TNF receptor-associated factor

Overview
NameTNF receptor-associated factor
Smed IDSMED30009834
Length (bp)1164
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of TNF receptor-associated factor (SMED30009834) t-SNE clustered cells

Violin plots show distribution of expression levels for TNF receptor-associated factor (SMED30009834) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of TNF receptor-associated factor (SMED30009834) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for TNF receptor-associated factor (SMED30009834) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30009834

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30009834SMESG000047296.1 dd_Smed_v4_2916_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30009834SMESG000047296.1 dd_Smed_v4_2916_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
pharynxSMED30009834SMESG000047296.1 dd_Smed_v6_2916_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30009834SMESG000047296.1 dd_Smed_v4_2916_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30009834SMESG000047296.1 dd_Smed_v4_2916_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of TNF receptor-associated factor vs. Ensembl Human
Match: TRAF2 (TNF receptor associated factor 2 [Source:HGNC Symbol;Acc:HGNC:12032])

HSP 1 Score: 122.094 bits (305), Expect = 4.702e-30
Identity = 59/177 (33.33%), Postives = 103/177 (58.19%), Query Frame = 2
Query:  614 LELKIEEIRNSIQNLKIQYSNISKSTFILD----NPVFLWPINRFSEAYDDAKSGKNTSIISKPFYVSEYGYKMSIKIYPNGHGEGLGTHLSIYFVILQGKYDPLLNWPFQEKISLELVGQKNKTFS-ETFKGPPNSEWTQRPKQERSISVGNPKFIEIGKITKSDDLLINDSLYIK 1129
            L  K++++  SI    +  +++ +    ++    + VF+W I+ F+    +A +G+  +I S  FY S YGYKM ++IY NG G G GTHLS++FV+++G  D LL WPF +K++L L+ Q N+    + F+    S   QRP  + +I+ G P F  + K+   +  + +D+++IK
Sbjct:  317 LSSKVQQLERSIGLKDLAMADLEQKVLEMEASTYDGVFIWKISDFARKRQEAVAGRIPAIFSPAFYTSRYGYKMCLRIYLNGDGTGRGTHLSLFFVVMKGPNDALLRWPFNQKVTLMLLDQNNREHVIDAFRPDVTSSSFQRPVNDMNIASGCPLFCPVSKMEAKNSYVRDDAIFIK 493          
BLAST of TNF receptor-associated factor vs. Ensembl Human
Match: TRAF3 (TNF receptor associated factor 3 [Source:HGNC Symbol;Acc:HGNC:12033])

HSP 1 Score: 120.939 bits (302), Expect = 1.236e-29
Identity = 59/179 (32.96%), Postives = 107/179 (59.78%), Query Frame = 2
Query:  602 SKLNLELKIEEIRNSIQNLKIQYSNISKSTFILDNPVFLWPINRFSEAYDDAKSGKNTSIISKPFYVSEYGYKMSIKIYPNGHGEGLGTHLSIYFVILQGKYDPLLNWPFQEKISLELV--GQKNKTFSETFKGPPNSEWTQRPKQERSISVGNPKFIEIGKITKSDDLLINDSLYIKM 1132
            S+ +  L + +IR  + ++ +++  +  +++   N V +W I  +     +A  GK  S+ S+PFY   +GYKM  ++Y NG G G GTHLS++FVI++G+YD LL WPF++K++L L+  G   +   + FK  PNS   ++P  E +I+ G P F+    + ++   + +D+++IK+
Sbjct:  303 SRHDQMLSVHDIR--LADMDLRFQVLETASY---NGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPDPNSSSFKKPTGEMNIASGCPVFV-AQTVLENGTYIKDDTIFIKV 475          

HSP 2 Score: 51.6026 bits (122), Expect = 1.480e-6
Identity = 33/100 (33.00%), Postives = 49/100 (49.00%), Query Frame = 2
Query:  197 VPEKFKCINCKDILCSPVQLLCGCRMCLYCYNKVKESDVRRCPGNDINCLEAFTSSVVMRDKSCERDMKMHLIKCPNVN--CNENISIYNLKNHL-NECN 487
            V +K+KC  C  +LCSP Q  CG R C  C   +  S   +C      C E+     V +D  C+R++    I C N +  C E + + +L  HL N+C+
Sbjct:   47 VEDKYKCEKCHLVLCSPKQTECGHRFCESCMAALLSSSSPKCTA----CQESIVKDKVFKDNCCKREILALQIYCRNESRGCAEQLMLGHLLVHLKNDCH 142          
BLAST of TNF receptor-associated factor vs. Ensembl Human
Match: TRAF3 (TNF receptor associated factor 3 [Source:HGNC Symbol;Acc:HGNC:12033])

HSP 1 Score: 121.324 bits (303), Expect = 1.636e-29
Identity = 59/179 (32.96%), Postives = 107/179 (59.78%), Query Frame = 2
Query:  602 SKLNLELKIEEIRNSIQNLKIQYSNISKSTFILDNPVFLWPINRFSEAYDDAKSGKNTSIISKPFYVSEYGYKMSIKIYPNGHGEGLGTHLSIYFVILQGKYDPLLNWPFQEKISLELV--GQKNKTFSETFKGPPNSEWTQRPKQERSISVGNPKFIEIGKITKSDDLLINDSLYIKM 1132
            S+ +  L + +IR  + ++ +++  +  +++   N V +W I  +     +A  GK  S+ S+PFY   +GYKM  ++Y NG G G GTHLS++FVI++G+YD LL WPF++K++L L+  G   +   + FK  PNS   ++P  E +I+ G P F+    + ++   + +D+++IK+
Sbjct:  386 SRHDQMLSVHDIR--LADMDLRFQVLETASY---NGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPDPNSSSFKKPTGEMNIASGCPVFV-AQTVLENGTYIKDDTIFIKV 558          

HSP 2 Score: 51.2174 bits (121), Expect = 2.518e-6
Identity = 33/100 (33.00%), Postives = 49/100 (49.00%), Query Frame = 2
Query:  197 VPEKFKCINCKDILCSPVQLLCGCRMCLYCYNKVKESDVRRCPGNDINCLEAFTSSVVMRDKSCERDMKMHLIKCPNVN--CNENISIYNLKNHL-NECN 487
            V +K+KC  C  +LCSP Q  CG R C  C   +  S   +C      C E+     V +D  C+R++    I C N +  C E + + +L  HL N+C+
Sbjct:   47 VEDKYKCEKCHLVLCSPKQTECGHRFCESCMAALLSSSSPKCTA----CQESIVKDKVFKDNCCKREILALQIYCRNESRGCAEQLMLGHLLVHLKNDCH 142          
BLAST of TNF receptor-associated factor vs. Ensembl Human
Match: TRAF3 (TNF receptor associated factor 3 [Source:HGNC Symbol;Acc:HGNC:12033])

HSP 1 Score: 121.324 bits (303), Expect = 1.636e-29
Identity = 59/179 (32.96%), Postives = 107/179 (59.78%), Query Frame = 2
Query:  602 SKLNLELKIEEIRNSIQNLKIQYSNISKSTFILDNPVFLWPINRFSEAYDDAKSGKNTSIISKPFYVSEYGYKMSIKIYPNGHGEGLGTHLSIYFVILQGKYDPLLNWPFQEKISLELV--GQKNKTFSETFKGPPNSEWTQRPKQERSISVGNPKFIEIGKITKSDDLLINDSLYIKM 1132
            S+ +  L + +IR  + ++ +++  +  +++   N V +W I  +     +A  GK  S+ S+PFY   +GYKM  ++Y NG G G GTHLS++FVI++G+YD LL WPF++K++L L+  G   +   + FK  PNS   ++P  E +I+ G P F+    + ++   + +D+++IK+
Sbjct:  386 SRHDQMLSVHDIR--LADMDLRFQVLETASY---NGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPDPNSSSFKKPTGEMNIASGCPVFV-AQTVLENGTYIKDDTIFIKV 558          

HSP 2 Score: 51.2174 bits (121), Expect = 2.518e-6
Identity = 33/100 (33.00%), Postives = 49/100 (49.00%), Query Frame = 2
Query:  197 VPEKFKCINCKDILCSPVQLLCGCRMCLYCYNKVKESDVRRCPGNDINCLEAFTSSVVMRDKSCERDMKMHLIKCPNVN--CNENISIYNLKNHL-NECN 487
            V +K+KC  C  +LCSP Q  CG R C  C   +  S   +C      C E+     V +D  C+R++    I C N +  C E + + +L  HL N+C+
Sbjct:   47 VEDKYKCEKCHLVLCSPKQTECGHRFCESCMAALLSSSSPKCTA----CQESIVKDKVFKDNCCKREILALQIYCRNESRGCAEQLMLGHLLVHLKNDCH 142          
BLAST of TNF receptor-associated factor vs. Ensembl Human
Match: TRAF3 (TNF receptor associated factor 3 [Source:HGNC Symbol;Acc:HGNC:12033])

HSP 1 Score: 121.324 bits (303), Expect = 1.650e-29
Identity = 59/179 (32.96%), Postives = 107/179 (59.78%), Query Frame = 2
Query:  602 SKLNLELKIEEIRNSIQNLKIQYSNISKSTFILDNPVFLWPINRFSEAYDDAKSGKNTSIISKPFYVSEYGYKMSIKIYPNGHGEGLGTHLSIYFVILQGKYDPLLNWPFQEKISLELV--GQKNKTFSETFKGPPNSEWTQRPKQERSISVGNPKFIEIGKITKSDDLLINDSLYIKM 1132
            S+ +  L + +IR  + ++ +++  +  +++   N V +W I  +     +A  GK  S+ S+PFY   +GYKM  ++Y NG G G GTHLS++FVI++G+YD LL WPF++K++L L+  G   +   + FK  PNS   ++P  E +I+ G P F+    + ++   + +D+++IK+
Sbjct:  361 SRHDQMLSVHDIR--LADMDLRFQVLETASY---NGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPDPNSSSFKKPTGEMNIASGCPVFV-AQTVLENGTYIKDDTIFIKV 533          

HSP 2 Score: 51.2174 bits (121), Expect = 2.031e-6
Identity = 33/100 (33.00%), Postives = 49/100 (49.00%), Query Frame = 2
Query:  197 VPEKFKCINCKDILCSPVQLLCGCRMCLYCYNKVKESDVRRCPGNDINCLEAFTSSVVMRDKSCERDMKMHLIKCPNVN--CNENISIYNLKNHL-NECN 487
            V +K+KC  C  +LCSP Q  CG R C  C   +  S   +C      C E+     V +D  C+R++    I C N +  C E + + +L  HL N+C+
Sbjct:   47 VEDKYKCEKCHLVLCSPKQTECGHRFCESCMAALLSSSSPKCTA----CQESIVKDKVFKDNCCKREILALQIYCRNESRGCAEQLMLGHLLVHLKNDCH 142          
BLAST of TNF receptor-associated factor vs. Ensembl Celegans
Match: trf-1 (TNF Receptor Associated Factor (TRAF) homolog; TRF-1 [Source:UniProtKB/TrEMBL;Acc:G5EG80])

HSP 1 Score: 87.0409 bits (214), Expect = 1.549e-18
Identity = 50/188 (26.60%), Postives = 95/188 (50.53%), Query Frame = 2
Query:  599 DSKLNLELKIEEIRNSIQNLKIQYSNISKSTFILDNPVFLWPINRFSEAYDDAKSGKNTSIISKPFYVSEYGYKMSIKIYPNGHGEGLGTHLSIYFVILQGKYDPLLNWPFQEKISLELVGQK-------NKTFS-ETFKGPPNSEWTQRPKQERSISVGNPKFIEIGKITKSDDLLINDSLYIKMKI 1138
            D K   EL +E    S  + + +  + +++   +  P  +W I++  +  ++AKSG +T+I S PF    +GYKM       G G   G  +S+Y ++L+G++DP L WPF   I + L+ Q        N T+  +  K   N ++  RP+ ER+ + G+  F  +  +    + + +D +Y+++ +
Sbjct:  228 DLKGTYEL-MERDMGSFNDRQTRILSAAETCTEMFGPQLIWKIDKLQQRTNEAKSGADTTIFSVPFMSHRFGYKMMACACLFGDGSSAGKSISLYVLLLKGEFDPTLEWPFHRAIKISLLDQNPRPEDRVNITYVIDPRKLKANEKFLARPRGERNAAFGSQSFCSLAIL---QNYVKDDKIYVQIDV 411          
BLAST of TNF receptor-associated factor vs. Ensembl Celegans
Match: trf-2 (TNF Receptor Associated Factor (TRAF) homolog [Source:UniProtKB/TrEMBL;Acc:Q9N586])

HSP 1 Score: 65.855 bits (159), Expect = 1.099e-11
Identity = 42/164 (25.61%), Postives = 83/164 (50.61%), Query Frame = 2
Query:  662 IQYSNISKSTFILDNPVFLWPINRFSEAYDDAKSGK-NTSIISKPFYVSEYGYKMSIKIYPNGHGEGLGTHLSIYFVILQGKYDPLLNWPFQEKISLELVG-QKNKTFSETF---KGPPNSEWTQRPKQERSISVGNPKFIEIGKITKSDDLLINDSLYIKMKI 1138
            +QY +I++S F        + I +       A   K + SI S+PFY   YGYKM     P G G     + S++  +++G++D +L WPF+  ++  ++   K +  ++T    + P   E+ +RP+  R+ + G   F+ + K+T   +   +  ++I++K+
Sbjct:  143 LQYMSIAESAFEKYGSQHTFRIPKIGLTVVKATKNKSHRSIYSQPFYSHGYGYKMMAVAAPYGDGLAFREYFSVFVCLMKGEWDDILEWPFRCDVTFSILSDDKKELLTKTIYVNEMPEIQEFLERPEGLRNGTFGFQNFLPLAKVT---EFAADGDIFIQIKV 303          
BLAST of TNF receptor-associated factor vs. Ensembl Fly
Match: Traf4 (gene:FBgn0026319 transcript:FBtr0334401)

