ATP-dependent RNA helicase DHX8

Overview
NameATP-dependent RNA helicase DHX8
Smed IDSMED30009820
Length (bp)2028
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of ATP-dependent RNA helicase DHX8 (SMED30009820) t-SNE clustered cells

Violin plots show distribution of expression levels for ATP-dependent RNA helicase DHX8 (SMED30009820) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of ATP-dependent RNA helicase DHX8 (SMED30009820) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for ATP-dependent RNA helicase DHX8 (SMED30009820) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30009820

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
muscle cellSMED30009820SMESG000038843.1 dd_Smed_v4_5357_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30009820SMESG000038843.1 dd_Smed_v4_5357_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30009820SMESG000038843.1 dd_Smed_v4_5357_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of ATP-dependent RNA helicase DHX8 vs. Ensembl Human
Match: DHX8 (DEAH-box helicase 8 [Source:NCBI gene;Acc:1659])

HSP 1 Score: 478.789 bits (1231), Expect = 2.865e-154
Identity = 264/612 (43.14%), Postives = 395/612 (64.54%), Query Frame = 2
Query:  146 LPIYEYKDQIVELIRNNQIVIIQGQTGCGKTTQIPQFVLEANLNNGNMIGITQSRRIAAVSMAKRVAQEKQCNLGSEVGYEIRFDKKCSASTKIKYMTDGILLNECVTDANLKDYGVVMIDEAHERXXXXXXXXXXXXXVCKSRENLKIIITSATICAEKFSQFFDDSKILTIEGRLFPVEIIYEGYI-MDLIDYSAKLVRRIHIGNEPGDILVFLTGEEDIERCCKLL--------RNVGNLIVTPLYGAIDFQEQQEVFRTMDCGDRKVVVATNIAETSITIDGIRYVIDCGYMKQNKFDSRRGIETLESIKISKAQAEQRKGRSGRTGPGWCYRLYSEGSYND-FIQEAVPEIKRKDLSEIYLRIIEFNLNP-KDFNFIDXXXXXXXXXXXXXXXDLKIITKEGKLTPSGQNMLGFPVEPRLGKVLMESLNNKCTNDIIKIMAMLSERFIFRKHHKGRGRGDPLK-EFSDHDGDHFTLLNIYNDWISHKQNKQWCISSSIDYNSMQNAYNIFIQLCKILKKNHSFKETVGEKNA-IKKSLISGFFKNICVKTNRGAYTRLYGREVMYIHPQSSLFHSSPKIILFNEVRKTTKTFMHGVLRLDEEIIREF 1942
            LPIY+ K+Q+V+ + +NQI+I+ G+TG GKTTQI Q++ EA   +   IG TQ RR+AA+S+AKRV++E  C LG EVGY IRF+   S  T IKYMTDG+LL EC+ D +L  Y ++M+DEAHER++ +D+L GLLK   + R+++K+I+TSAT+ A KFSQ+F ++ I TI GR +PVEI+Y      D +D S   V +IH+   PGDILVFLTG+E+I+  C++L         +V  LI+ P+Y A+  + Q  +F     G RKVV+ATNIAETS+TIDGI YV+D G++KQ  ++S+ GI+ L    IS+AQA+QR GR+GRTGPG CYRLY+E +Y D  +   VPEI+R +L+   L +    +N    F+F+D PP E L  +  +L  L  +  EG LT  G+ M  FP+EP L K+L+ S++  C+ +++ I++MLS + +F +    +   D  K +F   +GDH TLL +YN W ++K +  WC  + I   S++ A +I  Q+  I+ ++     + G+    ++K++ SGFF+N   K  +  Y  L  ++V+YIHP S+LF+  P+ ++++E+  TTK +M  V  +D   + EF
Sbjct:  565 LPIYKLKEQLVQAVHDNQILIVIGETGSGKTTQITQYLAEAGYTSRGKIGCTQPRRVAAMSVAKRVSEEFGCCLGQEVGYTIRFEDCTSPETVIKYMTDGMLLRECLIDPDLTQYAIIMLDEAHERTIHTDVLFGLLKKTVQKRQDMKLIVTSATLDAVKFSQYFYEAPIFTIPGRTYPVEILYTKEPETDYLDASLITVMQIHLTEPPGDILVFLTGQEEIDTACEILYERMKSLGPDVPELIILPVYSALPSEMQTRIFDPAPPGSRKVVIATNIAETSLTIDGIYYVVDPGFVKQKVYNSKTGIDQLVVTPISQAQAKQRAGRAGRTGPGKCYRLYTERAYRDEMLTTNVPEIQRTNLASTVLSLKAMGINDLLSFDFMDAPPMETLITAMEQLYTLGALDDEGLLTRLGRRMAEFPLEPMLCKMLIMSVHLGCSEEMLTIVSMLSVQNVFYRPKDKQALADQKKAKFHQTEGDHLTLLAVYNSWKNNKFSNPWCYENFIQARSLRRAQDIRKQMLGIMDRHKLDVVSCGKSTVRVQKAICSGFFRNAAKKDPQEGYRTLIDQQVVYIHPSSALFNRQPEWVVYHELVLTTKEYMREVTTIDPRWLVEF 1176          
BLAST of ATP-dependent RNA helicase DHX8 vs. Ensembl Human
Match: DHX8 (DEAH-box helicase 8 [Source:NCBI gene;Acc:1659])

HSP 1 Score: 478.789 bits (1231), Expect = 2.865e-154
Identity = 264/612 (43.14%), Postives = 395/612 (64.54%), Query Frame = 2
Query:  146 LPIYEYKDQIVELIRNNQIVIIQGQTGCGKTTQIPQFVLEANLNNGNMIGITQSRRIAAVSMAKRVAQEKQCNLGSEVGYEIRFDKKCSASTKIKYMTDGILLNECVTDANLKDYGVVMIDEAHERXXXXXXXXXXXXXVCKSRENLKIIITSATICAEKFSQFFDDSKILTIEGRLFPVEIIYEGYI-MDLIDYSAKLVRRIHIGNEPGDILVFLTGEEDIERCCKLL--------RNVGNLIVTPLYGAIDFQEQQEVFRTMDCGDRKVVVATNIAETSITIDGIRYVIDCGYMKQNKFDSRRGIETLESIKISKAQAEQRKGRSGRTGPGWCYRLYSEGSYND-FIQEAVPEIKRKDLSEIYLRIIEFNLNP-KDFNFIDXXXXXXXXXXXXXXXDLKIITKEGKLTPSGQNMLGFPVEPRLGKVLMESLNNKCTNDIIKIMAMLSERFIFRKHHKGRGRGDPLK-EFSDHDGDHFTLLNIYNDWISHKQNKQWCISSSIDYNSMQNAYNIFIQLCKILKKNHSFKETVGEKNA-IKKSLISGFFKNICVKTNRGAYTRLYGREVMYIHPQSSLFHSSPKIILFNEVRKTTKTFMHGVLRLDEEIIREF 1942
            LPIY+ K+Q+V+ + +NQI+I+ G+TG GKTTQI Q++ EA   +   IG TQ RR+AA+S+AKRV++E  C LG EVGY IRF+   S  T IKYMTDG+LL EC+ D +L  Y ++M+DEAHER++ +D+L GLLK   + R+++K+I+TSAT+ A KFSQ+F ++ I TI GR +PVEI+Y      D +D S   V +IH+   PGDILVFLTG+E+I+  C++L         +V  LI+ P+Y A+  + Q  +F     G RKVV+ATNIAETS+TIDGI YV+D G++KQ  ++S+ GI+ L    IS+AQA+QR GR+GRTGPG CYRLY+E +Y D  +   VPEI+R +L+   L +    +N    F+F+D PP E L  +  +L  L  +  EG LT  G+ M  FP+EP L K+L+ S++  C+ +++ I++MLS + +F +    +   D  K +F   +GDH TLL +YN W ++K +  WC  + I   S++ A +I  Q+  I+ ++     + G+    ++K++ SGFF+N   K  +  Y  L  ++V+YIHP S+LF+  P+ ++++E+  TTK +M  V  +D   + EF
Sbjct:  565 LPIYKLKEQLVQAVHDNQILIVIGETGSGKTTQITQYLAEAGYTSRGKIGCTQPRRVAAMSVAKRVSEEFGCCLGQEVGYTIRFEDCTSPETVIKYMTDGMLLRECLIDPDLTQYAIIMLDEAHERTIHTDVLFGLLKKTVQKRQDMKLIVTSATLDAVKFSQYFYEAPIFTIPGRTYPVEILYTKEPETDYLDASLITVMQIHLTEPPGDILVFLTGQEEIDTACEILYERMKSLGPDVPELIILPVYSALPSEMQTRIFDPAPPGSRKVVIATNIAETSLTIDGIYYVVDPGFVKQKVYNSKTGIDQLVVTPISQAQAKQRAGRAGRTGPGKCYRLYTERAYRDEMLTTNVPEIQRTNLASTVLSLKAMGINDLLSFDFMDAPPMETLITAMEQLYTLGALDDEGLLTRLGRRMAEFPLEPMLCKMLIMSVHLGCSEEMLTIVSMLSVQNVFYRPKDKQALADQKKAKFHQTEGDHLTLLAVYNSWKNNKFSNPWCYENFIQARSLRRAQDIRKQMLGIMDRHKLDVVSCGKSTVRVQKAICSGFFRNAAKKDPQEGYRTLIDQQVVYIHPSSALFNRQPEWVVYHELVLTTKEYMREVTTIDPRWLVEF 1176          
BLAST of ATP-dependent RNA helicase DHX8 vs. Ensembl Human
Match: DHX8 (DEAH-box helicase 8 [Source:NCBI gene;Acc:1659])

HSP 1 Score: 461.84 bits (1187), Expect = 4.608e-148
Identity = 255/583 (43.74%), Postives = 378/583 (64.84%), Query Frame = 2
Query:  146 LPIYEYKDQIVELIRNNQIVIIQGQTGCGKTTQIPQFVLEANLNNGNMIGITQSRRIAAVSMAKRVAQEKQCNLGSEVGYEIRFDKKCSASTKIKYMTDGILLNECVTDANLKDYGVVMIDEAHERXXXXXXXXXXXXXVCKSRENLKIIITSATICAEKFSQFFDDSKILTIEGRLFPVEIIYEGYI-MDLIDYSAKLVRRIHIGNEPGDILVFLTGEEDIERCCKLL--------RNVGNLIVTPLYGAIDFQEQQEVFRTMDCGDRKVVVATNIAETSITIDGIRYVIDCGYMKQNKFDSRRGIETLESIKISKAQAEQRKGRSGRTGPGWCYRLYSEGSYND-FIQEAVPEIKRKDLSEIYLRIIEFNLNP-KDFNFIDXXXXXXXXXXXXXXXDLKIITKEGKLTPSGQNMLGFPVEPRLGKVLMESLNNKCTNDIIKIMAMLSERFIFRKHHKGRGRGDPLK-EFSDHDGDHFTLLNIYNDWISHKQNKQWCISSSIDYNSMQNAYNIFIQLCKILKKNHSFKETVGEKNA-IKKSLISGFFKNICVKTNRGAYTRLYGREVMYIHPQSSLFHSSPK 1855
            LPIY+ K+Q+V+ + +NQI+I+ G+TG GKTTQI Q++ EA   +   IG TQ RR+AA+S+AKRV++E  C LG EVGY IRF+   S  T IKYMTDG+LL EC+ D +L  Y ++M+DEAHER++ +D+L GLLK   + R+++K+I+TSAT+ A KFSQ+F ++ I TI GR +PVEI+Y      D +D S   V +IH+   PGDILVFLTG+E+I+  C++L         +V  LI+ P+Y A+  + Q  +F     G RKVV+ATNIAETS+TIDGI YV+D G++KQ  ++S+ GI+ L    IS+AQA+QR GR+GRTGPG CYRLY+E +Y D  +   VPEI+R +L+   L +    +N    F+F+D PP E L  +  +L  L  +  EG LT  G+ M  FP+EP L K+L+ S++  C+ +++ I++MLS + +F +    +   D  K +F   +GDH TLL +YN W ++K +  WC  + I   S++ A +I  Q+  I+ ++     + G+    ++K++ SGFF+N   K  +  Y  L  ++V+YIHP S+LF+  P+
Sbjct:  565 LPIYKLKEQLVQAVHDNQILIVIGETGSGKTTQITQYLAEAGYTSRGKIGCTQPRRVAAMSVAKRVSEEFGCCLGQEVGYTIRFEDCTSPETVIKYMTDGMLLRECLIDPDLTQYAIIMLDEAHERTIHTDVLFGLLKKTVQKRQDMKLIVTSATLDAVKFSQYFYEAPIFTIPGRTYPVEILYTKEPETDYLDASLITVMQIHLTEPPGDILVFLTGQEEIDTACEILYERMKSLGPDVPELIILPVYSALPSEMQTRIFDPAPPGSRKVVIATNIAETSLTIDGIYYVVDPGFVKQKVYNSKTGIDQLVVTPISQAQAKQRAGRAGRTGPGKCYRLYTERAYRDEMLTTNVPEIQRTNLASTVLSLKAMGINDLLSFDFMDAPPMETLITAMEQLYTLGALDDEGLLTRLGRRMAEFPLEPMLCKMLIMSVHLGCSEEMLTIVSMLSVQNVFYRPKDKQALADQKKAKFHQTEGDHLTLLAVYNSWKNNKFSNPWCYENFIQARSLRRAQDIRKQMLGIMDRHKLDVVSCGKSTVRVQKAICSGFFRNAAKKDPQEGYRTLIDQQVVYIHPSSALFNRQPE 1147          
BLAST of ATP-dependent RNA helicase DHX8 vs. Ensembl Human
Match: DHX16 (DEAH-box helicase 16 [Source:HGNC Symbol;Acc:HGNC:2739])

HSP 1 Score: 426.787 bits (1096), Expect = 4.250e-136
Identity = 242/613 (39.48%), Postives = 368/613 (60.03%), Query Frame = 2
Query:  146 LPIYEYKDQIVELIRNNQIVIIQGQTGCGKTTQIPQFVLEANLNNGNM-IGITQSRRIAAVSMAKRVAQEKQCNLGSEVGYEIRFDKKCSASTKIKYMTDGILLNECVTDANLKDYGVVMIDEAHERXXXXXXXXXXXXXVCKSRENLKIIITSATICAEKFSQFFDDSKILTIEGRLFPVEIIY-EGYIMDLIDYSAKLVRRIHIGNEPGDILVFLTGEEDIERCCKLL----RNVGN----LIVTPLYGAIDFQEQQEVFRTMDCGDRKVVVATNIAETSITIDGIRYVIDCGYMKQNKFDSRRGIETLESIKISKAQAEQRKGRSGRTGPGWCYRLYSEGSYNDFIQE-AVPEIKRKDLSEIYLRIIEFNLNP-KDFNFIDXXXXXXXXXXXXXXXDLKIITKEGKLTPSGQNMLGFPVEPRLGKVLMESLNNKCTNDIIKIMAMLS--ERFIFRKHHKGRGRGDPLKEFSDHDGDHFTLLNIYNDWISHKQNKQWCISSSIDYNSMQNAYNIFIQLCKILKKNH-SFKETVGEKNAIKKSLISGFFKNICVKTNRGAYTRLYGREVMYIHPQSSLFHSSPKIILFNEVRKTTKTFMHGVLRLDEEIIRE 1939
            LP++ ++++++  I N+Q++II+G+TG GKTTQIPQ++ E    N  M I  TQ RR+AA+S+A RVA+E    LG+EVGY IRF+   S  T ++YMTDG+LL E +++ +L  Y VVM+DEAHER+L +DIL GL+K V + R  LK+++ SAT+   +FS FFDD+ +  I GR FPV+I Y +    D ++     V +IH+   PGDILVFLTG+E+IE  C++L    R +G+    L+V P+Y  +    Q  +F+    G RKVVVATNIAETS+TI+GI YV+D G+ KQ  ++ R G+E+L     SKA A QR GR+GR   G C+RLY+  +Y   ++E  VPEI+R  L  + L +    ++    F+F+D PP E L  +  +L  L  +   G+LT SG+ M   PV+P L K+++ S    C+ +I+ + AMLS      +R   K     +    F    GDH  LLN+Y  W     + QWC  + + + SM+ A ++  QL  +L++         G+   ++K++ +G+F +   +  R  Y  +  ++ ++IHP SSLF   P+ +L++E+  TTK FM  VL ++   + E
Sbjct:  399 LPVFPFREELLAAIANHQVLIIEGETGSGKTTQIPQYLFEEGYTNKGMKIACTQPRRVAAMSVAARVAREMGVKLGNEVGYSIRFEDCTSERTVLRYMTDGMLLREFLSEPDLASYSVVMVDEAHERTLHTDILFGLIKDVARFRPELKVLVASATMDTARFSTFFDDAPVFRIPGRRFPVDIFYTKAPEADYLEACVVSVLQIHVTQPPGDILVFLTGQEEIEAACEMLQDRCRRLGSKIRELLVLPIYANLPSDMQARIFQPTPPGARKVVVATNIAETSLTIEGIIYVLDPGFCKQKSYNPRTGMESLTVTPCSKASANQRAGRAGRVAAGKCFRLYTAWAYQHELEETTVPEIQRTSLGNVVLLLKSLGIHDLMHFDFLDPPPYETLLLALEQLYALGALNHLGELTTSGRKMAELPVDPMLSKMILASEKYSCSEEILTVAAMLSVNNSIFYRPKDKVVHADNARVNFFLPGGDHLVLLNVYTQWAESGYSSQWCYENFVQFRSMRRARDVREQLEGLLERVEVGLSSCQGDYIRVRKAITAGYFYHTA-RLTRSGYRTVKQQQTVFIHPNSSLFEQQPRWLLYHELVLTTKEFMRQVLEIESSWLLE 1010          
BLAST of ATP-dependent RNA helicase DHX8 vs. Ensembl Human
Match: DHX16 (DEAH-box helicase 16 [Source:HGNC Symbol;Acc:HGNC:2739])

