Alanine aminotransferase 2

Overview
NameAlanine aminotransferase 2
Smed IDSMED30009857
Length (bp)1667
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Alanine aminotransferase 2 (SMED30009857) t-SNE clustered cells

Violin plots show distribution of expression levels for Alanine aminotransferase 2 (SMED30009857) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Alanine aminotransferase 2 (SMED30009857) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Alanine aminotransferase 2 (SMED30009857) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of Alanine aminotransferase 2 vs. Ensembl Human
Match: GPT2 (glutamic--pyruvic transaminase 2 [Source:HGNC Symbol;Acc:HGNC:18062])

HSP 1 Score: 546.969 bits (1408), Expect = 0.000e+0
Identity = 252/463 (54.43%), Postives = 344/463 (74.30%), Query Frame = 1
Query:  214 EYAVRGPIVIKAQELEKRLINNEKLPFDEVIKCNIGDCHAMGQKPLTFLRQVVALTVLPELINSKKFPADAKHRAKRVLESCGGNSVGSYSQSTGVEIVRKDIASFISKRDG-IACNSNDIFLSTGASEAIKVVLQMMATQSHGKDKAGIMVPIPQYPLYSATNAEYNAYQIGYYLSEENNWGINLSELERAINEASNHCIPRAIVIINPGNPTGQVLTADDIKMVIKFAYKHDLLIMADEVYQFNVYAPDRSFLSFKKALHDMGDEYKS-IQIASFMSASKGFMGECGFRGGYCELVNFPDDVQAQLYKCISARLCSSVAGQAMVEAIVNPPRPGEPSYELFEKEKAQVLSDLKLKGQLVTETLNQMPGFHCNAVQGAMYAFPRLELPASAIKEARKLKQAADFFYCSRLLEEMGVCVVPGSGFAQVPDTYHFRMTILPSVDKMKIVMDRIKHFHDGFMKQY 1596
            EYAVRGPIV+KA E+E  L    K PF EVI+ NIGD  AMGQ+P+TFLRQV+AL   P L++S  FP DAK RA+R+L++CGGNS+GSYS S GV  +R+D+A++I++RDG +  + ++I+L+TGAS+ I  +L+++ +   GK + G+M+PIPQYPLYSA  +E +A Q+ YYL EEN W +N++EL RA+ EA +HC P+ + IINPGNPTGQV +   I+ VI FA++  L ++ADEVYQ NVY+PD  F SFKK L++MG EY S +++ASF S SKG+MGECG+RGGY E++N   +++ QL K +S RLC  V+GQA ++ +VNPP  GE S+E F +EK  VL +L  K +L  +  NQ+PG HCN +QGAMYAFPR+ +PA A++ A+  + A D FYC +LLEE G+CVVPGSGF Q   TYHFRMTILP V+K+K V+ ++K FH  F+++Y
Sbjct:   61 EYAVRGPIVLKAGEIELELQRGIKKPFTEVIRANIGDAQAMGQQPITFLRQVMALCTYPNLLDSPSFPEDAKKRARRILQACGGNSLGSYSASQGVNCIREDVAAYITRRDGGVPADPDNIYLTTGASDGISTILKILVS-GGGKSRTGVMIPIPQYPLYSAVISELDAIQVNYYLDEENCWALNVNELRRAVQEAKDHCDPKVLCIINPGNPTGQVQSRKCIEDVIHFAWEEKLFLLADEVYQDNVYSPDCRFHSFKKVLYEMGPEYSSNVELASFHSTSKGYMGECGYRGGYMEVINLHPEIKGQLVKLLSVRLCPPVSGQAAMDIVVNPPVAGEESFEQFSREKESVLGNLAKKAKLTEDLFNQVPGIHCNPLQGAMYAFPRIFIPAKAVEAAQAHQMAPDMFYCMKLLEETGICVVPGSGFGQREGTYHFRMTILPPVEKLKTVLQKVKDFHINFLEKY 522          
BLAST of Alanine aminotransferase 2 vs. Ensembl Human
Match: GPT (glutamic--pyruvic transaminase [Source:HGNC Symbol;Acc:HGNC:4552])

HSP 1 Score: 517.309 bits (1331), Expect = 9.426e-180
Identity = 248/463 (53.56%), Postives = 340/463 (73.43%), Query Frame = 1
Query:  214 EYAVRGPIVIKAQELEKRLINNEKLPFDEVIKCNIGDCHAMGQKPLTFLRQVVALTVLPELINSKKFPADAKHRAKRVLESCGGNSVGSYSQSTGVEIVRKDIASFISKRDG-IACNSNDIFLSTGASEAIKVVLQMMATQSHGKDKAGIMVPIPQYPLYSATNAEYNAYQIGYYLSEENNWGINLSELERAINEASNHCIPRAIVIINPGNPTGQVLTADDIKMVIKFAYKHDLLIMADEVYQFNVYAPDRSFLSFKKALHDMGDEYKSIQ-IASFMSASKGFMGECGFRGGYCELVNFPDDVQAQLYKCISARLCSSVAGQAMVEAIVNPPRPGEPSYELFEKEKAQVLSDLKLKGQLVTETLNQMPGFHCNAVQGAMYAFPRLELPASAIKEARKLKQAADFFYCSRLLEEMGVCVVPGSGFAQVPDTYHFRMTILPSVDKMKIVMDRIKHFHDGFMKQY 1596
            EYAVRGPIV +A ELE+ L    K PF EVI+ NIGD  AMGQ+P+TFLRQV+AL V P+L++S  FP DAK RA+R+L++CGG+S+G+YS S+G++++R+D+A +I +RDG I  + N++FLSTGAS+AI  VL+++     G  + G+++PIPQYPLYSAT AE  A Q+ YYL EE  W ++++EL RA+ +A +HC PRA+ +INPGNPTGQV T + I+ VI+FA++  L ++ADEVYQ NVYA    F SFKK L +MG  Y   Q +ASF S SKG+MGECGFRGGY E+VN    VQ Q+ K +S RLC  V GQA+++ +V+PP P +PS+  F+ EK  VL++L  K +L  +  N+ PG  CN VQGAMY+FPR++LP  A++ A++L  A D F+C RLLEE G+CVVPGSGF Q   TYHFRMTILP ++K++++++++  FH  F  +Y
Sbjct:   34 EYAVRGPIVQRALELEQELRQGVKKPFTEVIRANIGDAQAMGQRPITFLRQVLALCVNPDLLSSPNFPDDAKKRAERILQACGGHSLGAYSVSSGIQLIREDVARYIERRDGGIPADPNNVFLSTGASDAIVTVLKLLVA-GEGHTRTGVLIPIPQYPLYSATLAELGAVQVDYYLDEERAWALDVAELHRALGQARDHCRPRALCVINPGNPTGQVQTRECIEAVIRFAFEERLFLLADEVYQDNVYAAGSQFHSFKKVLMEMGPPYAGQQELASFHSTSKGYMGECGFRGGYVEVVNMDAAVQQQMLKLMSVRLCPPVPGQALLDLVVSPPAPTDPSFAQFQAEKQAVLAELAAKAKLTEQVFNEAPGISCNPVQGAMYSFPRVQLPPRAVERAQELGLAPDMFFCLRLLEETGICVVPGSGFGQREGTYHFRMTILPPLEKLRLLLEKLSRFHAKFTLEY 495          
BLAST of Alanine aminotransferase 2 vs. Ensembl Human
Match: GPT (glutamic--pyruvic transaminase [Source:HGNC Symbol;Acc:HGNC:4552])

HSP 1 Score: 517.309 bits (1331), Expect = 9.426e-180
Identity = 248/463 (53.56%), Postives = 340/463 (73.43%), Query Frame = 1
Query:  214 EYAVRGPIVIKAQELEKRLINNEKLPFDEVIKCNIGDCHAMGQKPLTFLRQVVALTVLPELINSKKFPADAKHRAKRVLESCGGNSVGSYSQSTGVEIVRKDIASFISKRDG-IACNSNDIFLSTGASEAIKVVLQMMATQSHGKDKAGIMVPIPQYPLYSATNAEYNAYQIGYYLSEENNWGINLSELERAINEASNHCIPRAIVIINPGNPTGQVLTADDIKMVIKFAYKHDLLIMADEVYQFNVYAPDRSFLSFKKALHDMGDEYKSIQ-IASFMSASKGFMGECGFRGGYCELVNFPDDVQAQLYKCISARLCSSVAGQAMVEAIVNPPRPGEPSYELFEKEKAQVLSDLKLKGQLVTETLNQMPGFHCNAVQGAMYAFPRLELPASAIKEARKLKQAADFFYCSRLLEEMGVCVVPGSGFAQVPDTYHFRMTILPSVDKMKIVMDRIKHFHDGFMKQY 1596
            EYAVRGPIV +A ELE+ L    K PF EVI+ NIGD  AMGQ+P+TFLRQV+AL V P+L++S  FP DAK RA+R+L++CGG+S+G+YS S+G++++R+D+A +I +RDG I  + N++FLSTGAS+AI  VL+++     G  + G+++PIPQYPLYSAT AE  A Q+ YYL EE  W ++++EL RA+ +A +HC PRA+ +INPGNPTGQV T + I+ VI+FA++  L ++ADEVYQ NVYA    F SFKK L +MG  Y   Q +ASF S SKG+MGECGFRGGY E+VN    VQ Q+ K +S RLC  V GQA+++ +V+PP P +PS+  F+ EK  VL++L  K +L  +  N+ PG  CN VQGAMY+FPR++LP  A++ A++L  A D F+C RLLEE G+CVVPGSGF Q   TYHFRMTILP ++K++++++++  FH  F  +Y
Sbjct:   34 EYAVRGPIVQRALELEQELRQGVKKPFTEVIRANIGDAQAMGQRPITFLRQVLALCVNPDLLSSPNFPDDAKKRAERILQACGGHSLGAYSVSSGIQLIREDVARYIERRDGGIPADPNNVFLSTGASDAIVTVLKLLVA-GEGHTRTGVLIPIPQYPLYSATLAELGAVQVDYYLDEERAWALDVAELHRALGQARDHCRPRALCVINPGNPTGQVQTRECIEAVIRFAFEERLFLLADEVYQDNVYAAGSQFHSFKKVLMEMGPPYAGQQELASFHSTSKGYMGECGFRGGYVEVVNMDAAVQQQMLKLMSVRLCPPVPGQALLDLVVSPPAPTDPSFAQFQAEKQAVLAELAAKAKLTEQVFNEAPGISCNPVQGAMYSFPRVQLPPRAVERAQELGLAPDMFFCLRLLEETGICVVPGSGFGQREGTYHFRMTILPPLEKLRLLLEKLSRFHAKFTLEY 495          
BLAST of Alanine aminotransferase 2 vs. Ensembl Human
Match: GPT2 (glutamic--pyruvic transaminase 2 [Source:HGNC Symbol;Acc:HGNC:18062])

HSP 1 Score: 499.204 bits (1284), Expect = 9.308e-174
Identity = 227/423 (53.66%), Postives = 316/423 (74.70%), Query Frame = 1
Query:  334 MGQKPLTFLRQVVALTVLPELINSKKFPADAKHRAKRVLESCGGNSVGSYSQSTGVEIVRKDIASFISKRDG-IACNSNDIFLSTGASEAIKVVLQMMATQSHGKDKAGIMVPIPQYPLYSATNAEYNAYQIGYYLSEENNWGINLSELERAINEASNHCIPRAIVIINPGNPTGQVLTADDIKMVIKFAYKHDLLIMADEVYQFNVYAPDRSFLSFKKALHDMGDEYKS-IQIASFMSASKGFMGECGFRGGYCELVNFPDDVQAQLYKCISARLCSSVAGQAMVEAIVNPPRPGEPSYELFEKEKAQVLSDLKLKGQLVTETLNQMPGFHCNAVQGAMYAFPRLELPASAIKEARKLKQAADFFYCSRLLEEMGVCVVPGSGFAQVPDTYHFRMTILPSVDKMKIVMDRIKHFHDGFMKQY 1596
            MGQ+P+TFLRQV+AL   P L++S  FP DAK RA+R+L++CGGNS+GSYS S GV  +R+D+A++I++RDG +  + ++I+L+TGAS+ I  +L+++ +   GK + G+M+PIPQYPLYSA  +E +A Q+ YYL EEN W +N++EL RA+ EA +HC P+ + IINPGNPTGQV +   I+ VI FA++  L ++ADEVYQ NVY+PD  F SFKK L++MG EY S +++ASF S SKG+MGECG+RGGY E++N   +++ QL K +S RLC  V+GQA ++ +VNPP  GE S+E F +EK  VL +L  K +L  +  NQ+PG HCN +QGAMYAFPR+ +PA A++ A+  + A D FYC +LLEE G+CVVPGSGF Q   TYHFRMTILP V+K+K V+ ++K FH  F+++Y
Sbjct:    1 MGQQPITFLRQVMALCTYPNLLDSPSFPEDAKKRARRILQACGGNSLGSYSASQGVNCIREDVAAYITRRDGGVPADPDNIYLTTGASDGISTILKILVS-GGGKSRTGVMIPIPQYPLYSAVISELDAIQVNYYLDEENCWALNVNELRRAVQEAKDHCDPKVLCIINPGNPTGQVQSRKCIEDVIHFAWEEKLFLLADEVYQDNVYSPDCRFHSFKKVLYEMGPEYSSNVELASFHSTSKGYMGECGYRGGYMEVINLHPEIKGQLVKLLSVRLCPPVSGQAAMDIVVNPPVAGEESFEQFSREKESVLGNLAKKAKLTEDLFNQVPGIHCNPLQGAMYAFPRIFIPAKAVEAAQAHQMAPDMFYCMKLLEETGICVVPGSGFGQREGTYHFRMTILPPVEKLKTVLQKVKDFHINFLEKY 422          
BLAST of Alanine aminotransferase 2 vs. Ensembl Human
Match: GPT2 (glutamic--pyruvic transaminase 2 [Source:HGNC Symbol;Acc:HGNC:18062])

HSP 1 Score: 209.534 bits (532), Expect = 1.920e-64
Identity = 93/173 (53.76%), Postives = 133/173 (76.88%), Query Frame = 1
Query:  283 KLPFDEVIKCNIGDCHAMGQKPLTFLRQVVALTVLPELINSKKFPADAKHRAKRVLESCGGNSVGSYSQSTGVEIVRKDIASFISKRD-GIACNSNDIFLSTGASEAIKVVLQMMATQSHGKDKAGIMVPIPQYPLYSATNAEYNAYQIGYYLSEENNWGINLSELERAINEA 798
            K PF EVI+ NIGD  AMGQ+P+TFLRQV+AL   P L++S  FP DAK RA+R+L++CGGNS+GSYS S GV  +R+D+A++I++RD G+  + ++I+L+TGAS+ I  +L+++ +   GK + G+M+PIPQYPLYSA  +E +A Q+ YYL EEN W +N++EL RA+ EA
Sbjct:    6 KKPFTEVIRANIGDAQAMGQQPITFLRQVMALCTYPNLLDSPSFPEDAKKRARRILQACGGNSLGSYSASQGVNCIREDVAAYITRRDGGVPADPDNIYLTTGASDGISTILKILVS-GGGKSRTGVMIPIPQYPLYSAVISELDAIQVNYYLDEENCWALNVNELRRAVQEA 177          
BLAST of Alanine aminotransferase 2 vs. Ensembl Celegans
Match: C32F10.8 (pep chromosome:WBcel235:I:5822841:5825231:-1 gene:WBGene00016333.1 transcript:C32F10.8a.4 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:C32F10.8)

HSP 1 Score: 509.22 bits (1310), Expect = 5.797e-177
Identity = 247/464 (53.23%), Postives = 325/464 (70.04%), Query Frame = 1
Query:  214 EYAVRGPIVIKAQELEKRLINNEKLPFDEVIKCNIGDCHAMGQKPLTFLRQVVALTVLPELINS-KKFPADAKHRAKRVLESCGGNSVGSYSQSTGVEIVRKDIASFISKRDG-IACNSNDIFLSTGASEAIKVVLQMMATQSHGKDKAGIMVPIPQYPLYSATNAEYNAYQIGYYLSEENNWGINLSELERAINEASNHCIPRAIVIINPGNPTGQVLTADDIKMVIKFAYKHDLLIMADEVYQFNVYAPDRSFLSFKKALHDMGDEYKSIQIASFMSASKGFMGECGFRGGYCELVNFPDDVQAQLYKCISARLCSSVAGQAMVEAIVNPPRPGEPSYELFEKEKAQVLSDLKLKGQLVTETLNQMPGFHCNAVQGAMYAFPRLELPASAIKEARKLKQAADFFYCSRLLEEMGVCVVPGSGFAQVPDTYHFRMTILPSVDKMKIVMDRIKHFHDGFMKQYK 1599
            EYAVRGPIVI+A ELEK L    + PF  VIK NIGD HAMGQKP+TF+RQ++A  V PE++ + K  P+D    A   L SCGG S G+YSQSTGVEIVRK +A +I +RDG I CNS D+ LS GASE+I+ VL++    ++ K K G+M+PIPQYPLYSAT  E+   Q+GYYLSE +NW ++ +ELER+ N+       R + IINPGNPTGQ L+ ++I+ +IKFA K +L +MADEVYQ NVYA    F SFKK L +MG+ Y  +++ASF S SKG+MGECG RGGY E +N   +V     K ISA+LCS+V GQA+++A+VNPP+ G+ SY L+++EK  VL+ LK +  LV +  + + G  CN VQGAMYAFP++ +P  A+++A+ L Q  DFFY  +LLE  G+C+VPGSGF Q   TYHFR TILP  +  K ++ R   FH  F+ +YK
Sbjct:   42 EYAVRGPIVIRAVELEKELATGAQKPFPNVIKANIGDAHAMGQKPITFIRQLLACIVNPEIMKTDKSIPSDVIEHANAFLGSCGGKSAGAYSQSTGVEIVRKHVAEYIKRRDGGIPCNSEDVCLSGGASESIRNVLKLFINHNNAK-KVGVMIPIPQYPLYSATIEEFGLGQVGYYLSESSNWSMDEAELERSFNDHCKEYDIRVLCIINPGNPTGQALSRENIETIIKFAQKKNLFLMADEVYQDNVYAQGSQFHSFKKVLVEMGEPYNKMELASFHSVSKGYMGECGMRGGYVEFLNLDPEVYVLFKKMISAKLCSTVLGQAVIDAVVNPPKEGDASYALWKQEKDAVLASLKERATLVEKAYSSIDGISCNPVQGAMYAFPQITIPQRAVEKAQSLNQQPDFFYAMQLLETTGICIVPGSGFGQKDGTYHFRTTILPQPELFKDMLSRFTDFHQKFLAEYK 504          
BLAST of Alanine aminotransferase 2 vs. Ensembl Celegans
Match: C32F10.8 (pep chromosome:WBcel235:I:5822841:5826147:-1 gene:WBGene00016333.1 transcript:C32F10.8a.3 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:C32F10.8)

HSP 1 Score: 509.22 bits (1310), Expect = 5.797e-177
Identity = 247/464 (53.23%), Postives = 325/464 (70.04%), Query Frame = 1
Query:  214 EYAVRGPIVIKAQELEKRLINNEKLPFDEVIKCNIGDCHAMGQKPLTFLRQVVALTVLPELINS-KKFPADAKHRAKRVLESCGGNSVGSYSQSTGVEIVRKDIASFISKRDG-IACNSNDIFLSTGASEAIKVVLQMMATQSHGKDKAGIMVPIPQYPLYSATNAEYNAYQIGYYLSEENNWGINLSELERAINEASNHCIPRAIVIINPGNPTGQVLTADDIKMVIKFAYKHDLLIMADEVYQFNVYAPDRSFLSFKKALHDMGDEYKSIQIASFMSASKGFMGECGFRGGYCELVNFPDDVQAQLYKCISARLCSSVAGQAMVEAIVNPPRPGEPSYELFEKEKAQVLSDLKLKGQLVTETLNQMPGFHCNAVQGAMYAFPRLELPASAIKEARKLKQAADFFYCSRLLEEMGVCVVPGSGFAQVPDTYHFRMTILPSVDKMKIVMDRIKHFHDGFMKQYK 1599
            EYAVRGPIVI+A ELEK L    + PF  VIK NIGD HAMGQKP+TF+RQ++A  V PE++ + K  P+D    A   L SCGG S G+YSQSTGVEIVRK +A +I +RDG I CNS D+ LS GASE+I+ VL++    ++ K K G+M+PIPQYPLYSAT  E+   Q+GYYLSE +NW ++ +ELER+ N+       R + IINPGNPTGQ L+ ++I+ +IKFA K +L +MADEVYQ NVYA    F SFKK L +MG+ Y  +++ASF S SKG+MGECG RGGY E +N   +V     K ISA+LCS+V GQA+++A+VNPP+ G+ SY L+++EK  VL+ LK +  LV +  + + G  CN VQGAMYAFP++ +P  A+++A+ L Q  DFFY  +LLE  G+C+VPGSGF Q   TYHFR TILP  +  K ++ R   FH  F+ +YK
Sbjct:   42 EYAVRGPIVIRAVELEKELATGAQKPFPNVIKANIGDAHAMGQKPITFIRQLLACIVNPEIMKTDKSIPSDVIEHANAFLGSCGGKSAGAYSQSTGVEIVRKHVAEYIKRRDGGIPCNSEDVCLSGGASESIRNVLKLFINHNNAK-KVGVMIPIPQYPLYSATIEEFGLGQVGYYLSESSNWSMDEAELERSFNDHCKEYDIRVLCIINPGNPTGQALSRENIETIIKFAQKKNLFLMADEVYQDNVYAQGSQFHSFKKVLVEMGEPYNKMELASFHSVSKGYMGECGMRGGYVEFLNLDPEVYVLFKKMISAKLCSTVLGQAVIDAVVNPPKEGDASYALWKQEKDAVLASLKERATLVEKAYSSIDGISCNPVQGAMYAFPQITIPQRAVEKAQSLNQQPDFFYAMQLLETTGICIVPGSGFGQKDGTYHFRTTILPQPELFKDMLSRFTDFHQKFLAEYK 504          
BLAST of Alanine aminotransferase 2 vs. Ensembl Celegans
Match: C32F10.8 (pep chromosome:WBcel235:I:5822841:5825074:-1 gene:WBGene00016333.1 transcript:C32F10.8a.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:C32F10.8)

HSP 1 Score: 509.22 bits (1310), Expect = 5.797e-177
Identity = 247/464 (53.23%), Postives = 325/464 (70.04%), Query Frame = 1
Query:  214 EYAVRGPIVIKAQELEKRLINNEKLPFDEVIKCNIGDCHAMGQKPLTFLRQVVALTVLPELINS-KKFPADAKHRAKRVLESCGGNSVGSYSQSTGVEIVRKDIASFISKRDG-IACNSNDIFLSTGASEAIKVVLQMMATQSHGKDKAGIMVPIPQYPLYSATNAEYNAYQIGYYLSEENNWGINLSELERAINEASNHCIPRAIVIINPGNPTGQVLTADDIKMVIKFAYKHDLLIMADEVYQFNVYAPDRSFLSFKKALHDMGDEYKSIQIASFMSASKGFMGECGFRGGYCELVNFPDDVQAQLYKCISARLCSSVAGQAMVEAIVNPPRPGEPSYELFEKEKAQVLSDLKLKGQLVTETLNQMPGFHCNAVQGAMYAFPRLELPASAIKEARKLKQAADFFYCSRLLEEMGVCVVPGSGFAQVPDTYHFRMTILPSVDKMKIVMDRIKHFHDGFMKQYK 1599
            EYAVRGPIVI+A ELEK L    + PF  VIK NIGD HAMGQKP+TF+RQ++A  V PE++ + K  P+D    A   L SCGG S G+YSQSTGVEIVRK +A +I +RDG I CNS D+ LS GASE+I+ VL++    ++ K K G+M+PIPQYPLYSAT  E+   Q+GYYLSE +NW ++ +ELER+ N+       R + IINPGNPTGQ L+ ++I+ +IKFA K +L +MADEVYQ NVYA    F SFKK L +MG+ Y  +++ASF S SKG+MGECG RGGY E +N   +V     K ISA+LCS+V GQA+++A+VNPP+ G+ SY L+++EK  VL+ LK +  LV +  + + G  CN VQGAMYAFP++ +P  A+++A+ L Q  DFFY  +LLE  G+C+VPGSGF Q   TYHFR TILP  +  K ++ R   FH  F+ +YK
Sbjct:   42 EYAVRGPIVIRAVELEKELATGAQKPFPNVIKANIGDAHAMGQKPITFIRQLLACIVNPEIMKTDKSIPSDVIEHANAFLGSCGGKSAGAYSQSTGVEIVRKHVAEYIKRRDGGIPCNSEDVCLSGGASESIRNVLKLFINHNNAK-KVGVMIPIPQYPLYSATIEEFGLGQVGYYLSESSNWSMDEAELERSFNDHCKEYDIRVLCIINPGNPTGQALSRENIETIIKFAQKKNLFLMADEVYQDNVYAQGSQFHSFKKVLVEMGEPYNKMELASFHSVSKGYMGECGMRGGYVEFLNLDPEVYVLFKKMISAKLCSTVLGQAVIDAVVNPPKEGDASYALWKQEKDAVLASLKERATLVEKAYSSIDGISCNPVQGAMYAFPQITIPQRAVEKAQSLNQQPDFFYAMQLLETTGICIVPGSGFGQKDGTYHFRTTILPQPELFKDMLSRFTDFHQKFLAEYK 504          
BLAST of Alanine aminotransferase 2 vs. Ensembl Celegans
Match: C32F10.8 (pep chromosome:WBcel235:I:5822841:5826148:-1 gene:WBGene00016333.1 transcript:C32F10.8a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:C32F10.8)