HSP 1 Score: 100.908 bits (250), Expect = 4.541e-23
Identity = 53/177 (29.94%), Postives = 92/177 (51.98%), Query Frame = 2
Query:  623 KIEEIRNSIQNLKIQYSNISKSTFILDNPVFLWPINRFSEAYDDAKSGKNTSIISKPFYVSEYGYKMSIKIYPNGHGEGLGTHLSIYFVILQGKYDPLLNWPFQEKISLELVGQKNKT----FSETFKGPPNSEWTQRPKQER-SISVGNPKFIEIGKITKSDDLLINDSLYIKMKI 1138
            +I+ +++++  L I Y+              LW I  +S    +A+      ++S PFY S+YGYK+   ++ NG+G G  TH+S+Y  +L G+YD LL WPF   I+  L  Q  ++     +E+F   P  E  QRP  E   +  G P+FI   ++  S   +  D++++++K+
Sbjct:  305 QIQMLKSAVSKLSINYTG-----------TLLWKITDWSAKMAEARGKDGLELVSPPFYTSQYGYKLQASMFLNGNGPGENTHVSVYIKVLPGEYDALLKWPFSHSITFTLFEQGAQSGQGGVAESFVPDPTWENFQRPSNEPDQLGFGFPRFIS-HELLHSRPFIKGDTVFLRVKV 469          
BLAST of TNF receptor-associated factor vs. Ensembl Fly
Match: Traf4 (gene:FBgn0026319 transcript:FBtr0077429)

HSP 1 Score: 100.908 bits (250), Expect = 5.508e-23
Identity = 53/177 (29.94%), Postives = 92/177 (51.98%), Query Frame = 2
Query:  623 KIEEIRNSIQNLKIQYSNISKSTFILDNPVFLWPINRFSEAYDDAKSGKNTSIISKPFYVSEYGYKMSIKIYPNGHGEGLGTHLSIYFVILQGKYDPLLNWPFQEKISLELVGQKNKT----FSETFKGPPNSEWTQRPKQER-SISVGNPKFIEIGKITKSDDLLINDSLYIKMKI 1138
            +I+ +++++  L I Y+              LW I  +S    +A+      ++S PFY S+YGYK+   ++ NG+G G  TH+S+Y  +L G+YD LL WPF   I+  L  Q  ++     +E+F   P  E  QRP  E   +  G P+FI   ++  S   +  D++++++K+
Sbjct:  314 QIQMLKSAVSKLSINYTG-----------TLLWKITDWSAKMAEARGKDGLELVSPPFYTSQYGYKLQASMFLNGNGPGENTHVSVYIKVLPGEYDALLKWPFSHSITFTLFEQGAQSGQGGVAESFVPDPTWENFQRPSNEPDQLGFGFPRFIS-HELLHSRPFIKGDTVFLRVKV 478          
BLAST of TNF receptor-associated factor vs. Ensembl Fly
Match: Traf-like (gene:FBgn0030748 transcript:FBtr0074275)

HSP 1 Score: 52.7582 bits (125), Expect = 3.160e-7
Identity = 38/142 (26.76%), Postives = 70/142 (49.30%), Query Frame = 2
Query:  713 FLWPINRFSEAYDDAKSGKNTSIISKPFYVSEYGYKMSIKIYPNGHGEGLGTHLSIYFVILQGKYDPLLNWPFQEKISLELVGQKNKTFSETFKGPPNSEWTQRPKQERSISVGNPKFIEIGKITKSDDLLINDSLYIKMKI 1138
             +W I  +S+  +++K   +T + S  F    +GY + + IY NG G   G ++     +L G+YDPLL WP   ++  E++ +   T     +    + +  R K +  I   N  F    K+  S + L NDS++I++++
Sbjct:  336 LIWRIKDYSKKLEESKQY-DTILHSAMFSNKAFGYALRLDIYLNGKGTWKGRNMIACLNVLSGEYDPLLAWPC--RLQAEIIIRDQCTNVADAEDYVKTIFV-RKKSDDFIQ-SNQYFHIPHKVITSRNYLRNDSMFIEVRV 472          
BLAST of TNF receptor-associated factor vs. Ensembl Fly
Match: Traf-like (gene:FBgn0030748 transcript:FBtr0074273)

HSP 1 Score: 52.373 bits (124), Expect = 3.818e-7
Identity = 38/142 (26.76%), Postives = 70/142 (49.30%), Query Frame = 2
Query:  713 FLWPINRFSEAYDDAKSGKNTSIISKPFYVSEYGYKMSIKIYPNGHGEGLGTHLSIYFVILQGKYDPLLNWPFQEKISLELVGQKNKTFSETFKGPPNSEWTQRPKQERSISVGNPKFIEIGKITKSDDLLINDSLYIKMKI 1138
             +W I  +S+  +++K   +T + S  F    +GY + + IY NG G   G ++     +L G+YDPLL WP   ++  E++ +   T     +    + +  R K +  I   N  F    K+  S + L NDS++I++++
Sbjct:  314 LIWRIKDYSKKLEESKQY-DTILHSAMFSNKAFGYALRLDIYLNGKGTWKGRNMIACLNVLSGEYDPLLAWPC--RLQAEIIIRDQCTNVADAEDYVKTIFV-RKKSDDFIQ-SNQYFHIPHKVITSRNYLRNDSMFIEVRV 450          
BLAST of TNF receptor-associated factor vs. Ensembl Fly
Match: Traf-like (gene:FBgn0030748 transcript:FBtr0308606)

HSP 1 Score: 51.9878 bits (123), Expect = 4.294e-7
Identity = 38/142 (26.76%), Postives = 70/142 (49.30%), Query Frame = 2
Query:  713 FLWPINRFSEAYDDAKSGKNTSIISKPFYVSEYGYKMSIKIYPNGHGEGLGTHLSIYFVILQGKYDPLLNWPFQEKISLELVGQKNKTFSETFKGPPNSEWTQRPKQERSISVGNPKFIEIGKITKSDDLLINDSLYIKMKI 1138
             +W I  +S+  +++K   +T + S  F    +GY + + IY NG G   G ++     +L G+YDPLL WP   ++  E++ +   T     +    + +  R K +  I   N  F    K+  S + L NDS++I++++
Sbjct:  257 LIWRIKDYSKKLEESKQY-DTILHSAMFSNKAFGYALRLDIYLNGKGTWKGRNMIACLNVLSGEYDPLLAWPC--RLQAEIIIRDQCTNVADAEDYVKTIFV-RKKSDDFIQ-SNQYFHIPHKVITSRNYLRNDSMFIEVRV 393          
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Match: traf2b (Tnf receptor-associated factor 2b [Source:ZFIN;Acc:ZDB-GENE-030131-5345])

HSP 1 Score: 131.724 bits (330), Expect = 1.863e-33
Identity = 64/178 (35.96%), Postives = 104/178 (58.43%), Query Frame = 2
Query:  611 NLELKIEEIRNSIQNLKIQYSNISKS----TFILDNPVFLWPINRFSEAYDDAKSGKNTSIISKPFYVSEYGYKMSIKIYPNGHGEGLGTHLSIYFVILQGKYDPLLNWPFQEKISLELVGQKNKT-FSETFKGPPNSEWTQRPKQERSISVGNPKFIEIGKITKSDDLLINDSLYIK 1129
            NL  K+ ++  ++    +Q +   +S     F   + VF+W I  FS    DA +G+  ++ S  FY S+YGYKM +++Y NG G G G+HLS++FV+++GKYD LL WPF +K++L L+ Q N+    + F+   +S   QRP  E +I+ G P F  + K+      L +D+++IK
Sbjct:  347 NLSNKVRQLERTLTTRDLQLAESEQSLRELQFCTYDGVFIWKIAEFSRRRQDAVAGRAPAMFSPAFYSSKYGYKMCLRLYLNGDGTGRGSHLSLFFVVMKGKYDALLKWPFSQKVTLMLLDQNNREHIIDAFRPDVSSTSFQRPISEMNIASGCPLFCPLAKLAGKSSYLRDDTIFIK 524          

HSP 2 Score: 49.6766 bits (117), Expect = 4.737e-6
Identity = 36/123 (29.27%), Postives = 61/123 (49.59%), Query Frame = 2
Query:  185 SKSIVPEKFKCINCKDILCSPVQLLCGCRMCLYCYNKVKESD---VRRCPGNDINCLEAFTS----SVVMRDKSCERDMKMHLIKCPNVNCNENISIYNLKN-HLNECN-QKIEADNNSVVLL 526
            S S+ P K++C  CKDIL  P Q  CG R C++C+ ++  S       C    I   E  TS    +V   D +  R++     KCPN  C+ + ++ + +N H   C  ++++ +   V++L
Sbjct:   36 SVSMEP-KYQCQQCKDILRKPFQAQCGHRFCVFCFKQLTSSGPIPCEACRAEGI--FEEETSVLNIAVAFPDNAARREIDSLPAKCPNEGCSWSGTLKDFENQHEGRCAFERVKCEACQVLIL 155          
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Match: traf2b (Tnf receptor-associated factor 2b [Source:ZFIN;Acc:ZDB-GENE-030131-5345])

HSP 1 Score: 131.724 bits (330), Expect = 1.863e-33
Identity = 64/178 (35.96%), Postives = 104/178 (58.43%), Query Frame = 2
Query:  611 NLELKIEEIRNSIQNLKIQYSNISKS----TFILDNPVFLWPINRFSEAYDDAKSGKNTSIISKPFYVSEYGYKMSIKIYPNGHGEGLGTHLSIYFVILQGKYDPLLNWPFQEKISLELVGQKNKT-FSETFKGPPNSEWTQRPKQERSISVGNPKFIEIGKITKSDDLLINDSLYIK 1129
            NL  K+ ++  ++    +Q +   +S     F   + VF+W I  FS    DA +G+  ++ S  FY S+YGYKM +++Y NG G G G+HLS++FV+++GKYD LL WPF +K++L L+ Q N+    + F+   +S   QRP  E +I+ G P F  + K+      L +D+++IK
Sbjct:  347 NLSNKVRQLERTLTTRDLQLAESEQSLRELQFCTYDGVFIWKIAEFSRRRQDAVAGRAPAMFSPAFYSSKYGYKMCLRLYLNGDGTGRGSHLSLFFVVMKGKYDALLKWPFSQKVTLMLLDQNNREHIIDAFRPDVSSTSFQRPISEMNIASGCPLFCPLAKLAGKSSYLRDDTIFIK 524          

HSP 2 Score: 49.6766 bits (117), Expect = 4.737e-6
Identity = 36/123 (29.27%), Postives = 61/123 (49.59%), Query Frame = 2
Query:  185 SKSIVPEKFKCINCKDILCSPVQLLCGCRMCLYCYNKVKESD---VRRCPGNDINCLEAFTS----SVVMRDKSCERDMKMHLIKCPNVNCNENISIYNLKN-HLNECN-QKIEADNNSVVLL 526
            S S+ P K++C  CKDIL  P Q  CG R C++C+ ++  S       C    I   E  TS    +V   D +  R++     KCPN  C+ + ++ + +N H   C  ++++ +   V++L
Sbjct:   36 SVSMEP-KYQCQQCKDILRKPFQAQCGHRFCVFCFKQLTSSGPIPCEACRAEGI--FEEETSVLNIAVAFPDNAARREIDSLPAKCPNEGCSWSGTLKDFENQHEGRCAFERVKCEACQVLIL 155          
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Match: traf2b (Tnf receptor-associated factor 2b [Source:ZFIN;Acc:ZDB-GENE-030131-5345])

HSP 1 Score: 131.339 bits (329), Expect = 2.626e-33
Identity = 64/178 (35.96%), Postives = 104/178 (58.43%), Query Frame = 2
Query:  611 NLELKIEEIRNSIQNLKIQYSNISKS----TFILDNPVFLWPINRFSEAYDDAKSGKNTSIISKPFYVSEYGYKMSIKIYPNGHGEGLGTHLSIYFVILQGKYDPLLNWPFQEKISLELVGQKNKT-FSETFKGPPNSEWTQRPKQERSISVGNPKFIEIGKITKSDDLLINDSLYIK 1129
            NL  K+ ++  ++    +Q +   +S     F   + VF+W I  FS    DA +G+  ++ S  FY S+YGYKM +++Y NG G G G+HLS++FV+++GKYD LL WPF +K++L L+ Q N+    + F+   +S   QRP  E +I+ G P F  + K+      L +D+++IK
Sbjct:  360 NLSNKVRQLERTLTTRDLQLAESEQSLRELQFCTYDGVFIWKIAEFSRRRQDAVAGRAPAMFSPAFYSSKYGYKMCLRLYLNGDGTGRGSHLSLFFVVMKGKYDALLKWPFSQKVTLMLLDQNNREHIIDAFRPDVSSTSFQRPISEMNIASGCPLFCPLAKLAGKSSYLRDDTIFIK 537          

HSP 2 Score: 49.6766 bits (117), Expect = 3.985e-6
Identity = 35/121 (28.93%), Postives = 60/121 (49.59%), Query Frame = 2
Query:  185 SKSIVPEKFKCINCKDILCSPVQLLCGCRMCLYCYNKVKESDVRRCPG-NDINCLEAFTS----SVVMRDKSCERDMKMHLIKCPNVNCNENISIYNLKN-HLNECN-QKIEADNNSVVLL 526
            S S+ P K++C  CKDIL  P Q  CG R C++C+ ++  S    C         E  TS    +V   D +  R++     KCPN  C+ + ++ + +N H   C  ++++ +   V++L
Sbjct:   49 SVSMEP-KYQCQQCKDILRKPFQAQCGHRFCVFCFKQLTSSGPIPCEACRAEGIFEEETSVLNIAVAFPDNAARREIDSLPAKCPNEGCSWSGTLKDFENQHEGRCAFERVKCEACQVLIL 168          
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Match: unm_sa808 (un-named sa808 [Source:ZFIN;Acc:ZDB-GENE-120727-21])

HSP 1 Score: 125.946 bits (315), Expect = 4.901e-33
Identity = 65/184 (35.33%), Postives = 105/184 (57.07%), Query Frame = 2
Query:  623 KIEEIRNSIQNLKIQYS--------------NISKSTFILDNPVFLWPINRFSEAYDDAKSGKNTSIISKPFYVSEYGYKMSIKIYPNGHGEGLGTHLSIYFVILQGKYDPLLNWPFQEKISLELVGQKNKT-FSETFKGPPNSEWTQRPKQERSISVGNPKFIEIGKITKSDDLLINDSLYIK 1129
            KIE + N ++ L+ Q                 +S +TF   + VF+W I+ F++   DA +G+  ++ S  FY S+YGYKM ++IY NG G G GTHLS++FV+++G  D LL WPF +K++L L+ Q N+    + F+    S   QRP  E +I+ G P F  + K+   +  + +D+++IK
Sbjct:   93 KIEALSNKVRQLERQVGVKDLTVAEMEGRLREMSATTF---DGVFIWRISDFTKKRQDAIAGRAPAMFSPAFYTSKYGYKMCLRIYLNGDGTGRGTHLSLFFVVMRGMSDALLKWPFNQKVTLMLLDQSNREHIIDAFRPDITSSSFQRPVSEMNIASGCPLFCPLAKLEGKNSYIRDDTIFIK 273          
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Match: BX901915.1 (pep chromosome:GRCz11:CHR_ALT_CTG5_1_18:28764891:28768979:-1 gene:ENSDARG00000109857.1 transcript:ENSDART00000191629.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:BX901915.1)

