNEYEARSAIDKMNETFFHDEKIKCSWGKNKSNLAVVASKNASKTLEEIFNETPKSYTNVFVTGDNVTKELLEPHFEVFGKIKNIKAFPRNNQAFINYFSHESAGNAIHQMNGFVVNNIELNCSWAIKTEKSIKKLILPPPPMRKMRIANVGATRKYLANQINQYNGRQQPYESYDETGYGLPQFQQPSFTDDYTDQSFYNPVAMPTYQDDYNSYNVYPPSVPAPLIRNPPLGQPKPYLNVQPKPFGPAQPKPYGNVQSKPFNVQPLMGIPAQPKPRLNRVAQPFKKPILGNPGKYIGKNQ 452          
BLAST of Polyadenylate-binding protein vs. Planmine SMEST
Match: SMESG000044649.1 (SMESG000044649.1)

HSP 1 Score: 312.768 bits (800), Expect = 6.954e-102
Identity = 188/456 (41.23%), Postives = 261/456 (57.24%), Query Frame = 2
Query:  101 MESKNKKTIYISSLPKSVTEEDLLSIFENYGLCVSCSLDPETCTAYVEFDNENSANNSLSMNGVEMGTTKIEISIAYIEQEHNIKRESSLKQEASEDCKPAQIFVGNIGTKVDETILKGGFEHLGTIIEAKVIRDADGKHKGYGFVTFSNEYEARSAIDKMNETFFHDEKIKCSWG-KNKSNLAV-----VASKNASKTLEEIFNETPKSYTNVFVTGDNVTKELLEPHFEVFGKIKNIKAFPRNNQAFINYFSHESAGNAIHQMNGFVVNNIELNCSWAIKTEKSXXXXXXXXXXXXXXXXANVGAPRKYLANQINQYNGRQQPYESYDETGYGLPQFQQPSFTDDYTDQSFYNPVAMPTYQDDYNSYNVYPPSVPAPLIRNPP-----LGQPKPYLNVQPKPFGPAQPK-PYGNVQSKPFNVQPLMGIPAQPKPRLNRVAQPFKKPILGNPGKY 1432
            MESKN KTIY+S+LP  ++EEDLLSIF ++G+C+SC L+ ET +AY+EFDNE SA  +L+MN   M + ++ + IAY+E+  N      +  +  +   P QIFVG IG  +DE  LK GF H G +I+AKV+R  DG+HKG+ FV+FSNE EA +AI  MN T FH+ KI+C+W  K+K+   V     +A   ++KTLEEI  E P++ T+V+V  +N+++++L P FE FGKIKNIKAFP  N AF+NY +H++A  AI Q+NG+ +N+IEL C+W  K                    A  G   K + NQ+NQY    Q   ++D       Q+ QP+F   +    FYN   M +Y   YNS   Y P  P P  +  P        P+     QP   G  QPK  YG          P   I +Q KPR+NR   P+ KP + N  ++
Sbjct:    1 MESKNNKTIYVSNLPSPISEEDLLSIFGSFGVCISCQLNLETSSAYIEFDNELSAEKALAMNDTPMDSNQMNVVIAYVEEVQN-SAPYFVASKKVDYSTPVQIFVGGIGFDIDEAKLKDGFSHCGQVIDAKVVRGPDGQHKGFAFVSFSNEDEASAAIQSMNNTMFHNRKIQCNWATKSKNGNGVPPNKKMAFGQSTKTLEEISYEAPETNTSVYVMAENLSEDILRPTFERFGKIKNIKAFPEKNHAFVNYDTHDAAAYAIQQLNGYKINSIELKCNWGKKN------------------AAAGGNMNKPMGNQMNQYYDNSQ--ANFDNYQQQYDQYCQPNF---FQVPQFYNNSQMGSY---YNSAPNY-PQYPMPYFQQQPNSNANFSNPQGNFIAQPNLLG--QPKVSYGGQLKSNLKAIPKAPISSQTKPRMNRAPHPYNKPKVNNANQF 426          
BLAST of Polyadenylate-binding protein vs. Planmine SMEST
Match: SMESG000055074.1 (SMESG000055074.1)

HSP 1 Score: 207.223 bits (526), Expect = 1.725e-62
Identity = 104/280 (37.14%), Postives = 169/280 (60.36%), Query Frame = 2
Query:  101 MESKNKKTIYISSLPKSVTEEDLLSIFENYGLCVSCSLDPE-TCT----AYVEFDNENSANNSLS-MNGVEMGTTKIEISIAYIEQEHNIKRESSLKQEASEDCKPAQIFVGNIGTKVDETILKGGFEHLGTIIEAKVIRDADGKHKGYGFVTFSNEYEARSAIDKMNETFFHDEKIKCSWGKNKSNLAVVASKNASKTLEEIFNETPKSYTNVFVTGDNVTKELLEPHFEVFGKIKNIKAFPRNNQAFINYFSHESAGNAIHQMNGFVVNNIELNCSWA 922
            M  KN +TIY+ +LP +V ++ L+ IF N+G C+SC +  + +C     A++E+ +  SA+ +LS M+G+ M   +I+++  +      I   +++     +     QIFVG+IG  VDE +LK GF   G +I+AKV+R  DG+ +G+ FV+FSN  EA  AI  M++T+FH+  IKC+W            K   +  E ++ E P + TNV+V G+N+T+ELL  HF+ FG+I ++K +P    AFIN+ +HE+A  AI Q +G+ +N+  + C+W 
