SMED30009828

Overview
NameSMED30009828
Smed IDSMED30009828
Length (bp)731
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30009828 (SMED30009828) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30009828 (SMED30009828) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30009828 (SMED30009828) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30009828 (SMED30009828) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30009828

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
epidermisSMED30009828 dd_Smed_v4_16504_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30009828 dd_Smed_v4_16504_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30009828 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.009455:4470..5288 -3554
Homology
BLAST of SMED30009828 vs. Ensembl Human
Match: BIRC7 (baculoviral IAP repeat containing 7 [Source:HGNC Symbol;Acc:HGNC:13702])

HSP 1 Score: 47.3654 bits (111), Expect = 4.935e-6
Identity = 19/48 (39.58%), Postives = 30/48 (62.50%), Query Frame = 2
Query:  590 DEKIENEQERHTCNICMDDLVNIA-LQCGHLLCCNCSYQLIVCPLCNA 730
            + ++   QE  TC +C+D  V+I  + CGHL+C  C+  L +CP+C A
Sbjct:  135 EAQLRRLQEERTCKVCLDRAVSIVFVPCGHLVCAECAPGLQLCPICRA 182          
BLAST of SMED30009828 vs. Ensembl Human
Match: BIRC7 (baculoviral IAP repeat containing 7 [Source:HGNC Symbol;Acc:HGNC:13702])

HSP 1 Score: 48.1358 bits (113), Expect = 5.583e-6
Identity = 19/48 (39.58%), Postives = 30/48 (62.50%), Query Frame = 2
Query:  590 DEKIENEQERHTCNICMDDLVNIA-LQCGHLLCCNCSYQLIVCPLCNA 730
            + ++   QE  TC +C+D  V+I  + CGHL+C  C+  L +CP+C A
Sbjct:  240 EAQLRRLQEERTCKVCLDRAVSIVFVPCGHLVCAECAPGLQLCPICRA 287          
BLAST of SMED30009828 vs. Ensembl Human
Match: BIRC7 (baculoviral IAP repeat containing 7 [Source:HGNC Symbol;Acc:HGNC:13702])

HSP 1 Score: 47.7506 bits (112), Expect = 6.627e-6
Identity = 19/48 (39.58%), Postives = 30/48 (62.50%), Query Frame = 2
Query:  590 DEKIENEQERHTCNICMDDLVNIA-LQCGHLLCCNCSYQLIVCPLCNA 730
            + ++   QE  TC +C+D  V+I  + CGHL+C  C+  L +CP+C A
Sbjct:  222 EAQLRRLQEERTCKVCLDRAVSIVFVPCGHLVCAECAPGLQLCPICRA 269          
BLAST of SMED30009828 vs. Ensembl Zebrafish
Match: mib2 (mindbomb E3 ubiquitin protein ligase 2 [Source:ZFIN;Acc:ZDB-GENE-050628-1])

HSP 1 Score: 51.2174 bits (121), Expect = 4.667e-7
Identity = 22/66 (33.33%), Postives = 32/66 (48.48%), Query Frame = 2
Query:  527 TETNCKAEIEEFYRKNHKNTKDEKIENEQERHTCNICMDDLVNIALQCGHLLCCNCSYQLIVCPLC 724
            TE  C    E   + +       +    +ER TC IC+D+ + +  QCGH  C +CS  L  CP+C
Sbjct:  812 TEVECSPSSENSEQHHLLEQLQSRYRQMEERITCPICIDNHIRLVFQCGHASCIDCSSALKTCPIC 877          
BLAST of SMED30009828 vs. Ensembl Zebrafish
Match: birc7 (baculoviral IAP repeat containing 7 [Source:ZFIN;Acc:ZDB-GENE-070615-35])

HSP 1 Score: 49.6766 bits (117), Expect = 9.832e-7
Identity = 24/63 (38.10%), Postives = 38/63 (60.32%), Query Frame = 2
Query:  554 EEFYRKNHKNTK--DEKIENEQERHTCNICMDDLVNIA-LQCGHL-LCCNCSYQLIVCPLCNA 730
            + F+  N +  +  DE++   QE  TC +CMD LV++  + CGHL +C +C+  L  CP+C A
Sbjct:  220 QSFFNMNGRGVRKNDEQLRQLQEERTCKVCMDKLVSMVFIPCGHLVVCSDCAASLRHCPICRA 282          
BLAST of SMED30009828 vs. Ensembl Zebrafish
Match: birc7 (baculoviral IAP repeat containing 7 [Source:ZFIN;Acc:ZDB-GENE-070615-35])