HSP 1 Score: 125.176 bits (313), Expect = 6.800e-33
Identity = 60/163 (36.81%), Postives = 101/163 (61.96%), Query Frame = 2
Query:  644 SIQNLKIQYSNISKSTFILDNPVFLWPINRFSEAYDDAKSGKNTSIISKPFYVSEYGYKMSIKIYPNGHGEGLGTHLSIYFVILQGKYDPLLNWPFQEKISLELVGQKNKT-FSETFKGPPNSEWTQRPKQERSISVGNPKFIEIGKITKSDDLLINDSLYIK 1129
            SI  ++ +   +S +T+   + VF+W I+ FS+   DA +G+  ++ S  FY S+YGYKM ++IY NG G G GTHLS++FV+++G  D LL WPF +K++L L+ Q N+    + F+   +S   QRP  + +I+ G P F  + K+   +  + +D+++IK
Sbjct:  108 SIVEMEAKMREMSAATY---DGVFVWKISDFSKKRQDAVAGRAPAMFSPAFYTSKYGYKMCLRIYLNGDGTGRGTHLSLFFVVMRGHSDALLKWPFNQKVTLMLLDQNNREHIIDAFRPDISSSSFQRPVSDMNIASGCPLFCPLSKLDSKNSYIRDDTIFIK 267          
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Match: TRAF2 (TNF receptor associated factor 2 [Source:NCBI gene;Acc:100494415])

HSP 1 Score: 122.865 bits (307), Expect = 1.680e-30
Identity = 61/181 (33.70%), Postives = 108/181 (59.67%), Query Frame = 2
Query:  599 DSKLNLELKIEEIRNSIQNLKIQYSNISKSTFILDNPVFLWPINRFSEAYDDAKSGKNTSIISKPFYVSEYGYKMSIKIYPNGHGEGLGTHLSIYFVILQGKYDPLLNWPFQEKISLELVGQKNKTFS-ETFKGPPNSEWTQRPKQERSISVGNPKFIEIGKITKSDDLLINDSLYIKMKI 1138
            D++L   L  +E+  +    ++Q S +S       + VF+W I+ F +   DA +G+  ++ S PFY ++YGYKM ++IY NG G G  THLS++FV+++G  D LL WPF +K++L L+ Q N+    + F+   +S   QRP  E +I+ G P F ++ K+   +  + +D++++K+ +
Sbjct:  274 DTRLERTLGQKELIVAELETRMQESELSTY-----DGVFIWKISEFGKKRQDAINGRCPAMFSPPFYTNKYGYKMCLRIYLNGDGTGRNTHLSLFFVVMKGNNDALLRWPFNQKVTLMLLDQNNREHVIDAFRPDVSSSSFQRPISEMNIASGCPLFCQVSKLEGKNSYVRDDTIFVKVIV 449          
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Match: ssh2 (slingshot protein phosphatase 2 [Source:Xenbase;Acc:XB-GENE-993093])

HSP 1 Score: 121.709 bits (304), Expect = 1.186e-29
Identity = 59/173 (34.10%), Postives = 104/173 (60.12%), Query Frame = 2
Query:  620 LKIEEIRNSIQNLKIQYSNISKSTFILDNPVFLWPINRFSEAYDDAKSGKNTSIISKPFYVSEYGYKMSIKIYPNGHGEGLGTHLSIYFVILQGKYDPLLNWPFQEKISLELV--GQKNKTFSETFKGPPNSEWTQRPKQERSISVGNPKFIEIGKITKSDDLLINDSLYIKM 1132
            L + +IR  + ++ +++  +  +++   N V +W I  +     +A  GK  S+ S+PFY   +GYKM  ++Y NG G G GTHLS++FVI++G+YD LL WPF++K+SL L+  G   +   + FK  PNS   ++P  E +I+ G P F+    + ++   + +D+++IK+
Sbjct:  385 LSVHDIR--LADMDLRFQVLETASY---NGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVSLMLMDQGPSRRHLGDAFKPDPNSSSFKKPTGEMNIASGCPVFV-AQTVLENGTYIKDDTIFIKV 551          

HSP 2 Score: 53.1434 bits (126), Expect = 5.230e-7
Identity = 33/95 (34.74%), Postives = 47/95 (49.47%), Query Frame = 2
Query:  197 VPEKFKCINCKDILCSPVQLLCGCRMCLYCYNKVKESDVRRCPGNDINCLEAFTSSVVMRDKSCERDMKMHLIKCPN--VNCNENISIYNLKNHL 475
            V EK+KC  C+ +LC+P Q  CG R C  C N +  S   +C    + C +  T   V +D  C R++    + C N    C E I++ NL  HL
Sbjct:   42 VEEKYKCEKCRLVLCNPRQTECGHRFCETCMNAILSSTSPQC----MACEDNITKDKVFKDNCCRREVLALQMFCRNETRGCKELITLGNLLIHL 132          
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Match: ssh2 (slingshot protein phosphatase 2 [Source:Xenbase;Acc:XB-GENE-993093])

HSP 1 Score: 121.324 bits (303), Expect = 1.331e-29
Identity = 59/173 (34.10%), Postives = 104/173 (60.12%), Query Frame = 2
Query:  620 LKIEEIRNSIQNLKIQYSNISKSTFILDNPVFLWPINRFSEAYDDAKSGKNTSIISKPFYVSEYGYKMSIKIYPNGHGEGLGTHLSIYFVILQGKYDPLLNWPFQEKISLELV--GQKNKTFSETFKGPPNSEWTQRPKQERSISVGNPKFIEIGKITKSDDLLINDSLYIKM 1132
            L + +IR  + ++ +++  +  +++   N V +W I  +     +A  GK  S+ S+PFY   +GYKM  ++Y NG G G GTHLS++FVI++G+YD LL WPF++K+SL L+  G   +   + FK  PNS   ++P  E +I+ G P F+    + ++   + +D+++IK+
Sbjct:  360 LSVHDIR--LADMDLRFQVLETASY---NGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVSLMLMDQGPSRRHLGDAFKPDPNSSSFKKPTGEMNIASGCPVFV-AQTVLENGTYIKDDTIFIKV 526          

HSP 2 Score: 53.5286 bits (127), Expect = 3.992e-7
Identity = 33/95 (34.74%), Postives = 47/95 (49.47%), Query Frame = 2
Query:  197 VPEKFKCINCKDILCSPVQLLCGCRMCLYCYNKVKESDVRRCPGNDINCLEAFTSSVVMRDKSCERDMKMHLIKCPN--VNCNENISIYNLKNHL 475
            V EK+KC  C+ +LC+P Q  CG R C  C N +  S   +C    + C +  T   V +D  C R++    + C N    C E I++ NL  HL
Sbjct:   42 VEEKYKCEKCRLVLCNPRQTECGHRFCETCMNAILSSTSPQC----MACEDNITKDKVFKDNCCRREVLALQMFCRNETRGCKELITLGNLLIHL 132          
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Match: TRAF2 (TNF receptor associated factor 2 [Source:NCBI gene;Acc:100494415])

HSP 1 Score: 120.168 bits (300), Expect = 1.904e-29
Identity = 60/175 (34.29%), Postives = 105/175 (60.00%), Query Frame = 2
Query:  617 ELKIEEIRNSIQNLKIQYSNISKSTFILDNPVFLWPINRFSEAYDDAKSGKNTSIISKPFYVSEYGYKMSIKIYPNGHGEGLGTHLSIYFVILQGKYDPLLNWPFQEKISLELVGQKNKTFS-ETFKGPPNSEWTQRPKQERSISVGNPKFIEIGKITKSDDLLINDSLYIKMKI 1138
            EL + E+   +Q  ++       ST+   + VF+W I+ F +   DA +G+  ++ S PFY ++YGYKM ++IY NG G G  THLS++FV+++G  D LL WPF +K++L L+ Q N+    + F+   +S   QRP  E +I+ G P F ++ K+   +  + +D++++K+ +
Sbjct:  312 ELIVAELETRMQESEL-------STY---DGVFIWKISEFGKKRQDAINGRCPAMFSPPFYTNKYGYKMCLRIYLNGDGTGRNTHLSLFFVVMKGNNDALLRWPFNQKVTLMLLDQNNREHVIDAFRPDVSSSSFQRPISEMNIASGCPLFCQVSKLEGKNSYVRDDTIFVKVIV 476          
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Match: hspb6 (heat shock protein family B (small) member 6 [Source:Xenbase;Acc:XB-GENE-876273])

HSP 1 Score: 114.775 bits (286), Expect = 5.245e-28
Identity = 93/342 (27.19%), Postives = 158/342 (46.20%), Query Frame = 2
Query:  203 EKFKCINCKDILCSPVQLLCGCRMCLYCYNK-VKESDVRRCPGNDINCLEAFTSSVVMRDKSCERDM---------KMHLIKCPNVNCNENISIYNLKNHLNECNQKIEADN--NSVVLLS-TKQVQDIFXXXXXXXXXXXXXHDDSKLNLEL-----------KIEEIRNSIQNLKIQYSNISKSTFILD----NPVFLWPINRFSEAYDDAKSGKNTSIISKPFYVSEYGYKMSIKIYPNGHGEGLGTHLSIYFVILQGKYDPLLNWPFQEKISLELVGQKNK-TFSETFKGPPNSEWTQRPKQERSISVGNPKFIEIGKITKSDDLLIND-SLYIKMKI 1138
            EK+ C +CK++L    Q LCG R C  C    V+  D+  CP          +   +++++  +R +         +MH + C     +  I IY     L      I      +SV L   +  VQ I   +      +K +     L + L           ++E +R ++    I  + +   +  L+    + VFLW I+  +    DA +G+  S+ S  FY ++YGYK+ ++IY NG G G GTH+S++F +++G+YD LL WPF+ K++  LV   N+ +  + F+    S   QRP  + +++ G P F  I K+       I + +LYI+  I
Sbjct:   36 EKYLCCSCKNVLKKAQQTLCGHRYCTPCLVWIVRNHDL--CPKCKAEDPTTLSDDSLLKEERVKRSLFAFILLLITQMHSLLCAQNIPSLYICIYTYGTFLLCIFVFIHMGGRCHSVSLRQYSMGVQLIVCPEHSFSVHVKWRKQTPGLVMPLIKTPPLFPPSPQVENLRCTLAMKDIVLNELEMRSACLEQTSYDGVFLWKISDLTNKSHDAVTGRAISLYSPAFYTAKYGYKVCLRIYLNGDGAGKGTHVSLFFTVMKGEYDALLPWPFKHKVTFVLVDHNNRDSVFDAFRPDVTSASFQRPINDMNVASGCPLFCPIAKLNSPKHAYIRENTLYIRCII 375          
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Match: Traf5 (TNF receptor-associated factor 5 [Source:MGI Symbol;Acc:MGI:107548])

HSP 1 Score: 119.013 bits (297), Expect = 7.662e-31
Identity = 54/145 (37.24%), Postives = 88/145 (60.69%), Query Frame = 2
Query:  713 FLWPINRFSEAYDDAKSGKNTSIISKPFYVSEYGYKMSIKIYPNGHGEGLGTHLSIYFVILQGKYDPLLNWPFQEKISLELVGQKNKT--FSETFKGPPNSEWTQRPKQERSISVGNPKFIEIGKITKSDDLLI-NDSLYIKMKI 1138
             +W +  +     +A  G   S+ S+PFY S  GY++  + Y NG G G GTHLS+YFV+++G++D LL WPF+++++L L+ Q  K     ETFK  PNS   +RP  E +I+ G P+F+    +  S +  I +D+L++K+ +
Sbjct:   98 LIWKVTDYRVKKREAVEGHTVSVFSQPFYTSRCGYRLCARAYLNGDGSGKGTHLSLYFVVMRGEFDSLLQWPFRQRVTLMLLDQSGKKNHIVETFKADPNSSSFKRPDGEMNIASGCPRFVSHSTLENSKNTYIKDDTLFLKVAV 242          
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Match: Traf5 (TNF receptor-associated factor 5 [Source:MGI Symbol;Acc:MGI:107548])

HSP 1 Score: 119.013 bits (297), Expect = 7.662e-31
Identity = 54/145 (37.24%), Postives = 88/145 (60.69%), Query Frame = 2
Query:  713 FLWPINRFSEAYDDAKSGKNTSIISKPFYVSEYGYKMSIKIYPNGHGEGLGTHLSIYFVILQGKYDPLLNWPFQEKISLELVGQKNKT--FSETFKGPPNSEWTQRPKQERSISVGNPKFIEIGKITKSDDLLI-NDSLYIKMKI 1138
             +W +  +     +A  G   S+ S+PFY S  GY++  + Y NG G G GTHLS+YFV+++G++D LL WPF+++++L L+ Q  K     ETFK  PNS   +RP  E +I+ G P+F+    +  S +  I +D+L++K+ +
Sbjct:   98 LIWKVTDYRVKKREAVEGHTVSVFSQPFYTSRCGYRLCARAYLNGDGSGKGTHLSLYFVVMRGEFDSLLQWPFRQRVTLMLLDQSGKKNHIVETFKADPNSSSFKRPDGEMNIASGCPRFVSHSTLENSKNTYIKDDTLFLKVAV 242          
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Match: Traf2 (TNF receptor-associated factor 2 [Source:MGI Symbol;Acc:MGI:101835])