HSP 1 Score: 509.22 bits (1310), Expect = 5.797e-177
Identity = 247/464 (53.23%), Postives = 325/464 (70.04%), Query Frame = 1
Query:  214 EYAVRGPIVIKAQELEKRLINNEKLPFDEVIKCNIGDCHAMGQKPLTFLRQVVALTVLPELINS-KKFPADAKHRAKRVLESCGGNSVGSYSQSTGVEIVRKDIASFISKRDG-IACNSNDIFLSTGASEAIKVVLQMMATQSHGKDKAGIMVPIPQYPLYSATNAEYNAYQIGYYLSEENNWGINLSELERAINEASNHCIPRAIVIINPGNPTGQVLTADDIKMVIKFAYKHDLLIMADEVYQFNVYAPDRSFLSFKKALHDMGDEYKSIQIASFMSASKGFMGECGFRGGYCELVNFPDDVQAQLYKCISARLCSSVAGQAMVEAIVNPPRPGEPSYELFEKEKAQVLSDLKLKGQLVTETLNQMPGFHCNAVQGAMYAFPRLELPASAIKEARKLKQAADFFYCSRLLEEMGVCVVPGSGFAQVPDTYHFRMTILPSVDKMKIVMDRIKHFHDGFMKQYK 1599
            EYAVRGPIVI+A ELEK L    + PF  VIK NIGD HAMGQKP+TF+RQ++A  V PE++ + K  P+D    A   L SCGG S G+YSQSTGVEIVRK +A +I +RDG I CNS D+ LS GASE+I+ VL++    ++ K K G+M+PIPQYPLYSAT  E+   Q+GYYLSE +NW ++ +ELER+ N+       R + IINPGNPTGQ L+ ++I+ +IKFA K +L +MADEVYQ NVYA    F SFKK L +MG+ Y  +++ASF S SKG+MGECG RGGY E +N   +V     K ISA+LCS+V GQA+++A+VNPP+ G+ SY L+++EK  VL+ LK +  LV +  + + G  CN VQGAMYAFP++ +P  A+++A+ L Q  DFFY  +LLE  G+C+VPGSGF Q   TYHFR TILP  +  K ++ R   FH  F+ +YK
Sbjct:   42 EYAVRGPIVIRAVELEKELATGAQKPFPNVIKANIGDAHAMGQKPITFIRQLLACIVNPEIMKTDKSIPSDVIEHANAFLGSCGGKSAGAYSQSTGVEIVRKHVAEYIKRRDGGIPCNSEDVCLSGGASESIRNVLKLFINHNNAK-KVGVMIPIPQYPLYSATIEEFGLGQVGYYLSESSNWSMDEAELERSFNDHCKEYDIRVLCIINPGNPTGQALSRENIETIIKFAQKKNLFLMADEVYQDNVYAQGSQFHSFKKVLVEMGEPYNKMELASFHSVSKGYMGECGMRGGYVEFLNLDPEVYVLFKKMISAKLCSTVLGQAVIDAVVNPPKEGDASYALWKQEKDAVLASLKERATLVEKAYSSIDGISCNPVQGAMYAFPQITIPQRAVEKAQSLNQQPDFFYAMQLLETTGICIVPGSGFGQKDGTYHFRTTILPQPELFKDMLSRFTDFHQKFLAEYK 504          
BLAST of Alanine aminotransferase 2 vs. Ensembl Celegans
Match: C32F10.8 (pep chromosome:WBcel235:I:5823081:5825231:-1 gene:WBGene00016333.1 transcript:C32F10.8b.4 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:C32F10.8)

HSP 1 Score: 343.969 bits (881), Expect = 2.293e-114
Identity = 170/304 (55.92%), Postives = 217/304 (71.38%), Query Frame = 1
Query:  214 EYAVRGPIVIKAQELEKRLINNEKLPFDEVIKCNIGDCHAMGQKPLTFLRQVVALTVLPELINS-KKFPADAKHRAKRVLESCGGNSVGSYSQSTGVEIVRKDIASFISKRDG-IACNSNDIFLSTGASEAIKVVLQMMATQSHGKDKAGIMVPIPQYPLYSATNAEYNAYQIGYYLSEENNWGINLSELERAINEASNHCIPRAIVIINPGNPTGQVLTADDIKMVIKFAYKHDLLIMADEVYQFNVYAPDRSFLSFKKALHDMGDEYKSIQIASFMSASKGFMGECGFRGGYCELVNFPDDV 1119
            EYAVRGPIVI+A ELEK L    + PF  VIK NIGD HAMGQKP+TF+RQ++A  V PE++ + K  P+D    A   L SCGG S G+YSQSTGVEIVRK +A +I +RDG I CNS D+ LS GASE+I+ VL++    ++ K K G+M+PIPQYPLYSAT  E+   Q+GYYLSE +NW ++ +ELER+ N+       R + IINPGNPTGQ L+ ++I+ +IKFA K +L +MADEVYQ NVYA    F SFKK L +MG+ Y  +++ASF S SKG+MGECG RGGY E +N   +V
Sbjct:   42 EYAVRGPIVIRAVELEKELATGAQKPFPNVIKANIGDAHAMGQKPITFIRQLLACIVNPEIMKTDKSIPSDVIEHANAFLGSCGGKSAGAYSQSTGVEIVRKHVAEYIKRRDGGIPCNSEDVCLSGGASESIRNVLKLFINHNNAK-KVGVMIPIPQYPLYSATIEEFGLGQVGYYLSESSNWSMDEAELERSFNDHCKEYDIRVLCIINPGNPTGQALSRENIETIIKFAQKKNLFLMADEVYQDNVYAQGSQFHSFKKVLVEMGEPYNKMELASFHSVSKGYMGECGMRGGYVEFLNLDPEV 344          
BLAST of Alanine aminotransferase 2 vs. Ensembl Fly
Match: CG1640 (gene:FBgn0030478 transcript:FBtr0073770)

HSP 1 Score: 534.258 bits (1375), Expect = 0.000e+0
Identity = 249/463 (53.78%), Postives = 335/463 (72.35%), Query Frame = 1
Query:  214 EYAVRGPIVIKAQELEKRLINNEKLPFDEVIKCNIGDCHAMGQKPLTFLRQVVALTVLPELINSKKFPADAKHRAKRVLESCGGNSVGSYSQSTGVEIVRKDIASFISKRD-GIACNSNDIFLSTGASEAIKVVLQMMATQSHGKDKAGIMVPIPQYPLYSATNAEYNAYQIGYYLSEENNWGINLSELERAINEASNHCIPRAIVIINPGNPTGQVLTADDIKMVIKFAYKHDLLIMADEVYQFNVYAPDRSFLSFKKALHDMGDEYKSIQIASFMSASKGFMGECGFRGGYCELVNFPDDVQAQLYKCISARLCSSVAGQAMVEAIVNPPRPGEPSYELFEKEKAQVLSDLKLKGQLVTETLNQMPGFHCNAVQGAMYAFPRLELPASAIKEARKLKQAADFFYCSRLLEEMGVCVVPGSGFAQVPDTYHFRMTILPSVDKMKIVMDRIKHFHDGFMKQYK 1599
            EYAVRGP+VI+A E+EK L    K PFD+VI+ NIGDCHAMGQ+PLTFLRQ++ALT    L++S  +P D K RA  +L  C G SVGSY+ S G+E+VR+ +A +I KRD GIA N  DI+L+ GAS  IK +L M+  +  G    G+MVPIPQYPLYSAT +EY   ++ YYL EE  W ++  EL+R+ +EA   C PRA+V+INPGNPTGQVLT ++I+ +IKFA+ + +L++ADEVYQ NVY  +  F SFKK  ++MGD Y+++++ SF+S SKG++GECG RGGY E++N    V+A L K I+A LCS+ AGQ  V A+VNPP+PGEPSY+L++KE+  +L+ LK + +LV + LN   G+  N VQGAMY FP++E+P  AI+ A+    A D FY   LLE  G+C+VPGSGF Q P T+HFR TILP  DK+K++M++ + FH  FMK+YK
Sbjct:  107 EYAVRGPLVIRAGEIEKELEKGVKKPFDQVIRANIGDCHAMGQQPLTFLRQLLALTFETRLLDSPDYPEDVKKRACAILNGCQGQSVGSYTDSAGLEVVRRQVAQYIEKRDGGIASNWQDIYLTGGASPGIKSILSMINAEV-GCKAPGVMVPIPQYPLYSATISEYGMTKVDYYLEEETGWSLDRKELQRSYDEAKKVCNPRALVVINPGNPTGQVLTRENIEEIIKFAHDNKVLVLADEVYQDNVYDKNSKFWSFKKVAYEMGDPYRNLEMVSFLSTSKGYLGECGIRGGYMEVLNLDPKVKAMLTKSITAALCSTTAGQVAVSALVNPPQPGEPSYDLYKKERDGILAALKERAELVHKALNSFEGYKVNPVQGAMYVFPQIEIPPKAIEAAKAKGMAPDVFYAFELLETSGICIVPGSGFGQKPGTWHFRSTILPQTDKLKLMMEKFRVFHAEFMKKYK 568          
BLAST of Alanine aminotransferase 2 vs. Ensembl Fly
Match: CG1640 (gene:FBgn0030478 transcript:FBtr0073773)

HSP 1 Score: 534.258 bits (1375), Expect = 0.000e+0
Identity = 249/463 (53.78%), Postives = 335/463 (72.35%), Query Frame = 1
Query:  214 EYAVRGPIVIKAQELEKRLINNEKLPFDEVIKCNIGDCHAMGQKPLTFLRQVVALTVLPELINSKKFPADAKHRAKRVLESCGGNSVGSYSQSTGVEIVRKDIASFISKRD-GIACNSNDIFLSTGASEAIKVVLQMMATQSHGKDKAGIMVPIPQYPLYSATNAEYNAYQIGYYLSEENNWGINLSELERAINEASNHCIPRAIVIINPGNPTGQVLTADDIKMVIKFAYKHDLLIMADEVYQFNVYAPDRSFLSFKKALHDMGDEYKSIQIASFMSASKGFMGECGFRGGYCELVNFPDDVQAQLYKCISARLCSSVAGQAMVEAIVNPPRPGEPSYELFEKEKAQVLSDLKLKGQLVTETLNQMPGFHCNAVQGAMYAFPRLELPASAIKEARKLKQAADFFYCSRLLEEMGVCVVPGSGFAQVPDTYHFRMTILPSVDKMKIVMDRIKHFHDGFMKQYK 1599
            EYAVRGP+VI+A E+EK L    K PFD+VI+ NIGDCHAMGQ+PLTFLRQ++ALT    L++S  +P D K RA  +L  C G SVGSY+ S G+E+VR+ +A +I KRD GIA N  DI+L+ GAS  IK +L M+  +  G    G+MVPIPQYPLYSAT +EY   ++ YYL EE  W ++  EL+R+ +EA   C PRA+V+INPGNPTGQVLT ++I+ +IKFA+ + +L++ADEVYQ NVY  +  F SFKK  ++MGD Y+++++ SF+S SKG++GECG RGGY E++N    V+A L K I+A LCS+ AGQ  V A+VNPP+PGEPSY+L++KE+  +L+ LK + +LV + LN   G+  N VQGAMY FP++E+P  AI+ A+    A D FY   LLE  G+C+VPGSGF Q P T+HFR TILP  DK+K++M++ + FH  FMK+YK
Sbjct:  107 EYAVRGPLVIRAGEIEKELEKGVKKPFDQVIRANIGDCHAMGQQPLTFLRQLLALTFETRLLDSPDYPEDVKKRACAILNGCQGQSVGSYTDSAGLEVVRRQVAQYIEKRDGGIASNWQDIYLTGGASPGIKSILSMINAEV-GCKAPGVMVPIPQYPLYSATISEYGMTKVDYYLEEETGWSLDRKELQRSYDEAKKVCNPRALVVINPGNPTGQVLTRENIEEIIKFAHDNKVLVLADEVYQDNVYDKNSKFWSFKKVAYEMGDPYRNLEMVSFLSTSKGYLGECGIRGGYMEVLNLDPKVKAMLTKSITAALCSTTAGQVAVSALVNPPQPGEPSYDLYKKERDGILAALKERAELVHKALNSFEGYKVNPVQGAMYVFPQIEIPPKAIEAAKAKGMAPDVFYAFELLETSGICIVPGSGFGQKPGTWHFRSTILPQTDKLKLMMEKFRVFHAEFMKKYK 568          
BLAST of Alanine aminotransferase 2 vs. Ensembl Fly
Match: CG1640 (gene:FBgn0030478 transcript:FBtr0073774)

HSP 1 Score: 534.258 bits (1375), Expect = 0.000e+0
Identity = 249/463 (53.78%), Postives = 335/463 (72.35%), Query Frame = 1
Query:  214 EYAVRGPIVIKAQELEKRLINNEKLPFDEVIKCNIGDCHAMGQKPLTFLRQVVALTVLPELINSKKFPADAKHRAKRVLESCGGNSVGSYSQSTGVEIVRKDIASFISKRD-GIACNSNDIFLSTGASEAIKVVLQMMATQSHGKDKAGIMVPIPQYPLYSATNAEYNAYQIGYYLSEENNWGINLSELERAINEASNHCIPRAIVIINPGNPTGQVLTADDIKMVIKFAYKHDLLIMADEVYQFNVYAPDRSFLSFKKALHDMGDEYKSIQIASFMSASKGFMGECGFRGGYCELVNFPDDVQAQLYKCISARLCSSVAGQAMVEAIVNPPRPGEPSYELFEKEKAQVLSDLKLKGQLVTETLNQMPGFHCNAVQGAMYAFPRLELPASAIKEARKLKQAADFFYCSRLLEEMGVCVVPGSGFAQVPDTYHFRMTILPSVDKMKIVMDRIKHFHDGFMKQYK 1599
            EYAVRGP+VI+A E+EK L    K PFD+VI+ NIGDCHAMGQ+PLTFLRQ++ALT    L++S  +P D K RA  +L  C G SVGSY+ S G+E+VR+ +A +I KRD GIA N  DI+L+ GAS  IK +L M+  +  G    G+MVPIPQYPLYSAT +EY   ++ YYL EE  W ++  EL+R+ +EA   C PRA+V+INPGNPTGQVLT ++I+ +IKFA+ + +L++ADEVYQ NVY  +  F SFKK  ++MGD Y+++++ SF+S SKG++GECG RGGY E++N    V+A L K I+A LCS+ AGQ  V A+VNPP+PGEPSY+L++KE+  +L+ LK + +LV + LN   G+  N VQGAMY FP++E+P  AI+ A+    A D FY   LLE  G+C+VPGSGF Q P T+HFR TILP  DK+K++M++ + FH  FMK+YK
Sbjct:  107 EYAVRGPLVIRAGEIEKELEKGVKKPFDQVIRANIGDCHAMGQQPLTFLRQLLALTFETRLLDSPDYPEDVKKRACAILNGCQGQSVGSYTDSAGLEVVRRQVAQYIEKRDGGIASNWQDIYLTGGASPGIKSILSMINAEV-GCKAPGVMVPIPQYPLYSATISEYGMTKVDYYLEEETGWSLDRKELQRSYDEAKKVCNPRALVVINPGNPTGQVLTRENIEEIIKFAHDNKVLVLADEVYQDNVYDKNSKFWSFKKVAYEMGDPYRNLEMVSFLSTSKGYLGECGIRGGYMEVLNLDPKVKAMLTKSITAALCSTTAGQVAVSALVNPPQPGEPSYDLYKKERDGILAALKERAELVHKALNSFEGYKVNPVQGAMYVFPQIEIPPKAIEAAKAKGMAPDVFYAFELLETSGICIVPGSGFGQKPGTWHFRSTILPQTDKLKLMMEKFRVFHAEFMKKYK 568          
BLAST of Alanine aminotransferase 2 vs. Ensembl Fly
Match: CG1640 (gene:FBgn0030478 transcript:FBtr0073771)

HSP 1 Score: 534.258 bits (1375), Expect = 0.000e+0
Identity = 249/463 (53.78%), Postives = 335/463 (72.35%), Query Frame = 1
Query:  214 EYAVRGPIVIKAQELEKRLINNEKLPFDEVIKCNIGDCHAMGQKPLTFLRQVVALTVLPELINSKKFPADAKHRAKRVLESCGGNSVGSYSQSTGVEIVRKDIASFISKRD-GIACNSNDIFLSTGASEAIKVVLQMMATQSHGKDKAGIMVPIPQYPLYSATNAEYNAYQIGYYLSEENNWGINLSELERAINEASNHCIPRAIVIINPGNPTGQVLTADDIKMVIKFAYKHDLLIMADEVYQFNVYAPDRSFLSFKKALHDMGDEYKSIQIASFMSASKGFMGECGFRGGYCELVNFPDDVQAQLYKCISARLCSSVAGQAMVEAIVNPPRPGEPSYELFEKEKAQVLSDLKLKGQLVTETLNQMPGFHCNAVQGAMYAFPRLELPASAIKEARKLKQAADFFYCSRLLEEMGVCVVPGSGFAQVPDTYHFRMTILPSVDKMKIVMDRIKHFHDGFMKQYK 1599
            EYAVRGP+VI+A E+EK L    K PFD+VI+ NIGDCHAMGQ+PLTFLRQ++ALT    L++S  +P D K RA  +L  C G SVGSY+ S G+E+VR+ +A +I KRD GIA N  DI+L+ GAS  IK +L M+  +  G    G+MVPIPQYPLYSAT +EY   ++ YYL EE  W ++  EL+R+ +EA   C PRA+V+INPGNPTGQVLT ++I+ +IKFA+ + +L++ADEVYQ NVY  +  F SFKK  ++MGD Y+++++ SF+S SKG++GECG RGGY E++N    V+A L K I+A LCS+ AGQ  V A+VNPP+PGEPSY+L++KE+  +L+ LK + +LV + LN   G+  N VQGAMY FP++E+P  AI+ A+    A D FY   LLE  G+C+VPGSGF Q P T+HFR TILP  DK+K++M++ + FH  FMK+YK
Sbjct:  107 EYAVRGPLVIRAGEIEKELEKGVKKPFDQVIRANIGDCHAMGQQPLTFLRQLLALTFETRLLDSPDYPEDVKKRACAILNGCQGQSVGSYTDSAGLEVVRRQVAQYIEKRDGGIASNWQDIYLTGGASPGIKSILSMINAEV-GCKAPGVMVPIPQYPLYSATISEYGMTKVDYYLEEETGWSLDRKELQRSYDEAKKVCNPRALVVINPGNPTGQVLTRENIEEIIKFAHDNKVLVLADEVYQDNVYDKNSKFWSFKKVAYEMGDPYRNLEMVSFLSTSKGYLGECGIRGGYMEVLNLDPKVKAMLTKSITAALCSTTAGQVAVSALVNPPQPGEPSYDLYKKERDGILAALKERAELVHKALNSFEGYKVNPVQGAMYVFPQIEIPPKAIEAAKAKGMAPDVFYAFELLETSGICIVPGSGFGQKPGTWHFRSTILPQTDKLKLMMEKFRVFHAEFMKKYK 568          
BLAST of Alanine aminotransferase 2 vs. Ensembl Fly
Match: CG1640 (gene:FBgn0030478 transcript:FBtr0073772)

HSP 1 Score: 534.258 bits (1375), Expect = 0.000e+0
Identity = 249/463 (53.78%), Postives = 335/463 (72.35%), Query Frame = 1
Query:  214 EYAVRGPIVIKAQELEKRLINNEKLPFDEVIKCNIGDCHAMGQKPLTFLRQVVALTVLPELINSKKFPADAKHRAKRVLESCGGNSVGSYSQSTGVEIVRKDIASFISKRD-GIACNSNDIFLSTGASEAIKVVLQMMATQSHGKDKAGIMVPIPQYPLYSATNAEYNAYQIGYYLSEENNWGINLSELERAINEASNHCIPRAIVIINPGNPTGQVLTADDIKMVIKFAYKHDLLIMADEVYQFNVYAPDRSFLSFKKALHDMGDEYKSIQIASFMSASKGFMGECGFRGGYCELVNFPDDVQAQLYKCISARLCSSVAGQAMVEAIVNPPRPGEPSYELFEKEKAQVLSDLKLKGQLVTETLNQMPGFHCNAVQGAMYAFPRLELPASAIKEARKLKQAADFFYCSRLLEEMGVCVVPGSGFAQVPDTYHFRMTILPSVDKMKIVMDRIKHFHDGFMKQYK 1599
            EYAVRGP+VI+A E+EK L    K PFD+VI+ NIGDCHAMGQ+PLTFLRQ++ALT    L++S  +P D K RA  +L  C G SVGSY+ S G+E+VR+ +A +I KRD GIA N  DI+L+ GAS  IK +L M+  +  G    G+MVPIPQYPLYSAT +EY   ++ YYL EE  W ++  EL+R+ +EA   C PRA+V+INPGNPTGQVLT ++I+ +IKFA+ + +L++ADEVYQ NVY  +  F SFKK  ++MGD Y+++++ SF+S SKG++GECG RGGY E++N    V+A L K I+A LCS+ AGQ  V A+VNPP+PGEPSY+L++KE+  +L+ LK + +LV + LN   G+  N VQGAMY FP++E+P  AI+ A+    A D FY   LLE  G+C+VPGSGF Q P T+HFR TILP  DK+K++M++ + FH  FMK+YK
Sbjct:  107 EYAVRGPLVIRAGEIEKELEKGVKKPFDQVIRANIGDCHAMGQQPLTFLRQLLALTFETRLLDSPDYPEDVKKRACAILNGCQGQSVGSYTDSAGLEVVRRQVAQYIEKRDGGIASNWQDIYLTGGASPGIKSILSMINAEV-GCKAPGVMVPIPQYPLYSATISEYGMTKVDYYLEEETGWSLDRKELQRSYDEAKKVCNPRALVVINPGNPTGQVLTRENIEEIIKFAHDNKVLVLADEVYQDNVYDKNSKFWSFKKVAYEMGDPYRNLEMVSFLSTSKGYLGECGIRGGYMEVLNLDPKVKAMLTKSITAALCSTTAGQVAVSALVNPPQPGEPSYDLYKKERDGILAALKERAELVHKALNSFEGYKVNPVQGAMYVFPQIEIPPKAIEAAKAKGMAPDVFYAFELLETSGICIVPGSGFGQKPGTWHFRSTILPQTDKLKLMMEKFRVFHAEFMKKYK 568          
BLAST of Alanine aminotransferase 2 vs. Ensembl Zebrafish
Match: gpt2 (glutamic pyruvate transaminase (alanine aminotransferase) 2 [Source:ZFIN;Acc:ZDB-GENE-030729-8])

HSP 1 Score: 552.362 bits (1422), Expect = 0.000e+0
Identity = 263/465 (56.56%), Postives = 341/465 (73.33%), Query Frame = 1
Query:  214 EYAVRGPIVIKAQELEKRLINNEKLPFDEVIKCNIGDCHAMGQKPLTFLRQVVALTVLPELINSKKFPADAKHRAKRVLESCGGNSVGSYSQSTGVEIVRKDIASFISKRD-GIACNSNDIFLSTGASEAIKVVLQMMATQSHGKD--KAGIMVPIPQYPLYSATNAEYNAYQIGYYLSEENNWGINLSELERAINEASNHCIPRAIVIINPGNPTGQVLTADDIKMVIKFAYKHDLLIMADEVYQFNVYAPDRSFLSFKKALHDMGDEY-KSIQIASFMSASKGFMGECGFRGGYCELVNFPDDVQAQLYKCISARLCSSVAGQAMVEAIVNPPRPGEPSYELFEKEKAQVLSDLKLKGQLVTETLNQMPGFHCNAVQGAMYAFPRLELPASAIKEARKLKQAADFFYCSRLLEEMGVCVVPGSGFAQVPDTYHFRMTILPSVDKMKIVMDRIKHFHDGFMKQY 1596
            EYAVRGPIVIKA E+E+ L      PF EVIK NIGD HAMGQ+P+TFLRQVVAL   PEL+ S  FP DAK RA+R+L+ CGG+S+GSYS S GVE +RKDIA++I +RD G+  N  DI+L+TGAS+ I  +L+++ +   GKD  + G+M+PIPQYPLYSA  +E +A Q+ YYL E+N W ++++EL RA   A  HC PR I IINPGNPTGQV +   I+ V+ FAY+ +L +M+DEVYQ NVYAPD  F SFKK L++MG EY  S+++ASF S SKG+ GECGFRGGY E++N   +V+AQL K +S RLC  ++GQA ++ IVNPP+P E SY+ F +EK+ VL  L  K +L  E LN +PG  CN VQGAMYAFPR+ +P  A++EA+ L    D  YC RLLEE G+CVVPGSGF Q   TYHFRMTILPS +K+K+++ +++ FH  F+K+Y
Sbjct:   80 EYAVRGPIVIKAGEIERCLEEGGTKPFSEVIKANIGDAHAMGQQPITFLRQVVALCTFPELMESPSFPEDAKWRARRILQGCGGHSLGSYSASAGVEYIRKDIAAYIEQRDEGVPSNWEDIYLTTGASDGIMTILRLLVS---GKDSSRTGVMIPIPQYPLYSAAISEMDAVQVNYYLDEDNCWALDINELHRAYQAAKQHCQPRVICIINPGNPTGQVQSKKCIEEVLHFAYEENLFVMSDEVYQDNVYAPDCQFHSFKKVLYEMGPEYYNSVELASFHSTSKGYTGECGFRGGYMEVINMDPEVKAQLVKLLSVRLCPPLSGQAAMDVIVNPPQPDEHSYQQFHQEKSSVLGALAEKAKLTEEILNAVPGIKCNPVQGAMYAFPRIFIPPKAMEEAKTLGMQPDMLYCLRLLEETGICVVPGSGFGQKDGTYHFRMTILPSKEKLKVLLGKLRDFHVSFLKEY 541          
BLAST of Alanine aminotransferase 2 vs. Ensembl Zebrafish
Match: si:ch211-217a12.1 (si:ch211-217a12.1 [Source:ZFIN;Acc:ZDB-GENE-121214-95])