Sbjct:    1 MSFKNNRTIYVGNLPDAVNDQLLIRIFGNFGQCISCHIIRDFSCQTNPYAFIEYTDHPSASLALSAMDGIYMWNNQIKVN--WSSGPSTIPGPAAVTSAKIDYSNSVQIFVGDIGLDVDEPMLKEGFSQFGQLIDAKVVRYPDGQSRGFAFVSFSNRDEAERAIQSMHKTWFHNRTIKCNWATRNGLDGEQFIKYTPRPYELVYKEAPLTNTNVYVAGENLTEELLNCHFQEFGRIDSVKVYPEKGHAFINFVTHEAAARAISQRHGYKINDNVIKCNWG 278          

HSP 2 Score: 64.3142 bits (155), Expect = 5.130e-11
Identity = 45/184 (24.46%), Postives = 87/184 (47.28%), Query Frame = 2
Query:  407 IFVGNIGTKVDETILKGGFEHLGTIIEAKVIRDADGKHKGYGFVTFSNEYEARSAIDKMNETFFHDEKIKCSWGKNKSNLAVVASKNASKTLEEIFNETPKSYTN---VFV--TGDNVTKELLEPHFEVFGKIKNIKA--FPRNNQ---AFINYFSHESAGNAIHQMNGFVVNNIELNCSWAIK 928
            I+VGN+   V++ +L   F + G  I   +IRD   +   Y F+ +++   A  A+  M+  +  + +IK +W    S +   A+  ++K            Y+N   +FV   G +V + +L+  F  FG++ + K   +P       AF+++ + + A  AI  M+    +N  + C+WA +
Sbjct:    9 IYVGNLPDAVNDQLLIRIFGNFGQCISCHIIRDFSCQTNPYAFIEYTDHPSASLALSAMDGIYMWNNQIKVNWSSGPSTIPGPAAVTSAKI----------DYSNSVQIFVGDIGLDVDEPMLKEGFSQFGQLIDAKVVRYPDGQSRGFAFVSFSNRDEAERAIQSMHKTWFHNRTIKCNWATR 182          
BLAST of Polyadenylate-binding protein vs. Planmine SMEST
Match: SMESG000055075.1 (SMESG000055075.1)

HSP 1 Score: 207.223 bits (526), Expect = 2.015e-62
Identity = 104/280 (37.14%), Postives = 169/280 (60.36%), Query Frame = 2
Query:  101 MESKNKKTIYISSLPKSVTEEDLLSIFENYGLCVSCSLDPE-TCT----AYVEFDNENSANNSLS-MNGVEMGTTKIEISIAYIEQEHNIKRESSLKQEASEDCKPAQIFVGNIGTKVDETILKGGFEHLGTIIEAKVIRDADGKHKGYGFVTFSNEYEARSAIDKMNETFFHDEKIKCSWGKNKSNLAVVASKNASKTLEEIFNETPKSYTNVFVTGDNVTKELLEPHFEVFGKIKNIKAFPRNNQAFINYFSHESAGNAIHQMNGFVVNNIELNCSWA 922
            M  KN +TIY+ +LP +V ++ L+ IF N+G C+SC +  + +C     A++E+ +  SA+ +LS M+G+ M   +I+++  +      I   +++     +     QIFVG+IG  VDE +LK GF   G +I+AKV+R  DG+ +G+ FV+FSN  EA  AI  M++T+FH+  IKC+W            K   +  E ++ E P + TNV+V G+N+T+ELL  HF+ FG+I ++K +P    AFIN+ +HE+A  AI Q +G+ +N+  + C+W 
Sbjct:    1 MSFKNNRTIYVGNLPDAVNDQLLIRIFGNFGQCISCHIIRDFSCQTNPYAFIEYTDHPSASLALSAMDGIYMWNNQIKVN--WSSGPSTIPGPAAVTSAKIDYSNSVQIFVGDIGLDVDEPMLKEGFSQFGQLIDAKVVRYPDGQSRGFAFVSFSNRDEAERAIQSMHKTWFHNRTIKCNWATRNGLDGEQFIKYTPRPYELVYKEAPLTNTNVYVAGENLTEELLNCHFQEFGRIDSVKVYPEKGHAFINFVTHEAAARAISQRHGYKINDNVIKCNWG 278          

HSP 2 Score: 63.929 bits (154), Expect = 6.307e-11
Identity = 45/184 (24.46%), Postives = 87/184 (47.28%), Query Frame = 2
Query:  407 IFVGNIGTKVDETILKGGFEHLGTIIEAKVIRDADGKHKGYGFVTFSNEYEARSAIDKMNETFFHDEKIKCSWGKNKSNLAVVASKNASKTLEEIFNETPKSYTN---VFV--TGDNVTKELLEPHFEVFGKIKNIKA--FPRNNQ---AFINYFSHESAGNAIHQMNGFVVNNIELNCSWAIK 928
            I+VGN+   V++ +L   F + G  I   +IRD   +   Y F+ +++   A  A+  M+  +  + +IK +W    S +   A+  ++K            Y+N   +FV   G +V + +L+  F  FG++ + K   +P       AF+++ + + A  AI  M+    +N  + C+WA +
Sbjct:    9 IYVGNLPDAVNDQLLIRIFGNFGQCISCHIIRDFSCQTNPYAFIEYTDHPSASLALSAMDGIYMWNNQIKVNWSSGPSTIPGPAAVTSAKI----------DYSNSVQIFVGDIGLDVDEPMLKEGFSQFGQLIDAKVVRYPDGQSRGFAFVSFSNRDEAERAIQSMHKTWFHNRTIKCNWATR 182          