HSP 1 Score: 122.479 bits (306), Expect = 2.744e-30
Identity = 57/166 (34.34%), Postives = 99/166 (59.64%), Query Frame = 2
Query:  644 SIQNLKIQYSNISKSTFILDNPVFLWPINRFSEAYDDAKSGKNTSIISKPFYVSEYGYKMSIKIYPNGHGEGLGTHLSIYFVILQGKYDPLLNWPFQEKISLELVGQKNKTFS-ETFKGPPNSEWTQRPKQERSISVGNPKFIEIGKITKSDDLLINDSLYIKMKI 1138
            ++ +L+ + S +  ST+   + VF+W I+ F+    +A +G+  +I S  FY S YGYKM +++Y NG G G GTHLS++FV+++G  D LL WPF +K++L L+   N+    + F+    S   QRP  + +I+ G P F  + K+   +  + +D+++IK  +
Sbjct:  341 AMADLEQKVSELEVSTY---DGVFIWKISDFTRKRQEAVAGRTPAIFSPAFYTSRYGYKMCLRVYLNGDGTGRGTHLSLFFVVMKGPNDALLQWPFNQKVTLMLLDHNNREHVIDAFRPDVTSSSFQRPVSDMNIASGCPLFCPVSKMEAKNSYVRDDAIFIKAIV 503          
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Match: Traf2 (TNF receptor-associated factor 2 [Source:MGI Symbol;Acc:MGI:101835])

HSP 1 Score: 122.479 bits (306), Expect = 2.761e-30
Identity = 57/166 (34.34%), Postives = 99/166 (59.64%), Query Frame = 2
Query:  644 SIQNLKIQYSNISKSTFILDNPVFLWPINRFSEAYDDAKSGKNTSIISKPFYVSEYGYKMSIKIYPNGHGEGLGTHLSIYFVILQGKYDPLLNWPFQEKISLELVGQKNKTFS-ETFKGPPNSEWTQRPKQERSISVGNPKFIEIGKITKSDDLLINDSLYIKMKI 1138
            ++ +L+ + S +  ST+   + VF+W I+ F+    +A +G+  +I S  FY S YGYKM +++Y NG G G GTHLS++FV+++G  D LL WPF +K++L L+   N+    + F+    S   QRP  + +I+ G P F  + K+   +  + +D+++IK  +
Sbjct:  334 AMADLEQKVSELEVSTY---DGVFIWKISDFTRKRQEAVAGRTPAIFSPAFYTSRYGYKMCLRVYLNGDGTGRGTHLSLFFVVMKGPNDALLQWPFNQKVTLMLLDHNNREHVIDAFRPDVTSSSFQRPVSDMNIASGCPLFCPVSKMEAKNSYVRDDAIFIKAIV 496          
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Match: Traf5 (TNF receptor-associated factor 5 [Source:MGI Symbol;Acc:MGI:107548])

HSP 1 Score: 122.094 bits (305), Expect = 6.056e-30
Identity = 54/145 (37.24%), Postives = 88/145 (60.69%), Query Frame = 2
Query:  713 FLWPINRFSEAYDDAKSGKNTSIISKPFYVSEYGYKMSIKIYPNGHGEGLGTHLSIYFVILQGKYDPLLNWPFQEKISLELVGQKNKT--FSETFKGPPNSEWTQRPKQERSISVGNPKFIEIGKITKSDDLLI-NDSLYIKMKI 1138
             +W +  +     +A  G   S+ S+PFY S  GY++  + Y NG G G GTHLS+YFV+++G++D LL WPF+++++L L+ Q  K     ETFK  PNS   +RP  E +I+ G P+F+    +  S +  I +D+L++K+ +
Sbjct:  400 LIWKVTDYRVKKREAVEGHTVSVFSQPFYTSRCGYRLCARAYLNGDGSGKGTHLSLYFVVMRGEFDSLLQWPFRQRVTLMLLDQSGKKNHIVETFKADPNSSSFKRPDGEMNIASGCPRFVSHSTLENSKNTYIKDDTLFLKVAV 544          
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Match: sp|P39429|TRAF2_MOUSE (TNF receptor-associated factor 2 OS=Mus musculus OX=10090 GN=Traf2 PE=1 SV=1)

HSP 1 Score: 122.479 bits (306), Expect = 1.931e-29
Identity = 57/166 (34.34%), Postives = 99/166 (59.64%), Query Frame = 2
Query:  644 SIQNLKIQYSNISKSTFILDNPVFLWPINRFSEAYDDAKSGKNTSIISKPFYVSEYGYKMSIKIYPNGHGEGLGTHLSIYFVILQGKYDPLLNWPFQEKISLELVGQKNKTFS-ETFKGPPNSEWTQRPKQERSISVGNPKFIEIGKITKSDDLLINDSLYIKMKI 1138
            ++ +L+ + S +  ST+   + VF+W I+ F+    +A +G+  +I S  FY S YGYKM +++Y NG G G GTHLS++FV+++G  D LL WPF +K++L L+   N+    + F+    S   QRP  + +I+ G P F  + K+   +  + +D+++IK  +
Sbjct:  334 AMADLEQKVSELEVSTY---DGVFIWKISDFTRKRQEAVAGRTPAIFSPAFYTSRYGYKMCLRVYLNGDGTGRGTHLSLFFVVMKGPNDALLQWPFNQKVTLMLLDHNNREHVIDAFRPDVTSSSFQRPVSDMNIASGCPLFCPVSKMEAKNSYVRDDAIFIKAIV 496          
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Match: sp|Q12933|TRAF2_HUMAN (TNF receptor-associated factor 2 OS=Homo sapiens OX=9606 GN=TRAF2 PE=1 SV=2)

HSP 1 Score: 122.094 bits (305), Expect = 2.258e-29
Identity = 59/177 (33.33%), Postives = 103/177 (58.19%), Query Frame = 2
Query:  614 LELKIEEIRNSIQNLKIQYSNISKSTFILD----NPVFLWPINRFSEAYDDAKSGKNTSIISKPFYVSEYGYKMSIKIYPNGHGEGLGTHLSIYFVILQGKYDPLLNWPFQEKISLELVGQKNKTFS-ETFKGPPNSEWTQRPKQERSISVGNPKFIEIGKITKSDDLLINDSLYIK 1129
            L  K++++  SI    +  +++ +    ++    + VF+W I+ F+    +A +G+  +I S  FY S YGYKM ++IY NG G G GTHLS++FV+++G  D LL WPF +K++L L+ Q N+    + F+    S   QRP  + +I+ G P F  + K+   +  + +D+++IK
Sbjct:  317 LSSKVQQLERSIGLKDLAMADLEQKVLEMEASTYDGVFIWKISDFARKRQEAVAGRIPAIFSPAFYTSRYGYKMCLRIYLNGDGTGRGTHLSLFFVVMKGPNDALLRWPFNQKVTLMLLDQNNREHVIDAFRPDVTSSSFQRPVNDMNIASGCPLFCPVSKMEAKNSYVRDDAIFIK 493          
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Match: sp|P70191|TRAF5_MOUSE (TNF receptor-associated factor 5 OS=Mus musculus OX=10090 GN=Traf5 PE=1 SV=1)

HSP 1 Score: 121.709 bits (304), Expect = 5.037e-29
Identity = 54/145 (37.24%), Postives = 88/145 (60.69%), Query Frame = 2
Query:  713 FLWPINRFSEAYDDAKSGKNTSIISKPFYVSEYGYKMSIKIYPNGHGEGLGTHLSIYFVILQGKYDPLLNWPFQEKISLELVGQKNKT--FSETFKGPPNSEWTQRPKQERSISVGNPKFIEIGKITKSDDLLI-NDSLYIKMKI 1138
             +W +  +     +A  G   S+ S+PFY S  GY++  + Y NG G G GTHLS+YFV+++G++D LL WPF+++++L L+ Q  K     ETFK  PNS   +RP  E +I+ G P+F+    +  S +  I +D+L++K+ +
Sbjct:  406 LIWKVTDYRVKKREAVEGHTVSVFSQPFYTSRCGYRLCARAYLNGDGSGKGTHLSLYFVVMRGEFDSLLQWPFRQRVTLMLLDQSGKKNHIVETFKADPNSSSFKRPDGEMNIASGCPRFVSHSTLENSKNTYIKDDTLFLKVAV 550          
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Match: sp|Q13114|TRAF3_HUMAN (TNF receptor-associated factor 3 OS=Homo sapiens OX=9606 GN=TRAF3 PE=1 SV=2)

HSP 1 Score: 121.324 bits (303), Expect = 7.858e-29
Identity = 59/179 (32.96%), Postives = 107/179 (59.78%), Query Frame = 2
Query:  602 SKLNLELKIEEIRNSIQNLKIQYSNISKSTFILDNPVFLWPINRFSEAYDDAKSGKNTSIISKPFYVSEYGYKMSIKIYPNGHGEGLGTHLSIYFVILQGKYDPLLNWPFQEKISLELV--GQKNKTFSETFKGPPNSEWTQRPKQERSISVGNPKFIEIGKITKSDDLLINDSLYIKM 1132
            S+ +  L + +IR  + ++ +++  +  +++   N V +W I  +     +A  GK  S+ S+PFY   +GYKM  ++Y NG G G GTHLS++FVI++G+YD LL WPF++K++L L+  G   +   + FK  PNS   ++P  E +I+ G P F+    + ++   + +D+++IK+
Sbjct:  386 SRHDQMLSVHDIR--LADMDLRFQVLETASY---NGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPDPNSSSFKKPTGEMNIASGCPVFV-AQTVLENGTYIKDDTIFIKV 558          
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Match: sp|Q60803|TRAF3_MOUSE (TNF receptor-associated factor 3 OS=Mus musculus OX=10090 GN=Traf3 PE=1 SV=2)

HSP 1 Score: 121.324 bits (303), Expect = 8.277e-29
Identity = 59/179 (32.96%), Postives = 107/179 (59.78%), Query Frame = 2
Query:  602 SKLNLELKIEEIRNSIQNLKIQYSNISKSTFILDNPVFLWPINRFSEAYDDAKSGKNTSIISKPFYVSEYGYKMSIKIYPNGHGEGLGTHLSIYFVILQGKYDPLLNWPFQEKISLELV--GQKNKTFSETFKGPPNSEWTQRPKQERSISVGNPKFIEIGKITKSDDLLINDSLYIKM 1132
            S+ +  L + +IR  + ++ +++  +  +++   N V +W I  +     +A  GK  S+ S+PFY   +GYKM  ++Y NG G G GTHLS++FVI++G+YD LL WPF++K++L L+  G   +   + FK  PNS   ++P  E +I+ G P F+    + ++   + +D+++IK+
Sbjct:  385 SRHDQMLSVHDIR--LADMDLRFQVLETASY---NGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPDPNSSSFKKPTGEMNIASGCPVFV-AQTVLENGTYIKDDTIFIKV 557          

HSP 2 Score: 51.9878 bits (123), Expect = 6.253e-6
Identity = 32/100 (32.00%), Postives = 49/100 (49.00%), Query Frame = 2
Query:  197 VPEKFKCINCKDILCSPVQLLCGCRMCLYCYNKVKESDVRRCPGNDINCLEAFTSSVVMRDKSCERDMKMHLIKCPN--VNCNENISIYNLKNHL-NECN 487
            V +K+KC  C+ +LC+P Q  CG R C  C   +  S   +C      C E+     V +D  C+R++    + C N    C E +++ +L  HL NEC 
Sbjct:   46 VEDKYKCEKCRLVLCNPKQTECGHRFCESCMAALLSSSSPKCTA----CQESIIKDKVFKDNCCKREILALQVYCRNEGRGCAEQLTLGHLLVHLKNECQ 141          
BLAST of TNF receptor-associated factor vs. TrEMBL
Match: A0A2I0LIG5 (TNF receptor-associated factor 2 OS=Columba livia OX=8932 GN=TRAF2 PE=4 SV=1)

HSP 1 Score: 141.739 bits (356), Expect = 4.909e-35
Identity = 89/318 (27.99%), Postives = 158/318 (49.69%), Query Frame = 2
Query:  206 KFKCINCKDILCSPVQLLCGCRMCLYCYNKVKESDVRRCPG--------NDINCLEAFTSSVVMRDKSCERDMKMHLIKCPNVNCNENISIYNLKNHLNECNQ-KIEADNNSVVLLSTKQVQDIFXXXXXXXXXXXXXHDDSKLNLELKIEEIRNSIQNLKIQYSNISKSTFILDNPVFLWPINRFSEAYDDAKSGKNTSIISKPFYVSEYGYKMSIKIYPNGHGEGLGTHLSIYFVILQGKYDPLLNWPFQEKISLELVGQKNKT-FSETFKGPPNSEWTQRPKQERSISVGNPKFIEIGKITKSDDLLINDSLYIK 1129
            K+ C +CK+IL  P Q  CG R C YC  K+  +  ++C            I+ LE   +S    D +  R+++     C N  C    +I   + H   C +  +  +     +   K   + +  + ++++   +   +    LE  I     ++  ++ +  N+  ST+   + VF+W I  F+    +A +G++ +I S  FY S+YGYKM +++Y NG G G GTHLS++FV+++G  D LL WPF +K++L L+ Q N+    + F+    S   QRP  E +I+ G P F  +  +   +  + +D+++IK
Sbjct:   31 KYLCSDCKNILRRPFQAQCGHRYCSYCLKKIISAGPQKCASCIQEGIYEEGISILE---TSSAFPDNAARREVESLPAVCINSGCTWKGTIKEYEAHDEVCPEFPLTCEGCGKKVPREKVPTEAYSRQHRLDQEKIETLSNKVRQLERSIGLKDLAMAEMEEKIRNMEASTY---DGVFIWKITEFARKRQEAITGRSPAIFSPAFYTSKYGYKMCLRVYLNGDGTGRGTHLSLFFVVMKGPNDALLRWPFNQKVTLMLLDQNNREHIIDAFRPDVTSSSFQRPVTEMNIASGCPLFCPVSVMEAKNSYVRDDAIFIK 342          
BLAST of TNF receptor-associated factor vs. TrEMBL
Match: D5JG59 (TNF receptor-associated factor-2-like protein A OS=Dugesia japonica OX=6161 GN=TRAF-2A PE=2 SV=1)