HSP 1 Score: 544.273 bits (1401), Expect = 0.000e+0
Identity = 258/463 (55.72%), Postives = 339/463 (73.22%), Query Frame = 1
Query:  214 EYAVRGPIVIKAQELEKRLINNEKLPFDEVIKCNIGDCHAMGQKPLTFLRQVVALTVLPELINSKKFPADAKHRAKRVLESCGGNSVGSYSQSTGVEIVRKDIASFISKRDG-IACNSNDIFLSTGASEAIKVVLQMMATQSHGKDKAGIMVPIPQYPLYSATNAEYNAYQIGYYLSEENNWGINLSELERAINEASNHCIPRAIVIINPGNPTGQVLTADDIKMVIKFAYKHDLLIMADEVYQFNVYAPDRSFLSFKKALHDMGDEYKS-IQIASFMSASKGFMGECGFRGGYCELVNFPDDVQAQLYKCISARLCSSVAGQAMVEAIVNPPRPGEPSYELFEKEKAQVLSDLKLKGQLVTETLNQMPGFHCNAVQGAMYAFPRLELPASAIKEARKLKQAADFFYCSRLLEEMGVCVVPGSGFAQVPDTYHFRMTILPSVDKMKIVMDRIKHFHDGFMKQY 1596
            EYAVRGPIV +A +++K L    K PF EVIK NIGDCHAMGQKP+TF RQV+AL   P+L+   KFP DAK RA+R+L++CGG S+G+YS S G+E++R+D+A +I +RDG IAC+ ++I+LSTGAS+AI  +L++M +   G  + G+M+ IPQYPLYSA  AE  A QI YYL E+N W ++++EL RA+ EA  HC PRA+ IINPGNPTGQV +   I+ VI+FA   +L +M+DEVYQ NVYA    F SFKK L +MG +Y S +++ASF S SK +MGECGFRGGY E+VN   +V+ QL K +S RLC  V GQA+++ +VNPP+P EPSY+ F KE++  L+ L  K  +  + LNQ+PG  CN VQGAMY FPR+ LP  AI +A++  Q+ D FYC +LLEE G+C+VPGSGF Q   TYHFRMTILP  DK+K+V+ +IK FH  F +QY
Sbjct:   26 EYAVRGPIVQRAVQIDKELKMGIKKPFTEVIKANIGDCHAMGQKPITFFRQVLALCSYPDLLEDNKFPEDAKSRAQRILKACGGGSLGAYSTSQGIEMIRQDVARYIERRDGGIACDPDNIYLSTGASDAIVTMLKLMVS-GEGASRTGVMISIPQYPLYSAALAELGAVQINYYLDEDNCWSLDINELRRALQEAKKHCRPRALCIINPGNPTGQVQSRQCIEEVIRFAADENLFLMSDEVYQDNVYADGCKFHSFKKVLFEMGPQYSSKVELASFHSTSKCYMGECGFRGGYMEVVNLDPEVKVQLTKLVSVRLCPPVPGQALLDVVVNPPQPDEPSYDTFIKERSDTLAALAEKASMTQDILNQVPGIKCNPVQGAMYTFPRIHLPPKAILKAKENGQSPDMFYCMKLLEETGICLVPGSGFGQRDGTYHFRMTILPLKDKLKVVLAKIKDFHQIFTEQY 487          
BLAST of Alanine aminotransferase 2 vs. Ensembl Zebrafish
Match: si:ch211-217a12.1 (si:ch211-217a12.1 [Source:ZFIN;Acc:ZDB-GENE-121214-95])

HSP 1 Score: 544.273 bits (1401), Expect = 0.000e+0
Identity = 258/463 (55.72%), Postives = 339/463 (73.22%), Query Frame = 1
Query:  214 EYAVRGPIVIKAQELEKRLINNEKLPFDEVIKCNIGDCHAMGQKPLTFLRQVVALTVLPELINSKKFPADAKHRAKRVLESCGGNSVGSYSQSTGVEIVRKDIASFISKRDG-IACNSNDIFLSTGASEAIKVVLQMMATQSHGKDKAGIMVPIPQYPLYSATNAEYNAYQIGYYLSEENNWGINLSELERAINEASNHCIPRAIVIINPGNPTGQVLTADDIKMVIKFAYKHDLLIMADEVYQFNVYAPDRSFLSFKKALHDMGDEYKS-IQIASFMSASKGFMGECGFRGGYCELVNFPDDVQAQLYKCISARLCSSVAGQAMVEAIVNPPRPGEPSYELFEKEKAQVLSDLKLKGQLVTETLNQMPGFHCNAVQGAMYAFPRLELPASAIKEARKLKQAADFFYCSRLLEEMGVCVVPGSGFAQVPDTYHFRMTILPSVDKMKIVMDRIKHFHDGFMKQY 1596
            EYAVRGPIV +A +++K L    K PF EVIK NIGDCHAMGQKP+TF RQV+AL   P+L+   KFP DAK RA+R+L++CGG S+G+YS S G+E++R+D+A +I +RDG IAC+ ++I+LSTGAS+AI  +L++M +   G  + G+M+ IPQYPLYSA  AE  A QI YYL E+N W ++++EL RA+ EA  HC PRA+ IINPGNPTGQV +   I+ VI+FA   +L +M+DEVYQ NVYA    F SFKK L +MG +Y S +++ASF S SK +MGECGFRGGY E+VN   +V+ QL K +S RLC  V GQA+++ +VNPP+P EPSY+ F KE++  L+ L  K  +  + LNQ+PG  CN VQGAMY FPR+ LP  AI +A++  Q+ D FYC +LLEE G+C+VPGSGF Q   TYHFRMTILP  DK+K+V+ +IK FH  F +QY
Sbjct:   26 EYAVRGPIVQRAVQIDKELKMGIKKPFTEVIKANIGDCHAMGQKPITFFRQVLALCSYPDLLEDNKFPEDAKSRAQRILKACGGGSLGAYSTSQGIEMIRQDVARYIERRDGGIACDPDNIYLSTGASDAIVTMLKLMVS-GEGASRTGVMISIPQYPLYSAALAELGAVQINYYLDEDNCWSLDINELRRALQEAKKHCRPRALCIINPGNPTGQVQSRQCIEEVIRFAADENLFLMSDEVYQDNVYADGCKFHSFKKVLFEMGPQYSSKVELASFHSTSKCYMGECGFRGGYMEVVNLDPEVKVQLTKLVSVRLCPPVPGQALLDVVVNPPQPDEPSYDTFIKERSDTLAALAEKASMTQDILNQVPGIKCNPVQGAMYTFPRIHLPPKAILKAKENGQSPDMFYCMKLLEETGICLVPGSGFGQRDGTYHFRMTILPLKDKLKVVLAKIKDFHQIFTEQY 487          
BLAST of Alanine aminotransferase 2 vs. Ensembl Zebrafish
Match: gpt2l (glutamic pyruvate transaminase (alanine aminotransferase) 2, like [Source:NCBI gene;Acc:403086])

HSP 1 Score: 533.872 bits (1374), Expect = 0.000e+0
Identity = 256/463 (55.29%), Postives = 341/463 (73.65%), Query Frame = 1
Query:  214 EYAVRGPIVIKAQELEKRLINNEKLPFDEVIKCNIGDCHAMGQKPLTFLRQVVALTVLPELINSKKFPADAKHRAKRVLESCGGNSVGSYSQSTGVEIVRKDIASFISKRDG-IACNSNDIFLSTGASEAIKVVLQMMATQSHGKDKAGIMVPIPQYPLYSATNAEYNAYQIGYYLSEENNWGINLSELERAINEASNHCIPRAIVIINPGNPTGQVLTADDIKMVIKFAYKHDLLIMADEVYQFNVYAPDRSFLSFKKALHDMGDEY-KSIQIASFMSASKGFMGECGFRGGYCELVNFPDDVQAQLYKCISARLCSSVAGQAMVEAIVNPPRPGEPSYELFEKEKAQVLSDLKLKGQLVTETLNQMPGFHCNAVQGAMYAFPRLELPASAIKEARKLKQAADFFYCSRLLEEMGVCVVPGSGFAQVPDTYHFRMTILPSVDKMKIVMDRIKHFHDGFMKQY 1596
            +YAVRGPIV +A ++EK L    K PFDEVIK NIGD HAMGQ+P+TF RQV+AL   P+L++  KFP DAK+RA+R+L+SCGGNS+G+Y+ S G++ VR+D+A +I +RDG I  + ++I+L+TGAS+ I  +L+++ T   G  + G+M+ IPQYPLYSA+ AE  A QI YYL+EE  W +++SEL+R++  A  HC PR + IINPGNPTGQV +   I+ VI+FA K +L +MADEVYQ NVYA    F SFKK L +MG EY K +++ASF S SK +MGECGFRGGY E++N   DV+AQL K +S RLC    GQA+++ +VNPP+PGEPS++ F +E+  VLS L  K +L  + LN +PG  CN VQGAMY+FPR+ LP  AI EA+   QA D FYC +LLEE G+C+VPGSGF Q   TYHFRMTILP  DK+K++++++K FH  F +QY
Sbjct:  100 DYAVRGPIVQRAVQIEKELKEGVKKPFDEVIKANIGDAHAMGQRPITFFRQVMALCTYPQLLDDNKFPEDAKNRARRILQSCGGNSIGAYTTSQGIDCVRQDVAKYIERRDGGIPSDPDNIYLTTGASDGIVTILKLL-TAGEGLTRTGVMISIPQYPLYSASIAELGAVQINYYLNEEKCWSLDISELQRSLQAARKHCNPRVLCIINPGNPTGQVQSRQCIEDVIQFAAKENLFLMADEVYQDNVYAKGCEFHSFKKVLFEMGPEYSKKVELASFHSTSKCYMGECGFRGGYMEVINMDADVKAQLTKLVSVRLCPPAPGQALMDLVVNPPQPGEPSHQTFMQERTAVLSALAEKAKLTEQILNTVPGISCNPVQGAMYSFPRITLPERAISEAKAKGQAPDMFYCMKLLEETGICLVPGSGFGQREGTYHFRMTILPPTDKLKLMLNKLKDFHQRFTQQY 561          
BLAST of Alanine aminotransferase 2 vs. Ensembl Zebrafish
Match: gpt2l (glutamic pyruvate transaminase (alanine aminotransferase) 2, like [Source:NCBI gene;Acc:403086])

HSP 1 Score: 147.517 bits (371), Expect = 6.388e-41
Identity = 64/107 (59.81%), Postives = 86/107 (80.37%), Query Frame = 1
Query:  214 EYAVRGPIVIKAQELEKRLINNEKLPFDEVIKCNIGDCHAMGQKPLTFLRQVVALTVLPELINSKKFPADAKHRAKRVLESCGGNSVGSYSQSTGVEIVRKDIASFI 534
            +YAVRGPIV +A ++EK L    K PFDEVIK NIGD HAMGQ+P+TF RQV+AL   P+L++  KFP DAK+RA+R+L+SCGGNS+G+Y+ S G++ VR+D+A +I
Sbjct:   87 DYAVRGPIVQRAVQIEKELKEGVKKPFDEVIKANIGDAHAMGQRPITFFRQVMALCTYPQLLDDNKFPEDAKNRARRILQSCGGNSIGAYTTSQGIDCVRQDVAKYI 193          
BLAST of Alanine aminotransferase 2 vs. Ensembl Xenopus
Match: gpt (glutamic-pyruvate transaminase (alanine aminotransferase) [Source:NCBI gene;Acc:549559])

HSP 1 Score: 556.214 bits (1432), Expect = 0.000e+0
Identity = 260/463 (56.16%), Postives = 344/463 (74.30%), Query Frame = 1
Query:  214 EYAVRGPIVIKAQELEKRLINNEKLPFDEVIKCNIGDCHAMGQKPLTFLRQVVALTVLPELINSKKFPADAKHRAKRVLESCGGNSVGSYSQSTGVEIVRKDIASFISKRDG-IACNSNDIFLSTGASEAIKVVLQMMATQSHGKDKAGIMVPIPQYPLYSATNAEYNAYQIGYYLSEENNWGINLSELERAINEASNHCIPRAIVIINPGNPTGQVLTADDIKMVIKFAYKHDLLIMADEVYQFNVYAPDRSFLSFKKALHDMGDEY-KSIQIASFMSASKGFMGECGFRGGYCELVNFPDDVQAQLYKCISARLCSSVAGQAMVEAIVNPPRPGEPSYELFEKEKAQVLSDLKLKGQLVTETLNQMPGFHCNAVQGAMYAFPRLELPASAIKEARKLKQAADFFYCSRLLEEMGVCVVPGSGFAQVPDTYHFRMTILPSVDKMKIVMDRIKHFHDGFMKQY 1596
            EYAVRGPIVI+A ELEK L    K PF EVIK NIGD HAMGQKP+TFLRQV A+ + PEL+N  KFP D K +A R+L++CGG+S+G+YS S G+E++R+D+A +I +RDG I  + N+I+LSTGAS++I  +L+++ +   GK + G+++PIPQYPLYSA  AE NA Q+ YYL EEN W ++++EL R++ EA  HC P+ + IINPGNPTGQV +   I+ VI+FA + +L +MADEVYQ NVYA   +F SFKK L +MG +Y +++++ASF S SKG+MGECGFRGGY E++N    V+ QL K +S RLC  V GQA+++ IVNPP+PGEPSY+ F  EK  VL +L  K +L  E LNQ PG  CN VQGAMY+FPR+ +P  AIK A+ + QA D F+C +LLEE G+CVVPGSGF Q   T+HFRMTILP  DK+K +++R+K FH  F ++Y
Sbjct:   47 EYAVRGPIVIRAVELEKELQQGVKKPFTEVIKANIGDAHAMGQKPITFLRQVSAICLYPELMNDNKFPEDVKQKAARILQACGGHSIGAYSASQGIEVIRQDVAKYIERRDGGIQSDPNNIYLSTGASDSIVTMLKLLVS-GQGKSRTGVLIPIPQYPLYSAALAELNAVQVNYYLDEENCWALDINELRRSLTEARKHCDPKVLCIINPGNPTGQVQSRKCIEDVIRFAAEENLFLMADEVYQDNVYAKGCTFHSFKKVLFEMGPKYSETVELASFHSTSKGYMGECGFRGGYMEVINMDPAVKQQLTKLVSVRLCPPVPGQALLDVIVNPPKPGEPSYKQFMAEKQAVLGNLAEKARLTEEILNQSPGIRCNPVQGAMYSFPRIHIPEKAIKLAQVIGQAPDMFFCMKLLEETGICVVPGSGFGQREGTHHFRMTILPPTDKLKSLLERLKDFHQKFTEEY 508          
BLAST of Alanine aminotransferase 2 vs. Ensembl Xenopus
Match: gpt (glutamic-pyruvate transaminase (alanine aminotransferase) [Source:NCBI gene;Acc:549559])

HSP 1 Score: 555.444 bits (1430), Expect = 0.000e+0
Identity = 260/463 (56.16%), Postives = 343/463 (74.08%), Query Frame = 1
Query:  214 EYAVRGPIVIKAQELEKRLINNEKLPFDEVIKCNIGDCHAMGQKPLTFLRQVVALTVLPELINSKKFPADAKHRAKRVLESCGGNSVGSYSQSTGVEIVRKDIASFISKRDG-IACNSNDIFLSTGASEAIKVVLQMMATQSHGKDKAGIMVPIPQYPLYSATNAEYNAYQIGYYLSEENNWGINLSELERAINEASNHCIPRAIVIINPGNPTGQVLTADDIKMVIKFAYKHDLLIMADEVYQFNVYAPDRSFLSFKKALHDMGDEY-KSIQIASFMSASKGFMGECGFRGGYCELVNFPDDVQAQLYKCISARLCSSVAGQAMVEAIVNPPRPGEPSYELFEKEKAQVLSDLKLKGQLVTETLNQMPGFHCNAVQGAMYAFPRLELPASAIKEARKLKQAADFFYCSRLLEEMGVCVVPGSGFAQVPDTYHFRMTILPSVDKMKIVMDRIKHFHDGFMKQY 1596
            EYAVRGPIVI+A ELEK L    K PF EVIK NIGD HAMGQKP+TFLRQV A+ + PEL+N  KFP D K +A R+L++CGG+S+G+YS S G+E++R+D+A +I +RDG I  + N+I+LSTGAS++I  +L+++ +   GK + G+++PIPQYPLYSA  AE NA Q+ YYL EEN W ++++EL R++ EA  HC P+ + IINPGNPTGQV +   I+ VI+FA + +L +MADEVYQ NVYA   +F SFKK L +MG +Y +++++ASF S SKG+MGECGFRGGY E++N    V+ QL K +S RLC  V GQA+++ IVNPP+PGEPSY+ F  EK  VL +L  K +L  E LNQ PG  CN VQGAMY+FPR+ +P  AIK A+   QA D F+C +LLEE G+CVVPGSGF Q   T+HFRMTILP  DK+K +++R+K FH  F ++Y
Sbjct:   57 EYAVRGPIVIRAVELEKELQQGVKKPFTEVIKANIGDAHAMGQKPITFLRQVSAICLYPELMNDNKFPEDVKQKAARILQACGGHSIGAYSASQGIEVIRQDVAKYIERRDGGIQSDPNNIYLSTGASDSIVTMLKLLVS-GQGKSRTGVLIPIPQYPLYSAALAELNAVQVNYYLDEENCWALDINELRRSLTEARKHCDPKVLCIINPGNPTGQVQSRKCIEDVIRFAAEENLFLMADEVYQDNVYAKGCTFHSFKKVLFEMGPKYSETVELASFHSTSKGYMGECGFRGGYMEVINMDPAVKQQLTKLVSVRLCPPVPGQALLDVIVNPPKPGEPSYKQFMAEKQAVLGNLAEKARLTEEILNQSPGIRCNPVQGAMYSFPRIHIPEKAIKLAQAEGQAPDMFFCMKLLEETGICVVPGSGFGQREGTHHFRMTILPPTDKLKSLLERLKDFHQKFTEEY 518          
BLAST of Alanine aminotransferase 2 vs. Ensembl Xenopus
Match: gpt (glutamic-pyruvate transaminase (alanine aminotransferase) [Source:NCBI gene;Acc:549559])

HSP 1 Score: 555.444 bits (1430), Expect = 0.000e+0
Identity = 260/463 (56.16%), Postives = 343/463 (74.08%), Query Frame = 1
Query:  214 EYAVRGPIVIKAQELEKRLINNEKLPFDEVIKCNIGDCHAMGQKPLTFLRQVVALTVLPELINSKKFPADAKHRAKRVLESCGGNSVGSYSQSTGVEIVRKDIASFISKRDG-IACNSNDIFLSTGASEAIKVVLQMMATQSHGKDKAGIMVPIPQYPLYSATNAEYNAYQIGYYLSEENNWGINLSELERAINEASNHCIPRAIVIINPGNPTGQVLTADDIKMVIKFAYKHDLLIMADEVYQFNVYAPDRSFLSFKKALHDMGDEY-KSIQIASFMSASKGFMGECGFRGGYCELVNFPDDVQAQLYKCISARLCSSVAGQAMVEAIVNPPRPGEPSYELFEKEKAQVLSDLKLKGQLVTETLNQMPGFHCNAVQGAMYAFPRLELPASAIKEARKLKQAADFFYCSRLLEEMGVCVVPGSGFAQVPDTYHFRMTILPSVDKMKIVMDRIKHFHDGFMKQY 1596
            EYAVRGPIVI+A ELEK L    K PF EVIK NIGD HAMGQKP+TFLRQV A+ + PEL+N  KFP D K +A R+L++CGG+S+G+YS S G+E++R+D+A +I +RDG I  + N+I+LSTGAS++I  +L+++ +   GK + G+++PIPQYPLYSA  AE NA Q+ YYL EEN W ++++EL R++ EA  HC P+ + IINPGNPTGQV +   I+ VI+FA + +L +MADEVYQ NVYA   +F SFKK L +MG +Y +++++ASF S SKG+MGECGFRGGY E++N    V+ QL K +S RLC  V GQA+++ IVNPP+PGEPSY+ F  EK  VL +L  K +L  E LNQ PG  CN VQGAMY+FPR+ +P  AIK A+   QA D F+C +LLEE G+CVVPGSGF Q   T+HFRMTILP  DK+K +++R+K FH  F ++Y
Sbjct:   36 EYAVRGPIVIRAVELEKELQQGVKKPFTEVIKANIGDAHAMGQKPITFLRQVSAICLYPELMNDNKFPEDVKQKAARILQACGGHSIGAYSASQGIEVIRQDVAKYIERRDGGIQSDPNNIYLSTGASDSIVTMLKLLVS-GQGKSRTGVLIPIPQYPLYSAALAELNAVQVNYYLDEENCWALDINELRRSLTEARKHCDPKVLCIINPGNPTGQVQSRKCIEDVIRFAAEENLFLMADEVYQDNVYAKGCTFHSFKKVLFEMGPKYSETVELASFHSTSKGYMGECGFRGGYMEVINMDPAVKQQLTKLVSVRLCPPVPGQALLDVIVNPPKPGEPSYKQFMAEKQAVLGNLAEKARLTEEILNQSPGIRCNPVQGAMYSFPRIHIPEKAIKLAQAEGQAPDMFFCMKLLEETGICVVPGSGFGQREGTHHFRMTILPPTDKLKSLLERLKDFHQKFTEEY 497          
BLAST of Alanine aminotransferase 2 vs. Ensembl Xenopus
Match: gpt (glutamic-pyruvate transaminase (alanine aminotransferase) [Source:NCBI gene;Acc:549559])

HSP 1 Score: 555.444 bits (1430), Expect = 0.000e+0
Identity = 260/463 (56.16%), Postives = 343/463 (74.08%), Query Frame = 1
Query:  214 EYAVRGPIVIKAQELEKRLINNEKLPFDEVIKCNIGDCHAMGQKPLTFLRQVVALTVLPELINSKKFPADAKHRAKRVLESCGGNSVGSYSQSTGVEIVRKDIASFISKRDG-IACNSNDIFLSTGASEAIKVVLQMMATQSHGKDKAGIMVPIPQYPLYSATNAEYNAYQIGYYLSEENNWGINLSELERAINEASNHCIPRAIVIINPGNPTGQVLTADDIKMVIKFAYKHDLLIMADEVYQFNVYAPDRSFLSFKKALHDMGDEY-KSIQIASFMSASKGFMGECGFRGGYCELVNFPDDVQAQLYKCISARLCSSVAGQAMVEAIVNPPRPGEPSYELFEKEKAQVLSDLKLKGQLVTETLNQMPGFHCNAVQGAMYAFPRLELPASAIKEARKLKQAADFFYCSRLLEEMGVCVVPGSGFAQVPDTYHFRMTILPSVDKMKIVMDRIKHFHDGFMKQY 1596
            EYAVRGPIVI+A ELEK L    K PF EVIK NIGD HAMGQKP+TFLRQV A+ + PEL+N  KFP D K +A R+L++CGG+S+G+YS S G+E++R+D+A +I +RDG I  + N+I+LSTGAS++I  +L+++ +   GK + G+++PIPQYPLYSA  AE NA Q+ YYL EEN W ++++EL R++ EA  HC P+ + IINPGNPTGQV +   I+ VI+FA + +L +MADEVYQ NVYA   +F SFKK L +MG +Y +++++ASF S SKG+MGECGFRGGY E++N    V+ QL K +S RLC  V GQA+++ IVNPP+PGEPSY+ F  EK  VL +L  K +L  E LNQ PG  CN VQGAMY+FPR+ +P  AIK A+   QA D F+C +LLEE G+CVVPGSGF Q   T+HFRMTILP  DK+K +++R+K FH  F ++Y
Sbjct:   42 EYAVRGPIVIRAVELEKELQQGVKKPFTEVIKANIGDAHAMGQKPITFLRQVSAICLYPELMNDNKFPEDVKQKAARILQACGGHSIGAYSASQGIEVIRQDVAKYIERRDGGIQSDPNNIYLSTGASDSIVTMLKLLVS-GQGKSRTGVLIPIPQYPLYSAALAELNAVQVNYYLDEENCWALDINELRRSLTEARKHCDPKVLCIINPGNPTGQVQSRKCIEDVIRFAAEENLFLMADEVYQDNVYAKGCTFHSFKKVLFEMGPKYSETVELASFHSTSKGYMGECGFRGGYMEVINMDPAVKQQLTKLVSVRLCPPVPGQALLDVIVNPPKPGEPSYKQFMAEKQAVLGNLAEKARLTEEILNQSPGIRCNPVQGAMYSFPRIHIPEKAIKLAQAEGQAPDMFFCMKLLEETGICVVPGSGFGQREGTHHFRMTILPPTDKLKSLLERLKDFHQKFTEEY 503          
BLAST of Alanine aminotransferase 2 vs. Ensembl Xenopus
Match: gpt (glutamic-pyruvate transaminase (alanine aminotransferase) [Source:NCBI gene;Acc:549559])

HSP 1 Score: 555.058 bits (1429), Expect = 0.000e+0
Identity = 260/463 (56.16%), Postives = 343/463 (74.08%), Query Frame = 1
Query:  214 EYAVRGPIVIKAQELEKRLINNEKLPFDEVIKCNIGDCHAMGQKPLTFLRQVVALTVLPELINSKKFPADAKHRAKRVLESCGGNSVGSYSQSTGVEIVRKDIASFISKRDG-IACNSNDIFLSTGASEAIKVVLQMMATQSHGKDKAGIMVPIPQYPLYSATNAEYNAYQIGYYLSEENNWGINLSELERAINEASNHCIPRAIVIINPGNPTGQVLTADDIKMVIKFAYKHDLLIMADEVYQFNVYAPDRSFLSFKKALHDMGDEY-KSIQIASFMSASKGFMGECGFRGGYCELVNFPDDVQAQLYKCISARLCSSVAGQAMVEAIVNPPRPGEPSYELFEKEKAQVLSDLKLKGQLVTETLNQMPGFHCNAVQGAMYAFPRLELPASAIKEARKLKQAADFFYCSRLLEEMGVCVVPGSGFAQVPDTYHFRMTILPSVDKMKIVMDRIKHFHDGFMKQY 1596
            EYAVRGPIVI+A ELEK L    K PF EVIK NIGD HAMGQKP+TFLRQV A+ + PEL+N  KFP D K +A R+L++CGG+S+G+YS S G+E++R+D+A +I +RDG I  + N+I+LSTGAS++I  +L+++ +   GK + G+++PIPQYPLYSA  AE NA Q+ YYL EEN W ++++EL R++ EA  HC P+ + IINPGNPTGQV +   I+ VI+FA + +L +MADEVYQ NVYA   +F SFKK L +MG +Y +++++ASF S SKG+MGECGFRGGY E++N    V+ QL K +S RLC  V GQA+++ IVNPP+PGEPSY+ F  EK  VL +L  K +L  E LNQ PG  CN VQGAMY+FPR+ +P  AIK A+   QA D F+C +LLEE G+CVVPGSGF Q   T+HFRMTILP  DK+K +++R+K FH  F ++Y
Sbjct:   52 EYAVRGPIVIRAVELEKELQQGVKKPFTEVIKANIGDAHAMGQKPITFLRQVSAICLYPELMNDNKFPEDVKQKAARILQACGGHSIGAYSASQGIEVIRQDVAKYIERRDGGIQSDPNNIYLSTGASDSIVTMLKLLVS-GQGKSRTGVLIPIPQYPLYSAALAELNAVQVNYYLDEENCWALDINELRRSLTEARKHCDPKVLCIINPGNPTGQVQSRKCIEDVIRFAAEENLFLMADEVYQDNVYAKGCTFHSFKKVLFEMGPKYSETVELASFHSTSKGYMGECGFRGGYMEVINMDPAVKQQLTKLVSVRLCPPVPGQALLDVIVNPPKPGEPSYKQFMAEKQAVLGNLAEKARLTEEILNQSPGIRCNPVQGAMYSFPRIHIPEKAIKLAQAEGQAPDMFFCMKLLEETGICVVPGSGFGQREGTHHFRMTILPPTDKLKSLLERLKDFHQKFTEEY 513          
BLAST of Alanine aminotransferase 2 vs. Ensembl Mouse
Match: Gpt2 (glutamic pyruvate transaminase (alanine aminotransferase) 2 [Source:MGI Symbol;Acc:MGI:1915391])