HSP 1 Score: 46.9802 bits (110), Expect = 8.099e-6
Identity = 21/51 (41.18%), Postives = 33/51 (64.71%), Query Frame = 2
Query:  584 TKDEKIENEQERHTCNICMDDLVNIA-LQCGHL-LCCNCSYQLIVCPLCNA 730
            + +E++   QE  TC +CMD LV++  + CGHL +C +C+  L  CP+C A
Sbjct:  268 SPEEQLRQLQEERTCKVCMDKLVSMVFIPCGHLVVCSDCAASLRHCPICRA 318          
BLAST of SMED30009828 vs. Ensembl Xenopus
Match: coa7 (cytochrome c oxidase assembly factor 7 (putative) [Source:Xenbase;Acc:XB-GENE-6258829])

HSP 1 Score: 53.9138 bits (128), Expect = 8.632e-8
Identity = 23/66 (34.85%), Postives = 32/66 (48.48%), Query Frame = 2
Query:  527 TETNCKAEIEEFYRKNHKNTKDEKIENEQERHTCNICMDDLVNIALQCGHLLCCNCSYQLIVCPLC 724
            TE  C   +E   +K        +    +ER TC IC+D+ + +  QCGH  C  CS  L  CP+C
Sbjct:  884 TEVECSPSLEVSDQKKVMEELQNRYRQMEERITCPICIDNHIKLVFQCGHGSCTECSTSLTACPIC 949          
BLAST of SMED30009828 vs. Ensembl Xenopus
Match: coa7 (cytochrome c oxidase assembly factor 7 (putative) [Source:Xenbase;Acc:XB-GENE-6258829])

HSP 1 Score: 53.9138 bits (128), Expect = 9.016e-8
Identity = 23/66 (34.85%), Postives = 32/66 (48.48%), Query Frame = 2
Query:  527 TETNCKAEIEEFYRKNHKNTKDEKIENEQERHTCNICMDDLVNIALQCGHLLCCNCSYQLIVCPLC 724
            TE  C   +E   +K        +    +ER TC IC+D+ + +  QCGH  C  CS  L  CP+C
Sbjct:  871 TEVECSPSLEVSDQKKVMEELQNRYRQMEERITCPICIDNHIKLVFQCGHGSCTECSTSLTACPIC 936          
BLAST of SMED30009828 vs. Ensembl Xenopus
Match: coa7 (cytochrome c oxidase assembly factor 7 (putative) [Source:Xenbase;Acc:XB-GENE-6258829])

HSP 1 Score: 53.9138 bits (128), Expect = 9.021e-8
Identity = 23/66 (34.85%), Postives = 32/66 (48.48%), Query Frame = 2
Query:  527 TETNCKAEIEEFYRKNHKNTKDEKIENEQERHTCNICMDDLVNIALQCGHLLCCNCSYQLIVCPLC 724
            TE  C   +E   +K        +    +ER TC IC+D+ + +  QCGH  C  CS  L  CP+C
Sbjct:  874 TEVECSPSLEVSDQKKVMEELQNRYRQMEERITCPICIDNHIKLVFQCGHGSCTECSTSLTACPIC 939          
BLAST of SMED30009828 vs. Ensembl Xenopus
Match: coa7 (cytochrome c oxidase assembly factor 7 (putative) [Source:Xenbase;Acc:XB-GENE-6258829])

HSP 1 Score: 53.9138 bits (128), Expect = 9.295e-8
Identity = 23/66 (34.85%), Postives = 32/66 (48.48%), Query Frame = 2
Query:  527 TETNCKAEIEEFYRKNHKNTKDEKIENEQERHTCNICMDDLVNIALQCGHLLCCNCSYQLIVCPLC 724
            TE  C   +E   +K        +    +ER TC IC+D+ + +  QCGH  C  CS  L  CP+C
Sbjct:  839 TEVECSPSLEVSDQKKVMEELQNRYRQMEERITCPICIDNHIKLVFQCGHGSCTECSTSLTACPIC 904          
BLAST of SMED30009828 vs. Ensembl Xenopus
Match: coa7 (cytochrome c oxidase assembly factor 7 (putative) [Source:Xenbase;Acc:XB-GENE-6258829])

HSP 1 Score: 50.0618 bits (118), Expect = 1.759e-6
Identity = 20/48 (41.67%), Postives = 29/48 (60.42%), Query Frame = 2
Query:  593 EKIENE----QERHTCNICMDDLVNIALQCGHLLCCNCSYQLIVCPLC 724
            E+++N     +ER TC IC+D+ + +  QCGH  C  CS  L  CP+C
Sbjct:  893 EELQNRYRQMEERITCPICIDNHIKLVFQCGHGSCTECSTSLTACPIC 940          
BLAST of SMED30009828 vs. UniProt/SwissProt
Match: sp|Q5ZIJ9|MIB2_CHICK (E3 ubiquitin-protein ligase MIB2 OS=Gallus gallus OX=9031 GN=MIB2 PE=2 SV=1)