HSP 1 Score: 139.043 bits (349), Expect = 6.999e-34
Identity = 69/182 (37.91%), Postives = 108/182 (59.34%), Query Frame = 2
Query:  599 DSKLNLELKIEEIRNSIQNLKIQYSNISKSTFILDNPVFLWPINRFSEAYDDAKSGKNTSIISKPFYVSEYGYKMSIKIYPNGHGEGLGTHLSIYFVILQGKYDPLLNWPFQEKISLELVGQK--NKTFSETFKGPPNSEWTQRPKQERSISVGNPKFIEIGKITKSDDLLINDSLYIKMKI 1138
            +S+L +E  IEE++       IQ   I     I  N  F+W    F     DA+SG   S+ S  FY SE+GYKM +++YP G G G GTHLS++F I++G++D LL+WPF++K++L ++ Q+  +K  S+TFK    S   Q+P  E +I+ G PKFI +  I  +     ND++++K+ +
Sbjct:  169 ESRLKIEKTIEELKKKAPATSIQ--TIDNKNVIFRNASFIWKFTDFEVRRVDAESGGRVSVTSDAFYTSEFGYKMCLRVYPAGDGVGKGTHLSVFFAIMKGEFDDLLSWPFKQKVTLSILDQESGSKPHSDTFKPDARSACYQKPTDECNIASGFPKFILLSLIMNNSIYCKNDTIFLKIAV 348          
BLAST of TNF receptor-associated factor vs. TrEMBL
Match: D5JG60 (TNF receptor-associated factor-2-like protein B OS=Dugesia japonica OX=6161 GN=TRAF-2B PE=2 SV=1)

HSP 1 Score: 135.961 bits (341), Expect = 3.798e-32
Identity = 66/153 (43.14%), Postives = 95/153 (62.09%), Query Frame = 2
Query:  695 ILDNPVFLWPINRFSEAYDDAKSGKNTSIISKPFYVSEYGYKMSIKIYPNGHGEGLGTHLSIYFVILQGKYDPLLNWPFQEKISLELVGQKNKT--FSETFKGPPNSEWTQRPKQERSISVGNPKFIEIGKITKSDDLLINDSLYIKMKIHYF 1147
            +  N VF+W I RFSE   +A+ G   SI S  FY  E+GYKMS+KIYP G G G GTHLS++F +++G++D LL WPF+ K++L ++ QKNKT   S+TFK    S   Q+P  + +I+ G+PKFI   ++         D +Y+   I +F
Sbjct:  301 VYRNGVFIWKIERFSELKSEAERGNRISITSDYFYTKEFGYKMSMKIYPAGDGVGKGTHLSVFFTLMRGEFDDLLQWPFKNKVTLTILDQKNKTNDHSDTFKPDVRSTCYQQPTDDYNIASGSPKFITFSQL---------DEIYLXXXILFF 444          
BLAST of TNF receptor-associated factor vs. TrEMBL
Match: A0A401RTZ6 (TNF receptor-associated factor OS=Chiloscyllium punctatum OX=137246 GN=chiPu_0020091 PE=3 SV=1)

HSP 1 Score: 134.806 bits (338), Expect = 5.748e-32
Identity = 99/374 (26.47%), Postives = 182/374 (48.66%), Query Frame = 2
Query:  164 ESAMNSDSKSIVPEKFKCINCKDILCSPVQLLCGCRMCLYCYNKVKESDVRRCPGND--INCLEAFTSSVVMRDKSCER--------DMKMHLI-KCPNV-----NCNENISIYNLKNHLNECNQKIEADNNSVVLLSTK-----------------------QVQDI-------FXXXXXXXXXXXXXHDDSKLNLELKIEEIRNSIQNLKIQYSNISKSTFILDNPVFLWPINRFSEAYDDAKSGKNTSIISKPFYVSEYGYKMSIKIYPNGHGEGLGTHLSIYFVILQGKYDPLLNWPFQEKISLELV--GQKNKTFSETFKGPPNSEWTQRPKQERSISVGNPKFIEIGKITKSDDLLI-NDSLYIKMKI 1138
            +   + D    V  K++C +C+ +L +  Q  CG R C  C N +     + CP +   ++  EA  +S   +   C R        ++  HL+ KC        +C + +++  LK  ++E   +I+  ++++  L+ +                       Q Q+I       + +  +       +HD    NL L + E+R  +  + +++  +  +++   N   +W I  ++    +A SGK  S+ S+PFY S +GYKM  ++Y NG G G GTHLS++FV+++G+YDPLL WPF++K++L L+  G      S+TFK  PNS   +RP+ E +++ G P F+    +       I +D+++IK+ +
Sbjct:   39 DGGYSEDFVQAVDNKYRCEHCQRVLRNAKQTECGHRFCESCLNALLRVPGQFCPADQQPLDNTEAHLNSCPFQTIQCSRCPEMVQRQELSDHLMFKCKRQAAQCRHCQKEMTVAELK--VSELESEIQEKHSALQKLAGQIPKMEKEMSLTNQSVNRSEIKLNQSQNIRITINYPWLLISESVGQQVTQHD----NL-LSVHEVR--LAEIDLRFQLLETASY---NGRLIWKIRDYARRKQEAVSGKTLSLYSQPFYSSSFGYKMCARVYLNGDGMGKGTHLSLFFVVMRGEYDPLLPWPFKQKVTLTLLDQGLAKAHVSDTFKPDPNSSSFRRPQSEMNVASGCPLFVTQTVLENEMHHYIKDDTIFIKVTV 400          
BLAST of TNF receptor-associated factor vs. TrEMBL
Match: T1DBK6 (TRAF-4 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1)

HSP 1 Score: 134.42 bits (337), Expect = 1.622e-31
Identity = 65/150 (43.33%), Postives = 98/150 (65.33%), Query Frame = 2
Query:  695 ILDNPVFLWPINRFSEAYDDAKSGKNTSIISKPFYVSEYGYKMSIKIYPNGHGEGLGTHLSIYFVILQGKYDPLLNWPFQEKISLELVG--QKNKTFSETFKGPPNSEWTQRPKQERSISVGNPKFIEIGKITKSDDLLINDSLYIKMKI 1138
            I  N  ++W I  FS+  ++A  GKN +I+S+ FY S++GYKM +KIYP G G G GTHLSI+FVI++G YD +L WPF+ K+ + +     K+   S+TFK  P S   QRP++E +I+ G+PKFI   ++    + L  D+LYI++ +
Sbjct:  300 IFRNGKYMWKIKSFSKLRENAMRGKNPTILSEAFYTSDFGYKMCMKIYPCGDGVGKGTHLSIFFVIMKGDYDDILPWPFKNKVIITIFDDFSKSTNLSDTFKPDPKSICYQRPEEEYNIASGSPKFISFSELK---NFLKKDTLYIQINV 446          
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Match: traf2b (TNF receptor associated factor 2 [Source:NCBI gene;Acc:103028261])

HSP 1 Score: 130.183 bits (326), Expect = 6.022e-33
Identity = 63/178 (35.39%), Postives = 105/178 (58.99%), Query Frame = 2
Query:  611 NLELKIEEIRNSIQNLKIQYSNISKS----TFILDNPVFLWPINRFSEAYDDAKSGKNTSIISKPFYVSEYGYKMSIKIYPNGHGEGLGTHLSIYFVILQGKYDPLLNWPFQEKISLELVGQKNKT-FSETFKGPPNSEWTQRPKQERSISVGNPKFIEIGKITKSDDLLINDSLYIK 1129
            NL  K+ ++  ++    +Q +   ++     F   + VF+W I+ FS    DA +G+  ++ S  FY S+YGYKM +++Y NG G G G+HLS++FV+++GKYD LL WPF +K++L L+ Q N+    + F+   +S   QRP  E +I+ G P F  + K+      L +D+++IK
Sbjct:  346 NLSNKVRQLERTLTMRDLQLAESEQALRELQFCTYDGVFVWKISDFSRRRQDALAGRAPAMFSPAFYSSKYGYKMCLRLYLNGDGTGRGSHLSLFFVVMRGKYDALLKWPFSQKVTLMLLDQNNREHIIDAFRPDISSTSFQRPISEMNIASGCPLFCPLAKLAGKSSYLRDDTIFIK 523          
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Match: traf2a (TNF receptor-associated factor 2-like [Source:NCBI gene;Acc:103036375])

HSP 1 Score: 123.635 bits (309), Expect = 4.747e-31
Identity = 60/163 (36.81%), Postives = 101/163 (61.96%), Query Frame = 2
Query:  644 SIQNLKIQYSNISKSTFILDNPVFLWPINRFSEAYDDAKSGKNTSIISKPFYVSEYGYKMSIKIYPNGHGEGLGTHLSIYFVILQGKYDPLLNWPFQEKISLELVGQKNKT-FSETFKGPPNSEWTQRPKQERSISVGNPKFIEIGKITKSDDLLINDSLYIK 1129
            SI  ++ +   +S +T+   + VF+W I+ FS+   DA +G+  ++ S  FY S+YGYKM ++IY NG G G GTHLS++FV+++G  D LL WPF +K++L L+ Q N+    + F+   +S   QRP  + +I+ G P F  + K+   +  + +D+++IK
Sbjct:  292 SIVEMEGKMREMSAATY---DGVFVWKISDFSKKRQDAVAGRAPAMFSPAFYTSKYGYKMCLRIYLNGDGTGRGTHLSLFFVVMRGHSDALLKWPFNQKVTLMLLDQNNREHIIDAFRPDISSSSFQRPVSDMNIASGCPLFCPLSKLDSKNSYIRDDTIFIK 451          
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Match: traf2a (TNF receptor-associated factor 2-like [Source:NCBI gene;Acc:103036375])

HSP 1 Score: 124.79 bits (312), Expect = 6.642e-31
Identity = 60/163 (36.81%), Postives = 101/163 (61.96%), Query Frame = 2
Query:  644 SIQNLKIQYSNISKSTFILDNPVFLWPINRFSEAYDDAKSGKNTSIISKPFYVSEYGYKMSIKIYPNGHGEGLGTHLSIYFVILQGKYDPLLNWPFQEKISLELVGQKNKT-FSETFKGPPNSEWTQRPKQERSISVGNPKFIEIGKITKSDDLLINDSLYIK 1129
            SI  ++ +   +S +T+   + VF+W I+ FS+   DA +G+  ++ S  FY S+YGYKM ++IY NG G G GTHLS++FV+++G  D LL WPF +K++L L+ Q N+    + F+   +S   QRP  + +I+ G P F  + K+   +  + +D+++IK
Sbjct:  405 SIVEMEGKMREMSAATY---DGVFVWKISDFSKKRQDAVAGRAPAMFSPAFYTSKYGYKMCLRIYLNGDGTGRGTHLSLFFVVMRGHSDALLKWPFNQKVTLMLLDQNNREHIIDAFRPDISSSSFQRPVSDMNIASGCPLFCPLSKLDSKNSYIRDDTIFIK 564          
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Match: ENSAMXT00000035169.1 (pep primary_assembly:Astyanax_mexicanus-2.0:9:3354744:3362219:1 gene:ENSAMXG00000029095.1 transcript:ENSAMXT00000035169.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 111.694 bits (278), Expect = 4.019e-29
Identity = 54/147 (36.73%), Postives = 89/147 (60.54%), Query Frame = 2
Query:  704 NPVFLWPINRFSEAYDDAKSGKNTSIISKPFYVSEYGYKMSIKIYPNGHGEGLGTHLSIYFVILQGKYDPLLNWPFQEKISLELV--GQKNKTFSETFKGPPNSEWTQRPKQERSISVGNPKFIEIGKITKSDDLLINDSLYIKMKI 1138
            N   +W I  +     +A + K  S+ S+PFY   +GYKM  ++Y NG G G GTHLS++FV+++G+YD LL WPF++K++L L+  G   K   + FK  PNS   +RP  E +I+ G P F+    + ++   + +D+++IK+ +
Sbjct:    3 NGTLIWKIRDYKRRKAEAVASKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVVMRGEYDALLPWPFKQKVTLMLMDQGPARKHLGDAFKPDPNSSSFRRPTGEMNIASGCPLFVA-QTVLENGTYIKDDTIFIKVTV 148          
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Match: traf1 (TNF receptor-associated factor 1-like [Source:NCBI gene;Acc:103045252])

HSP 1 Score: 113.235 bits (282), Expect = 3.903e-27
Identity = 59/167 (35.33%), Postives = 96/167 (57.49%), Query Frame = 2
Query:  635 IRNSIQNLKIQYSNISKSTFILDNPVFLWPINRFSEAYDDAKSGKNTSIISKPFYVSEYGYKMSIKIYPNGHGEGLGTHLSIYFVILQGKYDPLLNWPFQEKISLELVGQKNKT-FSETFKGPPNSEWTQRPKQERSISVGNPKFIEIGKITKSDDLLI-NDSLYIK 1129
            IR  +Q   +Q S IS    +  +  FLW I   S+   +A +G+ +S  S  FY S YG+K+ +++Y  G G G GTH+S++FVI++G YDPLL+WPF++K++  L+ Q  +    + F+    S   QRP  E +++ G P F  + K+       + +D+L+IK
Sbjct:  346 IRKDLQISSLQQS-ISAQQDVSYDGTFLWRICDVSQKLKEAATGQKSSQYSPAFYTSRYGFKVCMRLYMYGDGVGKGTHISLFFVIMKGDYDPLLSWPFKQKVTFFLIDQNQREHVVDAFRPDLRSASFQRPVSEMNVASGCPLFFPLSKLRSPKHAYVKDDTLFIK 511          
BLAST of TNF receptor-associated factor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000074.1 (pep scaffold:Pmarinus_7.0:GL482142:165593:173010:-1 gene:ENSPMAG00000000066.1 transcript:ENSPMAT00000000074.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 123.635 bits (309), Expect = 1.261e-31
Identity = 61/181 (33.70%), Postives = 108/181 (59.67%), Query Frame = 2
Query:  602 SKLNLELKIEEIRNSIQNLKIQYSNISKSTFILDNPVFLWPINRFSEAYDDAKSGKNTSIISKPFYVSEYGYKMSIKIYPNGHGEGLGTHLSIYFVILQGKYDPLLNWPFQEKISLELV--GQKNKTFSETFKGPPNSEWTQRPKQERSISVGNPKFIEIGKITKSDDLLINDSLYIKMKI 1138
            S+ + +L   + R +  +L+ Q   +  +++   N   +W I  ++    DA SG+  S+ S+PFY S +GY+M  + Y NG G G GTHLS++FV+++G+YD LL WPF+++++L L+  G   +  S+TFK  P S   +RP  + +I+ G P F+    + +S   L +D+++IK+ +
Sbjct:  295 SRHDTQLFAHDTRLAEMDLRFQV--LETASY---NGKLVWKIRDYARRKQDAVSGRTLSLYSQPFYTSPFGYRMCARAYLNGDGVGRGTHLSLFFVVMRGEYDALLPWPFRQRVTLTLLDQGAARRQLSDTFKPDPASSSFRRPTSDMNIASGCPLFVSHVAL-ESASYLQDDTIFIKVVV 469          
BLAST of TNF receptor-associated factor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002130.1 (pep scaffold:Pmarinus_7.0:GL484662:8457:12718:-1 gene:ENSPMAG00000001936.1 transcript:ENSPMAT00000002130.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 119.398 bits (298), Expect = 2.250e-30
Identity = 51/144 (35.42%), Postives = 89/144 (61.81%), Query Frame = 2
Query:  713 FLWPINRFSEAYDDAKSGKNTSIISKPFYVSEYGYKMSIKIYPNGHGEGLGTHLSIYFVILQGKYDPLLNWPFQEKISLELV--GQKNKTFSETFKGPPNSEWTQRPKQERSISVGNPKFIEIGKITKSDDLLINDSLYIKMKI 1138
             +W I  ++    +A SG+  S+ S+PFY S +GYKM  + Y NG G G GTHLS++FV+++G+YD LL WPF+ +++L L+  G   +  S+TF   P S   +RP  + +++ G P F+    +  S   L++D++++++ +
Sbjct:  270 LVWKIRDYARRKQEAASGRTLSLYSQPFYTSPFGYKMCARAYLNGDGVGRGTHLSLFFVVMRGEYDALLEWPFRRRVTLSLLDQGAARRHLSDTFTPDPASGSFRRPDGDMNVASGCPLFVSHVALEGS-SYLVDDTVFVRVVV 412          
BLAST of TNF receptor-associated factor vs. Ensembl Sea Lamprey
Match: traf6 (TNF receptor-associated factor 6 [Source:NCBI gene;Acc:554561])