HSP 1 Score: 559.296 bits (1440), Expect = 0.000e+0
Identity = 257/462 (55.63%), Postives = 343/462 (74.24%), Query Frame = 1
Query:  214 EYAVRGPIVIKAQELEKRLINNEKLPFDEVIKCNIGDCHAMGQKPLTFLRQVVALTVLPELINSKKFPADAKHRAKRVLESCGGNSVGSYSQSTGVEIVRKDIASFISKRDGIACNSNDIFLSTGASEAIKVVLQMMATQSHGKDKAGIMVPIPQYPLYSATNAEYNAYQIGYYLSEENNWGINLSELERAINEASNHCIPRAIVIINPGNPTGQVLTADDIKMVIKFAYKHDLLIMADEVYQFNVYAPDRSFLSFKKALHDMGDEYKS-IQIASFMSASKGFMGECGFRGGYCELVNFPDDVQAQLYKCISARLCSSVAGQAMVEAIVNPPRPGEPSYELFEKEKAQVLSDLKLKGQLVTETLNQMPGFHCNAVQGAMYAFPRLELPASAIKEARKLKQAADFFYCSRLLEEMGVCVVPGSGFAQVPDTYHFRMTILPSVDKMKIVMDRIKHFHDGFMKQY 1596
            EYAVRGPIV+KA E+E  L    K PF EVI+ NIGD HAMGQ+P+TFLRQV+AL   P L+NS  FP DAK RA+R+L++CGGNS+GSYS S GV  +R+D+A+FI++RDG+  + ++I+L+TGAS+ I  +L+++ +   GK + G+M+PIPQYPLYSA  +E +A Q+ YYL EEN W +N+ EL RA+ +A +HC P+ + IINPGNPTGQV +   I+ VI FA++  L ++ADEVYQ NVY+PD  F SFKK L+ MG EY S +++ASF S SKG+MGECG+RGGY E++N   +++ QL K +S RLC  V+GQA ++ +VNPP PGE S+E F +EK  VL +L  K +L  +  NQ+PG  CN +QGAMYAFPR+ +PA A++ A+  K A D FYC +LLEE G+CVVPGSGF Q   TYHFRMTILP VDK+K V+ ++K FH  F++QY
Sbjct:   61 EYAVRGPIVLKAGEIEMELQRGIKKPFTEVIRANIGDAHAMGQQPITFLRQVMALCTYPNLLNSPSFPEDAKKRARRILQACGGNSLGSYSASQGVNCIREDVAAFITRRDGVPADPDNIYLTTGASDGISTILKLLVS-GGGKSRTGVMIPIPQYPLYSAVISELDAVQVNYYLDEENCWALNVDELRRALRQAKDHCDPKVLCIINPGNPTGQVQSRKCIEDVIHFAWEEKLFLLADEVYQDNVYSPDCRFHSFKKVLYQMGHEYSSNVELASFHSTSKGYMGECGYRGGYMEVINLHPEIKGQLVKLLSVRLCPPVSGQAAMDIVVNPPEPGEESFEQFSREKEFVLGNLAKKAKLTEDLFNQVPGIQCNPLQGAMYAFPRILIPAKAVEAAQSHKMAPDMFYCMKLLEETGICVVPGSGFGQREGTYHFRMTILPPVDKLKTVLHKVKDFHLKFLEQY 521          
BLAST of Alanine aminotransferase 2 vs. Ensembl Mouse
Match: Gpt (glutamic pyruvic transaminase, soluble [Source:MGI Symbol;Acc:MGI:95802])

HSP 1 Score: 529.635 bits (1363), Expect = 0.000e+0
Identity = 244/463 (52.70%), Postives = 339/463 (73.22%), Query Frame = 1
Query:  214 EYAVRGPIVIKAQELEKRLINNEKLPFDEVIKCNIGDCHAMGQKPLTFLRQVVALTVLPELINSKKFPADAKHRAKRVLESCGGNSVGSYSQSTGVEIVRKDIASFISKRDG-IACNSNDIFLSTGASEAIKVVLQMMATQSHGKDKAGIMVPIPQYPLYSATNAEYNAYQIGYYLSEENNWGINLSELERAINEASNHCIPRAIVIINPGNPTGQVLTADDIKMVIKFAYKHDLLIMADEVYQFNVYAPDRSFLSFKKALHDMGDEYKSIQ-IASFMSASKGFMGECGFRGGYCELVNFPDDVQAQLYKCISARLCSSVAGQAMVEAIVNPPRPGEPSYELFEKEKAQVLSDLKLKGQLVTETLNQMPGFHCNAVQGAMYAFPRLELPASAIKEARKLKQAADFFYCSRLLEEMGVCVVPGSGFAQVPDTYHFRMTILPSVDKMKIVMDRIKHFHDGFMKQY 1596
            EYAVRGPIV +A ELE+ L    K PF EVI+ NIGD  AMGQ+P+TF RQV+AL V P L++S  FP DAK RA+R+L++CGG+S+G+YS S+G++ +R+D+A +I +RDG I  + N+IFLSTGAS+AI  +L+++     G+ + G+++PIPQYPLYSA  AE +A Q+ YYL EE  W ++++EL RA+ +A + C PR + +INPGNPTGQV T + I+ VI+FA++  L +MADEVYQ NVYA    F SFKK L +MG  Y + Q +ASF S SKG+MGECGFRGGY E+VN   +VQ Q+ K +S RLC  V GQA++  +V+PP P EPS++ F+ E+ +VL++L  K +L  +  N+ PG  CN VQGAMY+FP+++LP  A++ A+ L  A D F+C  LLEE G+CVVPGSGF Q   TYHFRMTILP ++K+++++++++HFH  F  +Y
Sbjct:   34 EYAVRGPIVQRALELEQELRQGVKKPFTEVIRANIGDAQAMGQRPITFFRQVLALCVYPNLLSSPDFPEDAKRRAERILQACGGHSLGAYSISSGIQPIREDVAQYIERRDGGIPADPNNIFLSTGASDAIVTMLKLLVA-GEGRARTGVLIPIPQYPLYSAALAELDAVQVDYYLDEERAWALDIAELRRALCQARDRCCPRVLCVINPGNPTGQVQTRECIEAVIRFAFEEGLFLMADEVYQDNVYAEGSQFHSFKKVLTEMGPPYATQQELASFHSVSKGYMGECGFRGGYVEVVNMDAEVQKQMAKLMSVRLCPPVPGQALMGMVVSPPTPSEPSFKQFQAERQEVLAELAAKAKLTEQVFNEAPGIRCNPVQGAMYSFPQIQLPLKAVQRAQDLGLAPDMFFCLCLLEETGICVVPGSGFGQQEGTYHFRMTILPPMEKLRVLLEKLRHFHAKFTHEY 495          
BLAST of Alanine aminotransferase 2 vs. Ensembl Mouse
Match: Gpt (glutamic pyruvic transaminase, soluble [Source:MGI Symbol;Acc:MGI:95802])

HSP 1 Score: 529.635 bits (1363), Expect = 0.000e+0
Identity = 244/463 (52.70%), Postives = 339/463 (73.22%), Query Frame = 1
Query:  214 EYAVRGPIVIKAQELEKRLINNEKLPFDEVIKCNIGDCHAMGQKPLTFLRQVVALTVLPELINSKKFPADAKHRAKRVLESCGGNSVGSYSQSTGVEIVRKDIASFISKRDG-IACNSNDIFLSTGASEAIKVVLQMMATQSHGKDKAGIMVPIPQYPLYSATNAEYNAYQIGYYLSEENNWGINLSELERAINEASNHCIPRAIVIINPGNPTGQVLTADDIKMVIKFAYKHDLLIMADEVYQFNVYAPDRSFLSFKKALHDMGDEYKSIQ-IASFMSASKGFMGECGFRGGYCELVNFPDDVQAQLYKCISARLCSSVAGQAMVEAIVNPPRPGEPSYELFEKEKAQVLSDLKLKGQLVTETLNQMPGFHCNAVQGAMYAFPRLELPASAIKEARKLKQAADFFYCSRLLEEMGVCVVPGSGFAQVPDTYHFRMTILPSVDKMKIVMDRIKHFHDGFMKQY 1596
            EYAVRGPIV +A ELE+ L    K PF EVI+ NIGD  AMGQ+P+TF RQV+AL V P L++S  FP DAK RA+R+L++CGG+S+G+YS S+G++ +R+D+A +I +RDG I  + N+IFLSTGAS+AI  +L+++     G+ + G+++PIPQYPLYSA  AE +A Q+ YYL EE  W ++++EL RA+ +A + C PR + +INPGNPTGQV T + I+ VI+FA++  L +MADEVYQ NVYA    F SFKK L +MG  Y + Q +ASF S SKG+MGECGFRGGY E+VN   +VQ Q+ K +S RLC  V GQA++  +V+PP P EPS++ F+ E+ +VL++L  K +L  +  N+ PG  CN VQGAMY+FP+++LP  A++ A+ L  A D F+C  LLEE G+CVVPGSGF Q   TYHFRMTILP ++K+++++++++HFH  F  +Y
Sbjct:   34 EYAVRGPIVQRALELEQELRQGVKKPFTEVIRANIGDAQAMGQRPITFFRQVLALCVYPNLLSSPDFPEDAKRRAERILQACGGHSLGAYSISSGIQPIREDVAQYIERRDGGIPADPNNIFLSTGASDAIVTMLKLLVA-GEGRARTGVLIPIPQYPLYSAALAELDAVQVDYYLDEERAWALDIAELRRALCQARDRCCPRVLCVINPGNPTGQVQTRECIEAVIRFAFEEGLFLMADEVYQDNVYAEGSQFHSFKKVLTEMGPPYATQQELASFHSVSKGYMGECGFRGGYVEVVNMDAEVQKQMAKLMSVRLCPPVPGQALMGMVVSPPTPSEPSFKQFQAERQEVLAELAAKAKLTEQVFNEAPGIRCNPVQGAMYSFPQIQLPLKAVQRAQDLGLAPDMFFCLCLLEETGICVVPGSGFGQQEGTYHFRMTILPPMEKLRVLLEKLRHFHAKFTHEY 495          
BLAST of Alanine aminotransferase 2 vs. Ensembl Mouse
Match: Gpt (glutamic pyruvic transaminase, soluble [Source:MGI Symbol;Acc:MGI:95802])

HSP 1 Score: 352.829 bits (904), Expect = 1.784e-117
Identity = 177/348 (50.86%), Postives = 240/348 (68.97%), Query Frame = 1
Query:  214 EYAVRGPIVIKAQELEKRLINNEKLPFDEVIKCNIGDCHAMGQKPLTFLRQVVALTVLPELINSKKFPADAKHRAKRVLESCGGNSVGSYSQSTGVEIVRKDIASFISKRD-GIACNSNDIFLSTGASEAIKVVLQMMATQSHGKDKAGIMVPIPQYPLYSATNAEYNAYQIGYYLSEENNWGINLSELERAINEASNHCIPRAIVIINPGNPTGQVLTADDIKMVIKFAYKHDLLIMADEVYQFNVYAPDRSFLSFKKALHDMGDEYKSIQ-IASFMSASKGFMGECGFRGGYCELVNFPDDVQAQLYKCISARLCSSVAGQAMVEAIVNPPRPGEPSYELFEKEKA 1251
            EYAVRGPIV +A ELE+ L    K PF EVI+ NIGD  AMGQ+P+TF RQV+AL V P L++S  FP DAK RA+R+L++CGG+S+G+YS S+G++ +R+D+A +I +RD GI  + N+IFLSTGAS+AI  +L+++     G+ + G+++PIPQYPLYSA  AE +A Q+ YYL EE  W ++++EL RA+      C               QV T + I+ VI+FA++  L +MADEVYQ NVYA    F SFKK L +MG  Y + Q +ASF S SKG+MGECGFRGGY E+VN   +VQ Q+ K +S RLC  V GQA++  +V+PP P EPS++ F+  KA
Sbjct:   34 EYAVRGPIVQRALELEQELRQGVKKPFTEVIRANIGDAQAMGQRPITFFRQVLALCVYPNLLSSPDFPEDAKRRAERILQACGGHSLGAYSISSGIQPIREDVAQYIERRDGGIPADPNNIFLSTGASDAIVTMLKLLVA-GEGRARTGVLIPIPQYPLYSAALAELDAVQVDYYLDEERAWALDIAELRRAL------C---------------QVQTRECIEAVIRFAFEEGLFLMADEVYQDNVYAEGSQFHSFKKVLTEMGPPYATQQELASFHSVSKGYMGECGFRGGYVEVVNMDAEVQKQMAKLMSVRLCPPVPGQALMGMVVSPPTPSEPSFKQFQAVKA 359          
BLAST of Alanine aminotransferase 2 vs. Ensembl Mouse
Match: Gpt (glutamic pyruvic transaminase, soluble [Source:MGI Symbol;Acc:MGI:95802])

HSP 1 Score: 279.256 bits (713), Expect = 2.719e-90
Identity = 129/249 (51.81%), Postives = 178/249 (71.49%), Query Frame = 1
Query:  853 GQVLTADDIKMVIKFAYKHDLLIMADEVYQFNVYAPDRSFLSFKKALHDMGDEYKSIQ-IASFMSASKGFMGECGFRGGYCELVNFPDDVQAQLYKCISARLCSSVAGQAMVEAIVNPPRPGEPSYELFEKEKAQVLSDLKLKGQLVTETLNQMPGFHCNAVQGAMYAFPRLELPASAIKEARKLKQAADFFYCSRLLEEMGVCVVPGSGFAQVPDTYHFRMTILPSVDKMKIVMDRIKHFHDGFMKQY 1596
            GQV T + I+ VI+FA++  L +MADEVYQ NVYA    F SFKK L +MG  Y + Q +ASF S SKG+MGECGFRGGY E+VN   +VQ Q+ K +S RLC  V GQA++  +V+PP P EPS++ F+ E+ +VL++L  K +L  +  N+ PG  CN VQGAMY+FP+++LP  A++ A+ L  A D F+C  LLEE G+CVVPGSGF Q   TYHFRMTILP ++K+++++++++HFH  F  +Y
Sbjct:    7 GQVQTRECIEAVIRFAFEEGLFLMADEVYQDNVYAEGSQFHSFKKVLTEMGPPYATQQELASFHSVSKGYMGECGFRGGYVEVVNMDAEVQKQMAKLMSVRLCPPVPGQALMGMVVSPPTPSEPSFKQFQAERQEVLAELAAKAKLTEQVFNEAPGIRCNPVQGAMYSFPQIQLPLKAVQRAQDLGLAPDMFFCLCLLEETGICVVPGSGFGQQEGTYHFRMTILPPMEKLRVLLEKLRHFHAKFTHEY 255          
BLAST of Alanine aminotransferase 2 vs. UniProt/SwissProt
Match: sp|Q8BGT5|ALAT2_MOUSE (Alanine aminotransferase 2 OS=Mus musculus OX=10090 GN=Gpt2 PE=1 SV=1)

HSP 1 Score: 559.296 bits (1440), Expect = 0.000e+0
Identity = 257/462 (55.63%), Postives = 343/462 (74.24%), Query Frame = 1
Query:  214 EYAVRGPIVIKAQELEKRLINNEKLPFDEVIKCNIGDCHAMGQKPLTFLRQVVALTVLPELINSKKFPADAKHRAKRVLESCGGNSVGSYSQSTGVEIVRKDIASFISKRDGIACNSNDIFLSTGASEAIKVVLQMMATQSHGKDKAGIMVPIPQYPLYSATNAEYNAYQIGYYLSEENNWGINLSELERAINEASNHCIPRAIVIINPGNPTGQVLTADDIKMVIKFAYKHDLLIMADEVYQFNVYAPDRSFLSFKKALHDMGDEYKS-IQIASFMSASKGFMGECGFRGGYCELVNFPDDVQAQLYKCISARLCSSVAGQAMVEAIVNPPRPGEPSYELFEKEKAQVLSDLKLKGQLVTETLNQMPGFHCNAVQGAMYAFPRLELPASAIKEARKLKQAADFFYCSRLLEEMGVCVVPGSGFAQVPDTYHFRMTILPSVDKMKIVMDRIKHFHDGFMKQY 1596
            EYAVRGPIV+KA E+E  L    K PF EVI+ NIGD HAMGQ+P+TFLRQV+AL   P L+NS  FP DAK RA+R+L++CGGNS+GSYS S GV  +R+D+A+FI++RDG+  + ++I+L+TGAS+ I  +L+++ +   GK + G+M+PIPQYPLYSA  +E +A Q+ YYL EEN W +N+ EL RA+ +A +HC P+ + IINPGNPTGQV +   I+ VI FA++  L ++ADEVYQ NVY+PD  F SFKK L+ MG EY S +++ASF S SKG+MGECG+RGGY E++N   +++ QL K +S RLC  V+GQA ++ +VNPP PGE S+E F +EK  VL +L  K +L  +  NQ+PG  CN +QGAMYAFPR+ +PA A++ A+  K A D FYC +LLEE G+CVVPGSGF Q   TYHFRMTILP VDK+K V+ ++K FH  F++QY
Sbjct:   61 EYAVRGPIVLKAGEIEMELQRGIKKPFTEVIRANIGDAHAMGQQPITFLRQVMALCTYPNLLNSPSFPEDAKKRARRILQACGGNSLGSYSASQGVNCIREDVAAFITRRDGVPADPDNIYLTTGASDGISTILKLLVS-GGGKSRTGVMIPIPQYPLYSAVISELDAVQVNYYLDEENCWALNVDELRRALRQAKDHCDPKVLCIINPGNPTGQVQSRKCIEDVIHFAWEEKLFLLADEVYQDNVYSPDCRFHSFKKVLYQMGHEYSSNVELASFHSTSKGYMGECGYRGGYMEVINLHPEIKGQLVKLLSVRLCPPVSGQAAMDIVVNPPEPGEESFEQFSREKEFVLGNLAKKAKLTEDLFNQVPGIQCNPLQGAMYAFPRILIPAKAVEAAQSHKMAPDMFYCMKLLEETGICVVPGSGFGQREGTYHFRMTILPPVDKLKTVLHKVKDFHLKFLEQY 521          
BLAST of Alanine aminotransferase 2 vs. UniProt/SwissProt
Match: sp|Q28DB5|ALAT2_XENTR (Alanine aminotransferase 2 OS=Xenopus tropicalis OX=8364 GN=gpt2 PE=2 SV=1)

HSP 1 Score: 554.673 bits (1428), Expect = 0.000e+0
Identity = 260/463 (56.16%), Postives = 343/463 (74.08%), Query Frame = 1
Query:  214 EYAVRGPIVIKAQELEKRLINNEKLPFDEVIKCNIGDCHAMGQKPLTFLRQVVALTVLPELINSKKFPADAKHRAKRVLESCGGNSVGSYSQSTGVEIVRKDIASFISKRDG-IACNSNDIFLSTGASEAIKVVLQMMATQSHGKDKAGIMVPIPQYPLYSATNAEYNAYQIGYYLSEENNWGINLSELERAINEASNHCIPRAIVIINPGNPTGQVLTADDIKMVIKFAYKHDLLIMADEVYQFNVYAPDRSFLSFKKALHDMGDEY-KSIQIASFMSASKGFMGECGFRGGYCELVNFPDDVQAQLYKCISARLCSSVAGQAMVEAIVNPPRPGEPSYELFEKEKAQVLSDLKLKGQLVTETLNQMPGFHCNAVQGAMYAFPRLELPASAIKEARKLKQAADFFYCSRLLEEMGVCVVPGSGFAQVPDTYHFRMTILPSVDKMKIVMDRIKHFHDGFMKQY 1596
            EYAVRGPIVI+A ELEK L    K PF EVIK NIGD HAMGQKP+TFLRQV A+ + PEL+N  KFP D K +A R+L++CGG+S+G+YS S G+E++R+D+A +I +RDG I  + N+I+LSTGAS++I  +L+++ +   GK + G+++PIPQYPLYSA  AE NA Q+ YYL EEN W ++++EL R++ EA  HC P+ + IINPGNPTGQV +   I+ VI+FA + +L +MADEVYQ NVYA   +F SFKK L +MG +Y +++++ASF S SKG+MGECGFRGGY E++N    V+ QL K +S RLC  V GQA+++ IVNPP+PGEPSY+ F  EK  VL +L  K +L  E LNQ PG  CN VQGAMY+FPR+ +P  AIK A+   QA D F+C +LLEE G+CVVPGSGF Q   T+HFRMTILP  DK+K +++R+K FH  F ++Y
Sbjct:   62 EYAVRGPIVIRAVELEKELQQGVKKPFTEVIKANIGDAHAMGQKPITFLRQVSAICLYPELMNDNKFPEDVKQKAARILQACGGHSIGAYSASQGIEVIRQDVAKYIERRDGGIQSDPNNIYLSTGASDSIVTMLKLLVS-GQGKSRTGVLIPIPQYPLYSAALAELNAVQVNYYLDEENCWALDINELRRSLTEARKHCDPKVLCIINPGNPTGQVQSRKCIEDVIRFAAEENLFLMADEVYQDNVYAKGCTFHSFKKVLFEMGPKYSETVELASFHSTSKGYMGECGFRGGYMEVINMDPAVKQQLTKLVSVRLCPPVPGQALLDVIVNPPKPGEPSYKQFMAEKQAVLGNLAEKARLTEEILNQSPGIRCNPVQGAMYSFPRIHIPEKAIKLAQAEGQAPDMFFCMKLLEETGICVVPGSGFGQREGTHHFRMTILPPTDKLKSLLERLKDFHQKFTEEY 523          
BLAST of Alanine aminotransferase 2 vs. UniProt/SwissProt
Match: sp|Q6GM82|ALAT2_XENLA (Alanine aminotransferase 2 OS=Xenopus laevis OX=8355 GN=gpt2 PE=2 SV=1)

HSP 1 Score: 554.673 bits (1428), Expect = 0.000e+0
Identity = 261/463 (56.37%), Postives = 343/463 (74.08%), Query Frame = 1
Query:  214 EYAVRGPIVIKAQELEKRLINNEKLPFDEVIKCNIGDCHAMGQKPLTFLRQVVALTVLPELINSKKFPADAKHRAKRVLESCGGNSVGSYSQSTGVEIVRKDIASFISKRDG-IACNSNDIFLSTGASEAIKVVLQMMATQSHGKDKAGIMVPIPQYPLYSATNAEYNAYQIGYYLSEENNWGINLSELERAINEASNHCIPRAIVIINPGNPTGQVLTADDIKMVIKFAYKHDLLIMADEVYQFNVYAPDRSFLSFKKALHDMGDEY-KSIQIASFMSASKGFMGECGFRGGYCELVNFPDDVQAQLYKCISARLCSSVAGQAMVEAIVNPPRPGEPSYELFEKEKAQVLSDLKLKGQLVTETLNQMPGFHCNAVQGAMYAFPRLELPASAIKEARKLKQAADFFYCSRLLEEMGVCVVPGSGFAQVPDTYHFRMTILPSVDKMKIVMDRIKHFHDGFMKQY 1596
            EYAVRGPIVI+A ELEK L    K PF EVIK NIGD HAMGQKP+TFLRQV A+ + PEL+N  KFP D K +A R+L++CGG+S+G+YS S G+E++R+D+A +I +RDG I  + N+I+LSTGAS++I  +L+++ +   GK + G+M+PIPQYPLYSA  AE +A Q+ YYL EEN W ++++EL RA+ EA  HC P+ + IINPGNPTGQV +   I+ VI+FA + +L +MADEVYQ NVYA   +F SFKK L +MG +Y +++++ASF S SKG+MGECGFRGGY E++N    V+ QL K +S RLC  V GQ +++ IVNPP+PGEPSY+ F  EK  VL++L  K +L  E LNQ PG  CN VQGAMY+FPR+ +P  AIK A+   QA D F+C +LLEE G+CVVPGSGF Q   T+HFRMTILP  DK+K +++R+K FH  FM +Y
Sbjct:   78 EYAVRGPIVIRAVELEKELQQGVKKPFTEVIKANIGDAHAMGQKPVTFLRQVSAICLYPELMNDNKFPEDVKQKAARILQACGGHSIGAYSASQGIEVIRQDVAKYIERRDGGILSDPNNIYLSTGASDSIVTMLKLLVS-GQGKSRTGVMIPIPQYPLYSAALAELDAVQVNYYLDEENCWALDINELRRALAEARKHCDPKVLCIINPGNPTGQVQSRKCIEDVIRFAAEENLFLMADEVYQDNVYAKGCAFHSFKKVLFEMGPKYSETLELASFHSTSKGYMGECGFRGGYMEVINMDPAVKQQLTKLVSVRLCPPVPGQVLLDVIVNPPKPGEPSYKQFISEKQAVLNNLAEKARLTEEILNQAPGIRCNPVQGAMYSFPRIHIPEKAIKLAQAEGQAPDMFFCMKLLEETGICVVPGSGFGQREGTHHFRMTILPPTDKLKSLLERLKDFHQKFMDEY 539          
BLAST of Alanine aminotransferase 2 vs. UniProt/SwissProt
Match: sp|Q8TD30|ALAT2_HUMAN (Alanine aminotransferase 2 OS=Homo sapiens OX=9606 GN=GPT2 PE=1 SV=1)