HSP 1 Score: 426.787 bits (1096), Expect = 4.250e-136
Identity = 242/613 (39.48%), Postives = 368/613 (60.03%), Query Frame = 2
Query:  146 LPIYEYKDQIVELIRNNQIVIIQGQTGCGKTTQIPQFVLEANLNNGNM-IGITQSRRIAAVSMAKRVAQEKQCNLGSEVGYEIRFDKKCSASTKIKYMTDGILLNECVTDANLKDYGVVMIDEAHERXXXXXXXXXXXXXVCKSRENLKIIITSATICAEKFSQFFDDSKILTIEGRLFPVEIIY-EGYIMDLIDYSAKLVRRIHIGNEPGDILVFLTGEEDIERCCKLL----RNVGN----LIVTPLYGAIDFQEQQEVFRTMDCGDRKVVVATNIAETSITIDGIRYVIDCGYMKQNKFDSRRGIETLESIKISKAQAEQRKGRSGRTGPGWCYRLYSEGSYNDFIQE-AVPEIKRKDLSEIYLRIIEFNLNP-KDFNFIDXXXXXXXXXXXXXXXDLKIITKEGKLTPSGQNMLGFPVEPRLGKVLMESLNNKCTNDIIKIMAMLS--ERFIFRKHHKGRGRGDPLKEFSDHDGDHFTLLNIYNDWISHKQNKQWCISSSIDYNSMQNAYNIFIQLCKILKKNH-SFKETVGEKNAIKKSLISGFFKNICVKTNRGAYTRLYGREVMYIHPQSSLFHSSPKIILFNEVRKTTKTFMHGVLRLDEEIIRE 1939
            LP++ ++++++  I N+Q++II+G+TG GKTTQIPQ++ E    N  M I  TQ RR+AA+S+A RVA+E    LG+EVGY IRF+   S  T ++YMTDG+LL E +++ +L  Y VVM+DEAHER+L +DIL GL+K V + R  LK+++ SAT+   +FS FFDD+ +  I GR FPV+I Y +    D ++     V +IH+   PGDILVFLTG+E+IE  C++L    R +G+    L+V P+Y  +    Q  +F+    G RKVVVATNIAETS+TI+GI YV+D G+ KQ  ++ R G+E+L     SKA A QR GR+GR   G C+RLY+  +Y   ++E  VPEI+R  L  + L +    ++    F+F+D PP E L  +  +L  L  +   G+LT SG+ M   PV+P L K+++ S    C+ +I+ + AMLS      +R   K     +    F    GDH  LLN+Y  W     + QWC  + + + SM+ A ++  QL  +L++         G+   ++K++ +G+F +   +  R  Y  +  ++ ++IHP SSLF   P+ +L++E+  TTK FM  VL ++   + E
Sbjct:  399 LPVFPFREELLAAIANHQVLIIEGETGSGKTTQIPQYLFEEGYTNKGMKIACTQPRRVAAMSVAARVAREMGVKLGNEVGYSIRFEDCTSERTVLRYMTDGMLLREFLSEPDLASYSVVMVDEAHERTLHTDILFGLIKDVARFRPELKVLVASATMDTARFSTFFDDAPVFRIPGRRFPVDIFYTKAPEADYLEACVVSVLQIHVTQPPGDILVFLTGQEEIEAACEMLQDRCRRLGSKIRELLVLPIYANLPSDMQARIFQPTPPGARKVVVATNIAETSLTIEGIIYVLDPGFCKQKSYNPRTGMESLTVTPCSKASANQRAGRAGRVAAGKCFRLYTAWAYQHELEETTVPEIQRTSLGNVVLLLKSLGIHDLMHFDFLDPPPYETLLLALEQLYALGALNHLGELTTSGRKMAELPVDPMLSKMILASEKYSCSEEILTVAAMLSVNNSIFYRPKDKVVHADNARVNFFLPGGDHLVLLNVYTQWAESGYSSQWCYENFVQFRSMRRARDVREQLEGLLERVEVGLSSCQGDYIRVRKAITAGYFYHTA-RLTRSGYRTVKQQQTVFIHPNSSLFEQQPRWLLYHELVLTTKEFMRQVLEIESSWLLE 1010          
BLAST of ATP-dependent RNA helicase DHX8 vs. Ensembl Celegans
Match: mog-5 (Probable pre-mRNA-splicing factor ATP-dependent RNA helicase mog-5 [Source:UniProtKB/Swiss-Prot;Acc:Q09530])

HSP 1 Score: 469.159 bits (1206), Expect = 3.801e-151
Identity = 257/619 (41.52%), Postives = 394/619 (63.65%), Query Frame = 2
Query:  146 LPIYEYKDQIVELIRNNQIVIIQGQTGCGKTTQIPQFVLEANLNNGNMIGITQSRRIAAVSMAKRVAQEKQCNLGSEVGYEIRFDKKCSASTKIKYMTDGILLNECVTDANLKDYGVVMIDEAHERXXXXXXXXXXXXXVCKSRENLKIIITSATICAEKFSQFFDDSKILTIEGRLFPVEIIYEGYI-MDLIDYSAKLVRRIHIGNEPGDILVFLTGEEDIERCCKLL--------RNVGNLIVTPLYGAIDFQEQQEVFRTMDCGDRKVVVATNIAETSITIDGIRYVIDCGYMKQNKFDSRRGIETLESIKISKAQAEQRKGRSGRTGPGWCYRLYSEGSYND-FIQEAVPEIKRKDLSEIYLRIIEFNLNPK-DFNFIDXXXXXXXXXXXXXXXDLKIITKEGKLTPSGQNMLGFPVEPRLGKVLMESLNNKCTNDIIKIMAMLSERFIFRKHHKGRGRGDPLK-EFSDHDGDHFTLLNIYNDWISHKQNKQWCISSSIDYNSMQNAYNIFIQLCKILKKNHSFKETVG-EKNAIKKSLISGFFKNICVKTNRGAYTRLYGREVMYIHPQSSLFHSSPKIILFNEVRKTTKTFMHGVLRLDEEIIREF-PEELKI 1960
            LPI+  K  ++E + +NQI+++ G+TG GKTTQ+ Q+ +EA L     IG TQ RR+AA+S+AKRVA+E  C LG++VGY IRF+   S  T IKYMTDG+LL EC+ D +L  Y ++M+DEAHER++ +D+L GLLK   + R  LK+IITSAT+ + KFS++F ++ I TI GR FPVEI+Y      D ++ +   V +IH+   PGD+LVFLTG+E+I+  C++L         +V  LI+ P+YGA+  + Q  +F     G RKVV+ATNIAETS+TIDGI YV+D G++KQ  ++ + G+++L    IS+A A+QR GR+GRTGPG CYRLY+E ++ D  +   VPEI+R +L+   L++    +N   DF+F+D PP + +  +   L  L  +  +G LT  G+ M  FP+EP L K+L+ S++  C+ +++ I+AML+ + IF +  + +   D  K +F   +GDH TLL +YN W +H  ++ WC  + I   SM+ A +I  QL  I+ ++     + G + + ++K++ SGFF+N   +  +  Y  L   + +YIHP S+ F   P+ ++++E+  TTK +M  V  +D + + EF P   KI
Sbjct:  540 LPIFALKKNLMEAMIDNQILVVVGETGSGKTTQMTQYAIEAGLGRRGKIGCTQPRRVAAMSVAKRVAEEYGCKLGTDVGYTIRFEDCTSQDTIIKYMTDGMLLRECLIDPDLSGYSLIMLDEAHERTIHTDVLFGLLKAAARKRPELKLIITSATLDSVKFSEYFLEAPIFTIPGRTFPVEILYTREPESDYLEAAHITVMQIHLTEPPGDVLVFLTGQEEIDTSCEVLYERMKSMGPDVPELIILPVYGALPSEMQTRIFDPAPAGKRKVVIATNIAETSLTIDGIFYVVDPGFVKQKIYNPKSGMDSLVVTPISQAAAKQRSGRAGRTGPGKCYRLYTERAFRDEMLPTPVPEIQRTNLASTLLQLKAMGINNLIDFDFMDAPPLDSMITALNTLHTLSALDGDGLLTKLGRRMAEFPLEPSLSKLLIMSVDLGCSEEVLTIVAMLNVQNIFYRPKEKQDHADQKKAKFHQPEGDHLTLLAVYNSWKNHHFSQPWCFENFIQVRSMKRAQDIRKQLLGIMDRHKLLMVSCGRDVSRVQKAICSGFFRNAAKRDPQEGYRTLTDGQNVYIHPSSACFQQQPEWVVYHELVMTTKEYMREVTAIDPKWLVEFAPSFFKI 1158          
BLAST of ATP-dependent RNA helicase DHX8 vs. Ensembl Celegans
Match: mog-4 (Probable pre-mRNA-splicing factor ATP-dependent RNA helicase mog-4 [Source:UniProtKB/Swiss-Prot;Acc:O45244])

HSP 1 Score: 439.499 bits (1129), Expect = 8.973e-142
Identity = 245/600 (40.83%), Postives = 370/600 (61.67%), Query Frame = 2
Query:  146 LPIYEYKDQIVELIRNNQIVIIQGQTGCGKTTQIPQFVLEANL-NNGNMIGITQSRRIAAVSMAKRVAQEKQCNLGSEVGYEIRFDKKCSASTKIKYMTDGILLNECVTDANLKDYGVVMIDEAHERXXXXXXXXXXXXXVCKSRENLKIIITSATICAEKFSQFFDDSKILTIEGRLFPVEIIY-EGYIMDLIDYSAKLVRRIHIGNE-PGDILVFLTGEEDI--------ERCCKLLRNVGNLIVTPLYGAIDFQEQQEVFRTMDCGDRKVVVATNIAETSITIDGIRYVIDCGYMKQNKFDSRRGIETLESIKISKAQAEQRKGRSGRTGPGWCYRLYSEGSYNDFIQE-AVPEIKRKDLSEIYLRIIEFNLNP-KDFNFIDXXXXXXXXXXXXXXXDLKIITKEGKLTPSGQNMLGFPVEPRLGKVLMESLNNKCTNDIIKIMAMLS--ERFIFRKHHKGRGRGDPLKEFSDHDGDHFTLLNIYNDWISHKQNKQWCISSSIDYNSMQNAYNIFIQLCKILKKNHSFKETVGEKNAIKKSLISGFFKNICVKTNRGAYTRLYGREVMYIHPQSSLFHSSPKIILFNEVRKTTKTFM 1900
            LP+Y ++D  +E ++ +Q++II+G+TG GKTTQ+PQ++ EA     G  IG TQ RR+AA+S+A RVA E  C LG++VGY IRF+   S  T +KYMTDG+LL E + + +L  Y V+MIDEAHER+L +DIL GL+K + + R++LK++I+SAT+ AEKFS FFDD+ I  I GR FPV+I Y +    D +D +   + +IH+    PGDILVFLTG+E+I        ER   L   +  LI  P+Y  +    Q ++F       RKVV+ATNIAETS+TIDGI YVID G+ KQN FD+R G+E L  + ISKA A QR GR+GRTGPG C+RLY+  +Y   ++E  +PEI+R +L  + L +    ++    F+F+D PP+E L  +  +L  L  +   G+LT  G+ M  FP +P + K+++ S   +C+ +I+ I AMLS      +R   +        K F    GDH TL+N+YN W     +++WC+ + + + +M+ A ++  QL  +L++     ++  +   I+K++ +G+F N+    N G Y  +  +   + HP S LF  +P+ +++ E+  T+K FM
Sbjct:  364 LPVYAFRDAFIEAVKEHQVLIIEGETGSGKTTQLPQYLYEAGFCEGGKRIGCTQPRRVAAMSVAARVADEVGCKLGTQVGYSIRFEDCTSEKTVLKYMTDGMLLREFLNEPDLASYSVMMIDEAHERTLHTDILFGLVKDIARFRKDLKLLISSATLDAEKFSSFFDDAPIFRIPGRRFPVDIYYTQAPEADYVDAAIVTIMQIHLTQPLPGDILVFLTGQEEIETVQEALMERSKALGSKIKELIPLPVYANLPSDLQAKIFEPTPKDARKVVLATNIAETSVTIDGINYVIDPGFSKQNSFDARSGVEHLHVVTISKAAANQRAGRAGRTGPGKCFRLYTAWAYKHELEEQPIPEIQRTNLGNVVLMLKSLGIHDLVHFDFLDPPPQETLVIALEQLYALGALNHRGELTKLGRRMAEFPCDPCMSKMIIASEKYECSEEIVTIAAMLSCNAAVFYRPKAQVIHADSARKGFWSPAGDHITLMNVYNKWQESSFSQRWCVENYVQHRTMKRARDVRDQLVGLLERVEIETKSSTDTIKIRKAITAGYFYNVSKLDNTGHYKTVKHKHTTHPHPNSCLFEETPRWVVYFELVFTSKEFM 963          
BLAST of ATP-dependent RNA helicase DHX8 vs. Ensembl Celegans
Match: ddx-15 (Pre-mRNA-splicing factor ATP-dependent RNA helicase ddx-15 [Source:UniProtKB/Swiss-Prot;Acc:Q20875])

HSP 1 Score: 409.453 bits (1051), Expect = 4.017e-133
Identity = 249/647 (38.49%), Postives = 387/647 (59.81%), Query Frame = 2
Query:  140 NKLPIYEYKDQIVELIRNNQIVIIQGQTGCGKTTQIPQFVLE--------ANLNNGNMIGITQSRRIAAVSMAKRVAQEKQCNLGSEVGYEIRFDKKCSASTKIKYMTDGILLNECVTDANLKDYGVVMIDEAHERXXXXXXXXXXXXXVCKSRENLKIIITSATICAEKFSQFFDDSKILTIEGRLFPVEIIYEGYI-MDLIDYSAKLVRRIHIGNE-PGDILVFLTGEEDIERCCK--------LLRNVGNLIVTPLYGAIDFQEQQEVF------RTMDCGDRKVVVATNIAETSITIDGIRYVIDCGYMKQNKFDSRRGIETLESIKISKAQAEQRKGRSGRTGPGWCYRLYSEGSYNDFIQ-EAVPEIKRKDLSEIYLRIIEFNLNPKD---FNFIDXXXXXXXXXXXXXXXDLKIITKEGKLTPSGQNMLGFPVEPRLGKVLMESLNNKCTNDIIKIMAMLSERFIFRKHHKGRGRGDPLK-EFSDHDGDHFTLLNIYNDWISHKQNKQWCISSSIDYNSMQNAYNIFIQLCKILKKNHSFKETVGEKNA-----IKKSLISGFFKNICVKTNRGAYTRLYGREVMYIHPQSSLFHSSPKIILFNEVRKTTKTFMHGVLRLDEEIIREF-PEELKIINYPD 1975
            ++LP++EYK++ +EL+RNNQ + + G+TG GKTTQIPQ+ +E               ++  TQ RR+AA+S+A RVA+E    LG EVGY IRF+   S  T +KY TDG+LL E +    L  Y V+++DEAHER+L++DIL+GL+K + ++R ++K++I SAT+ A KF ++F+D  +L++ GR FPVEI +      D ++ + + V +IH+  E  GDIL+FLTG+E+IE  CK        L  + G L   PLY  +    QQ +F      R      RK V++TNIAETS+TIDG+ +VID G+ KQ  ++ R  +E+L    ISKA A QR GR+GRT PG C+RLY+E +Y   +Q +  PEI R +L  + L++ +  L  +D   F+F+D P  E L R+   L  L+ I  +G+LT  G  M  FP++P+L K+L+ S    C+N+I+ I AMLS    + + ++ R   D  K  F+  DGDH TLLN+Y+ +  ++++ QWC  + I+Y +M+ A  +  QL +++ K +  + +   K+      I+K+L++GFF  +      G Y  +   +++ +HP + L H  P+  L+NE   TTK F+  V  +  E + +  P+   + N+PD
Sbjct:   74 SQLPVWEYKEKFMELLRNNQCITLVGETGSGKTTQIPQWAVEFMKQQQQGQPPGQARLVACTQPRRVAAMSVATRVAEEMDVVLGQEVGYSIRFEDCISERTVLKYCTDGMLLREAMNSPLLDKYKVLILDEAHERTLATDILMGLIKEIVRNRADIKVVIMSATLDAGKFQRYFEDCPLLSVPGRTFPVEIFFTPNAEKDYLEAAIRTVIQIHMVEEVEGDILLFLTGQEEIEEACKRIDREIQALGADAGALSCIPLYSTLPPAAQQRIFEPAPPNRPNGAISRKCVISTNIAETSLTIDGVVFVIDPGFSKQKVYNPRIRVESLLVCPISKASAMQRAGRAGRTKPGKCFRLYTETAYGSEMQDQTYPEILRSNLGSVVLQLKK--LGTEDLVHFDFMDPPAPETLMRALELLNYLQAINDDGELTELGSLMAEFPLDPQLAKMLITSTELNCSNEILSITAMLSVPQCWVRPNEMRTEADEAKARFAHIDGDHLTLLNVYHSFKQNQEDPQWCYDNFINYRTMKTADTVRTQLSRVMDKYNLRRVSTDFKSRDYYLNIRKALVAGFFMQVAHLERSGHYVTVKDNQLVNLHPSTVLDH-KPEWALYNEFVLTTKNFIRTVTDVRPEWLLQIAPQYYDLDNFPD 717          
BLAST of ATP-dependent RNA helicase DHX8 vs. Ensembl Celegans
Match: ddx-15 (Pre-mRNA-splicing factor ATP-dependent RNA helicase ddx-15 [Source:UniProtKB/Swiss-Prot;Acc:Q20875])