HSP 1 Score: 55.4546 bits (132), Expect = 1.083e-8
Identity = 43/183 (23.50%), Postives = 74/183 (40.44%), Query Frame = 2
Query:  671 SNISKSTFILDNPVFLWPINRFSE----------AYDDAKSGKNTSIISKPFYVSEYGYKMSIKI-------YPNGHGE------GLGTHLSIYFVILQGKYDPLLNWPFQEKISLELVGQKNKT---FSETFKGPPNSEWTQRPKQERSI-SVGNPKFIEIGKITKSDDLLINDSLYIKMKI 1138
            + +++S   L   +F W + RFS           A D         + S  FY    GY++ +++        P G         G   HL+++  +LQG YD  L WPF+ +I + +V Q  +     +E     P     QRP   R+    G   F++I  +      L +D L ++ ++
Sbjct:  381 ARVAESESRLCAGIFTWRVERFSRLLPGGLASGFASDGMHPDAPAVMHSSGFYTGVPGYRLCLRLQVLSGREVPAGAASPSVLLAGRQPHLALFVHLLQGDYDHRLPWPFKGRIRISVVDQCERDSVHVTEMMDADPQLSAFQRPSVHRNPKGFGYMNFMDINTLHHR-SYLRDDCLVVRCEV 562          
BLAST of TNF receptor-associated factor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008091.1 (pep scaffold:Pmarinus_7.0:GL477915:34322:50582:-1 gene:ENSPMAG00000007312.1 transcript:ENSPMAT00000008091.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 54.6842 bits (130), Expect = 1.446e-8
Identity = 33/114 (28.95%), Postives = 56/114 (49.12%), Query Frame = 2
Query:  611 NLELKIEEIRNSIQNLKIQYSNISKSTFILDNPVFLWPI----NRFSEAYDDAKSGKNTSIISKPFYVSEYGYKMSIKIYPNGHGEGLGTHLSIYFVILQGKYDPLLNWPFQEK 940
             +E   +E   SI  L  + + +  + +   N +FLW I    NR  EA + A+  +   I S  F+ + YGY++ +++  +G       H+S Y ++  G YD  L WP+Q K
Sbjct:  296 RVEHSDQETERSILGLTRRLAELENTAY---NGMFLWKIKHVINRLREAGNGAE--RPPQIDSPAFFTTRYGYRLRLRLCRSG------EHVSAYAMLGPGPYDATLAWPYQLK 398          
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Match: EDO49464 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RG36])

HSP 1 Score: 124.02 bits (310), Expect = 3.074e-31
Identity = 58/175 (33.14%), Postives = 108/175 (61.71%), Query Frame = 2
Query:  617 ELKIEEIRNSIQNLKIQYSNISKSTFILDNPVFLWPINRFSEAYDDAKSGKNTSIISKPFYVSEYGYKMSIKIYPNGHGEGLGTHLSIYFVILQGKYDPLLNWPFQEKISLELVGQ-KNKTFSETFKGPPNSEWTQRPKQERSISVGNPKFIEIGKITKSDDLLINDSLYIKMKI 1138
            +L + +I+ +  +LK+Q   +  +++   +  ++W I+ ++  Y +  SGK  SI S PFYV  YGYK   ++YPNG G G G+HLS++FV+++G++D LL WPF++K++ +L+ Q +     +TF+  P S   +RP    +I+ G P FI    + ++   + +D+++IK+ +
Sbjct:  353 QLALHDIQLAEHDLKLQM--LEATSY---DGTYIWKIDEYTRRYQEGVSGKTPSIYSPPFYVGRYGYKACARVYPNGDGMGKGSHLSLFFVLMRGEFDALLPWPFRQKVTFKLLDQDRVHDIGDTFRPDPTSSSFKRPTSNMNIASGCPLFISHTNL-QTRAYVRDDTMFIKIAV 521          
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Match: EDO35237 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SM27])

HSP 1 Score: 120.168 bits (300), Expect = 6.212e-30
Identity = 60/156 (38.46%), Postives = 92/156 (58.97%), Query Frame = 2
Query:  602 SKLNLELKIEEIRNSIQNLKIQYSNISKSTFILDNPVFLWPINRFSEAYDDAKSGKNTSIISKPFYVSEYGYKMSIKIYPNGHGEGLGTHLSIYFVILQGKYDPLLNWPFQEKISLELVGQKNKT-FSETFKGPPNSEWTQRPKQERSISVGNPKF 1066
            S+L   + I + +   ++L+IQ         I  +  FLW I++F+E Y +AKSG  TSI S PFY   +GYK+  +++PNG G     +LSI+  +++G+YD +L WPFQE I++ L+ Q N    SETF   P S   QRP +  +++ G P+F
Sbjct:  350 SQLESSITIHKTKLFQEDLRIQIQQA-----ISYDGTFLWKIDKFTERYAEAKSGNATSIYSSPFYTHRFGYKLCARLFPNGDGSARDNYLSIFIALMRGEYDSILPWPFQETITITLIDQDNGMNISETFDPDPCSISFQRPTRNINVASGCPRF 500          
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Match: EDO40665 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S6K0])

HSP 1 Score: 116.701 bits (291), Expect = 1.973e-29
Identity = 94/363 (25.90%), Postives = 167/363 (46.01%), Query Frame = 2
Query:  155 KRIESAMNSDSKSIVPEKFKCINCKDILCSPVQLL-CGCRMCLYCYNKVKESDVRRCPGNDINCLEAFTSSVVMRDKSCERDMKMHLIKCPN--VNCNENISIYNL------------KNHLNECNQ-KIEADNN--SVVLLSTKQVQDIFXXXXXXXXXXXXXHDDSKLNLELKIEEIRNSIQNLKIQYSNIS---------KSTFILDNPVFLWPINRFSEAYDDAKSGKNTS-IISKPFYVSEYGYKMSIKIYPNGHGEGLGTHLSIYFVILQGKYDPLLNWPFQEKISLELVGQ-------KNKTFSETFKGPPNSEWTQRPKQERSISVGNPKFIEIGKITKSDDLLINDSLYIKMKI 1138
            K+      +D    +P  ++C  C+     PVQ   CG R C  C   +       CP  D  C+   +   V  DK+C+R +    +KCPN   +C     + NL            K H+  C +  I+  NN     +   +    I    +     +  K+ D     ++K  E+   +Q+    + +++         +   I  N  FLW I+ +++ +  + + K    + S PFY  +YGYK+  + + NG G+G GTHLS+Y VI++G YD +L WPFQ+++   L+ Q       +NKT+  T     NS++  RP + +S+  G PKF+   +  KS + + +++++I +++
Sbjct:   22 KKEAGGFEADFVCTIPPDYQCPICQLPFRDPVQTRDCGHRFCESCLEPILRKPPAFCP-IDRRCI---SRDKVYPDKACKRTVLSLTVKCPNHVTDCEWVGELGNLPSNSSNSYEVLVKVHIEACKRVPIKCVNNCGRTDIAREEMAVHIDVDGDCPLATVPCKYSDVGCKTKVKRIEMEKHLQDSMASHLDMAHIRIRELEQRQEKICTNGKFLWKISNYTQLFQQSATKKEKEKLCSPPFYTGQYGYKLRAEAFLNGLGQGKGTHLSLYVVIMKGDYDSVLPWPFQQRVDFILIDQDDDFTSRQNKTWRLTCDR--NSDYFGRPNKAKSLGFGCPKFVS-QETLKSRNFVRDNTVFIMIEV 377          
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Match: EDO49545 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGK7])

HSP 1 Score: 117.087 bits (292), Expect = 2.678e-29
Identity = 99/406 (24.38%), Postives = 173/406 (42.61%), Query Frame = 2
Query:  146 NKTKRIESAMNSDSKSIVPEKFKCINCKDILCSPVQLL-CGCRMCLYCYNKVKESDVRRCPGNDINC---LEAFTSSVVMRDKSCER-----------------------DMKMHL-------IKCPNVNCNENISIYNLKNHL-----------NECNQKIEADNNSVVLLSTKQV----------QDI------FXXXXXXXXXXXXXHDDSKLNLELKIEEIRNSIQNLKIQYSNIS-------KSTFILDNPVFLWPINRFSEAYDDA-KSGKNTSIISKPFYVSEYGYKMSIKIYPNGHGEGLGTHLSIYFVILQGKYDPLLNWPFQEKISLELVGQKNKTFSETFKGPPNSEWT------QRPKQERSISVGNPKFIEIGKITKSDDLLINDSLYIKMKI 1138
            ++  R      ++    +PE+++C  C+     P+Q+  CG R C  C       ++RR  G+ + C       +S+ V  DK+  R                       +++ H        + C N  CNE +   +L+ HL           + C +     +    + S K++          +DI      F + E    +    + D     + + + +    +N    + NI+       +S  +  N +FLW I+ +   YD A  S +  +I S PFY S+YGYK+ +K Y NG   G GTHLS+Y +I++G YD LL WPF++KI+  L+ Q  K    T    PN           RP  + ++ +GNP F+   ++ +S + + +D ++IK  +
Sbjct:    3 DRVDRATGGYEAEFVEPLPEEYECPICQLAFRDPIQIEECGHRFCQSCLQ-----ELRRLQGSPVLCPMDRRPISSTKVFVDKAARRAILGLGVKCWNWKRKCEWTGELSNIEEHAKNCAHEDVHCTNPECNEVMPRRSLQYHLVSKCKWRIVSCHFCTEMYTYKDGKTHMKSCKRLPIECVNKCGAKDIPREEMPFHMSECPLAVHPCMYRDIGCPFKGRRDALEEHCKNAVHTHLNIACQKIRENESRSLCTNGIFLWKISNYKHQYDQAVASPEELAIFSPPFYTSQYGYKLRLKAYLNGRDRGKGTHLSLYIIIMKGDYDALLEWPFKQKITFYLIDQSEKQNHRTHLLSPNRSLPNIKVVFNRPTVKENLGIGNPCFVP-NEVLESGEYVKDDVMFIKAVV 402          
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Match: EDO38873 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SBN4])

HSP 1 Score: 113.235 bits (282), Expect = 1.162e-27
Identity = 60/182 (32.97%), Postives = 108/182 (59.34%), Query Frame = 2
Query:  599 DSKLNLELKIEEIRN-SIQNLKIQYSNISKSTFILDNPVFLWPINRFSEAYDDAKSGKNTSIISKPFYVSEYGYKMSIKIYPNGHGEGLGTHLSIYFVILQGKYDPLLNWPFQEKISLELVGQKN-KTFSETFKGPPNSEWTQRPKQERSISVGNPKFIEIGKITKSDDLLINDSLYIKMKI 1138
            + +L L  +   +RN +I +L+ + + +  +TF   + V LW I   +    +A SG+ TS  S  F+   +GYKM  +IY NG G G   H+S++FVI++G++D LL WPF++K++L L+ Q N +   + F+  P+S   QRP+ E +I+ G P F    ++T+    + +D++++K+ +
Sbjct:  299 ERQLELHDQGTGLRNLAIADLEERLNTLQGTTF---DSVLLWKITNVANKRSEATSGRVTSFYSPCFFTGPHGYKMCARIYLNGDGMGRNHHVSLFFVIMRGEFDALLRWPFRQKVTLMLLDQDNVEHVIDAFRPDPSSSSFQRPRAEMNIASGCPLFCSHEQLTQH-AYIRDDTMFLKIIV 476          
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Match: traf3 (TNF receptor associated factor 3 [Source:NCBI gene;Acc:101161601])

HSP 1 Score: 128.642 bits (322), Expect = 7.941e-33
Identity = 84/295 (28.47%), Postives = 148/295 (50.17%), Query Frame = 2
Query:  275 CLYCYNKVKESDVRR-----CPGNDINCLEAFTSSVVMRDKSCERDMKMHLIKCPNVNCNENISIYNLKNHLNECNQKIEADNNSVVLLSTKQVQDIFXXXXXXXXXXXXXHDDSKLNLELKIEEIRNSIQNLKIQYSNISKSTFILDNPVFLWPINRFSEAYDDAKSGKNTSIISKPFYVSEYGYKMSIKIYPNGHGEGLGTHLSIYFVILQGKYDPLLNWPFQEKISLELV--GQKNKTFSETFKGPPNSEWTQRPKQERSISVGNPKFIEIGKITKSDDLLINDSLYIKMKI 1138
            C +C NK+  +++++     CP   ++C    TSS + R    E+ M  H  K         + +      L +   ++E+   ++  + T+ +  + +      E    +HDD      L + EIR +  +L+ Q    +       N   +W I  +     DA +GK  S+ S+PFY   +GYKM  ++Y NG G G GTHLS++FV+++G+YD LL WPF++K++L L+  G   K   + FK  P+S   +RP  E +I+ G P F+    + +S   + +D+++IK+ +
Sbjct:  171 CEFCKNKMPLTELQKHKETVCPAFPVSCPNHCTSSSLPRS---EKLMSSHTEK--------LLELELELRSLRQLRDEMESLRGTLDTVRTR-LSALEQGGRASLETQLNRHDDM-----LSVHEIRLADMDLRFQVLETASY-----NGTLIWKIRDYKRRKQDAVAGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVVMRGEYDALLPWPFKQKVTLMLMDQGPSRKHLGDAFKPDPSSSSFRRPVAEMNIASGCPLFVS-QSVLESGTYIKDDTIFIKVTV 442          