HSP 1 Score: 546.969 bits (1408), Expect = 0.000e+0
Identity = 252/463 (54.43%), Postives = 344/463 (74.30%), Query Frame = 1
Query:  214 EYAVRGPIVIKAQELEKRLINNEKLPFDEVIKCNIGDCHAMGQKPLTFLRQVVALTVLPELINSKKFPADAKHRAKRVLESCGGNSVGSYSQSTGVEIVRKDIASFISKRDG-IACNSNDIFLSTGASEAIKVVLQMMATQSHGKDKAGIMVPIPQYPLYSATNAEYNAYQIGYYLSEENNWGINLSELERAINEASNHCIPRAIVIINPGNPTGQVLTADDIKMVIKFAYKHDLLIMADEVYQFNVYAPDRSFLSFKKALHDMGDEYKS-IQIASFMSASKGFMGECGFRGGYCELVNFPDDVQAQLYKCISARLCSSVAGQAMVEAIVNPPRPGEPSYELFEKEKAQVLSDLKLKGQLVTETLNQMPGFHCNAVQGAMYAFPRLELPASAIKEARKLKQAADFFYCSRLLEEMGVCVVPGSGFAQVPDTYHFRMTILPSVDKMKIVMDRIKHFHDGFMKQY 1596
            EYAVRGPIV+KA E+E  L    K PF EVI+ NIGD  AMGQ+P+TFLRQV+AL   P L++S  FP DAK RA+R+L++CGGNS+GSYS S GV  +R+D+A++I++RDG +  + ++I+L+TGAS+ I  +L+++ +   GK + G+M+PIPQYPLYSA  +E +A Q+ YYL EEN W +N++EL RA+ EA +HC P+ + IINPGNPTGQV +   I+ VI FA++  L ++ADEVYQ NVY+PD  F SFKK L++MG EY S +++ASF S SKG+MGECG+RGGY E++N   +++ QL K +S RLC  V+GQA ++ +VNPP  GE S+E F +EK  VL +L  K +L  +  NQ+PG HCN +QGAMYAFPR+ +PA A++ A+  + A D FYC +LLEE G+CVVPGSGF Q   TYHFRMTILP V+K+K V+ ++K FH  F+++Y
Sbjct:   61 EYAVRGPIVLKAGEIELELQRGIKKPFTEVIRANIGDAQAMGQQPITFLRQVMALCTYPNLLDSPSFPEDAKKRARRILQACGGNSLGSYSASQGVNCIREDVAAYITRRDGGVPADPDNIYLTTGASDGISTILKILVS-GGGKSRTGVMIPIPQYPLYSAVISELDAIQVNYYLDEENCWALNVNELRRAVQEAKDHCDPKVLCIINPGNPTGQVQSRKCIEDVIHFAWEEKLFLLADEVYQDNVYSPDCRFHSFKKVLYEMGPEYSSNVELASFHSTSKGYMGECGYRGGYMEVINLHPEIKGQLVKLLSVRLCPPVSGQAAMDIVVNPPVAGEESFEQFSREKESVLGNLAKKAKLTEDLFNQVPGIHCNPLQGAMYAFPRIFIPAKAVEAAQAHQMAPDMFYCMKLLEETGICVVPGSGFGQREGTYHFRMTILPPVEKLKTVLQKVKDFHINFLEKY 522          
BLAST of Alanine aminotransferase 2 vs. UniProt/SwissProt
Match: sp|Q6NYL5|ALAT2_DANRE (Alanine aminotransferase 2-like OS=Danio rerio OX=7955 GN=gpt2l PE=2 SV=2)

HSP 1 Score: 533.872 bits (1374), Expect = 0.000e+0
Identity = 256/463 (55.29%), Postives = 341/463 (73.65%), Query Frame = 1
Query:  214 EYAVRGPIVIKAQELEKRLINNEKLPFDEVIKCNIGDCHAMGQKPLTFLRQVVALTVLPELINSKKFPADAKHRAKRVLESCGGNSVGSYSQSTGVEIVRKDIASFISKRDG-IACNSNDIFLSTGASEAIKVVLQMMATQSHGKDKAGIMVPIPQYPLYSATNAEYNAYQIGYYLSEENNWGINLSELERAINEASNHCIPRAIVIINPGNPTGQVLTADDIKMVIKFAYKHDLLIMADEVYQFNVYAPDRSFLSFKKALHDMGDEY-KSIQIASFMSASKGFMGECGFRGGYCELVNFPDDVQAQLYKCISARLCSSVAGQAMVEAIVNPPRPGEPSYELFEKEKAQVLSDLKLKGQLVTETLNQMPGFHCNAVQGAMYAFPRLELPASAIKEARKLKQAADFFYCSRLLEEMGVCVVPGSGFAQVPDTYHFRMTILPSVDKMKIVMDRIKHFHDGFMKQY 1596
            +YAVRGPIV +A ++EK L    K PFDEVIK NIGD HAMGQ+P+TF RQV+AL   P+L++  KFP DAK+RA+R+L+SCGGNS+G+Y+ S G++ VR+D+A +I +RDG I  + ++I+L+TGAS+ I  +L+++ T   G  + G+M+ IPQYPLYSA+ AE  A QI YYL+EE  W +++SEL+R++  A  HC PR + IINPGNPTGQV +   I+ VI+FA K +L +MADEVYQ NVYA    F SFKK L +MG EY K +++ASF S SK +MGECGFRGGY E++N   DV+AQL K +S RLC    GQA+++ +VNPP+PGEPS++ F +E+  VLS L  K +L  + LN +PG  CN VQGAMY+FPR+ LP  AI EA+   QA D FYC +LLEE G+C+VPGSGF Q   TYHFRMTILP  DK+K++++++K FH  F +QY
Sbjct:   87 DYAVRGPIVQRAVQIEKELKEGVKKPFDEVIKANIGDAHAMGQRPITFFRQVMALCTYPQLLDDNKFPEDAKNRARRILQSCGGNSIGAYTTSQGIDCVRQDVAKYIERRDGGIPSDPDNIYLTTGASDGIVTILKLL-TAGEGLTRTGVMISIPQYPLYSASIAELGAVQINYYLNEEKCWSLDISELQRSLQAARKHCNPRVLCIINPGNPTGQVQSRQCIEDVIQFAAKENLFLMADEVYQDNVYAKGCEFHSFKKVLFEMGPEYSKKVELASFHSTSKCYMGECGFRGGYMEVINMDADVKAQLTKLVSVRLCPPAPGQALMDLVVNPPQPGEPSHQTFMQERTAVLSALAEKAKLTEQILNTVPGISCNPVQGAMYSFPRITLPERAISEAKAKGQAPDMFYCMKLLEETGICLVPGSGFGQREGTYHFRMTILPPTDKLKLMLNKLKDFHQRFTQQY 548          
BLAST of Alanine aminotransferase 2 vs. TrEMBL
Match: A0A4S2MFV4 (Aminotran_1_2 domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_001215 PE=4 SV=1)

HSP 1 Score: 633.254 bits (1632), Expect = 0.000e+0
Identity = 293/462 (63.42%), Postives = 365/462 (79.00%), Query Frame = 1
Query:  214 EYAVRGPIVIKAQELEKRLINNEKLPFDEVIKCNIGDCHAMGQKPLTFLRQVVALTVLPELINSKKFPADAKHRAKRVLESCGGNSVGSYSQSTGVEIVRKDIASFISKRDGIACNSNDIFLSTGASEAIKVVLQMMATQSHGKDKAGIMVPIPQYPLYSATNAEYNAYQIGYYLSEENNWGINLSELERAINEASNHCIPRAIVIINPGNPTGQVLTADDIKMVIKFAYKHDLLIMADEVYQFNVYAPDRSFLSFKKALHDMGDEY-KSIQIASFMSASKGFMGECGFRGGYCELVNFPDDVQAQLYKCISARLCSSVAGQAMVEAIVNPPRPGEPSYELFEKEKAQVLSDLKLKGQLVTETLNQMPGFHCNAVQGAMYAFPRLELPASAIKEARKLKQAADFFYCSRLLEEMGVCVVPGSGFAQVPDTYHFRMTILPSVDKMKIVMDRIKHFHDGFMKQY 1596
            +YAVRGPIV +AQE+E  L       +D VIKCNIGDCHA GQKP++F+R V+     PE I +   P DAK RA+R LE CGG SVG YS+STGV IVR+DIA +I KRDG++ N NDIFLS+GASE +K VLQ+++T   GK +AGIMVPIPQYPLYSATNAEYNAYQIGYYL+E ++W +N+ +LE  + +A   CIPRA+V+INPGNPTGQ+L+ D I+ V++FA++H L+++ADEVYQ NVY+PDRSF+SFK+ LHDMG    K +Q+ASFMS SKGFMGECG RGGYCELVNF  DVQAQLYKC+SAR+CSS+ GQ  V+AIVNPP  GEPSYELF+KEK  VL  LKLK +LV+E+LN +PGF CN V GAMYAFP+L LP  AI+ A+    A DFFYC   L+E G+CVVPGSGF QVP T+HFR+TILP+V++M+IV+ +++ FH  F+K+Y
Sbjct:   64 QYAVRGPIVQRAQEIEAELQKGVAKKYDHVIKCNIGDCHASGQKPISFIRHVLCAATYPEFIQAVTIPEDAKLRARRFLEDCGG-SVGVYSESTGVRIVRQDIARYIEKRDGLSANPNDIFLSSGASEGVKSVLQLISTGCDGKKRAGIMVPIPQYPLYSATNAEYNAYQIGYYLNESDHWSLNVDQLEELMEKARGECIPRALVVINPGNPTGQLLSKDVIRNVLEFAHRHSLVVLADEVYQHNVYSPDRSFVSFKRVLHDMGSPISKELQLASFMSCSKGFMGECGLRGGYCELVNFSPDVQAQLYKCLSARICSSLLGQLAVDAIVNPPEVGEPSYELFQKEKESVLGALKLKARLVSESLNSLPGFSCNPVTGAMYAFPQLNLPPKAIEAAKDKGVAPDFFYCMNFLDEYGICVVPGSGFGQVPGTWHFRITILPTVEQMRIVIQKLEAFHTDFLKKY 524          
BLAST of Alanine aminotransferase 2 vs. TrEMBL
Match: A0A419QHT4 (Alanine aminotransferase 2 OS=Clonorchis sinensis OX=79923 GN=GPT2 PE=4 SV=1)

HSP 1 Score: 632.098 bits (1629), Expect = 0.000e+0
Identity = 293/462 (63.42%), Postives = 366/462 (79.22%), Query Frame = 1
Query:  214 EYAVRGPIVIKAQELEKRLINNEKLPFDEVIKCNIGDCHAMGQKPLTFLRQVVALTVLPELINSKKFPADAKHRAKRVLESCGGNSVGSYSQSTGVEIVRKDIASFISKRDGIACNSNDIFLSTGASEAIKVVLQMMATQSHGKDKAGIMVPIPQYPLYSATNAEYNAYQIGYYLSEENNWGINLSELERAINEASNHCIPRAIVIINPGNPTGQVLTADDIKMVIKFAYKHDLLIMADEVYQFNVYAPDRSFLSFKKALHDMGDEY-KSIQIASFMSASKGFMGECGFRGGYCELVNFPDDVQAQLYKCISARLCSSVAGQAMVEAIVNPPRPGEPSYELFEKEKAQVLSDLKLKGQLVTETLNQMPGFHCNAVQGAMYAFPRLELPASAIKEARKLKQAADFFYCSRLLEEMGVCVVPGSGFAQVPDTYHFRMTILPSVDKMKIVMDRIKHFHDGFMKQY 1596
            +YAVRGPIV +AQE+E  L       +D VIKCNIGDC A GQKP++F+RQV+     P+ I +   P DAK RA+R LE+CGG SVG YS+STGV IVR+DIA +I KRDG++ N NDIFLS+GASEA+K VLQ+++T   G+ +AGIMVPIPQYPLYSATNAEYNAYQIGYYL E ++W +N+ +LE  + +A   CIPRA+V+INPGNPTGQ+L+ D I+ V++FA++H L+++ADEVYQ NVY+PDRSF+SFK+ LHDMG    K IQ+ASFMS SKGFMGECG RGGYCELVNF  DVQAQLYKC+SARLCSS+ GQ  V+ IVNPP  GEPSYE F+KEK  VLS LKLK +LV+E+LN +PGF CN V GAMYAFP+L+LP  AI+ A+    A DFFYC   L+E G+CVVPGSGF QVP T+HFR+TILP+V++M+IV+ +++ FH  F+K+Y
Sbjct:   37 QYAVRGPIVQRAQEIEAELQKGAAKKYDHVIKCNIGDCQASGQKPISFIRQVLCAATYPDFIQAVAIPEDAKLRARRFLENCGG-SVGVYSESTGVRIVRQDIARYIEKRDGLSANPNDIFLSSGASEAVKSVLQLISTGCDGRKRAGIMVPIPQYPLYSATNAEYNAYQIGYYLDESDHWSLNVDQLEELVEKARGECIPRALVVINPGNPTGQLLSKDVIRNVLEFAHRHSLVVLADEVYQHNVYSPDRSFVSFKRVLHDMGSPISKEIQLASFMSCSKGFMGECGLRGGYCELVNFNPDVQAQLYKCLSARLCSSLIGQLAVDVIVNPPEVGEPSYESFQKEKESVLSALKLKAKLVSESLNSLPGFSCNPVTGAMYAFPQLKLPPKAIEAAKDKGVAPDFFYCMNFLDECGICVVPGSGFGQVPGTWHFRITILPTVEQMRIVIQKLEEFHTDFLKKY 497          
BLAST of Alanine aminotransferase 2 vs. TrEMBL
Match: A0A075A163 (Aminotran_1_2 domain-containing protein OS=Opisthorchis viverrini OX=6198 GN=T265_00993 PE=4 SV=1)

HSP 1 Score: 624.78 bits (1610), Expect = 0.000e+0
Identity = 292/468 (62.39%), Postives = 367/468 (78.42%), Query Frame = 1
Query:  214 EYAVRGPIVIKAQELEKRLINNEKLP------FDEVIKCNIGDCHAMGQKPLTFLRQVVALTVLPELINSKKFPADAKHRAKRVLESCGGNSVGSYSQSTGVEIVRKDIASFISKRDGIACNSNDIFLSTGASEAIKVVLQMMATQSHGKDKAGIMVPIPQYPLYSATNAEYNAYQIGYYLSEENNWGINLSELERAINEASNHCIPRAIVIINPGNPTGQVLTADDIKMVIKFAYKHDLLIMADEVYQFNVYAPDRSFLSFKKALHDMGDEY-KSIQIASFMSASKGFMGECGFRGGYCELVNFPDDVQAQLYKCISARLCSSVAGQAMVEAIVNPPRPGEPSYELFEKEKAQVLSDLKLKGQLVTETLNQMPGFHCNAVQGAMYAFPRLELPASAIKEARKLKQAADFFYCSRLLEEMGVCVVPGSGFAQVPDTYHFRMTILPSVDKMKIVMDRIKHFHDGFMKQY 1596
            +YAVRGPIV +AQE+E  L   +KLP      +D VIKCNIGDCHA GQKP++F+RQV+     PE I +   P DAK RA+R LE+CGG SVG YS+STGV IVR+DIA +I KRDG++ N NDIFLS+GASEA+K VLQ+++T   G  +AG+MVPIPQYPLYSAT AEYNA QIGYYL E ++W +N+ +LE  + +A   C+PR +V+INPGNPTGQ+L+ D I+ V++FA++H L+++ADEVYQ NVY+PDRSF+SFK+ LHDMG    K +Q+ASFMS SKGFMGECG RGGYCELVNF  DVQAQLYKC+SARLCS + GQ  V+ IVNPP  GEPSYE F+KEK  VLSDLKLK QLV+E+LN +PGF CN V GAMYAFP+L+LP  AI+ A+    A DFFYC   L+E G+CV+PGSGF QVP T+HFR+TILP+V++M+IV+ +++ FH  F+K+Y
Sbjct:   46 QYAVRGPIVQRAQEIEVEL---QKLPKGAAKKYDHVIKCNIGDCHASGQKPISFIRQVLCAATYPEFIQAVAIPEDAKLRARRFLENCGG-SVGVYSESTGVRIVRQDIARYIEKRDGLSANPNDIFLSSGASEAVKSVLQLISTGCDGNKRAGVMVPIPQYPLYSATIAEYNACQIGYYLDESDHWSLNVDQLEELVEKARGECVPRVLVVINPGNPTGQLLSKDVIRNVLEFAHRHSLVVLADEVYQHNVYSPDRSFVSFKRVLHDMGSSISKELQLASFMSCSKGFMGECGLRGGYCELVNFSPDVQAQLYKCLSARLCSPLLGQLAVDVIVNPPEVGEPSYESFQKEKESVLSDLKLKAQLVSESLNSLPGFSCNPVTGAMYAFPQLKLPPKAIEAAKDKGVAPDFFYCMNFLDEYGICVIPGSGFGQVPGTWHFRITILPTVEQMRIVIQKLQEFHTEFLKKY 509          
BLAST of Alanine aminotransferase 2 vs. TrEMBL
Match: A0A4E0RDS2 (Alanine aminotransferase OS=Fasciola hepatica OX=6192 GN=D915_004407 PE=4 SV=1)

HSP 1 Score: 621.313 bits (1601), Expect = 0.000e+0
Identity = 284/462 (61.47%), Postives = 363/462 (78.57%), Query Frame = 1
Query:  214 EYAVRGPIVIKAQELEKRLINNEKLPFDEVIKCNIGDCHAMGQKPLTFLRQVVALTVLPELINSKKFPADAKHRAKRVLESCGGNSVGSYSQSTGVEIVRKDIASFISKRDGIACNSNDIFLSTGASEAIKVVLQMMATQSHGKDKAGIMVPIPQYPLYSATNAEYNAYQIGYYLSEENNWGINLSELERAINEASNHCIPRAIVIINPGNPTGQVLTADDIKMVIKFAYKHDLLIMADEVYQFNVYAPDRSFLSFKKALHDMGDEY-KSIQIASFMSASKGFMGECGFRGGYCELVNFPDDVQAQLYKCISARLCSSVAGQAMVEAIVNPPRPGEPSYELFEKEKAQVLSDLKLKGQLVTETLNQMPGFHCNAVQGAMYAFPRLELPASAIKEARKLKQAADFFYCSRLLEEMGVCVVPGSGFAQVPDTYHFRMTILPSVDKMKIVMDRIKHFHDGFMKQY 1596
            EYAVRGPIV +AQE+E  L   EK  FD +I+CNIGDC A GQKP++F+R V+++    +L  S + P DAK RA+R L+SCGG SVG YSQSTGV+IVR+D+A +I  RD +  N +DIFLSTGASEA+K++LQ+++T S G  +AGIMVPIPQYPLYSATNAEYNAYQIGYYL EE+ WG+++ +LE  + E  + C+PRA+V+INPGNPTGQVL A+ I+ V++FA++++L+++ADEVYQ N+Y PDR F+SFK+ LHDMG    K +Q+ASFMS SKG+MGECG RGGYCEL+NF  DVQAQLYKC+SARLCSS+ GQ  ++ +VNPP+ GEPSYE F KEK  VLS LK K  LVTE+LN +PGF CN V GAMYAFP+++LP  AI+ A+      DF YC + LEE GVC+VPGSGF Q+P T+HFR+TILP V++MKIVM ++  FH  F+K+Y
Sbjct:   39 EYAVRGPIVQRAQEIENSLRKGEKKSFDHIIRCNIGDCQAAGQKPISFIRNVLSVATNHDLFKSARIPEDAKERARRFLDSCGG-SVGVYSQSTGVQIVREDVARYIKNRDNLPANPSDIFLSTGASEAVKIILQLLSTGSDGSKRAGIMVPIPQYPLYSATNAEYNAYQIGYYLDEEHEWGLDVEQLESKLKEHVSKCVPRALVVINPGNPTGQVLPAEVIRRVLEFAHRYNLVVLADEVYQHNIYFPDRHFVSFKRVLHDMGGSIAKELQLASFMSCSKGYMGECGLRGGYCELINFDPDVQAQLYKCLSARLCSSLLGQLALDVVVNPPQQGEPSYESFTKEKDAVLSALKQKAALVTESLNALPGFRCNPVTGAMYAFPQIKLPPKAIEAAKAAGMNPDFMYCLKFLEETGVCIVPGSGFGQIPGTWHFRITILPPVEEMKIVMKKLGQFHKAFLKEY 499          
BLAST of Alanine aminotransferase 2 vs. TrEMBL
Match: A0A504YJK4 (Alanine aminotransferase OS=Fasciola gigantica OX=46835 GN=FGIG_03447 PE=4 SV=1)

HSP 1 Score: 620.157 bits (1598), Expect = 0.000e+0
Identity = 283/462 (61.26%), Postives = 363/462 (78.57%), Query Frame = 1
Query:  214 EYAVRGPIVIKAQELEKRLINNEKLPFDEVIKCNIGDCHAMGQKPLTFLRQVVALTVLPELINSKKFPADAKHRAKRVLESCGGNSVGSYSQSTGVEIVRKDIASFISKRDGIACNSNDIFLSTGASEAIKVVLQMMATQSHGKDKAGIMVPIPQYPLYSATNAEYNAYQIGYYLSEENNWGINLSELERAINEASNHCIPRAIVIINPGNPTGQVLTADDIKMVIKFAYKHDLLIMADEVYQFNVYAPDRSFLSFKKALHDMGDEY-KSIQIASFMSASKGFMGECGFRGGYCELVNFPDDVQAQLYKCISARLCSSVAGQAMVEAIVNPPRPGEPSYELFEKEKAQVLSDLKLKGQLVTETLNQMPGFHCNAVQGAMYAFPRLELPASAIKEARKLKQAADFFYCSRLLEEMGVCVVPGSGFAQVPDTYHFRMTILPSVDKMKIVMDRIKHFHDGFMKQY 1596
            EYAVRGPIV +AQE+E  L   E+  FD +I+CNIGDC A GQKP++F+R V+++    +L  S + P DAK RA+R L+SCGG SVG YSQSTGV+IVR+D+A +I  RD +  N +DIFLSTGASEA+K++LQ+++T S G  +AGIMVPIPQYPLYSATNAEYNAYQIGYYL EE+ WG+++ +LE  + E  + C+PRA+V+INPGNPTGQVL A+ I+ V++FA++++L+++ADEVYQ N+Y PDR F+SFK+ LHDMG    K +Q+ASFMS SKG+MGECG RGGYCEL+NF  DVQAQLYKC+SARLCSS+ GQ  ++ +VNPP+ GEPSYE F KEK  VLS LK K  LVTE+LN +PGF CN V GAMYAFP+++LP  AI+ A+      DF YC + LEE GVC+VPGSGF Q+P T+HFR+TILP V++MKIVM ++  FH  F+K+Y
Sbjct:   39 EYAVRGPIVQRAQEIENSLRKGERKSFDHIIRCNIGDCQAAGQKPISFIRNVLSVATNHDLFKSARIPEDAKERARRFLDSCGG-SVGVYSQSTGVQIVREDVARYIKNRDNLPANPSDIFLSTGASEAVKIILQLLSTGSDGSKRAGIMVPIPQYPLYSATNAEYNAYQIGYYLDEEHEWGLDVEQLESKLKEHVSKCVPRALVVINPGNPTGQVLPAEVIRRVLEFAHRYNLVVLADEVYQHNIYFPDRHFVSFKRVLHDMGGSIAKELQLASFMSCSKGYMGECGLRGGYCELINFDPDVQAQLYKCLSARLCSSLLGQLALDVVVNPPQQGEPSYESFTKEKDAVLSALKQKAALVTESLNALPGFRCNPVTGAMYAFPQIKLPPKAIEAAKAAGMNPDFMYCLKFLEETGVCIVPGSGFGQIPGTWHFRITILPPVEEMKIVMKKLGQFHKAFLKEY 499          
BLAST of Alanine aminotransferase 2 vs. Ensembl Cavefish
Match: gpt2 (glutamic--pyruvic transaminase 2 [Source:NCBI gene;Acc:103044245])

HSP 1 Score: 552.747 bits (1423), Expect = 0.000e+0
Identity = 262/463 (56.59%), Postives = 343/463 (74.08%), Query Frame = 1
Query:  214 EYAVRGPIVIKAQELEKRLINNEKLPFDEVIKCNIGDCHAMGQKPLTFLRQVVALTVLPELINSKKFPADAKHRAKRVLESCGGNSVGSYSQSTGVEIVRKDIASFISKRD-GIACNSNDIFLSTGASEAIKVVLQMMATQSHGKDKAGIMVPIPQYPLYSATNAEYNAYQIGYYLSEENNWGINLSELERAINEASNHCIPRAIVIINPGNPTGQVLTADDIKMVIKFAYKHDLLIMADEVYQFNVYAPDRSFLSFKKALHDMGDEY-KSIQIASFMSASKGFMGECGFRGGYCELVNFPDDVQAQLYKCISARLCSSVAGQAMVEAIVNPPRPGEPSYELFEKEKAQVLSDLKLKGQLVTETLNQMPGFHCNAVQGAMYAFPRLELPASAIKEARKLKQAADFFYCSRLLEEMGVCVVPGSGFAQVPDTYHFRMTILPSVDKMKIVMDRIKHFHDGFMKQY 1596
            EYAVRGPIVIKA E+EK L    K PF EVIK NIGD HAMGQ+P+TFLRQVVAL   PEL++S  FP DAK RA+R+L+SCGG S+GSYS S GV+ +RKDIA++I +RD G+  +  +IFL+TGAS+ I  +L+++ + + G+ + G+M+PIPQYPLYSA  AE  A Q+ YYL E+N W ++++EL R+   A  HC PR + IINPGNPTGQV +   I+ V+ FAY+ +L +MADEVYQ NVYAPD  F SFKK L++MG EY  S+++ASF S SKG+ GECGFRGG+ E+VN   +V+AQL K +S RLC  VAGQA ++ IVNPP+P EPS+  F KEKA VL  L  K +L  + L+ +PG  CN VQGAMYAFP++ +P  A++EA+ L    D  YC RLLEE G+CVVPGSGF Q   TYHFRMTILPS +K+K+++++++ FH  F+K++
Sbjct:   84 EYAVRGPIVIKAGEIEKSLQEGCKRPFTEVIKANIGDAHAMGQQPITFLRQVVALCTFPELMDSPSFPEDAKRRARRILQSCGGQSLGSYSASQGVDCIRKDIAAYIEQRDQGVPSDWENIFLTTGASDGIVNILRLLVSGA-GRSRTGVMIPIPQYPLYSAAIAEMGAVQVNYYLDEDNCWALDVNELHRSYQAAKEHCQPRVLCIINPGNPTGQVQSKKCIEDVLHFAYEENLFVMADEVYQENVYAPDCQFHSFKKVLYEMGPEYFNSVELASFHSTSKGYTGECGFRGGFMEVVNLDPEVKAQLVKLLSVRLCPPVAGQAAMDVIVNPPQPDEPSFTQFHKEKAAVLGALADKAKLTEQILSAVPGIKCNPVQGAMYAFPQIFIPPRAVEEAKALGMQPDMLYCLRLLEETGICVVPGSGFGQREGTYHFRMTILPSPEKLKVLLEKVRDFHMKFLKEF 545          
BLAST of Alanine aminotransferase 2 vs. Ensembl Cavefish
Match: gpt2l (alanine aminotransferase 2-like [Source:NCBI gene;Acc:111194474])