HSP 1 Score: 404.06 bits (1037), Expect = 1.455e-131
Identity = 244/624 (39.10%), Postives = 376/624 (60.26%), Query Frame = 2
Query:  140 NKLPIYEYKDQIVELIRNNQIVIIQGQTGCGKTTQIPQFVLE--------ANLNNGNMIGITQSRRIAAVSMAKRVAQEKQCNLGSEVGYEIRFDKKCSASTKIKYMTDGILLNECVTDANLKDYGVVMIDEAHERXXXXXXXXXXXXXVCKSRENLKIIITSATICAEKFSQFFDDSKILTIEGRLFPVEIIYEGYI-MDLIDYSAKLVRRIHIGNE-PGDILVFLTGEEDIERCCK--------LLRNVGNLIVTPLYGAIDFQEQQEVF------RTMDCGDRKVVVATNIAETSITIDGIRYVIDCGYMKQNKFDSRRGIETLESIKISKAQAEQRKGRSGRTGPGWCYRLYSEGSYNDFIQEAV-PEIKRKDLSEIYLRIIEFNLNPKD---FNFIDXXXXXXXXXXXXXXXDLKIITKEGKLTPSGQNMLGFPVEPRLGKVLMESLNNKCTNDIIKIMAMLSERFIFRKHHKGRGRGDPLK-EFSDHDGDHFTLLNIYNDWISHKQNKQWCISSSIDYNSMQNAYNIFIQLCKILKKNHSFKETVGEKNA-----IKKSLISGFFKNICVKTNRGAYTRLYGREVMYIHPQSSLFHSSPKIILFNEVRKTTKTFMHGV 1909
            ++LP++EYK++ +EL+RNNQ + + G+TG GKTTQIPQ+ +E               ++  TQ RR+AA+S+A RVA+E    LG EVGY IRF+   S  T +KY TDG+LL E +    L  Y V+++DEAHER+L++DIL+GL+K + ++R ++K++I SAT+ A KF ++F+D  +L++ GR FPVEI +      D ++ + + V +IH+  E  GDIL+FLTG+E+IE  CK        L  + G L   PLY  +    QQ +F      R      RK V++TNIAETS+TIDG+ +VID G+ KQ  ++ R  +E+L    ISKA A QR GR+GRT PG C+RLY+E +Y   +Q+   PEI R +L  + L++ +  L  +D   F+F+D P  E L R+   L  L+ I  +G+LT  G  M  FP++P+L K+L+ S    C+N+I+ I AMLS    + + ++ R   D  K  F+  DGDH TLLN+Y+ +  ++++ QWC  + I+Y +M+ A  +  QL +++ K +  + +   K+      I+K+L++GFF  +      G Y  +   +++ +HP + L H  P+  L+NE   TTK F+  V
Sbjct:   74 SQLPVWEYKEKFMELLRNNQCITLVGETGSGKTTQIPQWAVEFMKQQQQGQPPGQARLVACTQPRRVAAMSVATRVAEEMDVVLGQEVGYSIRFEDCISERTVLKYCTDGMLLREAMNSPLLDKYKVLILDEAHERTLATDILMGLIKEIVRNRADIKVVIMSATLDAGKFQRYFEDCPLLSVPGRTFPVEIFFTPNAEKDYLEAAIRTVIQIHMVEEVEGDILLFLTGQEEIEEACKRIDREIQALGADAGALSCIPLYSTLPPAAQQRIFEPAPPNRPNGAISRKCVISTNIAETSLTIDGVVFVIDPGFSKQKVYNPRIRVESLLVCPISKASAMQRAGRAGRTKPGKCFRLYTETAYGSEMQDQTYPEILRSNLGSVVLQLKK--LGTEDLVHFDFMDPPAPETLMRALELLNYLQAINDDGELTELGSLMAEFPLDPQLAKMLITSTELNCSNEILSITAMLSVPQCWVRPNEMRTEADEAKARFAHIDGDHLTLLNVYHSFKQNQEDPQWCYDNFINYRTMKTADTVRTQLSRVMDKYNLRRVSTDFKSRDYYLNIRKALVAGFFMQVAHLERSGHYVTVKDNQLVNLHPSTVLDH-KPEWALYNEFVLTTKNFIRTV 694          
BLAST of ATP-dependent RNA helicase DHX8 vs. Ensembl Celegans
Match: mog-1 (Probable pre-mRNA-splicing factor ATP-dependent RNA helicase mog-1 [Source:UniProtKB/Swiss-Prot;Acc:P34498])

HSP 1 Score: 404.831 bits (1039), Expect = 1.942e-127
Identity = 232/607 (38.22%), Postives = 362/607 (59.64%), Query Frame = 2
Query:  146 LPIYEYKDQIVELIRNNQIVIIQGQTGCGKTTQIPQFVLEANLNNGNMIGITQSRRIAAVSMAKRVAQEKQCNLGSEVGYEIRFDKKCSASTKIKYMTDGILLNECVTDANLKDYGVVMIDEAHERXXXXXXXXXXXXXVCKSRENLKIIITSATICAEKFSQFF-DDSKILTIEGRLFPVEIIY-EGYIMDLIDYSAKLVRRIHIGNEPGDILVFLTGEEDIERCCKLLR-------NVGNLIVTPLYGAIDFQEQQEVFRTMDCGDRKVVVATNIAETSITIDGIRYVIDCGYMKQNKFDSRRGIETLESIKISKAQAEQRKGRSGRTGPGWCYRLYSEGSYND-FIQEAVPEIKRKDLSEIYLRIIEFNLNP-KDFNFIDXXXXXXXXXXXXXXXDLKIITKEGKLTPSGQNMLGFPVEPRLGKVLMESLNNKCTNDIIKIMAMLSERFIFRKHHKGRGRGDPLKE-FSDHDGDHFTLLNIYNDWISHKQNKQWCISSSIDYNSMQNAYNIFIQLCKILKK-NHSFKETVGEKNAIKKSLISGFFKNICVKTNRGAYTRLYGREVMYIHPQSSLFHSS--PKIILFNEVRKTTKTFMHGVLRLD 1921
            LP++  + +++ +IR N +VII G+TG GKTTQ+ Q++LE    +  +IG TQ RR+AA+S+A+RVA E   +LG +VGY IRF+   S  T IKYMTDGILL EC+ D +L  Y  +++DEAHERSL++D+L GLL+ V   R +LK+I+TSAT+ A+KF+ FF  +    TI GR FPVE+ +    + D +D + K    IH+G   GDIL+F+ G+EDIE  C++++           L V P+Y  +    Q ++F+    G RK +VATNIAETS+T+DGI +VID G+ K   ++ R G++ L    +S+A A QR GR+GRTGPG CYRLY+E  + D  ++  VPEI+R +L+ + L +    ++    F+F+D PP++ +  S  +L  L  +   G+LTP G+ M+ FP++P L K+L+ S    C+++++ I++MLS   IF +        D  KE F   + DH T LN+Y  W +HK + +WC  + +   +++    +  QL +I++           E + ++K + S +F N       G Y  +      ++HP S+LF     P  ++++E+  T K +M  V  +D
Sbjct:  441 LPVFACRQKMMNVIRENNVVIIVGETGSGKTTQLAQYLLEDGFGDSGLIGCTQPRRVAAMSVARRVADEMGVDLGQDVGYAIRFEDCTSEKTIIKYMTDGILLRECLGDGSLDQYSAIIMDEAHERSLNTDVLFGLLREVIAKRADLKLIVTSATMDADKFADFFGGNCPTFTIPGRTFPVELFHARTPVEDYVDAAVKQAVTIHLGGMDGDILIFMPGQEDIECTCEMIKEKLGELDEAPPLAVLPIYSQLPSDLQAKIFQRAPGGMRKAIVATNIAETSLTVDGILFVIDPGFCKMKVYNPRIGMDALSIFPVSQASANQRTGRAGRTGPGQCYRLYTERQFKDELLKSTVPEIQRTNLANVVLLLKSLGVDDLLKFHFMDAPPQDNMLNSMYQLWTLGALDNTGQLTPMGRKMVEFPLDPTLSKMLIMSAEMGCSDEVLTIVSMLSVPAIFFRPKGREEEADAKKEKFQVPESDHLTFLNVYIQWRTHKYSAKWCADNYLHVKALKKVREVRAQLKEIMQDLKLPLISNGSEWDIVRKCICSAYFHNAARLKGIGEYVNVRTGIPCFLHPTSALFGMGFMPDYVVYHELIMTAKEYMQCVTAVD 1047          
BLAST of ATP-dependent RNA helicase DHX8 vs. Ensembl Fly
Match: pea (gene:FBgn0086895 transcript:FBtr0087518)

HSP 1 Score: 474.937 bits (1221), Expect = 6.290e-153
Identity = 262/613 (42.74%), Postives = 393/613 (64.11%), Query Frame = 2
Query:  146 LPIYEYKDQIVELIRNNQIVIIQGQTGCGKTTQIPQFVLEANLNNGNMIGITQSRRIAAVSMAKRVAQEKQCNLGSEVGYEIRFDKKCSASTKIKYMTDGILLNECVTDANLKDYGVVMIDEAHERXXXXXXXXXXXXXVCKSRENLKIIITSATICAEKFSQFFDDSKILTIEGRLFPVEIIYEGYI-MDLIDYSAKLVRRIHIGNEPGDILVFLTGEEDIERCCKLL--------RNVGNLIVTPLYGAIDFQEQQEVFRTMDCGDRKVVVATNIAETSITIDGIRYVIDCGYMKQNKFDSRRGIETLESIKISKAQAEQRKGRSGRTGPGWCYRLYSEGSYND-FIQEAVPEIKRKDLSEIYLRIIEFNLNP-KDFNFIDXXXXXXXXXXXXXXXDLKIITKEGKLTPSGQNMLGFPVEPRLGKVLMESLNNKCTNDIIKIMAMLSERFIFRKHHKGRGRGDPLK-EFSDHDGDHFTLLNIYNDWISHKQNKQWCISSSIDYNSMQNAYNIFIQLCKILKKNHSFKETVGEKNA--IKKSLISGFFKNICVKTNRGAYTRLYGREVMYIHPQSSLFHSSPKIILFNEVRKTTKTFMHGVLRLDEEIIREF 1942
            LPIY+ +D +++ + +NQI+I+ G+TG GKTTQI Q++ E        IG TQ RR+AA+S+AKRVA+E  C LG EVGY IRF+   S  T IKYMTDG+LL EC+ +A LK Y V+M+DEAHER++ +D+L GLLK   + R  LK+I+TSAT+ A KFSQ+F  + I TI GR FPVE++Y      D +D S   V +IH+   PGDIL+FLTG+E+I+  C++L         +V  LI+ P+Y A+  + Q  +F     G RKVV+ATNIAETS+TIDGI YV+D G++KQ  ++S+ G+++L    IS+A A+QR GR+GRTGPG  YRLY+E +Y D  +   VPEI+R +L+   L++    +N    F+F+D PP E L  +  +L  L  +  EG LT  G+ M  FP+EP L K+L+ S+  +C+++I+ I++MLS + +F +    +   D  K +F+  +GDH TLL +YN W ++K +  WC  + +   +++ + ++  QL  I+ + H        KN+  I+K++ SGFF+N   K  +  Y  L   +V+YIHP S+LF+  P+ ++++E+ +TTK +M  V  +D + + EF
Sbjct:  586 LPIYKLRDDLIKAVTDNQILIVIGETGSGKTTQITQYLGECGFTARGKIGCTQPRRVAAMSVAKRVAEEYGCRLGQEVGYTIRFEDCTSPETIIKYMTDGMLLRECLMEAELKSYSVIMLDEAHERTIHTDVLFGLLKTAVQKRPELKLIVTSATLDAVKFSQYFFKAPIFTIPGRTFPVEVLYTKEPETDYLDASLITVMQIHLREPPGDILLFLTGQEEIDTACEILYERMKSLGPDVPELIILPVYSALPSEMQTRIFDPAPAGSRKVVIATNIAETSLTIDGIFYVVDPGFVKQKVYNSKTGMDSLVVTPISQAAAKQRAGRAGRTGPGKTYRLYTERAYRDEMLPTPVPEIQRTNLATTVLQLKTMGINDLLHFDFMDAPPVESLVMALEQLHSLSALDDEGLLTRLGRRMAEFPLEPNLSKMLIMSVALQCSDEILTIVSMLSVQNVFYRPKDKQALADQKKAKFNQAEGDHLTLLAVYNSWKNNKFSNAWCYENFVQIRTLKRSQDVRKQLLGIMDR-HKLDVVSAGKNSVRIQKAICSGFFRNAAKKDPQEGYRTLVDSQVVYIHPSSALFNRQPEWVIYHELVQTTKEYMREVTTIDPKWLVEF 1197          
BLAST of ATP-dependent RNA helicase DHX8 vs. Ensembl Fly
Match: l(2)37Cb (gene:FBgn0086444 transcript:FBtr0081163)