HSP 1 Score: 55.8398 bits (133), Expect = 1.126e-7
Identity = 24/66 (36.36%), Postives = 33/66 (50.00%), Query Frame = 2
Query:  527 TETNCKAEIEEFYRKNHKNTKDEKIENEQERHTCNICMDDLVNIALQCGHLLCCNCSYQLIVCPLC 724
            TE  C    E   ++        +    +ER TC IC+DD + +  QCGH  C +CS  L VCP+C
Sbjct:  877 TEVECSPSSESTDQRKLMEELQNRYRQMEERITCPICIDDQIKLVFQCGHGSCPDCSTALTVCPIC 942          
BLAST of SMED30009828 vs. Ensembl Cavefish
Match: mib2 (mindbomb E3 ubiquitin protein ligase 2 [Source:NCBI gene;Acc:103034310])

HSP 1 Score: 53.1434 bits (126), Expect = 9.684e-8
Identity = 22/66 (33.33%), Postives = 32/66 (48.48%), Query Frame = 2
Query:  527 TETNCKAEIEEFYRKNHKNTKDEKIENEQERHTCNICMDDLVNIALQCGHLLCCNCSYQLIVCPLC 724
            TE  C    +   + N       +    +ER TC IC+D+ + +  QCGH  C +CS  L  CP+C
Sbjct:  940 TEVECSPNSDNSEQHNLLEQLQSRYRQMEERITCPICIDNQIKLVFQCGHASCIDCSAALKTCPIC 1005          
BLAST of SMED30009828 vs. Ensembl Cavefish
Match: mib2 (mindbomb E3 ubiquitin protein ligase 2 [Source:NCBI gene;Acc:103034310])

HSP 1 Score: 53.1434 bits (126), Expect = 9.924e-8
Identity = 22/66 (33.33%), Postives = 32/66 (48.48%), Query Frame = 2
Query:  527 TETNCKAEIEEFYRKNHKNTKDEKIENEQERHTCNICMDDLVNIALQCGHLLCCNCSYQLIVCPLC 724
            TE  C    +   + N       +    +ER TC IC+D+ + +  QCGH  C +CS  L  CP+C
Sbjct:  870 TEVECSPNSDNSEQHNLLEQLQSRYRQMEERITCPICIDNQIKLVFQCGHASCIDCSAALKTCPIC 935          
BLAST of SMED30009828 vs. Ensembl Cavefish
Match: mib2 (mindbomb E3 ubiquitin protein ligase 2 [Source:NCBI gene;Acc:103034310])

HSP 1 Score: 53.1434 bits (126), Expect = 1.004e-7
Identity = 22/66 (33.33%), Postives = 32/66 (48.48%), Query Frame = 2
Query:  527 TETNCKAEIEEFYRKNHKNTKDEKIENEQERHTCNICMDDLVNIALQCGHLLCCNCSYQLIVCPLC 724
            TE  C    +   + N       +    +ER TC IC+D+ + +  QCGH  C +CS  L  CP+C
Sbjct:  934 TEVECSPNSDNSEQHNLLEQLQSRYRQMEERITCPICIDNQIKLVFQCGHASCIDCSAALKTCPIC 999          
BLAST of SMED30009828 vs. Ensembl Cavefish
Match: birc7 (baculoviral IAP repeat-containing protein 7 [Source:NCBI gene;Acc:103036970])

HSP 1 Score: 47.7506 bits (112), Expect = 4.845e-6
Identity = 21/51 (41.18%), Postives = 33/51 (64.71%), Query Frame = 2
Query:  584 TKDEKIENEQERHTCNICMDDLVNIA-LQCGHL-LCCNCSYQLIVCPLCNA 730
            + +E++   QE  TC +CMD LV++  + CGHL +C +C+  L  CP+C A
Sbjct:  365 SAEEQLRQLQEERTCKVCMDKLVSMVFIPCGHLVVCTDCAASLRHCPICRA 415          
BLAST of SMED30009828 vs. Ensembl Cavefish
Match: birc7 (baculoviral IAP repeat-containing protein 7 [Source:NCBI gene;Acc:103036970])