HSP 1 Score: 537.724 bits (1384), Expect = 0.000e+0
Identity = 252/463 (54.43%), Postives = 337/463 (72.79%), Query Frame = 1
Query:  214 EYAVRGPIVIKAQELEKRLINNEKLPFDEVIKCNIGDCHAMGQKPLTFLRQVVALTVLPELINSKKFPADAKHRAKRVLESCGGNSVGSYSQSTGVEIVRKDIASFISKRDG-IACNSNDIFLSTGASEAIKVVLQMMATQSHGKDKAGIMVPIPQYPLYSATNAEYNAYQIGYYLSEENNWGINLSELERAINEASNHCIPRAIVIINPGNPTGQVLTADDIKMVIKFAYKHDLLIMADEVYQFNVYAPDRSFLSFKKALHDMGDEYKS-IQIASFMSASKGFMGECGFRGGYCELVNFPDDVQAQLYKCISARLCSSVAGQAMVEAIVNPPRPGEPSYELFEKEKAQVLSDLKLKGQLVTETLNQMPGFHCNAVQGAMYAFPRLELPASAIKEARKLKQAADFFYCSRLLEEMGVCVVPGSGFAQVPDTYHFRMTILPSVDKMKIVMDRIKHFHDGFMKQY 1596
            EYAVRGPIV +A ++EK L    K PF+EVIK NIGD HAMGQ+P+TF RQV+AL   PEL++  KFP DAK+RA+R+L++CGG+S+G+Y+ S G++ VR D+A +I +RDG I+C+ ++I+L+TGAS+ I  +L+++ T   G+ + G+M+ IPQYPLYSA  AE  A QI YYL+EE  W +++SEL+R+++ A  +C PR + IINPGNPTGQV +   I+ VI+FA K  L +MADEVYQ NVYA   +F SFKK L +MG E+ S +++ASF S SK +MGECG RGGY E++N   +V+AQL K +S RLC  V GQ ++  + N P+PGEPSY  F  E+   L+DL  K +L  E LN +PG  CN VQGAMY+FP++ LP  AIKEA+   Q  D FYC +LLEE G+C+VPGSGF Q   TYHFRMTILP  DK+KI++D++K FH  F +QY
Sbjct:   64 EYAVRGPIVQRAVQIEKELKEGVKKPFNEVIKANIGDAHAMGQQPITFFRQVLALCSYPELLDDNKFPEDAKNRARRILKACGGSSIGAYTASQGIDCVRIDVARYIERRDGGISCDPDNIYLTTGASDGIVTILKLL-TAGEGRTRTGVMISIPQYPLYSAAIAELGAVQINYYLNEEKCWSLDISELQRSLDAARQYCNPRVLCIINPGNPTGQVQSRQCIEDVIRFAAKERLFLMADEVYQDNVYAEGCAFHSFKKVLFEMGPEFSSTVELASFHSTSKCYMGECGLRGGYMEVINMDPEVKAQLTKLVSVRLCPPVPGQTLMGLVTNSPQPGEPSYAQFITERTATLNDLAQKAKLTEEILNTVPGIRCNPVQGAMYSFPQITLPERAIKEAKAKGQVPDMFYCMKLLEETGICLVPGSGFGQKEGTYHFRMTILPPTDKLKIMLDKLKEFHQRFTQQY 525          
BLAST of Alanine aminotransferase 2 vs. Ensembl Cavefish
Match: gpt2 (glutamic--pyruvic transaminase 2 [Source:NCBI gene;Acc:103044245])

HSP 1 Score: 523.087 bits (1346), Expect = 0.000e+0
Identity = 252/438 (57.53%), Postives = 321/438 (73.29%), Query Frame = 1
Query:  214 EYAVRGPIVIKAQELEKRLINNEKLPFDEVIKCNIGDCHAMGQKPLTFLRQVVALTVLPELINSKKFPADAKHRAKRVLESCGGNSVGSYSQSTGVEIVRKDIASFISKRD-GIACNSNDIFLSTGASEAIKVVLQMMATQSHGKDKAGIMVPIPQYPLYSATNAEYNAYQIGYYLSEENNWGINLSELERAINEASNHCIPRAIVIINPGNPTGQVLTADDIKMVIKFAYKHDLLIMADEVYQFNVYAPDRSFLSFKKALHDMGDEY-KSIQIASFMSASKGFMGECGFRGGYCELVNFPDDVQAQLYKCISARLCSSVAGQAMVEAIVNPPRPGEPSYELFEKEKAQVLSDLKLKGQLVTETLNQMPGFHCNAVQGAMYAFPRLELPASAIKEARKLKQAADFFYCSRLLEEMGVCVVPGSGFAQVPDTYHFRMTI 1521
            EYAVRGPIVIKA E+EK L    K PF EVIK NIGD HAMGQ+P+TFLRQVVAL   PEL++S  FP DAK RA+R+L+SCGG S+GSYS S GV+ +RKDIA++I +RD G+  +  +IFL+TGAS+ I  +L+++ + + G+ + G+M+PIPQYPLYSA  AE  A Q+ YYL E+N W ++++EL R+   A  HC PR + IINPGNPTGQV +   I+ V+ FAY+ +L +MADEVYQ NVYAPD  F SFKK L++MG EY  S+++ASF S SKG+ GECGFRGG+ E+VN   +V+AQL K +S RLC  VAGQA ++ IVNPP+P EPS+  F KEKA VL  L  K +L  + L+ +PG  CN VQGAMYAFP++ +P  A++EA+ L    D  YC RLLEE G+CVVPGSGF Q   TYHFRM I
Sbjct:   84 EYAVRGPIVIKAGEIEKSLQEGCKRPFTEVIKANIGDAHAMGQQPITFLRQVVALCTFPELMDSPSFPEDAKRRARRILQSCGGQSLGSYSASQGVDCIRKDIAAYIEQRDQGVPSDWENIFLTTGASDGIVNILRLLVSGA-GRSRTGVMIPIPQYPLYSAAIAEMGAVQVNYYLDEDNCWALDVNELHRSYQAAKEHCQPRVLCIINPGNPTGQVQSKKCIEDVLHFAYEENLFVMADEVYQENVYAPDCQFHSFKKVLYEMGPEYFNSVELASFHSTSKGYTGECGFRGGFMEVVNLDPEVKAQLVKLLSVRLCPPVAGQAAMDVIVNPPQPDEPSFTQFHKEKAAVLGALADKAKLTEQILSAVPGIKCNPVQGAMYAFPQIFIPPRAVEEAKALGMQPDMLYCLRLLEETGICVVPGSGFGQREGTYHFRMII 520          
BLAST of Alanine aminotransferase 2 vs. Ensembl Cavefish
Match: gpt2 (glutamic--pyruvic transaminase 2 [Source:NCBI gene;Acc:103044245])

HSP 1 Score: 523.087 bits (1346), Expect = 0.000e+0
Identity = 252/438 (57.53%), Postives = 321/438 (73.29%), Query Frame = 1
Query:  214 EYAVRGPIVIKAQELEKRLINNEKLPFDEVIKCNIGDCHAMGQKPLTFLRQVVALTVLPELINSKKFPADAKHRAKRVLESCGGNSVGSYSQSTGVEIVRKDIASFISKRD-GIACNSNDIFLSTGASEAIKVVLQMMATQSHGKDKAGIMVPIPQYPLYSATNAEYNAYQIGYYLSEENNWGINLSELERAINEASNHCIPRAIVIINPGNPTGQVLTADDIKMVIKFAYKHDLLIMADEVYQFNVYAPDRSFLSFKKALHDMGDEY-KSIQIASFMSASKGFMGECGFRGGYCELVNFPDDVQAQLYKCISARLCSSVAGQAMVEAIVNPPRPGEPSYELFEKEKAQVLSDLKLKGQLVTETLNQMPGFHCNAVQGAMYAFPRLELPASAIKEARKLKQAADFFYCSRLLEEMGVCVVPGSGFAQVPDTYHFRMTI 1521
            EYAVRGPIVIKA E+EK L    K PF EVIK NIGD HAMGQ+P+TFLRQVVAL   PEL++S  FP DAK RA+R+L+SCGG S+GSYS S GV+ +RKDIA++I +RD G+  +  +IFL+TGAS+ I  +L+++ + + G+ + G+M+PIPQYPLYSA  AE  A Q+ YYL E+N W ++++EL R+   A  HC PR + IINPGNPTGQV +   I+ V+ FAY+ +L +MADEVYQ NVYAPD  F SFKK L++MG EY  S+++ASF S SKG+ GECGFRGG+ E+VN   +V+AQL K +S RLC  VAGQA ++ IVNPP+P EPS+  F KEKA VL  L  K +L  + L+ +PG  CN VQGAMYAFP++ +P  A++EA+ L    D  YC RLLEE G+CVVPGSGF Q   TYHFRM I
Sbjct:   84 EYAVRGPIVIKAGEIEKSLQEGCKRPFTEVIKANIGDAHAMGQQPITFLRQVVALCTFPELMDSPSFPEDAKRRARRILQSCGGQSLGSYSASQGVDCIRKDIAAYIEQRDQGVPSDWENIFLTTGASDGIVNILRLLVSGA-GRSRTGVMIPIPQYPLYSAAIAEMGAVQVNYYLDEDNCWALDVNELHRSYQAAKEHCQPRVLCIINPGNPTGQVQSKKCIEDVLHFAYEENLFVMADEVYQENVYAPDCQFHSFKKVLYEMGPEYFNSVELASFHSTSKGYTGECGFRGGFMEVVNLDPEVKAQLVKLLSVRLCPPVAGQAAMDVIVNPPQPDEPSFTQFHKEKAAVLGALADKAKLTEQILSAVPGIKCNPVQGAMYAFPQIFIPPRAVEEAKALGMQPDMLYCLRLLEETGICVVPGSGFGQREGTYHFRMII 520          
BLAST of Alanine aminotransferase 2 vs. Ensembl Cavefish
Match: si:ch211-217a12.1 (si:ch211-217a12.1 [Source:ZFIN;Acc:ZDB-GENE-121214-95])

HSP 1 Score: 536.954 bits (1382), Expect = 2.287e-180
Identity = 253/463 (54.64%), Postives = 330/463 (71.27%), Query Frame = 1
Query:  214 EYAVRGPIVIKAQELEKRLINNEKLPFDEVIKCNIGDCHAMGQKPLTFLRQVVALTVLPELINSKKFPADAKHRAKRVLESCGGNSVGSYSQSTGVEIVRKDIASFISKRDG-IACNSNDIFLSTGASEAIKVVLQMMATQSHGKDKAGIMVPIPQYPLYSATNAEYNAYQIGYYLSEENNWGINLSELERAINEASNHCIPRAIVIINPGNPTGQVLTADDIKMVIKFAYKHDLLIMADEVYQFNVYAPDRSFLSFKKALHDMGDEY-KSIQIASFMSASKGFMGECGFRGGYCELVNFPDDVQAQLYKCISARLCSSVAGQAMVEAIVNPPRPGEPSYELFEKEKAQVLSDLKLKGQLVTETLNQMPGFHCNAVQGAMYAFPRLELPASAIKEARKLKQAADFFYCSRLLEEMGVCVVPGSGFAQVPDTYHFRMTILPSVDKMKIVMDRIKHFHDGFMKQY 1596
            EYAVRGPIV +A ++EK L    K PF EVIK NIGDCHAMGQKP+TF RQV+AL   PEL+   KFP D K+RA+R+L++C G S+GSYS S G+E++R D+A +I +RDG I C+ ++I+LS GAS+ I  +L+++ +   G  + G+M+ IPQYPLYSA  AE  A QI YYL E   W +++ EL RA+  A  HC PR + IINPGNPTGQV +   I+ VIKFA + +L +MADEVYQ NVYA    F SFKK L +MG EY + +++ SF S SK +MGECGFRGGY E+VN   +V+ QL K +S RLC  V GQA+++ +VNPP+P EPSY  F KE++  L+ L  K ++  + LNQ+PG  CN VQGAMY+FP ++LP  AI EA++  QA D FYC +LLEE G+C+VPGSGF Q   T+HFRMTILP  +K+KIV+ +IK FH  F +QY
Sbjct:  591 EYAVRGPIVQRAVQIEKELREGVKKPFTEVIKANIGDCHAMGQKPITFFRQVLALCSYPELLEDNKFPEDVKNRARRILQACAGGSIGSYSASQGIELIRNDVARYIERRDGGIPCSPDNIYLSAGASDGIMTMLKLLVS-GEGSSRTGVMISIPQYPLYSAGLAELAAVQINYYLDEAKCWSLDVKELRRALEAARKHCRPRVLCIINPGNPTGQVQSRQCIEDVIKFAAEENLFLMADEVYQDNVYAEGCQFHSFKKVLFEMGPEYSEKVELVSFHSTSKCYMGECGFRGGYMEVVNLDPEVKVQLTKLVSVRLCPPVTGQALLDLVVNPPQPDEPSYATFIKERSHTLAMLAEKAKMTQDILNQVPGISCNPVQGAMYSFPSIQLPPKAIAEAKEKGQAPDMFYCMKLLEEKGICLVPGSGFGQRDGTFHFRMTILPPTEKLKIVLAKIKEFHQSFSEQY 1052          
BLAST of Alanine aminotransferase 2 vs. Ensembl Sea Lamprey
Match: gpt2 (glutamic pyruvate transaminase (alanine aminotransferase) 2 [Source:ZFIN;Acc:ZDB-GENE-030729-8])

HSP 1 Score: 279.256 bits (713), Expect = 3.717e-91
Identity = 136/253 (53.75%), Postives = 171/253 (67.59%), Query Frame = 1
Query:  841 GNPTGQVLTADDIKMVIKFAYKHDLLIMADEVYQFNVYAPDRSFLSFKKALHDMGDEY-KSIQIASFMSASKGFMGECGFRGGYCELVNFPDDVQAQLYKCISARLCSSVAGQAMVEAIVNPPRPGEPSYELFEKEKAQVLSDLKLKGQLVTETLNQMPGFHCNAVQGAMYAFPRLELPASAIKEARKLKQAADFFYCSRLLEEMGVCVVPGSGFAQVPDTYHFRMTILPSVDKMKIVMDRIKHFHDGFMKQY 1596
            GNPTGQV     I+ VI+FA +  L I+ADEVYQ NVYAP   F SFKK LHDMG EY +++Q+AS  S SKGF+GECG RGGY E++N P  V+A+L K +S RLC  V GQA V+ + NPP  GEPS+ L+ +E+  VL  L  K  L  + LN   G  CN VQGAMYAFPR+ +P  A+ EA+      D FYC +LLEE G+CVVPGSGF Q   T+HFRMTILP  +K+KI++ ++  FH  F + Y
Sbjct:    1 GNPTGQVQDRHSIEEVIEFAAEEGLFIIADEVYQDNVYAPGCQFHSFKKVLHDMGPEYEQTVQLASLHSTSKGFLGECGQRGGYMEVLNLPAGVKAELVKLVSVRLCPPVLGQATVDVLANPPELGEPSHSLYVQERDSVLRSLARKALLTAQLLNGTEGIACNPVQGAMYAFPRVHIPPRAVAEAQARGLLPDMFYCLQLLEETGICVVPGSGFGQKDGTHHFRMTILPPEEKLKILLTKVTEFHARFTELY 253          
BLAST of Alanine aminotransferase 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003702.1 (pep scaffold:Pmarinus_7.0:GL476611:173756:192777:1 gene:ENSPMAG00000003364.1 transcript:ENSPMAT00000003702.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 55.0694 bits (131), Expect = 2.618e-8
Identity = 34/122 (27.87%), Postives = 62/122 (50.82%), Query Frame = 1
Query:  655 GIMVPIPQYPLYSATNAEYNAYQIGYY-LS------EENNWGINLSELERAINEASNHCIP-RAIVIINPGNPTGQVLTADDIKMVIKFAYKHDLLIMADEVYQFNVYAPDRSF---LSFKK 987
            GI++P P Y +       Y+  +  +  LS      E + + + + +LE A+  A    +  RA+++INP NP G +  AD +   ++FA +H+L ++ DE+Y   ++     F   LSF +
Sbjct:  159 GILIPTPYYGIIDEDIRHYSGVRTVHVPLSGVPSEDETHPFQLTVPKLETALEAAKKEGMRIRAVILINPNNPLGDIYPADALLSYLEFAKRHELHVIMDEIYMLTIFIKGPKFTSVLSFDR 280          
BLAST of Alanine aminotransferase 2 vs. Ensembl Yeast
Match: ALT2 (Catalytically inactive alanine transaminase; expression is repressed in the presence of alanine and repression is mediated by Nrg1p; ALT2 has a paralog, ALT1, that arose from the whole genome duplication [Source:SGD;Acc:S000002518])

HSP 1 Score: 387.882 bits (995), Expect = 3.828e-130
Identity = 203/477 (42.56%), Postives = 290/477 (60.80%), Query Frame = 1
Query:  214 EYAVRGPIVIKAQELEKRLINN-EKLPFDEVIKCNIGDCHAMGQKPLTFLRQVVALTVLPELINSKK--------FPADAKHRAKRVLESCGGNSVGSYSQSTGVEIVRKDIASFISKRDG-IACNSNDIFLSTGASEAIKVVLQMMATQSHGKDKAGIMVPIPQYPLYSATNAEYNAYQIGYYLSEENNWGINLSELERAINEASNHCI-PRAIVIINPGNPTGQVLTADDIKMVIKFAYKHDLLIMADEVYQFNVYAPDRSFLSFKKAL----HDMGDEYKSIQIASFMSASKGFMGECGFRGGYCELVNFPDDVQAQLYKCISARLCSSVAGQAMVEAIVNPPRPGEPSYELFEKEKAQVLSDLKLKGQLVTETLNQMPGFHCNAVQGAMYAFPRLELPASAIKEARKLKQAADFFYCSRLLEEMGVCVVPGSGFAQVPDTYHFRMTILPSVDKMKIVMDRIKHFHDGFMKQYK 1599
            EYAVRG I  +A EL++ L  N E LPFD++I  NIG+   + QKPLTF RQV+A+   PE++            F  DA  RA+R+L   GG S+G+YS S GV  +R+ +A FI++RDG       DI+L+TGAS A   +L ++   S    + G+++PIPQYPLY+A+ + +NA  + YYL EE+NW  N  E+E+ + +A    I P  +++INPGNPTG VL+ + I  +   A K+ + I++DEVYQ N++  D  F S KK L    H    ++ ++Q+AS  S SKGFM ECG RGGY E++ F  +++  L+K +S  +CS V GQA+V+ +V PP+PG+ SYE    E+ ++  +++ +  L+ ET  ++ G  C   QGAMY FPRL LP  A+ E+ +L    D FYC+ LLE  G+C VPGSGF Q P TYH R T L    K    +   K FH  F  +Y+
Sbjct:   39 EYAVRGAIPTRADELKEELKKNPEVLPFDDIINANIGNPQQLDQKPLTFTRQVLAILEYPEILRVGHNELASLNLFSRDALERAERLLNDIGG-SIGAYSHSQGVPGIRQTVADFITRRDGGEPATPEDIYLTTGASSAATSLLSLLCKDS----QTGLLIPIPQYPLYTASASLFNAQVLPYYLDEESNWSTNSDEIEKVVQDALKKQIRPSVLIVINPGNPTGAVLSEETIARICLIAAKYGITIISDEVYQENIFN-DVKFHSMKKVLRKLQHLYPGKFDNVQLASLHSISKGFMDECGQRGGYMEIIGFSQEIRDALFKLMSISICSVVTGQAVVDLMVKPPQPGDESYEQDHDERLKIFHEMRTRANLLYETFKELEGIECQKPQGAMYLFPRLVLPKKALCESERLGIEPDEFYCTSLLESTGICTVPGSGFGQRPGTYHVRTTFLAPGTKW---IQDWKEFHQDFFSKYR 506          
BLAST of Alanine aminotransferase 2 vs. Ensembl Yeast
Match: ALT1 (Alanine transaminase (glutamic pyruvic transaminase); involved in alanine biosynthesis and catabolism; TOR1-independent role in determining chronological lifespan; expression is induced in the presence of alanine; repression is mediated by Nrg1p; ALT1 has a paralog, ALT2, that arose from the whole genome duplication; Alt2p is catalytically inactive [Source:SGD;Acc:S000004079])

HSP 1 Score: 384.03 bits (985), Expect = 1.866e-127
Identity = 207/478 (43.31%), Postives = 287/478 (60.04%), Query Frame = 1
Query:  214 EYAVRGPIVIKAQELEKRLINN-EKLPFDEVIKCNIGDCHAMGQKPLTFLRQVVALTVLPELIN--------SKKFPADAKHRAKRVLESCGGNSVGSYSQSTGVEIVRKDIASFISKRD-GIACNSNDIFLSTGASEAIKVVLQMMATQSHGKDKAGIMVPIPQYPLYSATNAEYNAYQIGYYLSEENNWGINLSELERAINEA-SNHCIPRAIVIINPGNPTGQVLTADDIKMVIKFAYKHDLLIMADEVYQFNVYAPDRSFLSFKKALHDMGDE----YKSIQIASFMSASKGFMGECGFRGGYCELVNFPDDVQAQLYKCISARLCSSVAGQAMVEAIVNPPRPGEPSYELFEKEKAQVLSDLKLKGQLVTETLNQMPGFHCNAVQGAMYAFPRLELPASAIKEARKLKQAADFFYCSRLLEEMGVCVVPGSGFAQVPDTYHFRMTIL-PSVDKMKIVMDRIKHFHDGFMKQYK 1599
            +YAVRG I ++A+EL+ +L  + + LPFD +I  NIG+   + QKPLT+ RQV++L   PEL+N        SK F  DA  RAK ++E  GG SVG+YS S GVE +RK +A FI+KRD G      DIFL+ GAS A+  +L +         + G+++PIPQYPLY+AT A  N+  + YYL E + W  N  E+E  + EA  N   P  +V+INPGNPTG VL+ + I  + + A K+  +++ADEVYQ N++ P   F S KK L  +  E    + ++Q+AS  S SKG  GECG RGGY EL  F  +++  + K  S  LC  V GQA+V+ +V PP  GE S+E  + E+  +   L  +   + ET N + G  C   QGAMY FP+++LP  A++EAR L+   D FYC +LLE  G+C VPGSGF Q P TYH R T L P ++ +K    + + FH  F  QY+
Sbjct:  124 KYAVRGAIPMRAEELKAQLEKDPQSLPFDRIINANIGNPQQLQQKPLTYYRQVLSLLQYPELLNQNEQQLVDSKLFKLDAIKRAKSLMEDIGG-SVGAYSSSQGVEGIRKSVAEFITKRDEGEISYPEDIFLTAGASAAVNYLLSIFCR----GPETGVLIPIPQYPLYTATLALNNSQALPYYLDENSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTGAVLSPESIAQIFEVAAKYGTVVIADEVYQENIF-PGTKFHSMKKILRHLQREHPGKFDNVQLASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDLMVRPPVEGEESFESDQAERNSIHEKLITRAMTLYETFNSLEGIECQKPQGAMYLFPKIDLPFKAVQEARHLELTPDEFYCKKLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGLEWIK----KWESFHKEFFDQYR 591          
BLAST of Alanine aminotransferase 2 vs. Ensembl Yeast
Match: BNA3 (Kynurenine aminotransferase; catalyzes formation of kynurenic acid from kynurenine; potential Cdc28p substrate [Source:SGD;Acc:S000003596])

HSP 1 Score: 60.8474 bits (146), Expect = 2.142e-10
Identity = 58/251 (23.11%), Postives = 112/251 (44.62%), Query Frame = 1
Query:  754 WGINLSELERAINEASNHCIPRAIVIINPGNPTGQVLTADDIKMVIKFAYKHDLLIMADEVYQFNVYAPDRSFLSFKKALHDMGDEYKSIQIASFMSASKGFMGECGFRGGY-----CELVNFPDDVQAQLYKCISARLCSSVAGQAMVEAIVNPPRPGEPSYELFEKEKAQVLSDLKLKGQLVTETLNQMPGFHCNAVQGAMYA---FPRLELPASAIKEARKLKQAADFFYCSRLLEEMGVCVVPGSGF 1482
            W I+  + E+AI   +     +A++I  P NP G+V T +++  +     KH+++I++DEVY+ ++Y  D SF        ++G    ++      SA K F    G+R G+      EL+++      ++  C ++    S   +A   +I +  + G      FEK + + ++  K+   +  E      G    A +G  +    F ++++P         L +  DF     L+ E+GV  +P + F
Sbjct:  184 WTIDFEQFEKAITSKT-----KAVIINTPHNPIGKVFTREELTTLGNICVKHNVVIISDEVYE-HLYFTD-SFTRIATLSPEIGQLTLTVG-----SAGKSFAA-TGWRIGWVLSLNAELLSYAAKAHTRI--CFAS---PSPLQEACANSINDALKIG-----YFEKMRQEYINKFKIFTSIFDEL-----GLPYTAPEGTYFVLVDFSKVKIPEDYPYPEEILNKGKDFRISHWLINELGVVAIPPTEF 406          
BLAST of Alanine aminotransferase 2 vs. Ensembl Nematostella
Match: EDO30450 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T0S1])

HSP 1 Score: 537.724 bits (1384), Expect = 0.000e+0
Identity = 251/463 (54.21%), Postives = 330/463 (71.27%), Query Frame = 1
Query:  214 EYAVRGPIVIKAQELEKRLINNEKLPFDEVIKCNIGDCHAMGQKPLTFLRQVVALTVLPELINSKKFPADAKHRAKRVLESCGGNSVGSYSQSTGVEIVRKDIASFISKRDGIACNSNDIFLSTGASEAIKVVLQMMATQ-SHGKDKAGIMVPIPQYPLYSATNAEYNAYQIGYYLSEENNWGINLSELERAINEASNHCIPRAIVIINPGNPTGQVLTADDIKMVIKFAYKHDLLIMADEVYQFNVYAPDRSFLSFKKALHDMGDEYKSIQIASFMSASKGFMGECGFRGGYCELVNFPDDVQAQLYKCISARLCSSVAGQAMVEAIVNPPRPGEPSYELFEKEKAQVLSDLKLKGQLVTETLNQMPGFHCNAVQGAMYAFPRLELPASAIKEARKLKQAADFFYCSRLLEEMGVCVVPGSGFAQVPDTYHFRMTILPSVDKMKIVMDRIKHFHDGFMKQYK 1599
            EYAVRG IVI+A ELEK L    + PF EV+K NIGD HA+G KPL F RQV+AL V P L++   FP+DAK RA+R+L S  G S+G+YS S G+E +R+D+  +I +RDG   N  DI+L+ GASE I+ +L+++ T  S G ++AG+M+PIPQYPLYSAT  E N++QI YYL E N W +++ E+ RAINEA  HC+PRA+ +INPGNPTGQVL+ ++I+ VI+F  +  L IMADEVYQ NVYA D  F SFKK L DMG EY+ +++ASF S SKGF+GECGFRGGY E+V    +V+  L K +SA+LCS + GQAM++ +VNPPRPG+ SY+ F KEK  VL+  K + QL+T+T N + G  CN   GAMY+FP LELP  A+  A+      D FY   LLE+ G+CVVPG+GF Q   TYHFR+TILP ++K+K + +  K FH  F+ +YK
Sbjct:   33 EYAVRGAIVIRASELEKELQQGHEKPFKEVVKANIGDAHALGMKPLKFPRQVLALCVNPALLDDPSFPSDAKDRARRILNSTRGFSMGAYSDSVGLEAIREDVTKYIEERDGHPANIEDIYLTNGASEGIRSILKLLQTHVSEGNERAGVMIPIPQYPLYSATLLELNSHQINYYLDEANGWSLDIDEMRRAINEARKHCVPRALCVINPGNPTGQVLSYENIQQVIRFCKEEKLFIMADEVYQANVYAEDAKFHSFKKVLRDMGPEYEDMELASFHSTSKGFLGECGFRGGYMEIVGLDPEVKFHLNKMLSAKLCSCITGQAMMDCLVNPPRPGDESYDEFTKEKEAVLASFKERAQLITKTFNSVEGIQCNESMGAMYSFPGLELPHKAVVAAKSRGLHPDSFYAMELLEQTGLCVVPGNGFGQKDGTYHFRLTILPPIEKLKPLFESFKDFHSKFLAKYK 495          
BLAST of Alanine aminotransferase 2 vs. Ensembl Nematostella
Match: EDO35435 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLG7])