HSP 1 Score: 436.802 bits (1122), Expect = 1.043e-141
Identity = 254/641 (39.63%), Postives = 383/641 (59.75%), Query Frame = 2
Query:   74 SMNNLPDDTFDDEQELISKSPPNKLPIYEYKDQIVELIRNNQIVIIQGQTGCGKTTQIPQFVLEANLN-NGNMIGITQSRRIAAVSMAKRVAQEKQCNLGSEVGYEIRFDKKCSASTKIKYMTDGILLNECVTDANLKDYGVVMIDEAHERXXXXXXXXXXXXXVCKSRENLKIIITSATICAEKFSQFFDDSKILTIEGRLFPVEIIY-EGYIMDLIDYSAKLVRRIHIGNEPGDILVFLTGEEDIERCCKLLRN--------VGNLIVTPLYGAIDFQEQQEVFRTMDCGDRKVVVATNIAETSITIDGIRYVIDCGYMKQNKFDSRRGIETLESIKISKAQAEQRKGRSGRTGPGWCYRLYSEGSYNDFIQE-AVPEIKRKDLSEIYLRIIEFNLNPK-DFNFIDXXXXXXXXXXXXXXXDLKIITKEGKLTPSGQNMLGFPVEPRLGKVLMESLNNKCTNDIIKIMAMLS--ERFIFRKHHKGRGRGDPLKEFSDHDGDHFTLLNIYNDWISHKQNKQWCISSSIDYNSMQNAYNIFIQLCKILKKNH-----SFKETVGEKNAIKKSLISGFFKNICVKTNRGAYTRLYGREVMYIHPQSSLFHSSPKIILFNEVRKTTKTFMHGVLRLDEEIIRE 1939
            S +  P+ T  + + L        LP+Y +K+ ++  ++ +Q++II+G+TG GKTTQ+PQ+++EA    +  MIG TQ RR+AA+S+A RVA+E    LG+EVGY IRF+   S  T +KYMTDG L  E +++ +L  Y V++IDEAHER+L +DIL GL+K + + R  LK++I+SAT+ AEKFS FFDD+ I  I GR +PV+I Y +    D ID     V +IH     GDILVFLTG+++IE C ++L +        +  LIV P+Y  +    Q ++F       RKV++ATNIAETS+TID I YVID G+ KQN F+SR G+E+L  + ISKA A QR GR+GRT PG C+RLY+  +Y   +++  VPEI+R +L    L +    +N    F+F+D PP E L  +  +L  L  +   G+LT  G+ M  FPV+P +GK+L+ S   KC+ +++ I AMLS      +R   K        K F+   GDH +LL +YN W     + QWC  + I Y SM+ A ++  QL  ++++          ETV     ++K+  +G+F ++   +  G Y  +   + + IHP SSLF   P+ +L++E+  T+K +M  V+ ++ + + E
Sbjct:  228 SSSRQPELTEKERKRLTLDETRRSLPVYPFKEDLIAAVKEHQVLIIEGETGSGKTTQVPQYLVEAGFTKDKKMIGCTQPRRVAAMSVAARVAEEMGVKLGNEVGYSIRFEDCTSDRTILKYMTDGTLHREFLSEPDLASYSVMIIDEAHERTLHTDILFGLVKDIARFRPELKLLISSATLDAEKFSAFFDDAPIFRIPGRRYPVDIFYTKAPEADYIDACCVSVLQIHATQPLGDILVFLTGQDEIETCQEVLHDRVKRLGSKIRELIVIPVYANLPSDMQAKIFEPTPPNARKVILATNIAETSLTIDNIIYVIDPGFAKQNNFNSRTGMESLMVVPISKASANQRAGRAGRTAPGKCFRLYTAWAYKHELEDNTVPEIQRINLGNAVLMLKALGINDLIHFDFLDPPPHETLVLALEQLYALGALNHHGELTKLGRRMAEFPVDPMMGKMLLASEKYKCSEEMVTIAAMLSVNSAIFYRPKDKIIHADTARKNFNHMHGDHLSLLQVYNQWAETDYSTQWCYENFIQYRSMKRARDVREQLVGLMQRVEIDMVSCLPETVN----VRKAATAGYFYHVARLSKGGHYKTIKHNQTVMIHPNSSLFEELPRWVLYHELVFTSKEYMRQVIEIESKWLLE 864          
BLAST of ATP-dependent RNA helicase DHX8 vs. Ensembl Fly
Match: Dhx15 (gene:FBgn0033160 transcript:FBtr0336909)

HSP 1 Score: 399.053 bits (1024), Expect = 3.917e-129
Identity = 239/636 (37.58%), Postives = 383/636 (60.22%), Query Frame = 2
Query:  146 LPIYEYKDQIVELIRNNQIVIIQGQTGCGKTTQIPQFVLEANLNNGNM-IGITQSRRIAAVSMAKRVAQEKQCNLGSEVGYEIRFDKKCSASTKIKYMTDGILLNECVTDANLKDYGVVMIDEAHERXXXXXXXXXXXXXVCKSRENLKIIITSATICAEKFSQFFDDSKILTIEGRLFPVEIIYEGYI-MDLIDYSAKLVRRIHIGNE-PGDILVFLTGEEDIERCCKLLR--------NVGNLIVTPLYGAIDFQEQQEVFRTMDCGD------RKVVVATNIAETSITIDGIRYVIDCGYMKQNKFDSRRGIETLESIKISKAQAEQRKGRSGRTGPGWCYRLYSEGSYNDFIQE-AVPEIKRKDLSEIYLRIIEFNLNP-KDFNFIDXXXXXXXXXXXXXXXDLKIITKEGKLTPSGQNMLGFPVEPRLGKVLMESLNNKCTNDIIKIMAMLSERFIFRKHHKGRGRGDPLK-EFSDHDGDHFTLLNIYNDWISHKQNKQWCISSSIDYNSMQNAYNIFIQLCKILKKNHSFKETVGEKNA------IKKSLISGFFKNICVKTNRGAYTRLYGREVMYIHPQSSLFHSSPKIILFNEVRKTTKTFMHGVLRLDEEIIREF-PEELKIINYP 1972
            LP++EY+   + L+  +Q +++ G+TG GKTTQIPQ+ ++  ++ G   +  TQ RR+AA+S+A+RV++E    LG EVGY IRF+   +A T +KYMTDG+LL E ++D  L  Y V+++DEAHER+L++DIL+G+LK V + R +LK+++ SAT+ A KF Q+FD++ ++ + GR  PVEI Y      D ++ + + V +IH+  E  GDIL+FLTG+E+IE  CK ++         +G L   PLY  +    QQ +F      +      RKVVV+TNIAETS+TIDG+ +VID G+ KQ  ++ R  +E+L    ISKA A+QR GR+GRT PG C+RLY+E ++ + +Q+   PEI R +L  + L++ +  ++    F+F+D P  E L R+   L  L  +  +G LT  G  M  FP++P+L K+L+ S  + C+N+I+ I AMLS    F + ++ +   D  K  F+  DGDH TLLN+Y+ +    ++  WC  + I++ S+++A N+  QL +I+ +  + + T  E  +      I+K+L+ GFF  +      G Y  +   + + +HP + L H  P  +++NE   TTK ++  V  +  E +    P+   + N+P
Sbjct:   72 LPVFEYQADFMRLLSLHQCIVLVGETGSGKTTQIPQWCVDFAVSKGRKGVSCTQPRRVAAMSVAQRVSEEMDVKLGEEVGYSIRFEDCSTAKTLLKYMTDGMLLREAMSDPMLDQYQVILLDEAHERTLATDILMGVLKEVIRQRSDLKLVVMSATLDAGKFQQYFDNAPLMKVPGRTHPVEIFYTPEPERDYLEAAIRTVIQIHMCEEIEGDILMFLTGQEEIEEACKRIKREIDNLGSEIGELKCIPLYSTLPPNLQQRIFEPAPPPNANGAIGRKVVVSTNIAETSLTIDGVVFVIDPGFAKQKVYNPRIRVESLLVSPISKASAQQRSGRAGRTRPGKCFRLYTEKAFKNEMQDNTYPEILRSNLGTVVLQLKKLGIDDLVHFDFMDPPAPETLMRALELLNYLAALDDDGNLTDLGAVMSEFPLDPQLAKMLIASCQHNCSNEILSITAMLSVPQCFVRPNEAKKAADEAKMRFAHIDGDHLTLLNVYHAFKQSSEDPNWCYENFINFRSLKSADNVRQQLARIMDR-FNLRRTSTEFTSKDYYVNIRKALVQGFFMQVAHLERTGYYLTIKDNQNVQLHPSTCLDH-KPDWVIYNEFVLTTKNYIRTVTDVKPEWLCCLAPQYYDLNNFP 705          
BLAST of ATP-dependent RNA helicase DHX8 vs. Ensembl Fly
Match: Dhx15 (gene:FBgn0033160 transcript:FBtr0088966)

HSP 1 Score: 399.053 bits (1024), Expect = 3.917e-129
Identity = 239/636 (37.58%), Postives = 383/636 (60.22%), Query Frame = 2
Query:  146 LPIYEYKDQIVELIRNNQIVIIQGQTGCGKTTQIPQFVLEANLNNGNM-IGITQSRRIAAVSMAKRVAQEKQCNLGSEVGYEIRFDKKCSASTKIKYMTDGILLNECVTDANLKDYGVVMIDEAHERXXXXXXXXXXXXXVCKSRENLKIIITSATICAEKFSQFFDDSKILTIEGRLFPVEIIYEGYI-MDLIDYSAKLVRRIHIGNE-PGDILVFLTGEEDIERCCKLLR--------NVGNLIVTPLYGAIDFQEQQEVFRTMDCGD------RKVVVATNIAETSITIDGIRYVIDCGYMKQNKFDSRRGIETLESIKISKAQAEQRKGRSGRTGPGWCYRLYSEGSYNDFIQE-AVPEIKRKDLSEIYLRIIEFNLNP-KDFNFIDXXXXXXXXXXXXXXXDLKIITKEGKLTPSGQNMLGFPVEPRLGKVLMESLNNKCTNDIIKIMAMLSERFIFRKHHKGRGRGDPLK-EFSDHDGDHFTLLNIYNDWISHKQNKQWCISSSIDYNSMQNAYNIFIQLCKILKKNHSFKETVGEKNA------IKKSLISGFFKNICVKTNRGAYTRLYGREVMYIHPQSSLFHSSPKIILFNEVRKTTKTFMHGVLRLDEEIIREF-PEELKIINYP 1972
            LP++EY+   + L+  +Q +++ G+TG GKTTQIPQ+ ++  ++ G   +  TQ RR+AA+S+A+RV++E    LG EVGY IRF+   +A T +KYMTDG+LL E ++D  L  Y V+++DEAHER+L++DIL+G+LK V + R +LK+++ SAT+ A KF Q+FD++ ++ + GR  PVEI Y      D ++ + + V +IH+  E  GDIL+FLTG+E+IE  CK ++         +G L   PLY  +    QQ +F      +      RKVVV+TNIAETS+TIDG+ +VID G+ KQ  ++ R  +E+L    ISKA A+QR GR+GRT PG C+RLY+E ++ + +Q+   PEI R +L  + L++ +  ++    F+F+D P  E L R+   L  L  +  +G LT  G  M  FP++P+L K+L+ S  + C+N+I+ I AMLS    F + ++ +   D  K  F+  DGDH TLLN+Y+ +    ++  WC  + I++ S+++A N+  QL +I+ +  + + T  E  +      I+K+L+ GFF  +      G Y  +   + + +HP + L H  P  +++NE   TTK ++  V  +  E +    P+   + N+P
Sbjct:   72 LPVFEYQADFMRLLSLHQCIVLVGETGSGKTTQIPQWCVDFAVSKGRKGVSCTQPRRVAAMSVAQRVSEEMDVKLGEEVGYSIRFEDCSTAKTLLKYMTDGMLLREAMSDPMLDQYQVILLDEAHERTLATDILMGVLKEVIRQRSDLKLVVMSATLDAGKFQQYFDNAPLMKVPGRTHPVEIFYTPEPERDYLEAAIRTVIQIHMCEEIEGDILMFLTGQEEIEEACKRIKREIDNLGSEIGELKCIPLYSTLPPNLQQRIFEPAPPPNANGAIGRKVVVSTNIAETSLTIDGVVFVIDPGFAKQKVYNPRIRVESLLVSPISKASAQQRSGRAGRTRPGKCFRLYTEKAFKNEMQDNTYPEILRSNLGTVVLQLKKLGIDDLVHFDFMDPPAPETLMRALELLNYLAALDDDGNLTDLGAVMSEFPLDPQLAKMLIASCQHNCSNEILSITAMLSVPQCFVRPNEAKKAADEAKMRFAHIDGDHLTLLNVYHAFKQSSEDPNWCYENFINFRSLKSADNVRQQLARIMDR-FNLRRTSTEFTSKDYYVNIRKALVQGFFMQVAHLERTGYYLTIKDNQNVQLHPSTCLDH-KPDWVIYNEFVLTTKNYIRTVTDVKPEWLCCLAPQYYDLNNFP 705          
BLAST of ATP-dependent RNA helicase DHX8 vs. Ensembl Fly
Match: CG4901 (gene:FBgn0032194 transcript:FBtr0445415)

HSP 1 Score: 376.711 bits (966), Expect = 6.765e-121
Identity = 227/624 (36.38%), Postives = 363/624 (58.17%), Query Frame = 2
Query:  146 LPIYEYKDQIVELIRNNQIVIIQGQTGCGKTTQIPQFVLEANLNNGNMIGITQSRRIAAVSMAKRVAQEKQCNLGSEVGYEIRFDKKCSASTKIKYMTDGILLNECVTDANLKDYGVVMIDEAHERXXXXXXXXXXXXXVCKSRE-----NLKIIITSATICAEKFSQFFDDSKILTIEGRLFPVEII-----YEGYIMDLIDYSAKLVRRIHIGNEPG---DILVFLTGEEDIERCCKLLRNVG--------NLIVTPLYGAIDFQEQQEVFRTMDCGDRKVVVATNIAETSITIDGIRYVIDCGYMKQNKFDSRRGIETLESIKISKAQAEQRKGRSGRTGPGWCYRLYSEGSYNDFIQEAVPEIKRKDLSEIYLRIIEFNLNPKDFNFIDXXXXXXXXXXXXXXXDLKIITK--EGKLTPSGQNMLGFPVEPRLGKVLMESLNNKCTNDIIKIMAMLSERFIF-RKHHKGRGRGDPLKEFSDHDGDHFTLLNIYNDWISHKQNKQWCISSSIDYNSMQNAYNIFIQLCKILKKNHSFKETVGEKNAIKKSLISGFFKNICVKTNRGAYTRLYGREVMYIHPQSSLFHS--SPKIILFNEVRKTTKTFMHGVLRLDEEIIRE 1939
            LP++  + +I++ +  N  V+I  +TG GKTTQIPQF+L A      MIGITQ RR+AA+++A+RVAQE    +G  VGY +RF+   S +TKI+++TDG+LL E + D  L  Y V+++DEAHER++++D+L G++K   K R      NLK+++TSAT+  + F  +F + K + +EGR +PV ++     +E YI  +      LV   HI        D+L+FLTG+E+IE   + +R +         +L V  LY  +   +Q E F       RKV++ATNIAETSITI GIR VIDCG++K+  F++  G++ L+S++ISKAQA QR GR+GR   G CYR Y++   + F     PEI R + + + L+++  +++  +F+F+D P E+ L  + + L  L  I    +  +TP G+ M+ +P++P+  K+L+ + +  C  +I+ ++++LS   +F     K         +F    GDH TLLN++N ++  ++ K WC  + ++  S+  A N+  QL +I +  H    +  +   +KK +++GFF+NI V    G Y    G     IHP SS+ H    P  ILF E+ +T +TF+  V  +  E I+E
Sbjct:   68 LPVFNCRHRILKELEANDTVLIMSETGSGKTTQIPQFLLLAGYAKNGMIGITQPRRVAAITVARRVAQELNGTIGDTVGYTVRFEDVTSRATKIRFLTDGVLLRESIKDRLLLKYSVIILDEAHERTVNADLLFGIVKDAQKERRKQKLANLKVVVTSATMDIDHFGNYF-NCKGMYLEGRTYPVRVMHTKEEHEDYIHTV------LVTLFHIHRTTPKNHDVLIFLTGQEEIESLAQQIRQLAKIDTTGTTDLRVFTLYAQLSQGKQLECFVPTPANVRKVILATNIAETSITIPGIRCVIDCGFVKEKSFNTVDGLDVLKSVRISKAQAWQRAGRAGRDADGTCYRAYTKAEMDSFADATQPEILRTNPTSMVLQLLALDIDCNNFDFLDPPLEDGLRSAYKSLDALGAIKTGDDSYITPLGRQMVQYPLDPKYSKLLLTASSFGCMEEILSLVSVLSSDHVFVSNSEKNEMAALAHAKFQSKHGDHLTLLNVFNGFLKSEKPKMWCHDNYLNLRSLTYARNVRRQLREISEHLHLALNSSDDIEMLKKCILNGFFENIAVLQRDGFYITASGNIRSKIHP-SSVLHGKYKPSYILFTEIVQTEQTFLRQVTEISIEWIKE 683          
BLAST of ATP-dependent RNA helicase DHX8 vs. Ensembl Zebrafish
Match: AL833789.3 (DEAH (Asp-Glu-Ala-His) box polypeptide 8 [Source:NCBI gene;Acc:606595])