HSP 1 Score: 47.3654 bits (111), Expect = 5.883e-6
Identity = 21/51 (41.18%), Postives = 33/51 (64.71%), Query Frame = 2
Query:  584 TKDEKIENEQERHTCNICMDDLVNIA-LQCGHLLCC-NCSYQLIVCPLCNA 730
            + +E++   QE  TC +CMD LV++  + CGHL+ C +C+  L  CP+C A
Sbjct:  343 SAEEQLRQLQEERTCKVCMDKLVSMVFIPCGHLVVCTDCAASLRHCPICRA 393          
BLAST of SMED30009828 vs. Ensembl Sea Lamprey
Match: birc2 (baculoviral IAP repeat containing 2 [Source:ZFIN;Acc:ZDB-GENE-030825-6])

HSP 1 Score: 48.1358 bits (113), Expect = 7.712e-7
Identity = 21/49 (42.86%), Postives = 34/49 (69.39%), Query Frame = 2
Query:  590 DEKIENEQERHTCNICMDDLVNIA-LQCGHLLCC-NCSYQLIVCPLCNA 730
            +E+++  QE+HTC +CMD  V++  + CGHL+ C +C+  L  CP+C A
Sbjct:  517 EEELKRLQEQHTCKVCMDKEVSVVFIPCGHLVVCRDCASSLRKCPICRA 565          
BLAST of SMED30009828 vs. Ensembl Nematostella
Match: EDO30381 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T0Y6])

HSP 1 Score: 46.595 bits (109), Expect = 3.777e-6
Identity = 23/48 (47.92%), Postives = 29/48 (60.42%), Query Frame = 2
Query:  593 EKIENEQERHTCNICMDDLVNIA-LQCGHLLCC-NCSYQLIVCPLCNA 730
            +K+E  QE   C ICMD  V I  L CGHL CC  C+  + +CP+C A
Sbjct:  274 QKLERMQEERLCKICMDAEVGIVFLPCGHLSCCPGCAEGMELCPMCRA 321          
BLAST of SMED30009828 vs. Ensembl Medaka
Match: mib2 (mindbomb E3 ubiquitin protein ligase 2 [Source:NCBI gene;Acc:101175479])

HSP 1 Score: 54.6842 bits (130), Expect = 3.024e-8
Identity = 23/66 (34.85%), Postives = 32/66 (48.48%), Query Frame = 2
Query:  527 TETNCKAEIEEFYRKNHKNTKDEKIENEQERHTCNICMDDLVNIALQCGHLLCCNCSYQLIVCPLC 724
            TE +C    E   + N       +    +ER TC IC+D+ + +  QCGH  C  CS  L  CP+C
Sbjct: 1007 TEVDCSPGTENSEQHNLLEQLQSRYRQMEERITCPICIDNHIKLVFQCGHASCIECSAALKTCPIC 1072          
BLAST of SMED30009828 vs. Ensembl Medaka
Match: mib2 (mindbomb E3 ubiquitin protein ligase 2 [Source:NCBI gene;Acc:101175479])

HSP 1 Score: 54.299 bits (129), Expect = 3.638e-8
Identity = 23/66 (34.85%), Postives = 32/66 (48.48%), Query Frame = 2
Query:  527 TETNCKAEIEEFYRKNHKNTKDEKIENEQERHTCNICMDDLVNIALQCGHLLCCNCSYQLIVCPLC 724
            TE +C    E   + N       +    +ER TC IC+D+ + +  QCGH  C  CS  L  CP+C
Sbjct:  951 TEVDCSPGTENSEQHNLLEQLQSRYRQMEERITCPICIDNHIKLVFQCGHASCIECSAALKTCPIC 1016          
BLAST of SMED30009828 vs. Ensembl Medaka
Match: ENSORLT00000012200.2 (baculoviral IAP repeat containing 7 [Source:NCBI gene;Acc:101164308])

HSP 1 Score: 48.9062 bits (115), Expect = 1.583e-6
Identity = 24/72 (33.33%), Postives = 40/72 (55.56%), Query Frame = 2
Query:  521 ACTETNCKAEIEEFYRKNHKNTKDEKIENEQERHTCNICMDDLVNIA-LQCGHLLCC-NCSYQLIVCPLCNA 730
            + +  + +A+     R   + + +E +   QE  TC +CMD LV+I  + CGHL+ C +C+  L  CP+C A
Sbjct:  281 SSSAGDGRAQTPARERAVKEASPEELLRQLQEERTCKVCMDKLVSIVFIPCGHLVVCGDCAASLRHCPICRA 352          
BLAST of SMED30009828 vs. Ensembl Medaka
Match: ENSORLT00000039931.1 (baculoviral IAP repeat containing 7 [Source:NCBI gene;Acc:101164308])