HSP 1 Score: 437.958 bits (1125), Expect = 1.735e-149
Identity = 204/464 (43.97%), Postives = 304/464 (65.52%), Query Frame = 1
Query:  214 EYAVRGPIVIKAQELEKRLINNEKLPFDEVIKCNIGDCHAM-GQKPLTFLRQVVALTVLPELINSKKFPADAKHRAKRVLESCGGNSVGSYSQSTGVEIVRKDIASFISKRDGIACNSNDIFLSTGASEAIKVVLQ-MMATQSHGKDKAGIMVPIPQYPLYSATNAEYNAYQIGYYLSEENNWGINLSELERAINEASNHCIPRAIVIINPGNPTGQVLTADDIKMVIKFAYKHDLLIMADEVYQFNVYAPDRSFLSFKKALHDMGDEYKSIQIASFMSASKGFMGECGFRGGYCELVNFPDDVQAQLYKCISARLCSSVAGQAMVEAIVNPPRPGEPSYELFEKEKAQVLSDLKLKGQLVTETLNQMPGFHCNAVQGAMYAFPRLELPASAIKEARKLKQAADFFYCSRLLEEMGVCVVPGSGFAQVPDTYHFRMTILPSVDKMKIVMDRIKHFHDGFMKQYK 1599
            +Y +RGP+  ++Q +E+ L   +  PF EV+K +IGD   + GQKP+TF+RQV+ L   P+L+  ++FP+D K R + +L    G ++ SY+ S G++IVR+ IA FIS RDG   + ++I+L+ G  EAI++VL+ +M     G  +AG+M+PIP+YPLYS    E N YQI Y+L+E++NW + + EL+RA+N +  HC+PRA+V+INPGNPTGQVLT ++I+ VIKF ++  L++ ADEVYQ N+YA   +F S +K LHD+G+EY+  Q+ S   ++K   GEC  RGGY +L  F +DV++  +  ++   C ++ GQ  +  +  PP+PG+ SY L++KE+  +   +K K  + T  LN + G  CN VQGAMYAFPR+ LP  AI+ A+      D  Y S LLE  G  V PGS   Q   TYHFR+TI+P ++K     ++ K FH+ FMK+Y+
Sbjct:   28 KYGLRGPLDQRSQVIEEELAQGQAKPFTEVVK-HIGDPQGLQGQKPITFMRQVLCLLTYPDLLQDERFPSDVKKRVREILSEKNGGTISSYTSSQGLKIVRQQIADFISTRDGYPEDLSNIYLTNGGGEAIRIVLKALMTADQEGPGRAGVMIPIPEYPLYSGRLLELNGYQIPYFLNEDDNWQLEMGELQRALNSSRPHCVPRALVLINPGNPTGQVLTYENIREVIKFCHRERLVLFADEVYQDNIYADGCAFHSCRKVLHDLGEEYRDFQLVSLHCSAKSHFGECALRGGYYQLTGFDEDVKSFFHNRMTLYSCPNIYGQVAMGIVCQPPKPGDDSYALYDKERTAIQKSMKEKAGMTTRFLNSLAGIQCNTVQGAMYAFPRVLLPDKAIQAAKDQGLTPDSLYASELLEATGQFVAPGSVMGQKEGTYHFRITIIPPLEKTVHQYEQFKRFHEDFMKKYE 490          
BLAST of Alanine aminotransferase 2 vs. Ensembl Nematostella
Match: EDO40513 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S6Z0])

HSP 1 Score: 87.4261 bits (215), Expect = 1.817e-18
Identity = 85/369 (23.04%), Postives = 167/369 (45.26%), Query Frame = 1
Query:  427 KHRAKRVLESCGGNSVGSYSQSTGVEIVRKDIASFISKRDGIACNSNDIFLSTGASEAIKVVLQMMATQSHGKDKAGIMVPIPQYPLYSATNAEYNAYQIGYY-LSEENNWGINLSELERAINEASNHCIPRAIVIINPGNPTGQVLTADDIKMVIKFAYKHDLLIMADEVYQFNVYAPDRSFLSFKKALHDMGDEYKSIQIASFMSASKGFMGECGFRGGYCELVN----FPDDVQAQLYKCISARLCSSVAGQAMVEAIVNPPRPGEPSYELFEKEKAQVLSDLKLKGQLVTETLNQMPGFHCNAVQGAMYAFPRLELPASAIKEARKLKQAADFFYCSRLLEEMGVCVVPGSGFAQVPDTYHFRMT 1518
            K   + + ES        Y+ S+G    ++ IA + S R      + D+ +++G S A+++ + ++           +++P+P + +Y  T +    Y++ +Y L  E +W ++L  +E  I+  +     RAI++ +P NP G V   + ++ +I  A KH L I++DEVY   V++         +  + M    K++ I +  + SK F+   G+R G+  + +    F D+V+  L    +  L ++   QA +  I+   +  +  YE         ++ ++   +LV E L ++PG       GAMY    ++     I +   +K   DF    +L+ E  V  +P   F   P+ +   +T
Sbjct:   63 KEAVEAITESAKSGKNNGYAPSSGYLKSKEAIAKYCS-RPNAEVEAKDVVITSGCSHALEMAISVLLNPGDN-----LLIPLPGFSIYQ-TASISKGYEVRHYNLLPEKSWEVDLEHMESMIDSRT-----RAILVNSPSNPCGSVYNKEHLEAIIAVAEKHMLPIISDEVYADVVFS--------GQTFYPMASLSKNVPILTCGAVSKRFLAP-GWRVGWVLIHDRNGAFEDEVRPGLTALSTILLGANTVIQAALPDILA--KTPDSFYE-------NAINVMQTNAKLVYEELCRIPGLTPIMPCGAMYMMVGID-----ISQFPDIKDDVDF--TEKLVAEQSVFCLPAKCF-HYPNYFRIVLT 393          
BLAST of Alanine aminotransferase 2 vs. Ensembl Nematostella
Match: EDO32652 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SUH9])

HSP 1 Score: 63.1586 bits (152), Expect = 1.026e-10
Identity = 57/223 (25.56%), Postives = 106/223 (47.53%), Query Frame = 1
Query:  481 YSQSTGVEIVRKDIASFIS--KRDGIACNSNDIFLSTGASEAIKVVLQMMATQSHGKDKAGIMVPIPQYPLYSAT---NAEYNAYQIGYYLS------EENNWGINLSELERAINEASNHCIP-RAIVIINPGNPTGQVLTADDIKMVIKFAYKHDLLIMADEVYQFNVYAPDRSF---LSFKKALHDMGDEYKSIQIASFMSASKGFMGECGFRGGYCELVN 1104
            Y    G+   +K +A F++   +     + N++ +  G +  ++ +  ++A    G     I++P P Y  ++A     A+   + +  YLS      E   + +++  LE A+++A    +  R I++ NP NP G + + + ++  + FA+KH L ++ DE+Y  +V+  + SF   LSFK    ++ D  +   I  F   SK F G  GFR G     N
Sbjct:   74 YCDFGGLPSFKKAVADFLNYYMKPAETIDPNNLLVQNGCATVVEALGTVLADPGDG-----ILIPAPYYGGFNADLCQRAQVVPFPV--YLSSKPGPGENGPFQLSVWRLEDALDKAKKQGVTIRGILLTNPNNPVGNIYSDELLQDCLDFAHKHKLHVIFDEIYMLSVFKKEYSFKSILSFK----NIPDRERLHVIWGF---SKDF-GVSGFRCGVLHTWN 281          
BLAST of Alanine aminotransferase 2 vs. Ensembl Medaka
Match: gpt2l (alanine aminotransferase 2-like [Source:NCBI gene;Acc:101161270])

HSP 1 Score: 543.502 bits (1399), Expect = 0.000e+0
Identity = 258/463 (55.72%), Postives = 340/463 (73.43%), Query Frame = 1
Query:  214 EYAVRGPIVIKAQELEKRLINNEKLPFDEVIKCNIGDCHAMGQKPLTFLRQVVALTVLPELINSKKFPADAKHRAKRVLESCGGNSVGSYSQSTGVEIVRKDIASFISKRDG-IACNSNDIFLSTGASEAIKVVLQMMATQSHGKDKAGIMVPIPQYPLYSATNAEYNAYQIGYYLSEENNWGINLSELERAINEASNHCIPRAIVIINPGNPTGQVLTADDIKMVIKFAYKHDLLIMADEVYQFNVYAPDRSFLSFKKALHDMGDEY-KSIQIASFMSASKGFMGECGFRGGYCELVNFPDDVQAQLYKCISARLCSSVAGQAMVEAIVNPPRPGEPSYELFEKEKAQVLSDLKLKGQLVTETLNQMPGFHCNAVQGAMYAFPRLELPASAIKEARKLKQAADFFYCSRLLEEMGVCVVPGSGFAQVPDTYHFRMTILPSVDKMKIVMDRIKHFHDGFMKQY 1596
            EYAVRGPIV +A ELE+ L    K PF EVIK NIGD HAMGQ+P+TF RQV+AL   PEL++   FP DAK+RA+R+L SCGGNS+G+YS S G+E VR+D+A +I +RDG + C+ ++I+L+TGAS+ I  +L+++     G  +AG+M+ IPQYPLYSA  AE  A QI YYL+EE  W +++SEL+RA+NEA  +C PRA+ IINPGNPTGQV +   I+ VI+FA +  L +MADEVYQ NVYA    F SFKK L +MG EY +++++ASF S SK +MGECGFRGGY E++N  ++V+AQL K +S RLC  V GQA+++ +VNPP+PGEPSYE F  E+   LS L  K +L  + LN + G  CN VQGAMY+FPR+ +P  AIKEA +  Q  D FYC ++LEE G+C+VPGSGF Q   TYHFRMTILP  DK+KI++++++ FH  F +QY
Sbjct:   53 EYAVRGPIVQRAVELERELSEGMKKPFAEVIKANIGDAHAMGQQPITFFRQVLALCSYPELLSDSIFPEDAKNRARRILNSCGGNSMGAYSASQGIESVRQDVALYIERRDGGVPCDPDNIYLTTGASDGIVTMLKLLVC-GEGAARAGVMISIPQYPLYSAALAELGAVQINYYLNEEKCWSLDISELQRALNEARRYCNPRALCIINPGNPTGQVQSRQCIEDVIRFAARERLFLMADEVYQDNVYAEGCQFHSFKKVLFEMGPEYSETVELASFHSTSKCYMGECGFRGGYMEIINMDEEVKAQLTKLLSVRLCPPVPGQALMDLVVNPPQPGEPSYERFISERTATLSALAEKAKLTEQVLNTVDGIRCNPVQGAMYSFPRIAIPEKAIKEATENGQQPDMFYCMKMLEETGICLVPGSGFGQKDGTYHFRMTILPPRDKLKILLNKVQEFHQRFTQQY 514          
BLAST of Alanine aminotransferase 2 vs. Ensembl Medaka
Match: si:ch211-217a12.1 (alanine aminotransferase 2-like [Source:NCBI gene;Acc:101168997])

HSP 1 Score: 533.487 bits (1373), Expect = 0.000e+0
Identity = 254/463 (54.86%), Postives = 335/463 (72.35%), Query Frame = 1
Query:  214 EYAVRGPIVIKAQELEKRLINNEKLPFDEVIKCNIGDCHAMGQKPLTFLRQVVALTVLPELINSKKFPADAKHRAKRVLESCGGNSVGSYSQSTGVEIVRKDIASFISKRDG-IACNSNDIFLSTGASEAIKVVLQMMATQSHGKDKAGIMVPIPQYPLYSATNAEYNAYQIGYYLSEENNWGINLSELERAINEASNHCIPRAIVIINPGNPTGQVLTADDIKMVIKFAYKHDLLIMADEVYQFNVYAPDRSFLSFKKALHDMGDEY-KSIQIASFMSASKGFMGECGFRGGYCELVNFPDDVQAQLYKCISARLCSSVAGQAMVEAIVNPPRPGEPSYELFEKEKAQVLSDLKLKGQLVTETLNQMPGFHCNAVQGAMYAFPRLELPASAIKEARKLKQAADFFYCSRLLEEMGVCVVPGSGFAQVPDTYHFRMTILPSVDKMKIVMDRIKHFHDGFMKQY 1596
            EYAVRGPIV +A ++EK L    K PF EVIK NIGD HAMGQKP+TF RQV+AL   P+L+   KFP DAK RA+R+L++CGG+S+G+YS S G+E +R+D+A +I KRDG I  N ++I+LSTGAS+AI  +L+++     G+D+ G+M+ IPQYPLYSA  A+  A QI YYL E+  WG++++EL RA+N A  HC PR + IINPGNPTGQV + + I+ VI+FA + +L +MADEVYQ NVYA    F SFKK L +MG EY  S+++ASF S SK +MGECGFRGGY E++N   +V+AQL K +S RLC  V+GQAM++ +VNPP P EPSY  + KE+  VL+ L  K  L  E  N +PG  CN VQGAMY FPR+ LP  AI +A++  QA D  YC +LLEE G+C+VPGSGF Q   T+HFRMTILP  +K+K+V+ +I+ FH  F +++
Sbjct:   29 EYAVRGPIVQRAVQIEKELREGVKKPFTEVIKANIGDAHAMGQKPITFFRQVLALCSYPDLLEDNKFPEDAKKRARRILDACGGHSIGAYSASQGIECIRQDVARYIEKRDGGIPSNPDNIYLSTGASDAIVTMLKLLVC-GEGRDRTGVMISIPQYPLYSAALADLGAVQINYYLDEDKCWGLDVTELRRALNAAKQHCKPRVLCIINPGNPTGQVQSRECIEDVIRFAKEENLFLMADEVYQDNVYAKGCKFHSFKKVLFEMGPEYSSSLEMASFHSTSKCYMGECGFRGGYMEVLNMDPEVKAQLTKLVSVRLCPPVSGQAMLDLVVNPPLPDEPSYASYVKERTAVLAALAEKSHLTEEMFNTVPGITCNPVQGAMYTFPRITLPQKAIAKAQEEGQAPDMLYCMKLLEEEGICLVPGSGFGQKEGTFHFRMTILPPTEKLKVVLQKIRDFHLRFTQEF 490          
BLAST of Alanine aminotransferase 2 vs. Ensembl Medaka
Match: ENSORLT00000021621.2 (alanine aminotransferase 2 [Source:NCBI gene;Acc:101172281])

HSP 1 Score: 357.451 bits (916), Expect = 1.032e-117
Identity = 180/452 (39.82%), Postives = 268/452 (59.29%), Query Frame = 1
Query:  247 AQELEKRLINNEKLPFDEVIKCNIGDCHAMGQKPLTFLRQVVALTVLPELINSKKFPADAKHRAKRVLESCGGNSVGSYSQSTGVEIVRKDIASFISKRDG-IACNSNDIFLSTGASEAIKVVLQMMATQSHGKDKAGIMVPIPQYPLYSATNAEYNAYQIGYYLSEENNWGINLSELERAINEASNHCIPRAIVIINPGNPTGQVLTADDIKMVIKFAYKHDLLIMADEVYQFNVYAPDRSFLSFKKALHDMGDEYK-SIQIASFMSASKGFMGECGFRGGYCELVNFPDDVQAQLYKCISARLCSSVAGQAMVEAIVNPPRPGEPSYELFEKEKAQVLSDLKLKGQLVTETLNQMPGFHCNAVQGAMYAFPRLELPASAIKEARKLKQAADFFYCSRLLEEMGVCVVPGSGFAQVPDTYHFRMTILPSVDKMKIVMDRIKHFHDGFMKQY 1596
             +++++ L    K PF EVI  + GD H  G KPLTF+RQV+A  + P+L+N +K P D + RA+++L+ C G SVGSYS + G+  + + ++ FIS+RDG +  N  +IFL  G+  A+  +L ++   +      G++ P P Y   + +        + YYLSEE  W + + EL RA+      C P A+ +INPGNP GQV +   ++ VI+FA +  L ++ADEVYQ  +Y  ++ F+S+K+ L +MG     ++++ASF SASKGFMGECG RGGY ELVN    V+  +Y    A     V GQ  ++ + NPP+PG+PSY L+ +E   + S +    +   E +N + GF C AV+G  +AFPR+ LPA AI++A++     D FYC RLLEE GV   PGS + Q   T+H R  IL   D +  ++ R+  FH  FMK +
Sbjct:   26 TKQIKEDLRQGVKKPFKEVIDVSWGDPHRGGVKPLTFVRQVLAACLYPQLMNGEKLPVDVRQRAQKLLDGCAGWSVGSYSATGGLPEIVQRVSEFISRRDGGVQSNPENIFLCCGSQWALTRILNVLVN-AEAPYPTGVLTPAPCYSTTTLSIEGLGGVVVPYYLSEERGWELQVEELHRALESCKGACHPIALYVINPGNPAGQVQSRKSMQEVIRFASEKRLFLLADEVYQGCIYG-EKEFVSYKRVLSEMGPPLSDTVELASFHSASKGFMGECGLRGGYVELVNLDPAVKKYIYTLFCADSSPPVLGQIALDLMTNPPQPGDPSYLLYYQETQHIRSTVVKNVKKACEVINSLQGFSCQAVEGGAFAFPRIHLPAKAIQKAKEAGMQPDTFYCLRLLEEAGVLASPGSDYGQEEGTFHIRFCILLPHDVLGELLQRLSDFHTQFMKDF 475          
BLAST of Alanine aminotransferase 2 vs. Ensembl Medaka
Match: ENSORLT00000016290.2 (alanine aminotransferase 2 [Source:NCBI gene;Acc:105353973])

HSP 1 Score: 308.531 bits (789), Expect = 1.920e-98
Identity = 162/452 (35.84%), Postives = 257/452 (56.86%), Query Frame = 1
Query:  247 AQELEKRLINNEKLPFDEVIKCNIGDCHAMGQKPLTFLRQVVALTVLPELINSKKFPADAKHRAKRVLESCGGNSVGSYSQSTGVEIVRKDIASFISKRD-GIACNSNDIFLSTGASEAIKVVLQMMATQSHGKDKAGIMVPIPQYPLYSATNAEYNAYQIGYYLSEENNWGINLSELERAINEASNHCIPRAIVIINPGNPTGQVLTADDIKMVIKFAYKHDLLIMADEVYQFNVYAPDRSFLSFKKALHDMGDEY-KSIQIASFMSASKGFMGECGFRGGYCELVNFPDDVQAQLYKCISARLCSSVAGQAMVEAIVNPPRPGEPSYELFEKEKAQVLSDLKLKGQLVTETLNQMPGFHCNAVQGAMYAFPRLELPASAIKEARKLKQAADFFYCSRLLEEMGVCVVPGSGFAQVPDTYHFRMTILPSVDKMKIVMDRIKHFHDGFMKQY 1596
            A ++ + +    + P   VI  + GD H  G KP++F+RQV+A+ + P L+    FP D K RA+R+L+ C G S+GSY+ S+G+  +R+ IA FI+KRD GI+ N  ++F+S+GA  A+ VV++++++   G+ + GI+ P P          E     + Y L EE  W ++L++L +A++ +   C PRA+ I NPGNPTG V     I+ VI+ A    LL++ DEVYQ +VY  +  FLS+KK L +MG E+ +++++ SF S S   + ECG R GY E VN   DV       +   + +   GQ  ++ ++NPP PGEPSY+   +E     + L    Q   E LN +PGF C    G +Y +P ++LPA   ++A  L   AD FYC +LLEE  + +  G  ++    ++HFR+ +L   + ++  + R+  FH   M  +
Sbjct:   27 AHQITQNMTQGGQKPLKGVIDLSSGDPHRAGMKPVSFVRQVLAVCLYPHLLQDTIFPLDVKLRAQRLLQICEGQSLGSYTASSGLHHIRQTIADFITKRDTGISANPRNVFISSGAQRALMVVVKLLSS-GEGQTQTGILAPQPCPHTLPPLLDEAGVLAVPYRLMEERGWALDLNQLRQALDSSRGGCNPRAVYISNPGNPTGHVQDRKSIQEVIQLATAEKLLLLVDEVYQDSVYGQNTEFLSYKKVLFEMGQEFSETVELVSFHSLSCASVAECGLRAGYMEAVNIDPDVMKVFDTMLCTDISAPTTGQLALDLMLNPPGPGEPSYDTHAQELLLTRTVLTRNAQRALEVLNDLPGFSCQPAMGGIYLYPSVKLPAGIREQAEMLGLGADVFYCQKLLEEELLLLGAGQ-YSGEAGSHHFRLCVLVPTNVLEDALHRLSAFHLHLMGHH 476          
BLAST of Alanine aminotransferase 2 vs. Ensembl Medaka
Match: tat (tyrosine aminotransferase [Source:NCBI gene;Acc:101171329])

HSP 1 Score: 78.1814 bits (191), Expect = 6.080e-15
Identity = 86/372 (23.12%), Postives = 154/372 (41.40%), Query Frame = 1
Query:  481 YSQSTGVEIVRKDIASFISKRDGIACNSNDIFLSTGASEAIKVVLQMMATQSHGKDKAGIMVPIPQYPLYSATNAEYNAYQIGYYLSEENNWGINLSELERAINEASNHCIPRAIVIINPGNPTGQVLTADDIKMVIKFAYKHDLLIMADEVYQFNVY----APDRSFLSFKKALHDMGDEYKSIQIASFMSASKGFMGECGFRGGYCELVN----FPDDVQAQLYKCISARLCSSVAGQAMVEAIVNPPRPGEPSYELFEKEKAQVLSDLKLKGQLVTETLNQMPGFHCNAVQGAMYAFPRLELPASAIKEARKLKQAADFFYCSRLLEEMGVCVVPGSGFAQVPDTYHFRMTILPSVDKMKIVMDRIKHF 1572
            Y+ S G    R+ +A+F S        + D+ L++G S+AI++ + ++           I+VP P + LY             Y L  + +W I+L  LE  I+E ++      +++ NP NP G V + + ++ ++K A K+ + I+ADE+Y   V+    +P  + LS    +   G   K   +              G+R G+  + +    F   ++  L K     L +    Q  +E+I+N      P     +      +S LK   ++    L+ +PG +     GAMY    +++               DF    RL+ E  V  +P S F + P+   FR+ +    + M     RI+ F
Sbjct:  130 YAPSVGYLKSRQAVANFYSIPQA-PLEAEDVILTSGCSQAIELAINVLCNPGDN-----ILVPCPGFSLYKTLAVSVGIEVKLYNLLPDKSWEIDLQHLESMIDERTS-----CLIVTNPSNPCGSVFSKEHLQKILKVASKYCVPILADEIYSDMVFPGCSSPSLACLSSDVPILSCGGLAKRWLVP-------------GWRLGWILIHDRNDIFGSKIRQGLVKLSQRILGACTIVQGALESILN----NTP-----QSFYNNTISFLKSNSEICYNQLSLVPGLNPVMPSGAMYLMVGIDM-----DHFPDFTNDVDF--TERLVTEQSVFCLPASAF-EYPN--FFRIVVTVPEELMLQACARIREF 458          
BLAST of Alanine aminotransferase 2 vs. Planmine SMEST
Match: SMESG000009990.1 (SMESG000009990.1)

HSP 1 Score: 964.526 bits (2492), Expect = 0.000e+0
Identity = 461/462 (99.78%), Postives = 461/462 (99.78%), Query Frame = 1
Query:  214 EYAVRGPIVIKAQELEKRLINNEKLPFDEVIKCNIGDCHAMGQKPLTFLRQVVALTVLPELINSKKFPADAKHRAKRVLESCGGNSVGSYSQSTGVEIVRKDIASFISKRDGIACNSNDIFLSTGASEAIKVVLQMMATQSHGKDKAGIMVPIPQYPLYSATNAEYNAYQIGYYLSEENNWGINLSELERAINEASNHCIPRAIVIINPGNPTGQVLTADDIKMVIKFAYKHDLLIMADEVYQFNVYAPDRSFLSFKKALHDMGDEYKSIQIASFMSASKGFMGECGFRGGYCELVNFPDDVQAQLYKCISARLCSSVAGQAMVEAIVNPPRPGEPSYELFEKEKAQVLSDLKLKGQLVTETLNQMPGFHCNAVQGAMYAFPRLELPASAIKEARKLKQAADFFYCSRLLEEMGVCVVPGSGFAQVPDTYHFRMTILPSVDKMKIVMDRIKHFHDGFMKQYK 1599
            EYAVRGPIVIKAQELEKRLINNEKLPFDEVIKCNIGDCHAMGQKPLTFLRQVVALTVLPELINSKKFPADAKHRAKRVLESCGGNSVGSYSQSTGVEIVRKDIASFISKRDGIACNSNDIFLSTGASEAIKVVLQMMATQSHGKDKAGIMVPIPQYPLYSATNAEYNAYQIGYYLSEENNWGINLSELERAINEASNHCIPRAIVIINPGNPTGQVLTADDIKMVIKFAYKHDLLIMADEVYQFNVYAPDRSFLSFKKALHDMGDEYKSIQIASFMSASKGFMGECGFRGGYCELVNFPDDVQAQLYKCISARLCSSVAGQAMVEAIVNPPRPGEPSYELFEKEKAQVLSDLKLKGQLVTETLNQMPGFHCNAVQGAMYAFPRLELPASAIKEARKLKQAADFFYCSRLLEE GVCVVPGSGFAQVPDTYHFRMTILPSVDKMKIVMDRIKHFHDGFMKQYK
Sbjct:   42 EYAVRGPIVIKAQELEKRLINNEKLPFDEVIKCNIGDCHAMGQKPLTFLRQVVALTVLPELINSKKFPADAKHRAKRVLESCGGNSVGSYSQSTGVEIVRKDIASFISKRDGIACNSNDIFLSTGASEAIKVVLQMMATQSHGKDKAGIMVPIPQYPLYSATNAEYNAYQIGYYLSEENNWGINLSELERAINEASNHCIPRAIVIINPGNPTGQVLTADDIKMVIKFAYKHDLLIMADEVYQFNVYAPDRSFLSFKKALHDMGDEYKSIQIASFMSASKGFMGECGFRGGYCELVNFPDDVQAQLYKCISARLCSSVAGQAMVEAIVNPPRPGEPSYELFEKEKAQVLSDLKLKGQLVTETLNQMPGFHCNAVQGAMYAFPRLELPASAIKEARKLKQAADFFYCSRLLEETGVCVVPGSGFAQVPDTYHFRMTILPSVDKMKIVMDRIKHFHDGFMKQYK 503          
BLAST of Alanine aminotransferase 2 vs. Planmine SMEST
Match: SMESG000007248.1 (SMESG000007248.1)