HSP 1 Score: 476.093 bits (1224), Expect = 5.913e-154
Identity = 262/612 (42.81%), Postives = 393/612 (64.22%), Query Frame = 2
Query:  146 LPIYEYKDQIVELIRNNQIVIIQGQTGCGKTTQIPQFVLEANLNNGNMIGITQSRRIAAVSMAKRVAQEKQCNLGSEVGYEIRFDKKCSASTKIKYMTDGILLNECVTDANLKDYGVVMIDEAHERXXXXXXXXXXXXXVCKSRENLKIIITSATICAEKFSQFFDDSKILTIEGRLFPVEIIYEGYI-MDLIDYSAKLVRRIHIGNEPGDILVFLTGEEDIERCCKLL--------RNVGNLIVTPLYGAIDFQEQQEVFRTMDCGDRKVVVATNIAETSITIDGIRYVIDCGYMKQNKFDSRRGIETLESIKISKAQAEQRKGRSGRTGPGWCYRLYSEGSYND-FIQEAVPEIKRKDLSEIYLRIIEFNLNP-KDFNFIDXXXXXXXXXXXXXXXDLKIITKEGKLTPSGQNMLGFPVEPRLGKVLMESLNNKCTNDIIKIMAMLSERFIFRKHHKGRGRGDPLK-EFSDHDGDHFTLLNIYNDWISHKQNKQWCISSSIDYNSMQNAYNIFIQLCKILKKNHSFKETVGEKNA-IKKSLISGFFKNICVKTNRGAYTRLYGREVMYIHPQSSLFHSSPKIILFNEVRKTTKTFMHGVLRLDEEIIREF 1942
            LPIY+ K+Q+++ + +NQI+I+ G+TG GKTTQI Q++ EA       IG TQ RR+AA+S+AKRV++E  C LG EVGY IRF+   S  T IKYMTDG+LL EC+ D +L  Y ++M+DEAHER++ +D+L GLLK   + R ++K+I+TSAT+ A KFSQ+F ++ I TI GR +PVE++Y      D +D S   V +IH+   PGDILVFLTG+E+I+  C++L         +V  LI+ P+Y A+  + Q  +F     G RKVV+ATNIAETS+TIDGI YV+D G++KQ  ++S+ GI+ L    IS+AQA+QR GR+GRTGPG CYRLY+E +Y D  +   VPEI+R +L+   L +    +N    F+F+D PP E L  +  +L  L  +  EG LT  G+ M  FP+EP L K+L+ S++  C+ +++ I++MLS + +F +    +   D  K +F   +GDH TLL +YN W ++K +  WC  + I   S++ A +I  Q+  I+ ++     + G+    ++K++ SGFF+N   K  +  Y  L  ++V+YIHP S+LF+  P+ ++++E+  TTK +M  V  +D   + EF
Sbjct:  502 LPIYKLKEQLIQAVHDNQILIVIGETGSGKTTQITQYLAEAGYTTRGKIGCTQPRRVAAMSVAKRVSEEYGCCLGQEVGYTIRFEDCTSPETVIKYMTDGMLLRECLIDPDLGQYAIIMLDEAHERTIHTDVLFGLLKKTVQKRTDMKLIVTSATLDAVKFSQYFYEAPIFTIPGRTYPVEVLYTKEPETDYLDASLITVMQIHLTEPPGDILVFLTGQEEIDTACEILYERMKSLGPDVPELIILPVYSALPSEMQTRIFDPAPPGSRKVVIATNIAETSLTIDGIYYVVDPGFVKQKVYNSKTGIDQLVVTPISQAQAKQRAGRAGRTGPGKCYRLYTERAYRDEMLTTNVPEIQRTNLASTVLSLKAMGINDLLSFDFMDAPPMETLITAMEQLYTLGALDDEGLLTRLGRRMAEFPLEPMLCKMLIMSVHLGCSEEMLTIVSMLSVQNVFYRPKDKQALADQKKAKFHQPEGDHLTLLAVYNSWKNNKFSNPWCYENFIQARSLRRAQDIRKQMLGIMDRHKLDVVSCGKATVRVQKAICSGFFRNAAKKDPQEGYRTLIDQQVVYIHPSSALFNRQPEWVVYHELVLTTKEYMREVTTIDPRWLVEF 1113          
BLAST of ATP-dependent RNA helicase DHX8 vs. Ensembl Zebrafish
Match: dhx8 (DEAH (Asp-Glu-Ala-His) box polypeptide 8 [Source:ZFIN;Acc:ZDB-GENE-050809-39])

HSP 1 Score: 476.093 bits (1224), Expect = 1.551e-153
Identity = 262/612 (42.81%), Postives = 393/612 (64.22%), Query Frame = 2
Query:  146 LPIYEYKDQIVELIRNNQIVIIQGQTGCGKTTQIPQFVLEANLNNGNMIGITQSRRIAAVSMAKRVAQEKQCNLGSEVGYEIRFDKKCSASTKIKYMTDGILLNECVTDANLKDYGVVMIDEAHERXXXXXXXXXXXXXVCKSRENLKIIITSATICAEKFSQFFDDSKILTIEGRLFPVEIIYEGYI-MDLIDYSAKLVRRIHIGNEPGDILVFLTGEEDIERCCKLL--------RNVGNLIVTPLYGAIDFQEQQEVFRTMDCGDRKVVVATNIAETSITIDGIRYVIDCGYMKQNKFDSRRGIETLESIKISKAQAEQRKGRSGRTGPGWCYRLYSEGSYND-FIQEAVPEIKRKDLSEIYLRIIEFNLNP-KDFNFIDXXXXXXXXXXXXXXXDLKIITKEGKLTPSGQNMLGFPVEPRLGKVLMESLNNKCTNDIIKIMAMLSERFIFRKHHKGRGRGDPLK-EFSDHDGDHFTLLNIYNDWISHKQNKQWCISSSIDYNSMQNAYNIFIQLCKILKKNHSFKETVGEKNA-IKKSLISGFFKNICVKTNRGAYTRLYGREVMYIHPQSSLFHSSPKIILFNEVRKTTKTFMHGVLRLDEEIIREF 1942
            LPIY+ K+Q+++ + +NQI+I+ G+TG GKTTQI Q++ EA       IG TQ RR+AA+S+AKRV++E  C LG EVGY IRF+   S  T IKYMTDG+LL EC+ D +L  Y ++M+DEAHER++ +D+L GLLK   + R ++K+I+TSAT+ A KFSQ+F ++ I TI GR +PVE++Y      D +D S   V +IH+   PGDILVFLTG+E+I+  C++L         +V  LI+ P+Y A+  + Q  +F     G RKVV+ATNIAETS+TIDGI YV+D G++KQ  ++S+ GI+ L    IS+AQA+QR GR+GRTGPG CYRLY+E +Y D  +   VPEI+R +L+   L +    +N    F+F+D PP E L  +  +L  L  +  EG LT  G+ M  FP+EP L K+L+ S++  C+ +++ I++MLS + +F +    +   D  K +F   +GDH TLL +YN W ++K +  WC  + I   S++ A +I  Q+  I+ ++     + G+    ++K++ SGFF+N   K  +  Y  L  ++V+YIHP S+LF+  P+ ++++E+  TTK +M  V  +D   + EF
Sbjct:  555 LPIYKLKEQLIQAVHDNQILIVIGETGSGKTTQITQYLAEAGYTTRGKIGCTQPRRVAAMSVAKRVSEEYGCCLGQEVGYTIRFEDCTSPETVIKYMTDGMLLRECLIDPDLGQYAIIMLDEAHERTIHTDVLFGLLKKTVQKRTDMKLIVTSATLDAVKFSQYFYEAPIFTIPGRTYPVEVLYTKEPETDYLDASLITVMQIHLTEPPGDILVFLTGQEEIDTACEILYERMKSLGPDVPELIILPVYSALPSEMQTRIFDPAPPGSRKVVIATNIAETSLTIDGIYYVVDPGFVKQKVYNSKTGIDQLVVTPISQAQAKQRAGRAGRTGPGKCYRLYTERAYRDEMLTTNVPEIQRTNLASTVLSLKAMGINDLLSFDFMDAPPMETLITAMEQLYTLGALDDEGLLTRLGRRMAEFPLEPMLCKMLIMSVHLGCSEEMLTIVSMLSVQNVFYRPKDKQALADQKKAKFHQPEGDHLTLLAVYNSWKNNKFSNPWCYENFIQARSLRRAQDIRKQMLGIMDRHKLDVVSCGKATVRVQKAICSGFFRNAAKKDPQEGYRTLIDQQVVYIHPSSALFNRQPEWVVYHELVLTTKEYMREVTTIDPRWLVEF 1166          
BLAST of ATP-dependent RNA helicase DHX8 vs. Ensembl Zebrafish
Match: dhx8 (DEAH (Asp-Glu-Ala-His) box polypeptide 8 [Source:ZFIN;Acc:ZDB-GENE-050809-39])

HSP 1 Score: 461.07 bits (1185), Expect = 1.692e-147
Identity = 262/640 (40.94%), Postives = 393/640 (61.41%), Query Frame = 2
Query:  146 LPIYEYKDQIVELIRNNQIVIIQGQTGCGKTTQIPQFVLEANLNNGNMIGITQSRRIAAVSMAKRVAQEKQCNLGSEVGYEIRFDKKCSASTKIKYMTDGILLNECVTDANLKDYGVVMIDEAHERXXXXXXXXXXXXXVCKSRENLKIIITSATICAEKFSQFFDDSKILTIEGRLFPVEIIYEGYI-MDLIDYSAKLVRRIHIGNEPG----------------------------DILVFLTGEEDIERCCKLL--------RNVGNLIVTPLYGAIDFQEQQEVFRTMDCGDRKVVVATNIAETSITIDGIRYVIDCGYMKQNKFDSRRGIETLESIKISKAQAEQRKGRSGRTGPGWCYRLYSEGSYND-FIQEAVPEIKRKDLSEIYLRIIEFNLNP-KDFNFIDXXXXXXXXXXXXXXXDLKIITKEGKLTPSGQNMLGFPVEPRLGKVLMESLNNKCTNDIIKIMAMLSERFIFRKHHKGRGRGDPLK-EFSDHDGDHFTLLNIYNDWISHKQNKQWCISSSIDYNSMQNAYNIFIQLCKILKKNHSFKETVGEKNA-IKKSLISGFFKNICVKTNRGAYTRLYGREVMYIHPQSSLFHSSPKIILFNEVRKTTKTFMHGVLRLDEEIIREF 1942
            LPIY+ K+Q+++ + +NQI+I+ G+TG GKTTQI Q++ EA       IG TQ RR+AA+S+AKRV++E  C LG EVGY IRF+   S  T IKYMTDG+LL EC+ D +L  Y ++M+DEAHER++ +D+L GLLK   + R ++K+I+TSAT+ A KFSQ+F ++ I TI GR +PVE++Y      D +D S   V +IH+   PG                            DILVFLTG+E+I+  C++L         +V  LI+ P+Y A+  + Q  +F     G RKVV+ATNIAETS+TIDGI YV+D G++KQ  ++S+ GI+ L    IS+AQA+QR GR+GRTGPG CYRLY+E +Y D  +   VPEI+R +L+   L +    +N    F+F+D PP E L  +  +L  L  +  EG LT  G+ M  FP+EP L K+L+ S++  C+ +++ I++MLS + +F +    +   D  K +F   +GDH TLL +YN W ++K +  WC  + I   S++ A +I  Q+  I+ ++     + G+    ++K++ SGFF+N   K  +  Y  L  ++V+YIHP S+LF+  P+ ++++E+  TTK +M  V  +D   + EF
Sbjct:  555 LPIYKLKEQLIQAVHDNQILIVIGETGSGKTTQITQYLAEAGYTTRGKIGCTQPRRVAAMSVAKRVSEEYGCCLGQEVGYTIRFEDCTSPETVIKYMTDGMLLRECLIDPDLGQYAIIMLDEAHERTIHTDVLFGLLKKTVQKRTDMKLIVTSATLDAVKFSQYFYEAPIFTIPGRTYPVEVLYTKEPETDYLDASLITVMQIHLTEPPGKLSNTILQNKIIKFEKQFQLIKIINCAGDILVFLTGQEEIDTACEILYERMKSLGPDVPELIILPVYSALPSEMQTRIFDPAPPGSRKVVIATNIAETSLTIDGIYYVVDPGFVKQKVYNSKTGIDQLVVTPISQAQAKQRAGRAGRTGPGKCYRLYTERAYRDEMLTTNVPEIQRTNLASTVLSLKAMGINDLLSFDFMDAPPMETLITAMEQLYTLGALDDEGLLTRLGRRMAEFPLEPMLCKMLIMSVHLGCSEEMLTIVSMLSVQNVFYRPKDKQALADQKKAKFHQPEGDHLTLLAVYNSWKNNKFSNPWCYENFIQARSLRRAQDIRKQMLGIMDRHKLDVVSCGKATVRVQKAICSGFFRNAAKKDPQEGYRTLIDQQVVYIHPSSALFNRQPEWVVYHELVLTTKEYMREVTTIDPRWLVEF 1194          
BLAST of ATP-dependent RNA helicase DHX8 vs. Ensembl Zebrafish
Match: dhx16 (DEAH (Asp-Glu-Ala-His) box polypeptide 16 [Source:ZFIN;Acc:ZDB-GENE-030131-8589])

HSP 1 Score: 436.417 bits (1121), Expect = 7.961e-140
Identity = 244/607 (40.20%), Postives = 373/607 (61.45%), Query Frame = 2
Query:  146 LPIYEYKDQIVELIRNNQIVIIQGQTGCGKTTQIPQFVLEANLNNGNM-IGITQSRRIAAVSMAKRVAQEKQCNLGSEVGYEIRFDKKCSASTKIKYMTDGILLNECVTDANLKDYGVVMIDEAHERXXXXXXXXXXXXXVCKSRENLKIIITSATICAEKFSQFFDDSKILTIEGRLFPVEIIY-EGYIMDLIDYSAKLVRRIHIGNEPGDILVFLTGEEDIERCCKLLR--------NVGNLIVTPLYGAIDFQEQQEVFRTMDCGDRKVVVATNIAETSITIDGIRYVIDCGYMKQNKFDSRRGIETLESIKISKAQAEQRKGRSGRTGPGWCYRLYSEGSYNDFIQE-AVPEIKRKDLSEIYLRIIEFNLNPK-DFNFIDXXXXXXXXXXXXXXXDLKIITKEGKLTPSGQNMLGFPVEPRLGKVLMESLNNKCTNDIIKIMAMLS--ERFIFRKHHKGRGRGDPLKEFSDHDGDHFTLLNIYNDWISHKQNKQWCISSSIDYNSMQNAYNIFIQLCKILKK-NHSFKETVGEKNAIKKSLISGFFKNICVKTNRGAYTRLYGREVMYIHPQSSLFHSSPKIILFNEVRKTTKTFMHGVLRLD 1921
            LPI+ Y++ ++  I ++QI++I+G+TG GKTTQIPQ++LE     G M IG TQ RR+AA+S+A RVAQE    LG+EVGY IRF+   S  T +KYMTDG+LL E +T+ +L  Y V++IDEAHER+L +DIL GL+K + + R +LK+++ SAT+  E+FS FFDD+ +  I GR FPV+I Y +    D ++     V +IH+   PGD+LVFLTG+E+IE CC+LL+         +  L+V P+Y  +    Q ++F     G RKVVVATNIAETS+TIDGI YVID G+ KQ  ++++ G+E+L     S+A A QR GR+GR   G C+RLY+  ++   ++E  VPEI+R +L  + L +    +N    F+F+D PP E L  +  +L  L  +   G+LT  G+ M   PV+P L K+++ S   KC+ +++ I AMLS      +R   K     +    F    GDH  LLN+Y  W+    + QWC  + I + SM+ A ++  QL  ++ +       + G+   I+K++ +G+F +   + ++G Y  +  ++ +Y+HP SSLF   P+ ++++E+  TTK FM  V+ ++
Sbjct:  412 LPIFPYREDLLAAIGDHQILVIEGETGSGKTTQIPQYLLEEGYTKGGMKIGCTQPRRVAAMSVAARVAQEMSVKLGNEVGYSIRFEDCTSERTILKYMTDGMLLREFLTEPDLASYSVIIIDEAHERTLHTDILFGLIKDIARFRPDLKVLVASATLDTERFSSFFDDAPVFRIPGRRFPVDIYYTKAPEADYLEACVVSVLQIHVTQSPGDVLVFLTGQEEIEACCELLQERCRRLGSKISELLVLPIYANLPSDMQAKIFNPTPPGARKVVVATNIAETSLTIDGIIYVIDPGFCKQKSYNAKTGMESLIVTPCSRASANQRAGRAGRVAAGKCFRLYTAWAFKHEMEETTVPEIQRTNLGNVVLLLKSLGINDLIHFDFMDPPPHETLVLALEQLYALGALNHLGELTKLGRRMAELPVDPMLSKMILASEQYKCSEEVLTIAAMLSVNNSIFYRPKDKVVHADNARMNFVVPGGDHLVLLNVYTQWVESGYSTQWCFENFIQFRSMKRARDVRDQLEGLMDRIEVELCSSNGDSMPIRKAVTAGYFYHTA-RLSKGGYKTVKHQQTVYVHPNSSLFEEQPRWMIYHELVFTTKEFMRQVIEIE 1017          
BLAST of ATP-dependent RNA helicase DHX8 vs. Ensembl Zebrafish
Match: dhx16 (DEAH (Asp-Glu-Ala-His) box polypeptide 16 [Source:ZFIN;Acc:ZDB-GENE-030131-8589])