The following BLAST results are available for this feature:
BLAST of Polyadenylate-binding protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TIA17.453e-3626.96TIA1 cytotoxic granule associated RNA binding prot... [more]
TIA17.463e-3626.96TIA1 cytotoxic granule associated RNA binding prot... [more]
TIA14.532e-3527.41TIA1 cytotoxic granule associated RNA binding prot... [more]
TIAL11.091e-3127.27TIA1 cytotoxic granule associated RNA binding prot... [more]
TIAL17.682e-2925.98TIA1 cytotoxic granule associated RNA binding prot... [more]
back to top
BLAST of Polyadenylate-binding protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tiar-21.966e-2927.70TIA-1/TIAL RNA binding protein homolog [Source:Un... [more]
tiar-17.406e-2928.52TIA-1/TIAL RNA binding protein homolog [Source:Un... [more]
tiar-15.085e-2425.56TIA-1/TIAL RNA binding protein homolog [Source:Un... [more]
tiar-15.410e-2430.81TIA-1/TIAL RNA binding protein homolog [Source:Un... [more]
tiar-16.482e-2430.93TIA-1/TIAL RNA binding protein homolog [Source:Un... [more]
back to top
BLAST of Polyadenylate-binding protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rox81.002e-2523.84gene:FBgn0005649 transcript:FBtr0084592[more]
Rox81.002e-2523.84gene:FBgn0005649 transcript:FBtr0084594[more]
Rox81.274e-2523.84gene:FBgn0005649 transcript:FBtr0333200[more]
Rox81.274e-2523.84gene:FBgn0005649 transcript:FBtr0333202[more]
Rox81.274e-2523.84gene:FBgn0005649 transcript:FBtr0333201[more]
back to top
BLAST of Polyadenylate-binding protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tia1l1.854e-3630.00cytotoxic granule-associated RNA binding protein 1... [more]
tia1l8.251e-3629.66cytotoxic granule-associated RNA binding protein 1... [more]
tial18.795e-3527.25TIA1 cytotoxic granule-associated RNA binding prot... [more]
tia11.806e-3328.57TIA1 cytotoxic granule-associated RNA binding prot... [more]
tial19.524e-3225.87TIA1 cytotoxic granule-associated RNA binding prot... [more]
back to top
BLAST of Polyadenylate-binding protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tia12.650e-3629.41TIA1 cytotoxic granule-associated RNA binding prot... [more]
tia18.846e-3629.62TIA1 cytotoxic granule-associated RNA binding prot... [more]
tia12.956e-3429.29TIA1 cytotoxic granule-associated RNA binding prot... [more]
tia15.000e-3429.39TIA1 cytotoxic granule-associated RNA binding prot... [more]
tia11.776e-3129.41TIA1 cytotoxic granule-associated RNA binding prot... [more]
back to top
BLAST of Polyadenylate-binding protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Tia17.176e-3525.37cytotoxic granule-associated RNA binding protein 1... [more]
Tia17.916e-3525.37cytotoxic granule-associated RNA binding protein 1... [more]
Tia14.175e-3426.29cytotoxic granule-associated RNA binding protein 1... [more]