HSP 1 Score: 48.9062 bits (115), Expect = 1.583e-6
Identity = 24/72 (33.33%), Postives = 40/72 (55.56%), Query Frame = 2
Query:  521 ACTETNCKAEIEEFYRKNHKNTKDEKIENEQERHTCNICMDDLVNIA-LQCGHLLCC-NCSYQLIVCPLCNA 730
            + +  + +A+     R   + + +E +   QE  TC +CMD LV+I  + CGHL+ C +C+  L  CP+C A
Sbjct:  281 SSSAGDGRAQTPARERAVKEASPEELLRQLQEERTCKVCMDKLVSIVFIPCGHLVVCGDCAASLRHCPICRA 352          
BLAST of SMED30009828 vs. Ensembl Medaka
Match: ENSORLT00000034629.1 (baculoviral IAP repeat containing 7 [Source:NCBI gene;Acc:101164308])

HSP 1 Score: 48.1358 bits (113), Expect = 3.354e-6
Identity = 24/72 (33.33%), Postives = 40/72 (55.56%), Query Frame = 2
Query:  521 ACTETNCKAEIEEFYRKNHKNTKDEKIENEQERHTCNICMDDLVNIA-LQCGHLLCC-NCSYQLIVCPLCNA 730
            + +  + +A+     R   + + +E +   QE  TC +CMD LV+I  + CGHL+ C +C+  L  CP+C A
Sbjct:  317 SSSAGDGRAQTPARERAVKEASPEELLRQLQEERTCKVCMDKLVSIVFIPCGHLVVCGDCAASLRHCPICRA 388          
BLAST of SMED30009828 vs. Planmine SMEST
Match: SMESG000076369.1 (SMESG000076369.1)

HSP 1 Score: 307.76 bits (787), Expect = 9.432e-104
Identity = 167/243 (68.72%), Postives = 205/243 (84.36%), Query Frame = 2
Query:    2 AEPKLIRALFDKSSSLLQQSVLEILLCKAAHNDDSVMFDYFIKIEILRPNQLDSGETLLTFLIKENKTQFVWKILESINKMKFLHLKNRSKQGLLEIAIEKEDIDLVEFLIHESGDLDSENNDGKTPLVQLLEKISISTPGNFXXXXXXXXXXXXXXXXXXYKITSQGRQAIDACTETNCKAEIEEFYRKNHKNTKDEKIENEQERHTCNICMDDLVNIALQCGHLLCCNCSYQLIVCPLCNA 730
             E KLIRALFDKSSS+LQQSV+E LL +AAHNDD+VMFD+ I +EIL+PN+L+ GETLLT L+KE K  FVWKILESINK KF+ LKN + QG LEIAIE ++ DL+EFLIHESG+ ++E  +GKT L+QLL KISIST  + KRK+I+ I+SII+LGGDIY++TSQG++ IDAC ++  KAEIEEFYRK HK+ K+EK EN++ER+ CNICMD+LVNIALQCGHLLC NCS QL +CPLCNA
Sbjct:  177 GERKLIRALFDKSSSMLQQSVVENLLYEAAHNDDNVMFDHLIGMEILQPNELEGGETLLTVLMKECKINFVWKILESINKTKFVQLKNSNNQGPLEIAIENDEFDLIEFLIHESGEFNTEKANGKTTLIQLLGKISISTAPHLKRKVILLIRSIIVLGGDIYQVTSQGQRTIDACIDSKAKAEIEEFYRKIHKDMKEEKNENDKERNLCNICMDNLVNIALQCGHLLCGNCSDQLFICPLCNA 419          
BLAST of SMED30009828 vs. Planmine SMEST
Match: SMESG000040665.1 (SMESG000040665.1)

HSP 1 Score: 295.434 bits (755), Expect = 3.950e-100
Identity = 164/242 (67.77%), Postives = 198/242 (81.82%), Query Frame = 2
Query:    2 AEPKLIRALFDKSSSLLQQSVLEILLCKAAHNDDSVMFDYFIKIEILRPNQLDSGETLLTFLIKENKTQFVWKILESINKMKFLHLKNRSKQGLLEIAIEKEDIDLVEFLIHESGDLDSENNDGKTPLVQLLEKISISTPGNFXXXXXXXXXXXXXXXXXXYKITSQGRQAIDACTETNCKAEIEEFYRKNHKNTKDEKIENEQERHTCNICMDDLVNIALQCGHLLCCNCSYQLIVCPLCN 727
            AE KLIRALFDKSSS LQQSV+E LL ++AHNDD+VMFD+ I +EI++PN+L+ GETLLT L+KE+K  FVWKILES NK KF+ LKNR+ +G LEIAIE ++ DL+EFLIHESG+ +SEN DG+T L+QLL KISIST  N KRK+I+ I+SIILLGGDIY +TS+G++ IDACT++N KAEIEEFYRK+HK         + ER  C ICMD+LVNIALQCGHLLC NCS QL VCPLCN
Sbjct:  103 AERKLIRALFDKSSSGLQQSVVENLLYESAHNDDNVMFDHLIGMEIVQPNELEGGETLLTVLMKESKINFVWKILESNNKTKFVQLKNRNNEGPLEIAIENDEFDLIEFLIHESGEFNSENADGQTALIQLLGKISISTASNLKRKVILLIRSIILLGGDIYHVTSEGQRTIDACTDSNAKAEIEEFYRKHHK---------DNERILCKICMDNLVNIALQCGHLLCGNCSDQLFVCPLCN 335          
BLAST of SMED30009828 vs. Planmine SMEST
Match: SMESG000076363.1 (SMESG000076363.1)