HSP 1 Score: 436.417 bits (1121), Expect = 7.961e-140
Identity = 244/607 (40.20%), Postives = 373/607 (61.45%), Query Frame = 2
Query:  146 LPIYEYKDQIVELIRNNQIVIIQGQTGCGKTTQIPQFVLEANLNNGNM-IGITQSRRIAAVSMAKRVAQEKQCNLGSEVGYEIRFDKKCSASTKIKYMTDGILLNECVTDANLKDYGVVMIDEAHERXXXXXXXXXXXXXVCKSRENLKIIITSATICAEKFSQFFDDSKILTIEGRLFPVEIIY-EGYIMDLIDYSAKLVRRIHIGNEPGDILVFLTGEEDIERCCKLLR--------NVGNLIVTPLYGAIDFQEQQEVFRTMDCGDRKVVVATNIAETSITIDGIRYVIDCGYMKQNKFDSRRGIETLESIKISKAQAEQRKGRSGRTGPGWCYRLYSEGSYNDFIQE-AVPEIKRKDLSEIYLRIIEFNLNPK-DFNFIDXXXXXXXXXXXXXXXDLKIITKEGKLTPSGQNMLGFPVEPRLGKVLMESLNNKCTNDIIKIMAMLS--ERFIFRKHHKGRGRGDPLKEFSDHDGDHFTLLNIYNDWISHKQNKQWCISSSIDYNSMQNAYNIFIQLCKILKK-NHSFKETVGEKNAIKKSLISGFFKNICVKTNRGAYTRLYGREVMYIHPQSSLFHSSPKIILFNEVRKTTKTFMHGVLRLD 1921
            LPI+ Y++ ++  I ++QI++I+G+TG GKTTQIPQ++LE     G M IG TQ RR+AA+S+A RVAQE    LG+EVGY IRF+   S  T +KYMTDG+LL E +T+ +L  Y V++IDEAHER+L +DIL GL+K + + R +LK+++ SAT+  E+FS FFDD+ +  I GR FPV+I Y +    D ++     V +IH+   PGD+LVFLTG+E+IE CC+LL+         +  L+V P+Y  +    Q ++F     G RKVVVATNIAETS+TIDGI YVID G+ KQ  ++++ G+E+L     S+A A QR GR+GR   G C+RLY+  ++   ++E  VPEI+R +L  + L +    +N    F+F+D PP E L  +  +L  L  +   G+LT  G+ M   PV+P L K+++ S   KC+ +++ I AMLS      +R   K     +    F    GDH  LLN+Y  W+    + QWC  + I + SM+ A ++  QL  ++ +       + G+   I+K++ +G+F +   + ++G Y  +  ++ +Y+HP SSLF   P+ ++++E+  TTK FM  V+ ++
Sbjct:  412 LPIFPYREDLLAAIGDHQILVIEGETGSGKTTQIPQYLLEEGYTKGGMKIGCTQPRRVAAMSVAARVAQEMSVKLGNEVGYSIRFEDCTSERTILKYMTDGMLLREFLTEPDLASYSVIIIDEAHERTLHTDILFGLIKDIARFRPDLKVLVASATLDTERFSSFFDDAPVFRIPGRRFPVDIYYTKAPEADYLEACVVSVLQIHVTQSPGDVLVFLTGQEEIEACCELLQERCRRLGSKISELLVLPIYANLPSDMQAKIFNPTPPGARKVVVATNIAETSLTIDGIIYVIDPGFCKQKSYNAKTGMESLIVTPCSRASANQRAGRAGRVAAGKCFRLYTAWAFKHEMEETTVPEIQRTNLGNVVLLLKSLGINDLIHFDFMDPPPHETLVLALEQLYALGALNHLGELTKLGRRMAELPVDPMLSKMILASEQYKCSEEVLTIAAMLSVNNSIFYRPKDKVVHADNARMNFVVPGGDHLVLLNVYTQWVESGYSTQWCFENFIQFRSMKRARDVRDQLEGLMDRIEVELCSSNGDSMPIRKAVTAGYFYHTA-RLSKGGYKTVKHQQTVYVHPNSSLFEEQPRWMIYHELVFTTKEFMRQVIEIE 1017          
BLAST of ATP-dependent RNA helicase DHX8 vs. Ensembl Xenopus
Match: rps15a (ribosomal protein S15a [Source:Xenbase;Acc:XB-GENE-981311])

HSP 1 Score: 479.174 bits (1232), Expect = 1.233e-160
Identity = 265/628 (42.20%), Postives = 399/628 (63.54%), Query Frame = 2
Query:  146 LPIYEYKDQIVELIRNNQIVIIQGQTGCGKTTQIPQFVLEANLNNGNMIGITQSRRIAAVSMAKRVAQEKQCNLGSEVGYEIRFDKKCSASTKIKYMTDGILLNECVTDANLKDYGVVMIDEAHERXXXXXXXXXXXXXVCKSRENLKIIITSATICAEKFSQFFDDSKILTIEGRLFPVEIIYEGYI-MDLIDYSAKLVRRIHIGNEPGDILVFLTGEEDIERCCKLL--------RNVGNLIVTPLYGAIDFQEQQEVFRTMDCGDRKVVVATNIAETSITIDGIRYVIDCGYMKQNKFDSRRGIETLESIKISKAQAEQRKGRSGRTGPGWCYRLYSEGSYND-FIQEAVPEIKRKDLSEIYLRIIEFNLNP-KDFNFIDXXXXXXXXXXXXXXXDLKIITKEGKLTPSGQNMLGFPVEPRLGKVLMESLNNKCTNDIIKIMAMLSERFIFRKHHKGRGRGDPLK-EFSDHDGDHFTLLNIYNDWISHKQNKQWCISSSIDYNSMQNAYNIFIQLCKILKKNHSFKETVGEKNA-IKKSLISGFFKNICVKTNRGAYTRLYGREVMYIHPQSSLFHSSPKIILFNEVRKTTKTFMHGVLRLDEEIIREFPEELKIINYPDNIDSL 1990
            LPIY+ K+Q+V+ + +NQI+I+ G+TG GKTTQI Q++ EA       IG TQ RR+AA+S+AKRV++E  C LG EVGY IRF+   S  T IKYMTDG+LL EC+ D +L  Y ++M+DEAHER++ +D+L GLLK   + R ++K+I+TSAT+ A KFSQ+F ++ I TI GR +PVEI+Y      D +D S   V +IH+   PGDILVFLTG+E+I+  C++L         +V  LI+ P+Y A+  + Q  +F     G RKVV+ATNIAETS+TIDGI YV+D G++KQ  ++S+ GI+ L    IS+AQA+QR GR+GRTGPG CYRLY+E +Y D  +   VPEI+R +L+   L +    +N    F+F+D PP E L  +  +L  L  +  EG LT  G+ M  FP+EP L K+L+ S++  C+ +++ I++MLS + +F +    +   D  K +F   +GDH TLL +YN W ++K +  WC  + I   S++ A +I  Q+  I+ ++     + G+    ++K++ SGFF+N   K  +  Y  L  ++V+YIHP S+LF+  P+ ++++E+  TTK +M  V  +D   + EF      ++ P  + ++
Sbjct:   41 LPIYKLKEQLVQAVHDNQILIVIGETGSGKTTQITQYLAEAGYTTRGKIGCTQPRRVAAMSVAKRVSEEYGCCLGQEVGYTIRFEDCTSPETVIKYMTDGMLLRECLIDPDLTQYAIIMLDEAHERTIHTDVLFGLLKKTVQKRPDMKLIVTSATLDAVKFSQYFYEAPIFTIPGRTYPVEILYTKEPETDYLDASLITVMQIHLTEPPGDILVFLTGQEEIDTACEILYERMKSLGPDVPELIILPVYSALPSEMQTRIFDPAPPGSRKVVIATNIAETSLTIDGIYYVVDPGFVKQKVYNSKTGIDQLVVTPISQAQAKQRAGRAGRTGPGKCYRLYTERAYRDEMLTTNVPEIQRTNLASTVLSLKAMGINDLLSFDFMDAPPMETLITAMEQLYTLGALDDEGLLTRLGRRMAEFPLEPMLCKMLIMSVHLGCSEEMLTIVSMLSVQNVFYRPKDKQALADQKKAKFHQTEGDHLTLLAVYNSWKNNKFSNPWCYENFIQARSLRRAQDIRKQMLGIMDRHKLDVVSCGKATVRVQKAICSGFFRNAAKKDPQEGYRTLIDQQVVYIHPSSALFNRQPEWVVYHELVLTTKEYMREVTTIDPRWLVEFAPAFFKVSDPTKLKTM 668          
BLAST of ATP-dependent RNA helicase DHX8 vs. Ensembl Xenopus
Match: rps15a (ribosomal protein S15a [Source:Xenbase;Acc:XB-GENE-981311])

HSP 1 Score: 476.093 bits (1224), Expect = 1.939e-159
Identity = 266/624 (42.63%), Postives = 396/624 (63.46%), Query Frame = 2
Query:  146 LPIYEYKDQIVELIRNNQIVIIQGQTGCGKTTQIPQFVLEANLNNGNMIGITQSRRIAAVSMAKRVAQEKQCNLGSEVGYEIRFDKKCSASTKIKYMTDGILLNECVTDANLKDYGVVMIDEAHERXXXXXXXXXXXXXVCKSRENLKIIITSATICAEKFSQFFDDSKILTIEGRLFPVEIIYEGYI-MDLIDYSAKLVRRIHIGNEPGDILVFLTGEEDIERCCKLL--------RNVGNLIVTPLYGAIDFQEQQEVFRTMDCGDRKVVVATNIAETSITIDGIRYVIDCGYMKQNKFDSRRGIETLESIKISKAQAEQRKGRSGRTGPGWCYRLYSEGSYND-FIQEAVPEIKRKDLSEIYLRIIEFNLNP-KDFNFIDXXXXXXXXXXXXXXXDLKIITKEGKLTPSGQNMLGFPVEPRLGKVLMESLNNKCTNDIIKIMAMLSERFIFRKHHKGRGRGDPLK-EFSDHDGDHFTLLNIYNDWISHKQNKQWCISSSIDYNSMQNAYNIFIQLCKILKKNHSFKETVGEKNA-IKKSLISGFFKNICVKTNRGAYTRLYGREVMYIHPQSSLFHSSPKIILFNEVRKTTKTFMHGVLRLDEEIIREFPEELKIINYPDN 1978
            LPIY+ K+Q+V+ + +NQI+I+ G+TG GKTTQI Q++ EA       IG TQ RR+AA+S+AKRV++E  C LG EVGY IRF+   S  T IKYMTDG+LL EC+ D +L  Y ++M+DEAHER++ +D+L GLLK   + R ++K+I+TSAT+ A KFSQ+F ++ I TI GR +PVEI+Y      D +D S   V +IH+   PGDILVFLTG+E+I+  C++L         +V  LI+ P+Y A+  + Q  +F     G RKVV+ATNIAETS+TIDGI YV+D G++KQ  ++S+ GI+ L    IS+AQA+QR GR+GRTGPG CYRLY+E +Y D  +   VPEI+R +L+   L +    +N    F+F+D PP E L  +  +L  L  +  EG LT  G+ M  FP+EP L K+L+ S++  C+ +++ I++MLS + +F +    +   D  K +F   +GDH TLL +YN W ++K +  WC  + I   S++ A +I  Q+   L ++     + G+    ++K++ SGFF+N   K  +  Y  L  ++V+YIHP S+LF+  P+ ++++E+  TTK +M  V  +D   + EF      ++ P N
Sbjct:   41 LPIYKLKEQLVQAVHDNQILIVIGETGSGKTTQITQYLAEAGYTTRGKIGCTQPRRVAAMSVAKRVSEEYGCCLGQEVGYTIRFEDCTSPETVIKYMTDGMLLRECLIDPDLTQYAIIMLDEAHERTIHTDVLFGLLKKTVQKRPDMKLIVTSATLDAVKFSQYFYEAPIFTIPGRTYPVEILYTKEPETDYLDASLITVMQIHLTEPPGDILVFLTGQEEIDTACEILYERMKSLGPDVPELIILPVYSALPSEMQTRIFDPAPPGSRKVVIATNIAETSLTIDGIYYVVDPGFVKQKVYNSKTGIDQLVVTPISQAQAKQRAGRAGRTGPGKCYRLYTERAYRDEMLTTNVPEIQRTNLASTVLSLKAMGINDLLSFDFMDAPPMETLITAMEQLYTLGALDDEGLLTRLGRRMAEFPLEPMLCKMLIMSVHLGCSEEMLTIVSMLSVQNVFYRPKDKQALADQKKAKFHQTEGDHLTLLAVYNSWKNNKFSNPWCYENFIQARSLRRAQDIRKQILFHLCRHKLDVVSCGKATVRVQKAICSGFFRNAAKKDPQEGYRTLIDQQVVYIHPSSALFNRQPEWVVYHELVLTTKEYMREVTTIDPRWLVEFAPAFFKVSDPTN 664          
BLAST of ATP-dependent RNA helicase DHX8 vs. Ensembl Xenopus
Match: rps15a (ribosomal protein S15a [Source:Xenbase;Acc:XB-GENE-981311])

HSP 1 Score: 475.707 bits (1223), Expect = 4.938e-159
Identity = 268/624 (42.95%), Postives = 395/624 (63.30%), Query Frame = 2
Query:  146 LPIYEYKDQIVELIRNNQIVIIQGQTGCGKTTQIPQFVLEANLNNGNMIGITQSRRIAAVSMAKRVAQEKQCNLGSEVGYEIRFDKKCSASTKIKYMTDGILLNECVTDANLKDYGVVMIDEAHERXXXXXXXXXXXXXVCKSRENLKIIITSATICAEKFSQFFDDSKILTIEGRLFPVEIIYEGYI-MDLIDYSAKLVRRIHIGNEPGDILVFLTGEEDIERCCKLL--------RNVGNLIVTPLYGAIDFQEQQEVFRTMDCGDRKVVVATNIAETSITIDGIRYVIDCGYMKQNKFDSRRGIETLESIKISKAQAEQRKGRSGRTGPGWCYRLYSEGSYND-FIQEAVPEIKRKDLSEIYLRIIEFNLNP-KDFNFIDXXXXXXXXXXXXXXXDLKIITKEGKLTPSGQNMLGFPVEPRLGKVLMESLNNKCTNDIIKIMAMLSERFIFRKHHKGRGRGDPLK-EFSDHDGDHFTLLNIYNDWISHKQNKQWCISSSIDYNSMQNAYNIFIQLCKILKKNHSFKETVGEKNAIKKSLISGFFKNICVKTNRGAYTRLYGREVMYIHPQSSLFHSSPKIILFNEVRKTTKTFMHGVLRLDEEIIREFPEELKIINYPDNI 1981
            LPIY+ K+Q+V+ + +NQI+I+ G+TG GKTTQI Q++ EA       IG TQ RR+AA+S+AKRV++E  C LG EVGY IRF+   S  T IKYMTDG+LL EC+ D +L  Y ++M+DEAHER++ +D+L GLLK   + R ++K+I+TSAT+ A KFSQ+F ++ I TI GR +PVEI+Y      D +D S   V +IH+   PGDILVFLTG+E+I+  C++L         +V  LI+ P+Y A+  + Q  +F     G RKVV+ATNIAETS+TIDGI YV+D G++KQ  ++S+ GI+ L    IS+AQA+QR GR+GRTGPG CYRLY+E +Y D  +   VPEI+R +L+   L +    +N    F+F+D PP E L  +  +L  L  +  EG LT  G+ M  FP+EP L K+L+ S++  C+ +++ I++MLS + +F +    +   D  K +F   +GDH TLL +YN W ++K +  WC  + I   S++ A +I  Q+ K L      K TV     ++K++ SGFF+N   K  +  Y  L  ++V+YIHP S+LF+  P+ ++++E+  TTK +M  V  +D   + EF      ++ P  +
Sbjct:   41 LPIYKLKEQLVQAVHDNQILIVIGETGSGKTTQITQYLAEAGYTTRGKIGCTQPRRVAAMSVAKRVSEEYGCCLGQEVGYTIRFEDCTSPETVIKYMTDGMLLRECLIDPDLTQYAIIMLDEAHERTIHTDVLFGLLKKTVQKRPDMKLIVTSATLDAVKFSQYFYEAPIFTIPGRTYPVEILYTKEPETDYLDASLITVMQIHLTEPPGDILVFLTGQEEIDTACEILYERMKSLGPDVPELIILPVYSALPSEMQTRIFDPAPPGSRKVVIATNIAETSLTIDGIYYVVDPGFVKQKVYNSKTGIDQLVVTPISQAQAKQRAGRAGRTGPGKCYRLYTERAYRDEMLTTNVPEIQRTNLASTVLSLKAMGINDLLSFDFMDAPPMETLITAMEQLYTLGALDDEGLLTRLGRRMAEFPLEPMLCKMLIMSVHLGCSEEMLTIVSMLSVQNVFYRPKDKQALADQKKAKFHQTEGDHLTLLAVYNSWKNNKFSNPWCYENFIQARSLRRAQDIRKQMHK-LDVVSCGKATV----RVQKAICSGFFRNAAKKDPQEGYRTLIDQQVVYIHPSSALFNRQPEWVVYHELVLTTKEYMREVTTIDPRWLVEFAPAFFKVSDPTKL 659          
BLAST of ATP-dependent RNA helicase DHX8 vs. Ensembl Xenopus
Match: rps15a (ribosomal protein S15a [Source:Xenbase;Acc:XB-GENE-981311])