Tia14.598e-3426.41cytotoxic granule-associated RNA binding protein 1... [more]
Tial13.455e-3126.98Tia1 cytotoxic granule-associated RNA binding prot... [more]
back to top
BLAST of Polyadenylate-binding protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P31483|TIA1_HUMAN3.579e-3526.96Nucleolysin TIA-1 isoform p40 OS=Homo sapiens OX=9... [more]
sp|P52912|TIA1_MOUSE5.537e-3425.37Nucleolysin TIA-1 OS=Mus musculus OX=10090 GN=Tia1... [more]
sp|Q01085|TIAR_HUMAN5.239e-3127.27Nucleolysin TIAR OS=Homo sapiens OX=9606 GN=TIAL1 ... [more]
sp|P70318|TIAR_MOUSE1.760e-2725.70Nucleolysin TIAR OS=Mus musculus OX=10090 GN=Tial1... [more]
sp|Q9M427|UBP1_NICPL7.595e-2125.42Oligouridylate-binding protein 1 OS=Nicotiana plum... [more]
back to top
BLAST of Polyadenylate-binding protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
D5JG761.002e-16156.05TIA1-like protein (Fragment) OS=Dugesia japonica O... [more]
D5JG753.909e-9641.09TIA1-like protein (Fragment) OS=Dugesia japonica O... [more]
A4V6J53.495e-9368.12Polyadenylate-binding protein (Fragment) OS=Dugesi... [more]
D5JG779.081e-5936.79TIA1-like protein OS=Dugesia japonica OX=6161 GN=T... [more]
D5JG781.825e-5236.40TIA1-like protein (Fragment) OS=Dugesia japonica O... [more]
back to top
BLAST of Polyadenylate-binding protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tia1l3.098e-3529.66TIA1 cytotoxic granule associated RNA binding prot... [more]
tia1l3.098e-3529.66TIA1 cytotoxic granule associated RNA binding prot... [more]
tial11.950e-3226.85TIA1 cytotoxic granule associated RNA binding prot... [more]
tia1l1.029e-2628.63TIA1 cytotoxic granule associated RNA binding prot... [more]
ENSAMXT00000035946.19.002e-1925.00polyadenylate-binding protein 1-like [Source:NCBI ... [more]
back to top
BLAST of Polyadenylate-binding protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tia1l6.799e-2627.54cytotoxic granule-associated RNA binding protein 1... [more]
pabpc41.494e-1623.26poly(A) binding protein, cytoplasmic 4 (inducible ... [more]
pabpc41.714e-1625.31poly(A) binding protein, cytoplasmic 4 (inducible ... [more]
sf3b42.586e-1226.46splicing factor 3b, subunit 4 [Source:ZFIN;Acc:ZDB... [more]
RBM396.124e-1223.81RNA binding motif protein 39 [Source:HGNC Symbol;A... [more]
back to top
BLAST of Polyadenylate-binding protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
PAB12.776e-1826.83Poly(A) binding protein; part of the 3'-end RNA-pr... [more]
PUB16.827e-1323.04Poly (A)+ RNA-binding protein; abundant mRNP-compo... [more]
NSR14.101e-1126.74Nucleolar protein that binds nuclear localization ... [more]
HRP12.916e-928.26Subunit of cleavage factor I; cleavage factor I is... [more]
NAM89.067e-824.13RNA binding protein, component of the U1 snRNP pro... [more]
back to top