HSP 2 Score: 48.9062 bits (115), Expect = 6.120e-6
Identity = 29/99 (29.29%), Postives = 45/99 (45.45%), Query Frame = 2
Query:  197 VPE-KFKCINCKDILCSPVQLLCGCRMCLYCYNKVKESDVRRCPGNDINCLEAFTSSVVMRDKSCERDMKMHLIKCPNV--NCNENISIYNLKNHLNEC 484
             PE K+ C  C+ +LC P Q  CG R C  C N +       CP +    +E      + RD  C R++    + C +    C E +S+  + +H+N C
Sbjct:   41 APEAKYCCEACRLVLCQPRQTECGHRFCYSCINDILSCPNPVCPAD----MEPLFKDKIFRDVCCHREIMALKVYCRSEANGCQEQMSLQQIPDHVNVC 135          
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Match: traf2b (TNF receptor associated factor 2 [Source:NCBI gene;Acc:101159764])

HSP 1 Score: 127.872 bits (320), Expect = 3.325e-32
Identity = 77/253 (30.43%), Postives = 132/253 (52.17%), Query Frame = 2
Query:  389 ERDMKMHLIKCPNVNCNENISIYNLKNHLNECNQKIEADNNSVVLLSTKQVQDIFXXXXXXXXXXXXXHDDSKL-NLELKIEEIRNSIQNLKIQYSNISKSTFILD----NPVFLWPINRFSEAYDDAKSGKNTSIISKPFYVSEYGYKMSIKIYPNGHGEGLGTHLSIYFVILQGKYDPLLNWPFQEKISLELVGQKNKT-FSETFKGPPNSEWTQRPKQERSISVGNPKFIEIGKITKSDDLLINDSLYIK 1129
            + D  + L + P+  C    S+ ++     + ++K+ A  N V +L+ +  +    ++    +      D  K+ NL  KI ++  S+    +Q S   +    L     + +F+W I  FS    +A SG+  ++ S  FY S+YGYKM +++Y NG G G GTHLS++FV+++ KYD LL WPF +K++L L+ Q N+    + F+    S   QRP  E +I+ G P F  + K+      L +D+++IK
Sbjct:  271 QEDSGLGLYRAPDDGCGAAASVPSV-----DLDKKVSALENIVCVLNREVERSSLTLEAFSHQHRL---DQEKIENLSNKIRQLERSLTVKDLQLSEAEQMVRELQYCTYDGIFVWKITDFSHRRQEAVSGRAPAMFSPAFYSSKYGYKMCLRLYLNGDGTGRGTHLSLFFVVMRSKYDALLKWPFSQKVTLMLLDQNNREHIIDAFRPDITSTSFQRPVSEMNIASGCPLFCPLAKLAGKSPYLRDDTIFIK 515          
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Match: traf2b (TNF receptor associated factor 2 [Source:NCBI gene;Acc:101159764])

HSP 1 Score: 127.487 bits (319), Expect = 3.684e-32
Identity = 76/253 (30.04%), Postives = 133/253 (52.57%), Query Frame = 2
Query:  389 ERDMKMHLIKCPNVNCNENISIYNLKNHLNECNQKIEADNNSVVLLSTKQVQDIFXXXXXXXXXXXXXHDDSKL-NLELKIEEIRNSIQNLKIQYSN----ISKSTFILDNPVFLWPINRFSEAYDDAKSGKNTSIISKPFYVSEYGYKMSIKIYPNGHGEGLGTHLSIYFVILQGKYDPLLNWPFQEKISLELVGQKNKT-FSETFKGPPNSEWTQRPKQERSISVGNPKFIEIGKITKSDDLLINDSLYIK 1129
            + D  + L + P+  C    S+ ++     + ++K+ A  N V +L+ +  +    ++    +      D  K+ NL  KI ++  S+    +Q S     + +  +   + +F+W I  FS    +A SG+  ++ S  FY S+YGYKM +++Y NG G G GTHLS++FV+++ KYD LL WPF +K++L L+ Q N+    + F+    S   QRP  E +I+ G P F  + K+      L +D+++IK
Sbjct:  264 QEDSGLGLYRAPDDGCGAAASVPSV-----DLDKKVSALENIVCVLNREVERSSLTLEAFSHQHRL---DQEKIENLSNKIRQLERSLTVKDLQLSEAEQMVRELQYCTYDGIFVWKITDFSHRRQEAVSGRAPAMFSPAFYSSKYGYKMCLRLYLNGDGTGRGTHLSLFFVVMRSKYDALLKWPFSQKVTLMLLDQNNREHIIDAFRPDITSTSFQRPVSEMNIASGCPLFCPLAKLAGKSPYLRDDTIFIK 508          
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Match: unm_sa808 (TNF receptor-associated factor 2 [Source:NCBI gene;Acc:101155367])

HSP 1 Score: 124.02 bits (310), Expect = 1.120e-30
Identity = 58/163 (35.58%), Postives = 100/163 (61.35%), Query Frame = 2
Query:  644 SIQNLKIQYSNISKSTFILDNPVFLWPINRFSEAYDDAKSGKNTSIISKPFYVSEYGYKMSIKIYPNGHGEGLGTHLSIYFVILQGKYDPLLNWPFQEKISLELVGQKNKT-FSETFKGPPNSEWTQRPKQERSISVGNPKFIEIGKITKSDDLLINDSLYIK 1129
            ++  ++ +   ++ +TF   + VF+W I+ F++   DA +G+  ++ S  FY S+YGYKM ++IY NG G G GTHLS++FV+++G  D LL WPF +K++L L+ Q N+    + F+    S   QRP  E +I+ G P F  + K+   +  + +D+++IK
Sbjct:  429 TVAEMEGRLREMAATTF---DGVFIWRISDFAKKRQDAVAGRAPAMFSPAFYTSKYGYKMCLRIYLNGDGTGRGTHLSLFFVVMRGLSDALLKWPFNQKVTLMLLDQSNREHIIDAFRPDVTSSSFQRPVSEMNIASGCPLFCPLSKLDAKNSYIRDDTIFIK 588          
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Match: ENSORLT00000020861.2 (TNF receptor-associated factor 2 [Source:NCBI gene;Acc:101167626])

HSP 1 Score: 123.25 bits (308), Expect = 1.802e-30
Identity = 57/163 (34.97%), Postives = 102/163 (62.58%), Query Frame = 2
Query:  644 SIQNLKIQYSNISKSTFILDNPVFLWPINRFSEAYDDAKSGKNTSIISKPFYVSEYGYKMSIKIYPNGHGEGLGTHLSIYFVILQGKYDPLLNWPFQEKISLELVGQKNKT-FSETFKGPPNSEWTQRPKQERSISVGNPKFIEIGKITKSDDLLINDSLYIK 1129
            SI  ++ +  ++S +T+   + +F+W I+ F++   DA +G+  ++ S  FY S+YGYKM ++IY NG G G GTHLS++FV+++G  D LL WPF +K++L L+ Q N+    + F+   +S   QRP  + +I+ G P F  + K+   +  + +++++IK
Sbjct:  402 SIVEMEGKMKDMSAATY---DGIFIWKISDFTKKRQDAMAGRAPAMFSPAFYTSKYGYKMCLRIYLNGDGTGRGTHLSLFFVVMRGHSDALLKWPFNQKVTLMLLDQNNREHIIDAFRPDISSSSFQRPVSDMNIASGCPLFCPLSKLDSKNSYIRDETIFIK 561          
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Match: SMESG000047296.1 (SMESG000047296.1)

HSP 1 Score: 632.098 bits (1629), Expect = 0.000e+0
Identity = 323/325 (99.38%), Postives = 324/325 (99.69%), Query Frame = 2
Query:  173 MNSDSKSIVPEKFKCINCKDILCSPVQLLCGCRMCLYCYNKVKESDVRRCPGNDINCLEAFTSSVVMRDKSCERDMKMHLIKCPNVNCNENISIYNLKNHLNECNQKIEADNNSVVLLSTKQVQDIFXXXXXXXXXXXXXHDDSKLNLELKIEEIRNSIQNLKIQYSNISKSTFILDNPVFLWPINRFSEAYDDAKSGKNTSIISKPFYVSEYGYKMSIKIYPNGHGEGLGTHLSIYFVILQGKYDPLLNWPFQEKISLELVGQKNKTFSETFKGPPNSEWTQRPKQERSISVGNPKFIEIGKITKSDDLLINDSLYIKMKIHYF 1147
            MNSDSKSIVPE+FKCINCKDILCSPVQLLCGCRMCLYCYNKVKESDVRRCPGNDINCLEAFTSSVVMRDKSCERDMKMHLIKCPNVNCNENISIYNLKNHLNECNQKIEADNNSVVLLSTKQVQDIFEIKEKIEELLKQKHDDSKLNLEL IEEIRNSIQNLKIQYSNISKSTFILDNPVFLWPINRFSEAYDDAKSGKNTSIISKPFYVSEYGYKMSIKIYPNGHGEGLGTHLSIYFVILQGKYDPLLNWPFQEKISLELVGQKNKTFSETFKGPPNSEWTQRPKQERSISVGNPKFIEIGKITKSDDLLINDSLYIKMKIHYF
Sbjct:    1 MNSDSKSIVPERFKCINCKDILCSPVQLLCGCRMCLYCYNKVKESDVRRCPGNDINCLEAFTSSVVMRDKSCERDMKMHLIKCPNVNCNENISIYNLKNHLNECNQKIEADNNSVVLLSTKQVQDIFEIKEKIEELLKQKHDDSKLNLELTIEEIRNSIQNLKIQYSNISKSTFILDNPVFLWPINRFSEAYDDAKSGKNTSIISKPFYVSEYGYKMSIKIYPNGHGEGLGTHLSIYFVILQGKYDPLLNWPFQEKISLELVGQKNKTFSETFKGPPNSEWTQRPKQERSISVGNPKFIEIGKITKSDDLLINDSLYIKMKIHYF 325          
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Match: SMESG000027153.1 (SMESG000027153.1)

HSP 1 Score: 141.354 bits (355), Expect = 1.563e-37
Identity = 87/257 (33.85%), Postives = 147/257 (57.20%), Query Frame = 2
Query:  413 IKCP--NVNCN-ENISIYNLKNHLNECNQKIEADNNSVVLL-----STKQVQDIFXXXXXXXXXXXXXHDDSKLNLELKIEEIRNSIQNLKIQ-----YSNISKSTFILDNPVFLWPINRFSEAYDDAKSGKNTSIISKPFYVSEYGYKMSIKIYPNGHGEGLGTHLSIYFVILQGKYDPLLNWPFQEKISLELVGQK--NKTFSETFKGPPNSEWTQRPKQERSISVGNPKFIEIGKITKSDDLLINDSLYIKMKI 1138
            ++CP  ++NCN + ++  NL  HLNE  + +   +N +  +     + K + D  E ++ + + L   +  S L++ LK +E   +I+ LK +        +   + I  N  F+W    F     DA+SG+  S+ S PFY SE+GYKM ++IYP G G G GTHLS++F I++G++D LL+WPF++K++L ++ Q+   K  S+TFK    S   Q+P  E +I+ G+PKFI +  I  +     ND++Y+K+ +
Sbjct:  209 LECPFHSLNCNVDKMTKENLMKHLNE--EYVSHTSNLISKIKDMENTIKNLTDELENQKVLTKELLDMNKKSSLSV-LKTQE---TIEKLKTKSFPTPIQAVENKSVIFRNATFIWKFTDFESKRIDAESGRKVSVTSDPFYTSEFGYKMCLRIYPAGDGVGKGTHLSVFFAIMKGEFDDLLSWPFKQKVTLSIMDQEAGTKHHSDTFKPDARSACYQKPVDECNIASGSPKFILLSLIMNNSLYCKNDTIYLKIAV 459          
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Match: SMESG000039089.1 (SMESG000039089.1)

HSP 1 Score: 139.428 bits (350), Expect = 7.816e-37
Identity = 63/147 (42.86%), Postives = 99/147 (67.35%), Query Frame = 2
Query:  704 NPVFLWPINRFSEAYDDAKSGKNTSIISKPFYVSEYGYKMSIKIYPNGHGEGLGTHLSIYFVILQGKYDPLLNWPFQEKISLELVGQKNKT--FSETFKGPPNSEWTQRPKQERSISVGNPKFIEIGKITKSDDLLINDSLYIKMKI 1138
            N VF+W +  F E   +A+ G   S+ S+PFY  E+GYKMS+KIYP G G G  THLS++F +++G +D LL WPF+ K++L ++ QKNKT  +S+TFK  P S   Q+P +E +I+ G+PKFI   ++   +  + ND++++K+ +
Sbjct:  319 NGVFIWKVEHFPELKANAERGNRISVTSEPFYTKEFGYKMSMKIYPAGDGVGKSTHLSVFFTLMKGDFDDLLVWPFKNKVTLTILDQKNKTSDYSDTFKPDPRSTCYQQPTEEYNIASGSPKFISFTQL--QEYYMKNDTIFLKIVV 463          
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Match: SMESG000047778.1 (SMESG000047778.1)

HSP 1 Score: 137.887 bits (346), Expect = 2.457e-36
Identity = 68/172 (39.53%), Postives = 106/172 (61.63%), Query Frame = 2
Query:  641 NSIQNLKIQYSNISK-----STFILDNPVFLWPINRFSEAYDDAKSGKNTSIISKPFYVSEYGYKMSIKIYPNGHGEGLGTHLSIYFVILQGKYDPLLNWPFQEKISLELVGQK-NKTFSETFKGPPNSEWTQRPKQERSISVGNPKFIEIGKITKSDDLLINDSLYIKMKI 1138
            +S++ L I+ +N+ +     S +      F+W I  F++    +KSG+N S++S+PFY  E GYKM +KIY  G G G GTHLSIY  I +GKYD LL WPF +K  + ++ Q  NK  +E FK    S   QRP  E +++ GNP+F+++  + ++DD   +D L+IK+++
Sbjct:  277 DSVELLNIEKTNLKQLISKVSCYKHVGSTFVWKIEHFTDTVKKSKSGQNLSLLSQPFYTKEIGYKMFLKIYSFGDGIGKGTHLSIYMAIGKGKYDSLLTWPFSQKFKISILNQNGNKDITECFKPTSESLSYQRPDGEINLATGNPRFVDLKTLYQNDDFTKDDILFIKLEV 448          