HSP 1 Score: 475.707 bits (1223), Expect = 8.406e-159
Identity = 264/611 (43.21%), Postives = 392/611 (64.16%), Query Frame = 2
Query:  146 LPIYEYKDQIVELIRNNQIVIIQGQTGCGKTTQIPQFVLEANLNNGNMIGITQSRRIAAVSMAKRVAQEKQCNLGSEVGYEIRFDKKCSASTKIKYMTDGILLNECVTDANLKDYGVVMIDEAHERXXXXXXXXXXXXXVCKSRENLKIIITSATICAEKFSQFFDDSKILTIEGRLFPVEIIYEGYI-MDLIDYSAKLVRRIHIGNEPGDILVFLTGEEDIERCCKLL--------RNVGNLIVTPLYGAIDFQEQQEVFRTMDCGDRKVVVATNIAETSITIDGIRYVIDCGYMKQNKFDSRRGIETLESIKISKAQAEQRKGRSGRTGPGWCYRLYSEGSYND-FIQEAVPEIKRKDLSEIYLRIIEFNLNP-KDFNFIDXXXXXXXXXXXXXXXDLKIITKEGKLTPSGQNMLGFPVEPRLGKVLMESLNNKCTNDIIKIMAMLSERFIFRKHHKGRGRGDPLKEFSDHDGDHFTLLNIYNDWISHKQNKQWCISSSIDYNSMQNAYNIFIQLCKILKKNHSFKETVGEKNA-IKKSLISGFFKNICVKTNRGAYTRLYGREVMYIHPQSSLFHSSPKIILFNEVRKTTKTFMHGVLRLDEEIIREF 1942
            LPIY+ K+Q+V+ + +NQI+I+ G+TG GKTTQI Q++ EA       IG TQ RR+AA+S+AKRV++E  C LG EVGY IRF+   S  T IKYMTDG+LL EC+ D +L  Y ++M+DEAHER++ +D+L GLLK   + R ++K+I+TSAT+ A KFSQ+F ++ I TI GR +PVEI+Y      D +D S   V +IH+   PGDILVFLTG+E+I+  C++L         +V  LI+ P+Y A+  + Q  +F     G RKVV+ATNIAETS+TIDGI YV+D G++KQ  ++S+ GI+ L    IS+AQA+QR GR+GRTGPG CYRLY+E +Y D  +   VPEI+R +L+   L +    +N    F+F+D PP E L  +  +L  L  +  EG LT  G+ M  FP+EP L K+L+ S++  C+ +++ I++MLS + +F +  K R       +F   +GDH TLL +YN W ++K +  WC  + I   S++ A +I  Q+  I+ ++     + G+    ++K++ SGFF+N   K  +  Y  L  ++V+YIHP S+LF+  P+ ++++E+  TTK +M  V  +D   + EF
Sbjct:   41 LPIYKLKEQLVQAVHDNQILIVIGETGSGKTTQITQYLAEAGYTTRGKIGCTQPRRVAAMSVAKRVSEEYGCCLGQEVGYTIRFEDCTSPETVIKYMTDGMLLRECLIDPDLTQYAIIMLDEAHERTIHTDVLFGLLKKTVQKRPDMKLIVTSATLDAVKFSQYFYEAPIFTIPGRTYPVEILYTKEPETDYLDASLITVMQIHLTEPPGDILVFLTGQEEIDTACEILYERMKSLGPDVPELIILPVYSALPSEMQTRIFDPAPPGSRKVVIATNIAETSLTIDGIYYVVDPGFVKQKVYNSKTGIDQLVVTPISQAQAKQRAGRAGRTGPGKCYRLYTERAYRDEMLTTNVPEIQRTNLASTVLSLKAMGINDLLSFDFMDAPPMETLITAMEQLYTLGALDDEGLLTRLGRRMAEFPLEPMLCKMLIMSVHLGCSEEMLTIVSMLSVQNVFYR-PKVRIPDQKKAKFHQTEGDHLTLLAVYNSWKNNKFSNPWCYENFIQARSLRRAQDIRKQMLGIMDRHKLDVVSCGKATVRVQKAICSGFFRNAAKKDPQEGYRTLIDQQVVYIHPSSALFNRQPEWVVYHELVLTTKEYMREVTTIDPRWLVEF 650          
BLAST of ATP-dependent RNA helicase DHX8 vs. Ensembl Xenopus
Match: rps15a (ribosomal protein S15a [Source:Xenbase;Acc:XB-GENE-981311])

HSP 1 Score: 474.167 bits (1219), Expect = 1.904e-158
Identity = 267/611 (43.70%), Postives = 391/611 (63.99%), Query Frame = 2
Query:  146 LPIYEYKDQIVELIRNNQIVIIQGQTGCGKTTQIPQFVLEANLNNGNMIGITQSRRIAAVSMAKRVAQEKQCNLGSEVGYEIRFDKKCSASTKIKYMTDGILLNECVTDANLKDYGVVMIDEAHERXXXXXXXXXXXXXVCKSRENLKIIITSATICAEKFSQFFDDSKILTIEGRLFPVEIIYEGYI-MDLIDYSAKLVRRIHIGNEPGDILVFLTGEEDIERCCKLL--------RNVGNLIVTPLYGAIDFQEQQEVFRTMDCGDRKVVVATNIAETSITIDGIRYVIDCGYMKQNKFDSRRGIETLESIKISKAQAEQRKGRSGRTGPGWCYRLYSEGSYND-FIQEAVPEIKRKDLSEIYLRIIEFNLNP-KDFNFIDXXXXXXXXXXXXXXXDLKIITKEGKLTPSGQNMLGFPVEPRLGKVLMESLNNKCTNDIIKIMAMLSERFIFRKHHKGRGRGDPLK-EFSDHDGDHFTLLNIYNDWISHKQNKQWCISSSIDYNSMQNAYNIFIQLCKILKKNHSFKETVGEKNAIKKSLISGFFKNICVKTNRGAYTRLYGREVMYIHPQSSLFHSSPKIILFNEVRKTTKTFMHGVLRLDEEIIREF 1942
            LPIY+ K+Q+V+ + +NQI+I+ G+TG GKTTQI Q++ EA       IG TQ RR+AA+S+AKRV++E  C LG EVGY IRF+   S  T IKYMTDG+LL EC+ D +L  Y ++M+DEAHER++ +D+L GLLK   + R ++K+I+TSAT+ A KFSQ+F ++ I TI GR +PVEI+Y      D +D S   V +IH+   PGDILVFLTG+E+I+  C++L         +V  LI+ P+Y A+  + Q  +F     G RKVV+ATNIAETS+TIDGI YV+D G++KQ  ++S+ GI+ L    IS+AQA+QR GR+GRTGPG CYRLY+E +Y D  +   VPEI+R +L+   L +    +N    F+F+D PP E L  +  +L  L  +  EG LT  G+ M  FP+EP L K+L+ S++  C+ +++ I++MLS + +F +    +   D  K +F   +GDH TLL +YN W ++K +  WC  + I   S++ A +I  Q+ K L      K TV     ++K++ SGFF+N   K  +  Y  L  ++V+YIHP S+LF+  P+ ++++E+  TTK +M  V  +D   + EF
Sbjct:   41 LPIYKLKEQLVQAVHDNQILIVIGETGSGKTTQITQYLAEAGYTTRGKIGCTQPRRVAAMSVAKRVSEEYGCCLGQEVGYTIRFEDCTSPETVIKYMTDGMLLRECLIDPDLTQYAIIMLDEAHERTIHTDVLFGLLKKTVQKRPDMKLIVTSATLDAVKFSQYFYEAPIFTIPGRTYPVEILYTKEPETDYLDASLITVMQIHLTEPPGDILVFLTGQEEIDTACEILYERMKSLGPDVPELIILPVYSALPSEMQTRIFDPAPPGSRKVVIATNIAETSLTIDGIYYVVDPGFVKQKVYNSKTGIDQLVVTPISQAQAKQRAGRAGRTGPGKCYRLYTERAYRDEMLTTNVPEIQRTNLASTVLSLKAMGINDLLSFDFMDAPPMETLITAMEQLYTLGALDDEGLLTRLGRRMAEFPLEPMLCKMLIMSVHLGCSEEMLTIVSMLSVQNVFYRPKDKQALADQKKAKFHQTEGDHLTLLAVYNSWKNNKFSNPWCYENFIQARSLRRAQDIRKQMHK-LDVVSCGKATV----RVQKAICSGFFRNAAKKDPQEGYRTLIDQQVVYIHPSSALFNRQPEWVVYHELVLTTKEYMREVTTIDPRWLVEF 646          
BLAST of ATP-dependent RNA helicase DHX8 vs. Ensembl Mouse
Match: Dhx8 (DEAH (Asp-Glu-Ala-His) box polypeptide 8 [Source:MGI Symbol;Acc:MGI:1306823])

HSP 1 Score: 478.404 bits (1230), Expect = 9.974e-155
Identity = 264/612 (43.14%), Postives = 395/612 (64.54%), Query Frame = 2
Query:  146 LPIYEYKDQIVELIRNNQIVIIQGQTGCGKTTQIPQFVLEANLNNGNMIGITQSRRIAAVSMAKRVAQEKQCNLGSEVGYEIRFDKKCSASTKIKYMTDGILLNECVTDANLKDYGVVMIDEAHERXXXXXXXXXXXXXVCKSRENLKIIITSATICAEKFSQFFDDSKILTIEGRLFPVEIIYEGYI-MDLIDYSAKLVRRIHIGNEPGDILVFLTGEEDIERCCKLL--------RNVGNLIVTPLYGAIDFQEQQEVFRTMDCGDRKVVVATNIAETSITIDGIRYVIDCGYMKQNKFDSRRGIETLESIKISKAQAEQRKGRSGRTGPGWCYRLYSEGSYND-FIQEAVPEIKRKDLSEIYLRIIEFNLNP-KDFNFIDXXXXXXXXXXXXXXXDLKIITKEGKLTPSGQNMLGFPVEPRLGKVLMESLNNKCTNDIIKIMAMLSERFIFRKHHKGRGRGDPLK-EFSDHDGDHFTLLNIYNDWISHKQNKQWCISSSIDYNSMQNAYNIFIQLCKILKKNHSFKETVGEKNA-IKKSLISGFFKNICVKTNRGAYTRLYGREVMYIHPQSSLFHSSPKIILFNEVRKTTKTFMHGVLRLDEEIIREF 1942
            LPIY+ K+Q+V+ + +NQI+I+ G+TG GKTTQI Q++ EA   +   IG TQ RR+AA+S+AKRV++E  C LG EVGY IRF+   S  T IKYMTDG+LL EC+ D +L  Y ++M+DEAHER++ +D+L GLLK   + R+++K+I+TSAT+ A KFSQ+F ++ I TI GR +PVEI+Y      D +D S   V +IH+   PGDILVFLTG+E+I+  C++L         +V  LI+ P+Y A+  + Q  +F     G RKVV+ATNIAETS+TIDGI YV+D G++KQ  ++S+ GI+ L    IS+AQA+QR GR+GRTGPG CYRLY+E +Y D  +   VPEI+R +L+   L +    +N    F+F+D PP E L  +  +L  L  +  EG LT  G+ M  FP+EP L K+L+ S++  C+ +++ I++MLS + +F +    +   D  K +F   +GDH TLL +YN W ++K +  WC  + I   S++ A +I  Q+  I+ ++     + G+    ++K++ SGFF+N   K  +  Y  L  ++V+YIHP S+LF+  P+ ++++E+  TTK +M  V  +D   + EF
Sbjct:  536 LPIYKLKEQLVQAVHDNQILIVIGETGSGKTTQITQYLAEAGYTSRGKIGCTQPRRVAAMSVAKRVSEEFGCCLGQEVGYTIRFEDCTSPETVIKYMTDGMLLRECLIDPDLTQYAIIMLDEAHERTIHTDVLFGLLKKTVQKRQDMKLIVTSATLDAVKFSQYFYEAPIFTIPGRTYPVEILYTKEPETDYLDASLITVMQIHLTEPPGDILVFLTGQEEIDTACEILYERMKSLGPDVPELIILPVYSALPSEMQTRIFDPAPPGSRKVVIATNIAETSLTIDGIYYVVDPGFVKQKVYNSKTGIDQLVVTPISQAQAKQRAGRAGRTGPGKCYRLYTERAYRDEMLTTNVPEIQRTNLASTVLSLKAMGINDLLSFDFMDAPPMETLITAMEQLYTLGALDDEGLLTRLGRRMAEFPLEPMLCKMLIMSVHLGCSEEMLTIVSMLSVQNVFYRPKDKQALADQKKAKFHQTEGDHLTLLAVYNSWKNNKFSNPWCYENFIQARSLRRAQDIRKQMLGIMDRHKLDVVSCGKSTVRVQKAICSGFFRNAAKKDPQEGYRTLIDQQVVYIHPSSALFNRQPEWVVYHELVLTTKEYMREVTTIDPRWLVEF 1147          
BLAST of ATP-dependent RNA helicase DHX8 vs. Ensembl Mouse
Match: Dhx8 (DEAH (Asp-Glu-Ala-His) box polypeptide 8 [Source:MGI Symbol;Acc:MGI:1306823])

HSP 1 Score: 478.789 bits (1231), Expect = 3.363e-154
Identity = 264/612 (43.14%), Postives = 395/612 (64.54%), Query Frame = 2
Query:  146 LPIYEYKDQIVELIRNNQIVIIQGQTGCGKTTQIPQFVLEANLNNGNMIGITQSRRIAAVSMAKRVAQEKQCNLGSEVGYEIRFDKKCSASTKIKYMTDGILLNECVTDANLKDYGVVMIDEAHERXXXXXXXXXXXXXVCKSRENLKIIITSATICAEKFSQFFDDSKILTIEGRLFPVEIIYEGYI-MDLIDYSAKLVRRIHIGNEPGDILVFLTGEEDIERCCKLL--------RNVGNLIVTPLYGAIDFQEQQEVFRTMDCGDRKVVVATNIAETSITIDGIRYVIDCGYMKQNKFDSRRGIETLESIKISKAQAEQRKGRSGRTGPGWCYRLYSEGSYND-FIQEAVPEIKRKDLSEIYLRIIEFNLNP-KDFNFIDXXXXXXXXXXXXXXXDLKIITKEGKLTPSGQNMLGFPVEPRLGKVLMESLNNKCTNDIIKIMAMLSERFIFRKHHKGRGRGDPLK-EFSDHDGDHFTLLNIYNDWISHKQNKQWCISSSIDYNSMQNAYNIFIQLCKILKKNHSFKETVGEKNA-IKKSLISGFFKNICVKTNRGAYTRLYGREVMYIHPQSSLFHSSPKIILFNEVRKTTKTFMHGVLRLDEEIIREF 1942
            LPIY+ K+Q+V+ + +NQI+I+ G+TG GKTTQI Q++ EA   +   IG TQ RR+AA+S+AKRV++E  C LG EVGY IRF+   S  T IKYMTDG+LL EC+ D +L  Y ++M+DEAHER++ +D+L GLLK   + R+++K+I+TSAT+ A KFSQ+F ++ I TI GR +PVEI+Y      D +D S   V +IH+   PGDILVFLTG+E+I+  C++L         +V  LI+ P+Y A+  + Q  +F     G RKVV+ATNIAETS+TIDGI YV+D G++KQ  ++S+ GI+ L    IS+AQA+QR GR+GRTGPG CYRLY+E +Y D  +   VPEI+R +L+   L +    +N    F+F+D PP E L  +  +L  L  +  EG LT  G+ M  FP+EP L K+L+ S++  C+ +++ I++MLS + +F +    +   D  K +F   +GDH TLL +YN W ++K +  WC  + I   S++ A +I  Q+  I+ ++     + G+    ++K++ SGFF+N   K  +  Y  L  ++V+YIHP S+LF+  P+ ++++E+  TTK +M  V  +D   + EF
Sbjct:  589 LPIYKLKEQLVQAVHDNQILIVIGETGSGKTTQITQYLAEAGYTSRGKIGCTQPRRVAAMSVAKRVSEEFGCCLGQEVGYTIRFEDCTSPETVIKYMTDGMLLRECLIDPDLTQYAIIMLDEAHERTIHTDVLFGLLKKTVQKRQDMKLIVTSATLDAVKFSQYFYEAPIFTIPGRTYPVEILYTKEPETDYLDASLITVMQIHLTEPPGDILVFLTGQEEIDTACEILYERMKSLGPDVPELIILPVYSALPSEMQTRIFDPAPPGSRKVVIATNIAETSLTIDGIYYVVDPGFVKQKVYNSKTGIDQLVVTPISQAQAKQRAGRAGRTGPGKCYRLYTERAYRDEMLTTNVPEIQRTNLASTVLSLKAMGINDLLSFDFMDAPPMETLITAMEQLYTLGALDDEGLLTRLGRRMAEFPLEPMLCKMLIMSVHLGCSEEMLTIVSMLSVQNVFYRPKDKQALADQKKAKFHQTEGDHLTLLAVYNSWKNNKFSNPWCYENFIQARSLRRAQDIRKQMLGIMDRHKLDVVSCGKSTVRVQKAICSGFFRNAAKKDPQEGYRTLIDQQVVYIHPSSALFNRQPEWVVYHELVLTTKEYMREVTTIDPRWLVEF 1200          
BLAST of ATP-dependent RNA helicase DHX8 vs. Ensembl Mouse
Match: Dhx35 (DEAH (Asp-Glu-Ala-His) box polypeptide 35 [Source:MGI Symbol;Acc:MGI:1918965])