BLAST of Polyadenylate-binding protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO332066.003e-1721.99Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO348791.735e-1526.63Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO324923.437e-1526.83Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO424174.236e-1226.74Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO339268.106e-1223.81Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Polyadenylate-binding protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000019582.22.927e-3629.27nucleolysin TIA-1 [Source:NCBI gene;Acc:101158614][more]
ENSORLT00000003147.22.808e-3427.11nucleolysin TIA-1 [Source:NCBI gene;Acc:101155125][more]
ENSORLT00000019586.21.389e-2927.54nucleolysin TIA-1 [Source:NCBI gene;Acc:101158614][more]
tial17.819e-2928.06TIA1 cytotoxic granule associated RNA binding prot... [more]
ENSORLT00000003149.26.628e-2727.17nucleolysin TIA-1 [Source:NCBI gene;Acc:101155125][more]
back to top
BLAST of Polyadenylate-binding protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000044671.10.000e+099.35SMESG000044671.1[more]
SMESG000044671.10.000e+099.34SMESG000044671.1[more]
SMESG000044649.16.954e-10241.23SMESG000044649.1[more]
SMESG000055074.11.725e-6237.14SMESG000055074.1[more]
SMESG000055075.12.015e-6237.14SMESG000055075.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30009858 ID=SMED30009858|Name=Polyadenylate-binding protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1509bp
CTTAATTAGACAATTTTTTAATTCATAATTTAGTTTTTACTTTGTGTCTT
GTTTGAAATGTGAATAAATGATTAATTTAATTGACAATGAAATGAGCAAA
ATGGAAAGCAAAAATAAGAAAACTATTTATATATCAAGTTTACCGAAATC
GGTAACAGAAGAAGATTTGTTAAGTATTTTTGAAAACTATGGTCTTTGTG
TTTCTTGCAGTTTGGATCCAGAAACTTGTACTGCTTATGTTGAATTTGAT
AATGAAAATTCAGCTAATAATTCTCTGTCGATGAATGGTGTTGAAATGGG
AACGACTAAAATAGAAATATCAATTGCGTACATTGAACAAGAACATAATA
TAAAACGAGAATCTAGTTTAAAGCAAGAAGCCTCCGAAGATTGCAAACCA
GCGCAAATTTTTGTTGGAAATATCGGTACGAAAGTCGATGAAACGATATT
AAAAGGCGGTTTCGAGCATTTAGGTACCATAATTGAAGCAAAAGTCATTC
GAGATGCTGACGGTAAGCACAAAGGCTACGGATTTGTCACATTTAGCAAT
GAATATGAAGCAAGAAGCGCCATTGATAAAATGAATGAAACATTTTTCCA
TGATGAGAAAATCAAATGCAGTTGGGGAAAAAACAAATCAAATCTCGCTG
TTGTCGCAAGTAAAAATGCCTCAAAAACTCTTGAAGAAATCTTCAACGAA
ACCCCGAAATCCTATACAAACGTTTTTGTCACTGGCGATAACGTGACAAA
GGAACTGCTGGAGCCGCATTTCGAAGTGTTTGGAAAAATAAAAAACATCA
AAGCGTTTCCGAGAAACAATCAGGCATTCATTAATTATTTCAGCCACGAA
TCGGCCGGCAACGCCATCCATCAAATGAATGGGTTTGTAGTGAACAATAT
CGAATTGAATTGCAGCTGGGCGATCAAAACGGAAAAATCCATTAAAAAAC
CGATTTTGCCTCCGCCACCAATGAGAAAAATGCGAATTGCAAATGTTGGC
GCCCCCAGGAAATATTTAGCTAATCAAATCAATCAATACAATGGCAGACA
GCAGCCCTACGAATCCTACGATGAGACCGGATATGGATTGCCGCAGTTTC
AACAACCGAGTTTTACCGACGATTATACTGACCAATCGTTTTATAATCCC
GTTGCTATGCCAACCTATCAGGATGATTACAACAGCTACAACGTCTATCC
TCCTTCTGTTCCTGCTCCTCTCATAAGGAATCCTCCTCTCGGCCAACCGA
AACCATATTTGAATGTCCAACCAAAACCGTTCGGACCAGCCCAACCGAAA
CCGTATGGGAACGTCCAATCGAAACCTTTCAATGTGCAACCATTAATGGG
GATTCCCGCACAACCGAAACCGAGGCTGAACCGGGTTGCCCAGCCATTTA