HSP 1 Score: 303.908 bits (777), Expect = 1.287e-99
Identity = 165/243 (67.90%), Postives = 203/243 (83.54%), Query Frame = 2
Query:    2 AEPKLIRALFDKSSSLLQQSVLEILLCKAAHNDDSVMFDYFIKIEILRPNQLDSGETLLTFLIKENKTQFVWKILESINKMKFLHLKNRSKQGLLEIAIEKEDIDLVEFLIHESGDLDSENNDGKTPLVQLLEKISISTPGNFXXXXXXXXXXXXXXXXXXYKITSQGRQAIDACTETNCKAEIEEFYRKNHKNTKDEKIENEQERHTCNICMDDLVNIALQCGHLLCCNCSYQLIVCPLCNA 730
             E KLIRALFDKSSS+LQQSV+E LL +AAHNDD+VMFD+ I +EIL+PN+L+ GETLLT L+KE K  FVWKILESINK KF+ LKN + QG LEIAIE ++ DL+EFLIHESG+ ++E   GKT L+QLL KISIST  + KR++I+ I+SII+LGGDIY++TSQ ++ IDAC ++  KAEIEEFYRK HK+ K+EK EN++ER+ CNICMD+LVNIALQCGHLLC NCS QL +CPLCNA
Sbjct:  400 GERKLIRALFDKSSSMLQQSVVENLLYEAAHNDDNVMFDHLIGMEILQPNELEGGETLLTVLMKECKINFVWKILESINKTKFVQLKNSNNQGPLEIAIENDEFDLIEFLIHESGEFNTEKAYGKTTLIQLLGKISISTAPHLKRRVILLIRSIIVLGGDIYQVTSQRQRTIDACIDSKAKAEIEEFYRKIHKDMKEEKNENDKERNLCNICMDNLVNIALQCGHLLCGNCSDQLFICPLCNA 642          
BLAST of SMED30009828 vs. Planmine SMEST
Match: SMESG000076363.1 (SMESG000076363.1)

HSP 1 Score: 303.523 bits (776), Expect = 1.936e-99
Identity = 165/243 (67.90%), Postives = 203/243 (83.54%), Query Frame = 2
Query:    2 AEPKLIRALFDKSSSLLQQSVLEILLCKAAHNDDSVMFDYFIKIEILRPNQLDSGETLLTFLIKENKTQFVWKILESINKMKFLHLKNRSKQGLLEIAIEKEDIDLVEFLIHESGDLDSENNDGKTPLVQLLEKISISTPGNFXXXXXXXXXXXXXXXXXXYKITSQGRQAIDACTETNCKAEIEEFYRKNHKNTKDEKIENEQERHTCNICMDDLVNIALQCGHLLCCNCSYQLIVCPLCNA 730
             E KLIRALFDKSSS+LQQSV+E LL +AAHNDD+VMFD+ I +EIL+PN+L+ GETLLT L+KE K  FVWKILESINK KF+ LKN + QG LEIAIE ++ DL+EFLIHESG+ ++E   GKT L+QLL KISIST  + KR++I+ I+SII+LGGDIY++TSQ ++ IDAC ++  KAEIEEFYRK HK+ K+EK EN++ER+ CNICMD+LVNIALQCGHLLC NCS QL +CPLCNA
Sbjct:  408 GERKLIRALFDKSSSMLQQSVVENLLYEAAHNDDNVMFDHLIGMEILQPNELEGGETLLTVLMKECKINFVWKILESINKTKFVQLKNSNNQGPLEIAIENDEFDLIEFLIHESGEFNTEKAYGKTTLIQLLGKISISTAPHLKRRVILLIRSIIVLGGDIYQVTSQRQRTIDACIDSKAKAEIEEFYRKIHKDMKEEKNENDKERNLCNICMDNLVNIALQCGHLLCGNCSDQLFICPLCNA 650          
BLAST of SMED30009828 vs. Planmine SMEST
Match: SMESG000076385.1 (SMESG000076385.1)