HSP 2 Score: 50.447 bits (119), Expect = 1.327e-6
Identity = 29/97 (29.90%), Postives = 48/97 (49.48%), Query Frame = 2
Query:  206 KFKCINCKDILCSPVQLLCGCRMCLYCYNKVKESDVRRCPGNDINCLEAFTSSVVMRDKSCERDMKMHLIKCPNVNCNENISIYNLKNHLNECNQKI 496
            +F C  C  ++  PVQ+ CGCR C  C +   +    +CP +D   +E       + D++ E++M    I C N NC   + + NL  HL +C + +
Sbjct:   61 RFFCKLCNSLMNVPVQMNCGCRFCDKCCDNYFQLRSTKCPSSDCRDIEI---KQKIPDRAIEKEMSKISISCINDNCQVKMFLPNLHRHLQQCPESV 154          
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Match: SMESG000027123.1 (SMESG000027123.1)

HSP 1 Score: 135.191 bits (339), Expect = 2.148e-35
Identity = 84/266 (31.58%), Postives = 135/266 (50.75%), Query Frame = 2
Query:  419 CPNVNCNENISIYNLKNHLNECNQKIEADNNSVVLLSTKQVQDIFXXXXXXXXXXXXXHDDSKLNLELKIEEIRNSIQNLKIQYSNISKSTFIL-----------DNPV-------------FLWPINRFSEAYDDAKSGKNTSIISKPFYVSEYGYKMSIKIYPNGHGEGLGTHLSIYFVILQGKYDPLLNWPFQEKISLELVGQKN--KTFSETFKGPPNSEWTQRPKQERSISVGNPKFIEIGKITKSDDLLINDSLYIKMKI 1138
            CPN NC E   + NLK HL  C  +   D N     +   +Q+    +           + +  +L  K+E     I+ +  +Y  +++    L            NPV             F+W I        +A+  +  SI S PFY SE+GYK+ +++YP+G G G GTHLS++F +++G+YD LL WPF++K++L L+ Q+N  K +S+TFK  P S   QRP  + +I+ G+PKF  I  ++ +     ND++YIK+ +
Sbjct:  182 CPN-NCGETKEL-NLKLHLETCLNRKSDDQND----TNYHIQEFSNTQLSNLLKQIALLNQTSKDLLTKLENQDVIIREMSTKYIALTEDNIKLTKKINALEAERSNPVKIIAKTNDFRNGSFIWKIKDLKSQIQNAERSERLSITSDPFYTSEFGYKLCLRVYPSGDGLGKGTHLSVFFALMKGEYDDLLPWPFRQKLTLSLLDQENFTKHYSDTFKPDPKSPCFQRPILDSNIASGSPKFYSISHLSFNSIYYKNDTIYIKITV 441          
The following BLAST results are available for this feature:
BLAST of TNF receptor-associated factor vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TRAF24.702e-3033.33TNF receptor associated factor 2 [Source:HGNC Symb... [more]
TRAF31.236e-2932.96TNF receptor associated factor 3 [Source:HGNC Symb... [more]
TRAF31.636e-2932.96TNF receptor associated factor 3 [Source:HGNC Symb... [more]
TRAF31.636e-2932.96TNF receptor associated factor 3 [Source:HGNC Symb... [more]
TRAF31.650e-2932.96TNF receptor associated factor 3 [Source:HGNC Symb... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
trf-11.549e-1826.60TNF Receptor Associated Factor (TRAF) homolog; TRF... [more]
trf-21.099e-1125.61TNF Receptor Associated Factor (TRAF) homolog [So... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Traf44.541e-2329.94gene:FBgn0026319 transcript:FBtr0334401[more]
Traf45.508e-2329.94gene:FBgn0026319 transcript:FBtr0077429[more]
Traf-like3.160e-726.76gene:FBgn0030748 transcript:FBtr0074275[more]
Traf-like3.818e-726.76gene:FBgn0030748 transcript:FBtr0074273[more]
Traf-like4.294e-726.76gene:FBgn0030748 transcript:FBtr0308606[more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
traf2b1.863e-3335.96Tnf receptor-associated factor 2b [Source:ZFIN;Acc... [more]
traf2b1.863e-3335.96Tnf receptor-associated factor 2b [Source:ZFIN;Acc... [more]
traf2b2.626e-3335.96Tnf receptor-associated factor 2b [Source:ZFIN;Acc... [more]
unm_sa8084.901e-3335.33un-named sa808 [Source:ZFIN;Acc:ZDB-GENE-120727-21... [more]
BX901915.16.800e-3336.81pep chromosome:GRCz11:CHR_ALT_CTG5_1_18:28764891:2... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TRAF21.680e-3033.70TNF receptor associated factor 2 [Source:NCBI gene... [more]
ssh21.186e-2934.10slingshot protein phosphatase 2 [Source:Xenbase;Ac... [more]
ssh21.331e-2934.10slingshot protein phosphatase 2 [Source:Xenbase;Ac... [more]
TRAF21.904e-2934.29TNF receptor associated factor 2 [Source:NCBI gene... [more]
hspb65.245e-2827.19heat shock protein family B (small) member 6 [Sour... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Traf57.662e-3137.24TNF receptor-associated factor 5 [Source:MGI Symbo... [more]
Traf57.662e-3137.24TNF receptor-associated factor 5 [Source:MGI Symbo... [more]
Traf22.744e-3034.34TNF receptor-associated factor 2 [Source:MGI Symbo... [more]
Traf22.761e-3034.34TNF receptor-associated factor 2 [Source:MGI Symbo... [more]
Traf56.056e-3037.24TNF receptor-associated factor 5 [Source:MGI Symbo... [more]
back to top
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P39429|TRAF2_MOUSE1.931e-2934.34TNF receptor-associated factor 2 OS=Mus musculus O... [more]
sp|Q12933|TRAF2_HUMAN2.258e-2933.33TNF receptor-associated factor 2 OS=Homo sapiens O... [more]
sp|P70191|TRAF5_MOUSE5.037e-2937.24TNF receptor-associated factor 5 OS=Mus musculus O... [more]
sp|Q13114|TRAF3_HUMAN7.858e-2932.96TNF receptor-associated factor 3 OS=Homo sapiens O... [more]
sp|Q60803|TRAF3_MOUSE8.277e-2932.96TNF receptor-associated factor 3 OS=Mus musculus O... [more]
back to top
BLAST of TNF receptor-associated factor vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2I0LIG54.909e-3527.99TNF receptor-associated factor 2 OS=Columba livia ... [more]
D5JG596.999e-3437.91TNF receptor-associated factor-2-like protein A OS... [more]
D5JG603.798e-3243.14TNF receptor-associated factor-2-like protein B OS... [more]
A0A401RTZ65.748e-3226.47TNF receptor-associated factor OS=Chiloscyllium pu... [more]
T1DBK61.622e-3143.33TRAF-4 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1[more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
traf2b6.022e-3335.39TNF receptor associated factor 2 [Source:NCBI gene... [more]
traf2a4.747e-3136.81TNF receptor-associated factor 2-like [Source:NCBI... [more]
traf2a6.642e-3136.81TNF receptor-associated factor 2-like [Source:NCBI... [more]
ENSAMXT00000035169.14.019e-2936.73pep primary_assembly:Astyanax_mexicanus-2.0:9:3354... [more]
traf13.903e-2735.33TNF receptor-associated factor 1-like [Source:NCBI... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ENSPMAT00000000074.11.261e-3133.70pep scaffold:Pmarinus_7.0:GL482142:165593:173010:-... [more]
ENSPMAT00000002130.12.250e-3035.42pep scaffold:Pmarinus_7.0:GL484662:8457:12718:-1 g... [more]
traf61.083e-823.50TNF receptor-associated factor 6 [Source:NCBI gene... [more]
ENSPMAT00000008091.11.446e-828.95pep scaffold:Pmarinus_7.0:GL477915:34322:50582:-1 ... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO494643.074e-3133.14Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO352376.212e-3038.46Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO406651.973e-2925.90Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO495452.678e-2924.38Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO388731.162e-2732.97Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
traf37.941e-3328.47TNF receptor associated factor 3 [Source:NCBI gene... [more]
traf2b3.325e-3230.43TNF receptor associated factor 2 [Source:NCBI gene... [more]
traf2b3.684e-3230.04TNF receptor associated factor 2 [Source:NCBI gene... [more]
unm_sa8081.120e-3035.58TNF receptor-associated factor 2 [Source:NCBI gene... [more]
ENSORLT00000020861.21.802e-3034.97TNF receptor-associated factor 2 [Source:NCBI gene... [more]
back to top
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000047296.10.000e+099.38SMESG000047296.1[more]
SMESG000027153.11.563e-3733.85SMESG000027153.1[more]
SMESG000039089.17.816e-3742.86SMESG000039089.1[more]
SMESG000047778.12.457e-3639.53SMESG000047778.1[more]
SMESG000027123.12.148e-3531.58SMESG000027123.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30009834 ID=SMED30009834|Name=TNF receptor-associated factor|organism=Schmidtea mediterranea sexual|type=transcript|length=1164bp
CCTTAAATAATTTGATTTGATGCAGAATTGTTTAAAATCATAAATTACAC
ATACAAATGCCAAATTTCTGAGTAGTTATTAAGACGTCATTCAGCATAAG
ATTACTTTTAAACATTTTACTGACTTCGGATTTTGAAAATAAATCAACAA
AACAAAAAGAATTGAGAGTGCAATGAATTCTGACTCTAAATCAATAGTCC
CAGAAAAGTTTAAGTGCATTAACTGTAAAGATATTCTTTGTAGTCCAGTA
CAATTGTTATGTGGATGTCGGATGTGTCTGTACTGTTATAACAAAGTAAA
AGAGTCGGACGTCAGGCGATGTCCAGGTAACGACATCAACTGTTTAGAAG
CATTTACCAGCTCTGTTGTTATGCGAGATAAATCTTGTGAAAGAGACATG
AAAATGCATTTGATAAAATGTCCAAATGTAAATTGTAATGAAAATATTTC
CATTTACAATTTAAAAAATCATCTCAATGAATGTAATCAAAAAATTGAGG
CTGATAATAATTCTGTCGTTCTCTTATCTACCAAACAAGTTCAAGATATC
TTCGAAATTAAAGAAAAAATCGAGGAATTACTAAAACAAAAACATGATGA
TTCGAAATTAAACTTAGAATTGAAAATTGAAGAAATAAGAAATTCCATTC
AGAATTTGAAGATCCAGTATAGCAATATTTCAAAATCCACTTTTATTTTG
GATAATCCGGTATTTTTGTGGCCTATTAATCGTTTTTCAGAGGCTTATGA
TGATGCTAAATCTGGTAAAAATACTTCTATAATAAGTAAACCATTTTATG
TCAGTGAATATGGATACAAAATGTCCATTAAAATATATCCGAATGGCCAT
GGAGAAGGATTAGGGACCCATTTATCGATATATTTTGTGATTTTACAAGG
AAAATATGACCCATTGTTAAATTGGCCATTTCAAGAAAAAATTTCTTTAG
AATTAGTTGGACAAAAAAATAAAACTTTTTCGGAAACATTTAAAGGTCCG
CCAAATTCTGAATGGACTCAAAGACCAAAACAAGAAAGGAGCATAAGTGT
AGGAAATCCAAAGTTTATTGAAATTGGAAAAATTACTAAATCTGATGATC
TTTTAATAAACGATTCTTTGTATATTAAAATGAAAATTCATTACTTTTAA
TTGTTGAAAAAAAA
back to top

protein sequence of SMED30009834-orf-1

>SMED30009834-orf-1 ID=SMED30009834-orf-1|Name=SMED30009834-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=326bp
MNSDSKSIVPEKFKCINCKDILCSPVQLLCGCRMCLYCYNKVKESDVRRC
PGNDINCLEAFTSSVVMRDKSCERDMKMHLIKCPNVNCNENISIYNLKNH
LNECNQKIEADNNSVVLLSTKQVQDIFEIKEKIEELLKQKHDDSKLNLEL
KIEEIRNSIQNLKIQYSNISKSTFILDNPVFLWPINRFSEAYDDAKSGKN
TSIISKPFYVSEYGYKMSIKIYPNGHGEGLGTHLSIYFVILQGKYDPLLN
WPFQEKISLELVGQKNKTFSETFKGPPNSEWTQRPKQERSISVGNPKFIE
IGKITKSDDLLINDSLYIKMKIHYF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0001817regulation of cytokine production
GO:0007165signal transduction
GO:0008063Toll signaling pathway
GO:0032088negative regulation of NF-kappaB transcription factor activity
GO:0033209tumor necrosis factor-mediated signaling pathway
GO:0042981regulation of apoptotic process
GO:0045087innate immune response
GO:0050688regulation of defense response to virus
Vocabulary: molecular function
TermDefinition
GO:0005164tumor necrosis factor receptor binding
GO:0005515protein binding
GO:0008270zinc ion binding
GO:0046872metal ion binding
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR043211TNF_rcpt-assoc_TRAF
IPR002083MATH/TRAF_dom
IPR008974TRAF-like
IPR013083Znf_RING/FYVE/PHD
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 145..172
NoneNo IPR availablePANTHERPTHR10131:SF127coord: 139..321
NoneNo IPR availablePROSITEPS51257PROKAR_LIPOPROTEINcoord: 1..32
score: 5.0
IPR002083MATH/TRAF domainSMARTSM00061math_3coord: 180..304
e-value: 2.5E-7
score: 40.4
IPR002083MATH/TRAF domainPROSITEPS50144MATHcoord: 178..322
score: 22.615
IPR013083Zinc finger, RING/FYVE/PHD-typeGENE3DG3DSA:3.30.40.10coord: 1..114
e-value: 7.5E-11
score: 44.0
IPR008974TRAF-likeGENE3DG3DSA:2.60.210.10coord: 144..324
e-value: 2.9E-49
score: 169.1
IPR008974TRAF-likeSUPERFAMILYSSF49599TRAF domain-likecoord: 178..323
IPR043211TNF receptor-associated factor TRAFPANTHERPTHR10131TNF RECEPTOR ASSOCIATED FACTORcoord: 139..321