AAAAACCCATTTTAGGTAATCCTGGCAAATATATCGGCAAGAATCAATAA
TTTAATTAATGTATTTTAATAAATTTTCTAATAAATTTTGTTGTTGTCTT
CAAAAAAAA
back to top

protein sequence of SMED30009858-orf-1

>SMED30009858-orf-1 ID=SMED30009858-orf-1|Name=SMED30009858-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=461bp
MINLIDNEMSKMESKNKKTIYISSLPKSVTEEDLLSIFENYGLCVSCSLD
PETCTAYVEFDNENSANNSLSMNGVEMGTTKIEISIAYIEQEHNIKRESS
LKQEASEDCKPAQIFVGNIGTKVDETILKGGFEHLGTIIEAKVIRDADGK
HKGYGFVTFSNEYEARSAIDKMNETFFHDEKIKCSWGKNKSNLAVVASKN
ASKTLEEIFNETPKSYTNVFVTGDNVTKELLEPHFEVFGKIKNIKAFPRN
NQAFINYFSHESAGNAIHQMNGFVVNNIELNCSWAIKTEKSIKKPILPPP
PMRKMRIANVGAPRKYLANQINQYNGRQQPYESYDETGYGLPQFQQPSFT
DDYTDQSFYNPVAMPTYQDDYNSYNVYPPSVPAPLIRNPPLGQPKPYLNV
QPKPFGPAQPKPYGNVQSKPFNVQPLMGIPAQPKPRLNRVAQPFKKPILG
NPGKYIGKNQ*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003723RNA binding
GO:0003676nucleic acid binding
GO:0000166nucleotide binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000033epidermal progenitor cell
PLANA:0000044cephalic ganglia
PLANA:0000101muscle cell
PLANA:0000418head
PLANA:0000419prepharyngeal region
PLANA:0000420parapharyngeal region
PLANA:0000421tail
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR035979RBD_domain_sf
IPR000504RRM_dom
IPR012677Nucleotide-bd_a/b_plait_sf
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000504RNA recognition motif domainSMARTSM00360rrm1_1coord: 113..185
e-value: 2.5E-20
score: 83.5
coord: 19..85
e-value: 1.7E-12
score: 57.5
coord: 218..283
e-value: 2.3E-9
score: 47.1
IPR000504RNA recognition motif domainPFAMPF00076RRM_1coord: 225..279
e-value: 8.2E-10
score: 38.4
coord: 114..183
e-value: 1.1E-16
score: 60.4
coord: 20..82
e-value: 3.8E-11
score: 42.7
IPR000504RNA recognition motif domainPROSITEPS50102RRMcoord: 217..287
score: 10.514
IPR000504RNA recognition motif domainPROSITEPS50102RRMcoord: 112..189
score: 16.705
IPR000504RNA recognition motif domainPROSITEPS50102RRMcoord: 18..89
score: 12.936
IPR012677Nucleotide-binding alpha-beta plait domain superfamilyGENE3DG3DSA:3.30.70.330coord: 212..293
e-value: 6.6E-16
score: 60.3
IPR012677Nucleotide-binding alpha-beta plait domain superfamilyGENE3DG3DSA:3.30.70.330coord: 5..91
e-value: 5.2E-16
score: 60.6
IPR012677Nucleotide-binding alpha-beta plait domain superfamilyGENE3DG3DSA:3.30.70.330coord: 92..203
e-value: 4.0E-22
score: 80.6
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 441..460
NoneNo IPR availablePANTHERPTHR47640FAMILY NOT NAMEDcoord: 10..317
NoneNo IPR availablePANTHERPTHR47640:SF5TIA-1/TIAL RNA BINDING PROTEIN HOMOLOGcoord: 10..317
NoneNo IPR availableCDDcd00590RRM_SFcoord: 114..185
e-value: 2.02286E-19
score: 80.0417
IPR035979RNA-binding domain superfamilySUPERFAMILYSSF54928RNA-binding domain, RBDcoord: 17..187
IPR035979RNA-binding domain superfamilySUPERFAMILYSSF54928RNA-binding domain, RBDcoord: 206..287