HSP 1 Score: 300.827 bits (769), Expect = 3.056e-99
Identity = 165/243 (67.90%), Postives = 202/243 (83.13%), Query Frame = 2
Query:    2 AEPKLIRALFDKSSSLLQQSVLEILLCKAAHNDDSVMFDYFIKIEILRPNQLDSGETLLTFLIKENKTQFVWKILESINKMKFLHLKNRSKQGLLEIAIEKEDIDLVEFLIHESGDLDSENNDGKTPLVQLLEKISISTPGNFXXXXXXXXXXXXXXXXXXYKITSQGRQAIDACTETNCKAEIEEFYRKNHKNTKDEKIENEQERHTCNICMDDLVNIALQCGHLLCCNCSYQLIVCPLCNA 730
             E KLIRALFDKSSS+LQQSV+E LL +AAHNDD+VMFD+ I +EIL+PN+L+ GETLLT L+KE K  FVWKILESINK KF+ LKN + QG L+IAIE ++ DL+EFLIHESG+ +SEN DG+T L QLL KISIST  + KRK+I+ I+SII+LGGDIY++TSQG++ IDAC ++  KAEIEEFY K HK+ K+EK EN++E + C ICMD+LVNIALQCGHLLC NCS QL +CPLCNA
Sbjct:  325 GERKLIRALFDKSSSMLQQSVVENLLYEAAHNDDNVMFDHLIGMEILQPNELEGGETLLTVLMKECKINFVWKILESINKTKFVQLKNSNNQGPLKIAIENDEFDLIEFLIHESGEFNSENADGQTTLFQLLGKISISTAPHLKRKVILLIRSIIVLGGDIYQVTSQGQRTIDACIDSKAKAEIEEFYTKIHKDMKEEKNENDKETNLCKICMDNLVNIALQCGHLLCGNCSDQLFICPLCNA 567          
The following BLAST results are available for this feature:
BLAST of SMED30009828 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
BIRC74.935e-639.58baculoviral IAP repeat containing 7 [Source:HGNC S... [more]
BIRC75.583e-639.58baculoviral IAP repeat containing 7 [Source:HGNC S... [more]
BIRC76.627e-639.58baculoviral IAP repeat containing 7 [Source:HGNC S... [more]
back to top
BLAST of SMED30009828 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30009828 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30009828 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
mib24.667e-733.33mindbomb E3 ubiquitin protein ligase 2 [Source:ZFI... [more]
birc79.832e-738.10baculoviral IAP repeat containing 7 [Source:ZFIN;A... [more]
birc78.099e-641.18baculoviral IAP repeat containing 7 [Source:ZFIN;A... [more]
back to top
BLAST of SMED30009828 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
coa78.632e-834.85cytochrome c oxidase assembly factor 7 (putative) ... [more]
coa79.016e-834.85cytochrome c oxidase assembly factor 7 (putative) ... [more]
coa79.021e-834.85cytochrome c oxidase assembly factor 7 (putative) ... [more]
coa79.295e-834.85cytochrome c oxidase assembly factor 7 (putative) ... [more]
coa71.759e-641.67cytochrome c oxidase assembly factor 7 (putative) ... [more]
back to top
BLAST of SMED30009828 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30009828 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 1
Match NameE-valueIdentityDescription
sp|Q5ZIJ9|MIB2_CHICK1.126e-736.36E3 ubiquitin-protein ligase MIB2 OS=Gallus gallus ... [more]
back to top
BLAST of SMED30009828 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30009828 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mib29.684e-833.33mindbomb E3 ubiquitin protein ligase 2 [Source:NCB... [more]
mib29.924e-833.33mindbomb E3 ubiquitin protein ligase 2 [Source:NCB... [more]
mib21.004e-733.33mindbomb E3 ubiquitin protein ligase 2 [Source:NCB... [more]
birc74.845e-641.18baculoviral IAP repeat-containing protein 7 [Sourc... [more]
birc75.883e-641.18baculoviral IAP repeat-containing protein 7 [Sourc... [more]
back to top
BLAST of SMED30009828 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
birc27.712e-742.86baculoviral IAP repeat containing 2 [Source:ZFIN;A... [more]
back to top
BLAST of SMED30009828 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30009828 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO303813.777e-647.92Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED30009828 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mib23.024e-834.85mindbomb E3 ubiquitin protein ligase 2 [Source:NCB... [more]
mib23.638e-834.85mindbomb E3 ubiquitin protein ligase 2 [Source:NCB... [more]
ENSORLT00000012200.21.583e-633.33baculoviral IAP repeat containing 7 [Source:NCBI g... [more]
ENSORLT00000039931.11.583e-633.33baculoviral IAP repeat containing 7 [Source:NCBI g... [more]
ENSORLT00000034629.13.354e-633.33baculoviral IAP repeat containing 7 [Source:NCBI g... [more]
back to top
BLAST of SMED30009828 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000076369.19.432e-10468.72SMESG000076369.1[more]
SMESG000040665.13.950e-10067.77SMESG000040665.1[more]
SMESG000076363.11.287e-9967.90SMESG000076363.1[more]
SMESG000076363.11.936e-9967.90SMESG000076363.1[more]
SMESG000076385.13.056e-9967.90SMESG000076385.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30009828 ID=SMED30009828|Name=SMED30009828|organism=Schmidtea mediterranea sexual|type=transcript|length=731bp
AGCTGAACCGAAATTGATTAGAGCTCTGTTTGATAAATCGAGTTCTTTAT
TGCAGCAATCAGTTTTGGAGATTCTGCTTTGCAAAGCTGCTCATAACGAT
GATAGCGTGATGTTTGACTACTTCATAAAAATAGAGATATTGCGGCCCAA
TCAACTCGACAGCGGAGAAACCCTACTGACATTTCTGATAAAGGAAAACA
AAACTCAATTTGTTTGGAAGATTTTGGAATCAATTAATAAAATGAAATTC
CTCCATTTGAAAAACAGAAGCAAACAAGGCCTCCTTGAAATTGCAATAGA
AAAGGAAGACATTGATCTGGTTGAATTTCTAATTCATGAATCCGGTGATC
TCGATAGTGAAAATAATGATGGAAAAACCCCCTTGGTTCAATTATTAGAG
AAAATATCGATTTCCACACCAGGAAACTTTAAAAGAAAATTGATTATAGG
AATTAAATCAATAATTCTTTTGGGTGGAGACATTTACAAAATAACATCTC
AAGGTCGGCAGGCAATTGACGCATGCACCGAAACCAATTGCAAGGCAGAA
ATAGAAGAATTTTACAGGAAAAACCACAAAAATACGAAAGACGAGAAAAT
TGAAAATGAACAAGAGAGACACACATGTAACATTTGCATGGACGATCTTG
TGAATATTGCTCTTCAATGCGGACATTTGCTTTGCTGCAATTGTTCCTAT
CAATTAATCGTTTGTCCTCTTTGTAACGCTG
back to top