HSP 1 Score: 691.034 bits (1782), Expect = 0.000e+0
Identity = 322/463 (69.55%), Postives = 383/463 (82.72%), Query Frame = 1
Query:  214 EYAVRGPIVIKAQELEKRLINNEKLPFDEVIKCNIGDCHAMGQKPLTFLRQVVALTVLPELINSKKFPADAKHRAKRVLESCGGNSVGSYSQSTGVEIVRKDIASFISKRDGIACNSNDIFLSTGASEAIKVVLQMMATQSHGKDKAGIMVPIPQYPLYSATNAEYNAYQIGYYLSEENNWGINLSELERAINEASNHCIPRAIVIINPGNPTGQVLTADDIKMVIKFAYKHDLLIMADEVYQFNVYAPDRSFLSFKKALHDMGDEY-KSIQIASFMSASKGFMGECGFRGGYCELVNFPDDVQAQLYKCISARLCSSVAGQAMVEAIVNPPRPGEPSYELFEKEKAQVLSDLKLKGQLVTETLNQMPGFHCNAVQGAMYAFPRLELPASAIKEARKLKQAADFFYCSRLLEEMGVCVVPGSGFAQVPDTYHFRMTILPSVDKMKIVMDRIKHFHDGFMKQYK 1599
            EYAVRGPIV +A ELE  L   +  PF EVIKCNIGDCHAMGQKP+TF+RQV AL  +PE+ N   FP+DAK RAKR+LESCGG S+GSYSQSTGVEI+R+D A FIS+RDGI   S DIF+S GASEAIK +LQ+++TQ  GKD+AG+M+PIPQYPLYSATNAEYNAYQIGY+L E+  WG++  ELERAINEA + C PRAIVIINPGNPTGQVLT DDI+MVI+FA KH+LLIMADEVYQFN+YA +R+F+S KKALH+MG EY KS+ +ASFMS SKG+MGECGFRGGYCEL+N+  +V+AQLYKC+SARLCSSV GQ +++ +VN P+ GEPSYELFEKEK +VLSDLK KG+LV+ET N +PGF CN+VQGAMYAFP++ELP   I  A+ L   ADFFYC  LLE+ GVCVVPGSGF Q   T+HFR+TILP V+KM+ VM  IK FH  FM++YK
Sbjct:    9 EYAVRGPIVQRALELENELKKGKSHPFKEVIKCNIGDCHAMGQKPITFIRQVAALLAMPEMQNDPNFPSDAKQRAKRILESCGGGSIGSYSQSTGVEIIRQDCAKFISERDGIPSESQDIFVSNGASEAIKSILQILSTQKDGKDRAGVMIPIPQYPLYSATNAEYNAYQIGYFLEEDQFWGLSEKELERAINEAKDKCHPRAIVIINPGNPTGQVLTRDDIEMVIRFAKKHNLLIMADEVYQFNIYAENRTFISMKKALHEMGAEYNKSVTLASFMSTSKGYMGECGFRGGYCELINWDGEVKAQLYKCLSARLCSSVIGQGILDVVVNCPKKGEPSYELFEKEKNKVLSDLKAKGKLVSETFNSLPGFKCNSVQGAMYAFPKIELPPKVIAAAKALNYTADFFYCLNLLEQTGVCVVPGSGFGQKEGTFHFRITILPPVEKMQTVMKLIKEFHLKFMEKYK 471          
BLAST of Alanine aminotransferase 2 vs. Planmine SMEST
Match: SMESG000007253.1 (SMESG000007253.1)

HSP 1 Score: 669.463 bits (1726), Expect = 0.000e+0
Identity = 313/462 (67.75%), Postives = 376/462 (81.39%), Query Frame = 1
Query:  214 EYAVRGPIVIKAQELEKRLINNEKLPFDEVIKCNIGDCHAMGQKPLTFLRQVVALTVLPELINSKKFPADAKHRAKRVLESCGGNSVGSYSQSTGVEIVRKDIASFISKRDGIACNSNDIFLSTGASEAIKVVLQMMATQSHGKDKAGIMVPIPQYPLYSATNAEYNAYQIGYYLSEENNWGINLSELERAINEASNHCIPRAIVIINPGNPTGQVLTADDIKMVIKFAYKHDLLIMADEVYQFNVYAPDRSFLSFKKALHDMGDEY-KSIQIASFMSASKGFMGECGFRGGYCELVNFPDDVQAQLYKCISARLCSSVAGQAMVEAIVNPPRPGEPSYELFEKEKAQVLSDLKLKGQLVTETLNQMPGFHCNAVQGAMYAFPRLELPASAIKEARKLKQAADFFYCSRLLEEMGVCVVPGSGFAQVPDTYHFRMTILPSVDKMKIVMDRIKHFHDGFMKQY 1596
            EYAVRGPIV +A ELE  +   +  PF EVIKCNIGDCHAMGQKP+TF+RQV AL  +PEL N    P DAK RA+ +L +CGG+SVGSYS STGVE+VR+  + FI++RD I  +  +IFL+TGASEAIK VLQ++++Q  G+++AG+MVPIPQYPLYSATNAEYNAYQIGY+L E N WG++  ELERAINEA + C PRAIVIINPGNPTGQVLT DDI+MVI+FA KH+LLIMADEVYQFN+YA +R+F+S KKALH+MG EY KS+ +ASFMS SKG+MGECGFRGGYCELVN+  +V+AQLYKC+SARLCSSV GQ +++ +VN P+ GEPSYELFEKEK +VLSDLK KG+LV+ET N +PGF CN VQGAMYAFP++ELP   I  A+ L   ADFFYC  LLE+ GVCVVPGSGF Q   T+HFR+TILPSV+KM+ VM  IK FH  FM +Y
Sbjct:    9 EYAVRGPIVQRAMELENEMNQGKTFPFKEVIKCNIGDCHAMGQKPITFIRQVAALLAMPELQNDPNIPRDAKERAQSILGNCGGSSVGSYSASTGVELVRQHCSRFITERDRIPSDPQNIFLTTGASEAIKSVLQILSSQKEGRERAGVMVPIPQYPLYSATNAEYNAYQIGYFLDEANCWGLSEKELERAINEAKDKCHPRAIVIINPGNPTGQVLTRDDIEMVIRFAKKHNLLIMADEVYQFNIYAENRTFISMKKALHEMGAEYNKSVTLASFMSTSKGYMGECGFRGGYCELVNWDGEVKAQLYKCLSARLCSSVIGQGILDVVVNSPKKGEPSYELFEKEKNKVLSDLKAKGKLVSETFNSLPGFKCNPVQGAMYAFPKIELPPKVIAAAKALNYTADFFYCLNLLEQTGVCVVPGSGFGQKEGTFHFRITILPSVEKMQTVMKLIKEFHVKFMAKY 470          
BLAST of Alanine aminotransferase 2 vs. Planmine SMEST
Match: SMESG000007253.1 (SMESG000007253.1)

HSP 1 Score: 581.637 bits (1498), Expect = 0.000e+0
Identity = 271/396 (68.43%), Postives = 328/396 (82.83%), Query Frame = 1
Query:  214 EYAVRGPIVIKAQELEKRLINNEKLPFDEVIKCNIGDCHAMGQKPLTFLRQVVALTVLPELINSKKFPADAKHRAKRVLESCGGNSVGSYSQSTGVEIVRKDIASFISKRDGIACNSNDIFLSTGASEAIKVVLQMMATQSHGKDKAGIMVPIPQYPLYSATNAEYNAYQIGYYLSEENNWGINLSELERAINEASNHCIPRAIVIINPGNPTGQVLTADDIKMVIKFAYKHDLLIMADEVYQFNVYAPDRSFLSFKKALHDMGDEY-KSIQIASFMSASKGFMGECGFRGGYCELVNFPDDVQAQLYKCISARLCSSVAGQAMVEAIVNPPRPGEPSYELFEKEKAQVLSDLKLKGQLVTETLNQMPGFHCNAVQGAMYAFPRLELPASAIKEAR 1398
            EYAVRGPIV +A ELE  +   +  PF EVIKCNIGDCHAMGQKP+TF+RQV AL  +PEL N    P DAK RA+ +L +CGG+SVGSYS STGVE+VR+  + FI++RD I  +  +IFL+TGASEAIK VLQ++++Q  G+++AG+MVPIPQYPLYSATNAEYNAYQIGY+L E N WG++  ELERAINEA + C PRAIVIINPGNPTGQVLT DDI+MVI+FA KH+LLIMADEVYQFN+YA +R+F+S KKALH+MG EY KS+ +ASFMS SKG+MGECGFRGGYCELVN+  +V+AQLYKC+SARLCSSV GQ +++ +VN P+ GEPSYELFEKEK +VLSDLK KG+LV+ET N +PGF CN VQGAMYAFP++ELP   I  A+
Sbjct:    9 EYAVRGPIVQRAMELENEMNQGKTFPFKEVIKCNIGDCHAMGQKPITFIRQVAALLAMPELQNDPNIPRDAKERAQSILGNCGGSSVGSYSASTGVELVRQHCSRFITERDRIPSDPQNIFLTTGASEAIKSVLQILSSQKEGRERAGVMVPIPQYPLYSATNAEYNAYQIGYFLDEANCWGLSEKELERAINEAKDKCHPRAIVIINPGNPTGQVLTRDDIEMVIRFAKKHNLLIMADEVYQFNIYAENRTFISMKKALHEMGAEYNKSVTLASFMSTSKGYMGECGFRGGYCELVNWDGEVKAQLYKCLSARLCSSVIGQGILDVVVNSPKKGEPSYELFEKEKNKVLSDLKAKGKLVSETFNSLPGFKCNPVQGAMYAFPKIELPPKVIAAAK 404          
BLAST of Alanine aminotransferase 2 vs. Planmine SMEST
Match: SMESG000035843.1 (SMESG000035843.1)

HSP 1 Score: 76.2554 bits (186), Expect = 1.342e-14
Identity = 86/377 (22.81%), Postives = 159/377 (42.18%), Query Frame = 1
Query:  445 VLESCGGNSVGSYSQSTGVEIVRKDIASFISKRDGIACNSNDIFLSTGASEAIKVVLQMMATQSHGKDKAGIMVPIPQYPLYSATNAEYNAYQIGYY-LSEENNWGINLSELERAINEASNHCIPRAIVIINPGNPTGQVLTADDIKMVIKFAYKHDLLIMADEVYQFNVYAPDRSFLSFKKALHDMGDEYKSIQIASFMSASKGFMGECGFRGGYCELVNFPDDVQAQLYKCISARLCSSVAGQAMVEAIVNPPRPGEPSYELFEKEKAQVLSDLKLKGQLVTETLNQMPGFHCNAVQGAMYAFPRLELPASAIKEARKLKQAADFFYCSRLLEEMGVCVVPGSGFAQVPDTYHFRMTILPSVDKMKIVMDRIKHF 1572
            V+ES        Y+ +TG    R  +A + S       +S D+ +++G S A++  + ++A          I++P P +P+Y  T       +  YY L  E  W +++  LE  I+  +      AI+I NP NP G V + D +  ++K A  + L I+ADE+Y F  +  +     F  +L+D       + + S    +K F+   G+R G+  + +     + + +  +   L            IV    P +  + + E      +  +K    +V    ++ PG +    +GAMYA   + L     +  +  K   DF     +++E  V  +P   F  + + +   +T+ P V  M    +RIK +
Sbjct:   86 VVESVRSGKYNGYAPATGYVEARSAVAKY-SMCSNYNLSSEDVIITSGCSSALEHCILVLANPGQN-----ILIPRPGFPIYH-TLCHATGIETKYYNLLPEKEWQVDIEHLENQIDNDT-----VAILINNPSNPCGSVYSRDHLIEILKVAECYSLPIIADEIYSFFTF--NGLDFEFMASLND------KVPVLSCNGLTKRFLCP-GWRLGWIVIYD-----KYKRFTEVRQGLSDLATRTIGANTIVQGALP-QILFGVSEDHFESTIRIIKENFDIVESVFSKTPGLNLVKPKGAMYAMVEVRL-----ENFKAFKANEDFII--NMVKEESVFCLPSEPFG-ISNYFRILLTLPPEV--MIEACERIKSY 425          
The following BLAST results are available for this feature:
BLAST of Alanine aminotransferase 2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GPT20.000e+054.43glutamic--pyruvic transaminase 2 [Source:HGNC Symb... [more]
GPT9.426e-18053.56glutamic--pyruvic transaminase [Source:HGNC Symbol... [more]
GPT9.426e-18053.56glutamic--pyruvic transaminase [Source:HGNC Symbol... [more]
GPT29.308e-17453.66glutamic--pyruvic transaminase 2 [Source:HGNC Symb... [more]
GPT21.920e-6453.76glutamic--pyruvic transaminase 2 [Source:HGNC Symb... [more]
back to top
BLAST of Alanine aminotransferase 2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
C32F10.85.797e-17753.23pep chromosome:WBcel235:I:5822841:5825231:-1 gene:... [more]
C32F10.85.797e-17753.23pep chromosome:WBcel235:I:5822841:5826147:-1 gene:... [more]
C32F10.85.797e-17753.23pep chromosome:WBcel235:I:5822841:5825074:-1 gene:... [more]
C32F10.85.797e-17753.23pep chromosome:WBcel235:I:5822841:5826148:-1 gene:... [more]
C32F10.82.293e-11455.92pep chromosome:WBcel235:I:5823081:5825231:-1 gene:... [more]
back to top
BLAST of Alanine aminotransferase 2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG16400.000e+053.78gene:FBgn0030478 transcript:FBtr0073770[more]
CG16400.000e+053.78gene:FBgn0030478 transcript:FBtr0073773[more]
CG16400.000e+053.78gene:FBgn0030478 transcript:FBtr0073774[more]
CG16400.000e+053.78gene:FBgn0030478 transcript:FBtr0073771[more]
CG16400.000e+053.78gene:FBgn0030478 transcript:FBtr0073772[more]
back to top
BLAST of Alanine aminotransferase 2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gpt20.000e+056.56glutamic pyruvate transaminase (alanine aminotrans... [more]
si:ch211-217a12.10.000e+055.72si:ch211-217a12.1 [Source:ZFIN;Acc:ZDB-GENE-121214... [more]
si:ch211-217a12.10.000e+055.72si:ch211-217a12.1 [Source:ZFIN;Acc:ZDB-GENE-121214... [more]
gpt2l0.000e+055.29glutamic pyruvate transaminase (alanine aminotrans... [more]
gpt2l6.388e-4159.81glutamic pyruvate transaminase (alanine aminotrans... [more]
back to top
BLAST of Alanine aminotransferase 2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gpt0.000e+056.16glutamic-pyruvate transaminase (alanine aminotrans... [more]
gpt0.000e+056.16glutamic-pyruvate transaminase (alanine aminotrans... [more]
gpt0.000e+056.16glutamic-pyruvate transaminase (alanine aminotrans... [more]
gpt0.000e+056.16glutamic-pyruvate transaminase (alanine aminotrans... [more]
gpt0.000e+056.16glutamic-pyruvate transaminase (alanine aminotrans... [more]
back to top
BLAST of Alanine aminotransferase 2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Gpt20.000e+055.63glutamic pyruvate transaminase (alanine aminotrans... [more]
Gpt0.000e+052.70glutamic pyruvic transaminase, soluble [Source:MGI... [more]
Gpt0.000e+052.70glutamic pyruvic transaminase, soluble [Source:MGI... [more]
Gpt1.784e-11750.86glutamic pyruvic transaminase, soluble [Source:MGI... [more]
Gpt2.719e-9051.81glutamic pyruvic transaminase, soluble [Source:MGI... [more]
back to top
BLAST of Alanine aminotransferase 2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8BGT5|ALAT2_MOUSE0.000e+055.63Alanine aminotransferase 2 OS=Mus musculus OX=1009... [more]
sp|Q28DB5|ALAT2_XENTR0.000e+056.16Alanine aminotransferase 2 OS=Xenopus tropicalis O... [more]
sp|Q6GM82|ALAT2_XENLA0.000e+056.37Alanine aminotransferase 2 OS=Xenopus laevis OX=83... [more]
sp|Q8TD30|ALAT2_HUMAN0.000e+054.43Alanine aminotransferase 2 OS=Homo sapiens OX=9606... [more]
sp|Q6NYL5|ALAT2_DANRE0.000e+055.29Alanine aminotransferase 2-like OS=Danio rerio OX=... [more]
back to top
BLAST of Alanine aminotransferase 2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4S2MFV40.000e+063.42Aminotran_1_2 domain-containing protein OS=Opistho... [more]
A0A419QHT40.000e+063.42Alanine aminotransferase 2 OS=Clonorchis sinensis ... [more]
A0A075A1630.000e+062.39Aminotran_1_2 domain-containing protein OS=Opistho... [more]
A0A4E0RDS20.000e+061.47Alanine aminotransferase OS=Fasciola hepatica OX=6... [more]
A0A504YJK40.000e+061.26Alanine aminotransferase OS=Fasciola gigantica OX=... [more]
back to top
BLAST of Alanine aminotransferase 2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gpt20.000e+056.59glutamic--pyruvic transaminase 2 [Source:NCBI gene... [more]
gpt2l0.000e+054.43alanine aminotransferase 2-like [Source:NCBI gene;... [more]
gpt20.000e+057.53glutamic--pyruvic transaminase 2 [Source:NCBI gene... [more]
gpt20.000e+057.53glutamic--pyruvic transaminase 2 [Source:NCBI gene... [more]
si:ch211-217a12.12.287e-18054.64si:ch211-217a12.1 [Source:ZFIN;Acc:ZDB-GENE-121214... [more]
back to top
BLAST of Alanine aminotransferase 2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
gpt23.717e-9153.75glutamic pyruvate transaminase (alanine aminotrans... [more]
ENSPMAT00000003702.12.618e-827.87pep scaffold:Pmarinus_7.0:GL476611:173756:192777:1... [more]
back to top
BLAST of Alanine aminotransferase 2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
ALT23.828e-13042.56Catalytically inactive alanine transaminase; expre... [more]
ALT11.866e-12743.31Alanine transaminase (glutamic pyruvic transaminas... [more]
BNA32.142e-1023.11Kynurenine aminotransferase; catalyzes formation o... [more]
back to top
BLAST of Alanine aminotransferase 2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO304500.000e+054.21Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO354351.735e-14943.97Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO405131.817e-1823.04Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO326521.026e-1025.56Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Alanine aminotransferase 2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gpt2l0.000e+055.72alanine aminotransferase 2-like [Source:NCBI gene;... [more]
si:ch211-217a12.10.000e+054.86alanine aminotransferase 2-like [Source:NCBI gene;... [more]
ENSORLT00000021621.21.032e-11739.82alanine aminotransferase 2 [Source:NCBI gene;Acc:1... [more]
ENSORLT00000016290.21.920e-9835.84alanine aminotransferase 2 [Source:NCBI gene;Acc:1... [more]
tat6.080e-1523.12tyrosine aminotransferase [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of Alanine aminotransferase 2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000009990.10.000e+099.78SMESG000009990.1[more]
SMESG000007248.10.000e+069.55SMESG000007248.1[more]
SMESG000007253.10.000e+067.75SMESG000007253.1[more]
SMESG000007253.10.000e+068.43SMESG000007253.1[more]
SMESG000035843.11.342e-1422.81SMESG000035843.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30009857 ID=SMED30009857|Name=Alanine aminotransferase 2|organism=Schmidtea mediterranea sexual|type=transcript|length=1667bp
GTTGTTTTAATAATACTAGCAAATATTCAAGATTCTCATAAACTAATAAA
TTCTGATTATTGGAACTATTTAGCATTGTATTAAAATAAGATGTATAAAC
TAATCAAACTCAAATCCTGTTCGATAGAAAAGATAATTAGTTCGAAGATA
TCAACGATGGCGATATTAAACTCGTTGAACATCAATAATATGAATCCGAA
TATCAAGAATTTAGAATATGCTGTTAGAGGGCCTATAGTTATCAAAGCTC
AAGAATTAGAAAAACGGTTAATTAATAATGAAAAACTGCCATTTGACGAA
GTAATAAAGTGTAATATCGGTGACTGTCACGCAATGGGACAGAAACCGTT
GACATTTTTGAGACAAGTTGTTGCGTTAACAGTTTTACCAGAACTAATCA
ATTCAAAAAAATTTCCCGCAGATGCTAAACATCGAGCTAAACGCGTACTA
GAGTCCTGTGGAGGCAATAGCGTCGGTTCATATAGTCAATCAACGGGCGT
TGAAATCGTTCGGAAAGATATCGCGTCGTTTATTTCTAAACGGGACGGGA
TTGCGTGTAACTCTAATGATATTTTTCTCTCCACTGGAGCCAGTGAGGCT
ATTAAGGTCGTTCTGCAAATGATGGCCACCCAGTCCCATGGGAAGGATAA
GGCAGGGATAATGGTCCCTATACCACAATATCCTTTATATTCCGCTACGA
ATGCCGAATATAACGCGTATCAAATTGGTTACTACTTATCTGAAGAAAAC
AATTGGGGGATCAATTTATCGGAACTTGAAAGGGCTATAAATGAGGCGTC
TAACCACTGCATTCCTAGAGCTATTGTAATTATAAATCCCGGTAATCCGA
CCGGGCAAGTTCTGACCGCAGATGACATAAAAATGGTCATCAAATTTGCA
TACAAGCATGACTTATTAATCATGGCCGACGAAGTTTATCAGTTTAATGT
TTACGCTCCCGATCGTTCTTTCCTCAGCTTCAAAAAAGCTCTTCACGACA
TGGGGGACGAGTATAAATCAATCCAAATTGCCTCGTTTATGAGTGCCAGT
AAAGGCTTTATGGGCGAGTGTGGATTCCGTGGGGGCTATTGTGAATTGGT
AAATTTCCCTGACGATGTGCAAGCTCAGCTCTATAAATGTATATCAGCGA
GACTTTGTAGTTCCGTTGCCGGTCAGGCGATGGTAGAAGCAATAGTGAAT
CCTCCTCGTCCAGGAGAACCGTCCTATGAACTATTTGAGAAAGAGAAAGC
TCAAGTTCTGAGTGACCTTAAACTAAAAGGCCAATTGGTAACGGAAACTC
TCAATCAGATGCCGGGATTTCATTGCAACGCGGTTCAGGGAGCCATGTAT
GCTTTCCCTCGATTAGAGCTGCCTGCATCAGCTATTAAGGAAGCCAGAAA
ATTAAAACAGGCTGCCGACTTTTTTTACTGTTCAAGACTTCTAGAGGAAA
TGGGAGTTTGTGTAGTTCCAGGATCTGGATTTGCTCAGGTTCCAGATACC
TATCACTTTAGAATGACGATTTTACCGTCGGTGGACAAAATGAAAATCGT
CATGGACAGGATCAAGCATTTCCACGACGGCTTCATGAAACAGTACAAAT
GACATTTGACAGAATAATTATTTTTGATTTTGATGTGTAATACAATTCAT
TTAGACGAGAAAAAAAA
back to top

protein sequence of SMED30009857-orf-1

>SMED30009857-orf-1 ID=SMED30009857-orf-1|Name=SMED30009857-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=504bp
MYKLIKLKSCSIEKIISSKISTMAILNSLNINNMNPNIKNLEYAVRGPIV
IKAQELEKRLINNEKLPFDEVIKCNIGDCHAMGQKPLTFLRQVVALTVLP
ELINSKKFPADAKHRAKRVLESCGGNSVGSYSQSTGVEIVRKDIASFISK
RDGIACNSNDIFLSTGASEAIKVVLQMMATQSHGKDKAGIMVPIPQYPLY
SATNAEYNAYQIGYYLSEENNWGINLSELERAINEASNHCIPRAIVIINP
GNPTGQVLTADDIKMVIKFAYKHDLLIMADEVYQFNVYAPDRSFLSFKKA
LHDMGDEYKSIQIASFMSASKGFMGECGFRGGYCELVNFPDDVQAQLYKC
ISARLCSSVAGQAMVEAIVNPPRPGEPSYELFEKEKAQVLSDLKLKGQLV
TETLNQMPGFHCNAVQGAMYAFPRLELPASAIKEARKLKQAADFFYCSRL
LEEMGVCVVPGSGFAQVPDTYHFRMTILPSVDKMKIVMDRIKHFHDGFMK
QYK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000070intestinal phagocyte
PLANA:0000074oocyte
PLANA:0000231vitelline gland
Vocabulary: INTERPRO
TermDefinition
IPR004839Aminotransferase_I/II
IPR015421PyrdxlP-dep_Trfase_major
IPR015422PyrdxlP-dep_Trfase_dom1
IPR015424PyrdxlP-dep_Trfase
Vocabulary: biological process
TermDefinition
GO:0009058biosynthetic process
Vocabulary: molecular function
TermDefinition
GO:0030170pyridoxal phosphate binding
GO:0003824catalytic activity
GO:0008483transaminase activity
GO:0016740transferase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR015421Pyridoxal phosphate-dependent transferase, major domainGENE3DG3DSA:3.40.640.10coord: 123..346
e-value: 1.6E-43
score: 150.7
IPR015422Pyridoxal phosphate-dependent transferase domain 1GENE3DG3DSA:3.90.1150.10coord: 27..103
e-value: 4.8E-16
score: 60.7
coord: 347..503
e-value: 5.7E-46
score: 158.2
IPR004839Aminotransferase, class I/classIIPFAMPF00155Aminotran_1_2coord: 125..487
e-value: 1.8E-36
score: 126.1
NoneNo IPR availablePANTHERPTHR11751:SF29AT04676Pcoord: 28..503
NoneNo IPR availablePANTHERPTHR11751SUBGROUP I AMINOTRANSFERASE RELATEDcoord: 28..503
NoneNo IPR availableCDDcd00609AAT_likecoord: 131..492
e-value: 2.31408E-54
score: 184.467
IPR015424Pyridoxal phosphate-dependent transferaseSUPERFAMILYSSF53383PLP-dependent transferasescoord: 30..495