protein sequence of SMED30009828-orf-1

>SMED30009828-orf-1 ID=SMED30009828-orf-1|Name=SMED30009828-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=243bp
AEPKLIRALFDKSSSLLQQSVLEILLCKAAHNDDSVMFDYFIKIEILRPN
QLDSGETLLTFLIKENKTQFVWKILESINKMKFLHLKNRSKQGLLEIAIE
KEDIDLVEFLIHESGDLDSENNDGKTPLVQLLEKISISTPGNFKRKLIIG
IKSIILLGGDIYKITSQGRQAIDACTETNCKAEIEEFYRKNHKNTKDEKI
ENEQERHTCNICMDDLVNIALQCGHLLCCNCSYQLIVCPLCNA
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
Vocabulary: INTERPRO
TermDefinition
IPR036770Ankyrin_rpt-contain_sf
IPR013083Znf_RING/FYVE/PHD
IPR020683Ankyrin_rpt-contain_dom
IPR001841Znf_RING
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0008270zinc ion binding
GO:0004842ubiquitin-protein transferase activity
GO:0016740transferase activity
GO:0046872metal ion binding
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
Vocabulary: biological process
TermDefinition
GO:0007219Notch signaling pathway
GO:0016567protein ubiquitination
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR013083Zinc finger, RING/FYVE/PHD-typeGENE3DG3DSA:3.30.40.10coord: 44..103
e-value: 1.1E-9
score: 39.6
IPR001841Zinc finger, RING-typePROSITEPS50089ZF_RING_2coord: 69..102
score: 11.191
NoneNo IPR availableSUPERFAMILYSSF57850RING/U-boxcoord: 68..102
IPR036770Ankyrin repeat-containing domain superfamilyGENE3DG3DSA:1.25.40.20coord: 8..133
e-value: 1.1E-6
score: 30.3
IPR036770Ankyrin repeat-containing domain superfamilySUPERFAMILYSSF48403Ankyrin repeatcoord: 23..128
IPR020683Ankyrin repeat-containing domainPROSITEPS50297ANK_REP_REGIONcoord: 89..127
score: 9.516