HSP 1 Score: 417.542 bits (1072), Expect = 1.960e-136
Identity = 245/631 (38.83%), Postives = 377/631 (59.75%), Query Frame = 2
Query:  140 NKLPIYEYKDQIVELIRNNQIVIIQGQTGCGKTTQIPQFVLEANLN-NGNMIGITQSRRIAAVSMAKRVAQEKQCNLGSEVGYEIRFDKKCS--ASTKIKYMTDGILLNECVTDANLKDYGVVMIDEAHERXXXXXXXXXXXXXVCKSRENLKIIITSATICAEKFSQFF----------DDSKILTIEGRLFPVEIIY-EGYIMDLIDYSAKLVRRIHIGNEPGDILVFLTGEEDIERCCKLL----RNVG------NLIVTPLYGAIDFQEQQEVFRTMDCGDRKVVVATNIAETSITIDGIRYVIDCGYMKQNKFDSRRGIETLESIKISKAQAEQRKGRSGRTGPGWCYRLYSEGSYNDFIQEAVPEIKRKDLSEIYLRIIEFNL-NPKDFNFIDXXXXXXXXXXXXXXXDLKIITKEGKLT-PSGQNMLGFPVEPRLGKVLMESLNNKCTNDIIKIMAMLSER--FIFRKHHKGRGRGDPLKEFSDHDGDHFTLLNIYNDWISHKQNKQWCISSSIDYNSMQNAYNIFIQLCKILKKNHSFK-ETVGEKNAIKKSLISGFFKNICVKTNRGAYTRLYGREVMYIHPQSSLF-HSSPKIILFNEVRKTTKTFMHGVLRLDEEIIREF 1942
             KLP+++ ++ I+ L+ N Q V+I G+TGCGK+TQIPQ++ EA     G ++G+TQ RR+AAV++A RVA E+   LG EVGY IRFD  C+   +T+IK++TDG+L+ E + D  L  Y V+M+DEAHER+L +DI +GLLK + K R +L++I+ SAT+ AEKF  FF          D S  LT+EGR FPV+I Y +  + D I  +   V +IH     GDIL FLTG+E++E    +L    R +       +L V P+Y  +   EQ +VF  +    RKV+VATN+AETSITI GI YVIDCG+MK   ++ R  IE L  + +S+A A QR GR GR   G CYRLY+E +++   Q  VPE++R +L+ + L++    + N   F+F+  PP + + ++   L  L  + K+ +LT P G  +  FP+ P   K+L+ES N  C+ +++ I AM+  +  F+F  + K +      ++F+  +GDH T+LN+Y  +I H ++ QWC    ++Y  +  A  +  QL K+L K    K  + G+ + + + ++SGFF N     + GAY  +     ++IHP S L+    P+ +++NEV +T+K +M  V  ++   + E 
Sbjct:   52 QKLPVFKLRNHILYLVENYQTVVIVGETGCGKSTQIPQYLAEAGWTAEGRVVGVTQPRRVAAVTVAGRVADERGAVLGHEVGYCIRFDD-CTDPLATRIKFLTDGMLVREMMVDPLLTKYSVIMLDEAHERTLYTDIAIGLLKKIQKKRGDLRLIVASATLDAEKFRDFFNQNETSDPARDTSVTLTVEGRTFPVDIFYLQSPVPDYIKATVDTVVKIHQTEGDGDILAFLTGQEEVETVVSMLIEQARALARTGMKKHLRVLPMYAGLPSFEQMKVFERVSHSVRKVIVATNVAETSITISGIVYVIDCGFMKLRAYNPRTAIECLVVVPVSQASANQRAGRGGRNRSGKCYRLYTEEAFDQLPQSTVPEMQRSNLAPVILQLKALGIDNVLRFHFMSPPPAQSMVQALELLYALGGLDKDCRLTEPLGMRIAEFPLNPMFAKMLLESGNFGCSQEVLSIAAMMQIQNVFVFPSNQKSQAT-RVHRKFAVEEGDHLTMLNVYEAFIKHNKSSQWCQEHFLNYKGLVRAATVRDQLKKLLVKFQVPKVSSEGDPDPVLRCIVSGFFANAARFHSSGAYRTIRDDHELHIHPASVLYAEKPPRWVIYNEVIQTSKYYMRDVTAIESAWLLEL 680          
BLAST of ATP-dependent RNA helicase DHX8 vs. Ensembl Mouse
Match: Dhx16 (DEAH (Asp-Glu-Ala-His) box polypeptide 16 [Source:MGI Symbol;Acc:MGI:1916442])

HSP 1 Score: 425.246 bits (1092), Expect = 1.028e-135
Identity = 242/613 (39.48%), Postives = 367/613 (59.87%), Query Frame = 2
Query:  146 LPIYEYKDQIVELIRNNQIVIIQGQTGCGKTTQIPQFVLEANLNNGNM-IGITQSRRIAAVSMAKRVAQEKQCNLGSEVGYEIRFDKKCSASTKIKYMTDGILLNECVTDANLKDYGVVMIDEAHERXXXXXXXXXXXXXVCKSRENLKIIITSATICAEKFSQFFDDSKILTIEGRLFPVEIIY-EGYIMDLIDYSAKLVRRIHIGNEPGDILVFLTGEEDIERCCKLL----RNVGN----LIVTPLYGAIDFQEQQEVFRTMDCGDRKVVVATNIAETSITIDGIRYVIDCGYMKQNKFDSRRGIETLESIKISKAQAEQRKGRSGRTGPGWCYRLYSEGSYNDFIQE-AVPEIKRKDLSEIYLRIIEFNLNP-KDFNFIDXXXXXXXXXXXXXXXDLKIITKEGKLTPSGQNMLGFPVEPRLGKVLMESLNNKCTNDIIKIMAMLS--ERFIFRKHHKGRGRGDPLKEFSDHDGDHFTLLNIYNDWISHKQNKQWCISSSIDYNSMQNAYNIFIQLCKILKKNH-SFKETVGEKNAIKKSLISGFFKNICVKTNRGAYTRLYGREVMYIHPQSSLFHSSPKIILFNEVRKTTKTFMHGVLRLDEEIIRE 1939
            LP++ ++++++  I N+Q++II+G+TG GKTTQIPQ++ E       M I  TQ RR+AA+S+A RVA+E    LG+EVGY IRF+   S  T ++YMTDG+LL E +++ +L  Y VVM+DEAHER+L +DIL GL+K V + R  LK+++ SAT+   +FS FFDD+ +  I GR FPV+I Y +    D ++     V +IH+   PGDILVFLTG+E+IE  C++L    R +G+    L+V P+Y  +    Q  +F+    G RKVVVATNIAETS+TI+GI YV+D G+ KQ  ++ R G+E+L     SKA A QR GR+GR   G C+RLY+  +Y   ++E  VPEI+R  L  + L +    ++    F+F+D PP E L  +  +L  L  +   G+LT SG+ M   PV+P L K+++ S    C+ +I+ + AMLS      +R   K     +    F    GDH  LLN+Y  W     + QWC  + + + SM+ A ++  QL  +L++         G+   ++K++ SG+F +   +  R  Y  +  ++ ++IHP SSLF   P+ +L++E+  TTK FM  VL ++   + E
Sbjct:  402 LPVFPFREELLAAIANHQVLIIEGETGSGKTTQIPQYLFEEGYTKKGMKIACTQPRRVAAMSVAARVAREMGVKLGNEVGYSIRFEDCTSERTVLRYMTDGMLLREFLSEPDLASYSVVMVDEAHERTLHTDILFGLIKDVARFRPELKVLVASATLDTARFSAFFDDAPVFRIPGRRFPVDIFYTKAPEADYLEACVVSVLQIHVTQPPGDILVFLTGQEEIEAACEMLQDRCRRLGSKIRELLVLPIYANLPSDMQARIFQPTPPGARKVVVATNIAETSLTIEGIIYVLDPGFCKQKSYNPRTGMESLTVTPCSKASANQRAGRAGRVAAGKCFRLYTAWAYQHELEETTVPEIQRTSLGNVVLLLKSLGIHDLMHFDFLDPPPYETLLLALEQLYALGALNHLGELTTSGRKMAELPVDPMLSKMILASEKYSCSEEILTVAAMLSVNNSIFYRPKDKVVHADNARVNFFLPGGDHLVLLNVYTQWAESGYSSQWCYENFVQFRSMRRARDVREQLEGLLERVEVGLTSCQGDYVRVRKAITSGYFYHTA-RLTRSGYRTVKQQQTVFIHPNSSLFEQQPRWLLYHELVLTTKEFMRQVLEIESSWLLE 1013          
BLAST of ATP-dependent RNA helicase DHX8 vs. Ensembl Mouse
Match: Dhx15 (DEAH (Asp-Glu-Ala-His) box polypeptide 15 [Source:MGI Symbol;Acc:MGI:1099786])

HSP 1 Score: 407.912 bits (1047), Expect = 1.161e-131
Identity = 244/638 (38.24%), Postives = 388/638 (60.82%), Query Frame = 2
Query:  143 KLPIYEYKDQIVELIRNNQIVIIQGQTGCGKTTQIPQFVLE---ANLNNGNMIGITQSRRIAAVSMAKRVAQEKQCNLGSEVGYEIRFDKKCSASTKIKYMTDGILLNECVTDANLKDYGVVMIDEAHERXXXXXXXXXXXXXVCKSRENLKIIITSATICAEKFSQFFDDSKILTIEGRLFPVEIIYEGYI-MDLIDYSAKLVRRIHI-GNEPGDILVFLTGEEDIERCCKLLR--------NVGNLIVTPLYGAIDFQEQQEVF------RTMDCGDRKVVVATNIAETSITIDGIRYVIDCGYMKQNKFDSRRGIETLESIKISKAQAEQRKGRSGRTGPGWCYRLYSEGSYNDFIQE-AVPEIKRKDLSEIYLRIIEFNLNP-KDFNFIDXXXXXXXXXXXXXXXDLKIITKEGKLTPSGQNMLGFPVEPRLGKVLMESLNNKCTNDIIKIMAMLSERFIFRKHHKGRGRGDPLK-EFSDHDGDHFTLLNIYNDWISHKQNKQWCISSSIDYNSMQNAYNIFIQLCKILKKNHSFKETVGEKNA-----IKKSLISGFFKNICVKTNRGAYTRLYGREVMYIHPQSSLFHSSPKIILFNEVRKTTKTFMHGVLRLDEE-IIREFPEELKIINYP 1972
            +LP++EYKD+  +++  +Q  ++ G+TG GKTTQIPQ+ +E   +       +  TQ RR+AA+S+A+RVA E    LG EVGY IRF+   SA T +KYMTDG+LL E + D  L+ YGV+++DEAHER+L++DIL+G+LK V + R +LK+I+ SAT+ A KF  +FD+  +LTI GR  PVEI Y      D ++ + + V +IH+   E GD+L+FLTG+E+I+  CK ++         VG++ + PLY  +  Q+QQ +F      +      RKVVV+TNIAETS+TIDG+ +VID G+ KQ  ++ R  +E+L    ISKA A+QR GR+GRT PG C+RLY+E +Y   +Q+   PEI R +L  + L++ +  ++    F+F+D P  E L R+   L  L  +  +G LT  G  M  FP++P+L K+++ S +  C+N+++ I AMLS    F +  + +   D  K  F+  DGDH TLLN+Y+ +  + ++ QWC  + I+Y S+ +A N+  QL +I+ + +  + +    +      I+K+L++G+F  +      G Y  +   +V+ +HP + L H  P+ +L+NE   TTK ++     +  E +++  P+   + N+P
Sbjct:  136 QLPVWEYKDRFTDILVRHQSFVLVGETGSGKTTQIPQWCVEYMRSLPGPKRGVACTQPRRVAAMSVAQRVADEMDVMLGQEVGYSIRFEDCSSAKTILKYMTDGMLLREAMNDPLLERYGVIILDEAHERTLATDILMGVLKEVVRQRSDLKVIVMSATLDAGKFQIYFDNCPLLTIPGRTHPVEIFYTPEPERDYLEAAIRTVIQIHMCEEEEGDLLLFLTGQEEIDEACKRIKREVDDLGPEVGDIKIIPLYSTLPPQQQQRIFEPPPPKKQNGAIGRKVVVSTNIAETSLTIDGVVFVIDPGFAKQKVYNPRIRVESLLVTAISKASAQQRAGRAGRTRPGKCFRLYTEKAYKTEMQDNTYPEILRSNLGSVVLQLKKLGIDDLVHFDFMDPPAPETLMRALELLNYLAALNDDGDLTELGSMMAEFPLDPQLAKMVIASCDYNCSNEVLSITAMLSVPQCFVRPTEAKKAADEAKMRFAHIDGDHLTLLNVYHAFKQNHESVQWCYDNFINYRSLMSADNVRQQLSRIMDRFNLPRRSTDFTSRDYYINIRKALVTGYFMQVAHLERTGHYLTVKDNQVVQLHPSTVLDH-KPEWVLYNEFVLTTKNYIRTCTDIKPEWLVKIAPQYYDMSNFP 772          
BLAST of ATP-dependent RNA helicase DHX8 vs. UniProt/SwissProt
Match: sp|Q14562|DHX8_HUMAN (ATP-dependent RNA helicase DHX8 OS=Homo sapiens OX=9606 GN=DHX8 PE=1 SV=1)

HSP 1 Score: 478.789 bits (1231), Expect = 1.376e-153
Identity = 264/612 (43.14%), Postives = 395/612 (64.54%), Query Frame = 2
Query:  146 LPIYEYKDQIVELIRNNQIVIIQGQTGCGKTTQIPQFVLEANLNNGNMIGITQSRRIAAVSMAKRVAQEKQCNLGSEVGYEIRFDKKCSASTKIKYMTDGILLNECVTDANLKDYGVVMIDEAHERXXXXXXXXXXXXXVCKSRENLKIIITSATICAEKFSQFFDDSKILTIEGRLFPVEIIYEGYI-MDLIDYSAKLVRRIHIGNEPGDILVFLTGEEDIERCCKLL--------RNVGNLIVTPLYGAIDFQEQQEVFRTMDCGDRKVVVATNIAETSITIDGIRYVIDCGYMKQNKFDSRRGIETLESIKISKAQAEQRKGRSGRTGPGWCYRLYSEGSYND-FIQEAVPEIKRKDLSEIYLRIIEFNLNP-KDFNFIDXXXXXXXXXXXXXXXDLKIITKEGKLTPSGQNMLGFPVEPRLGKVLMESLNNKCTNDIIKIMAMLSERFIFRKHHKGRGRGDPLK-EFSDHDGDHFTLLNIYNDWISHKQNKQWCISSSIDYNSMQNAYNIFIQLCKILKKNHSFKETVGEKNA-IKKSLISGFFKNICVKTNRGAYTRLYGREVMYIHPQSSLFHSSPKIILFNEVRKTTKTFMHGVLRLDEEIIREF 1942
            LPIY+ K+Q+V+ + +NQI+I+ G+TG GKTTQI Q++ EA   +   IG TQ RR+AA+S+AKRV++E  C LG EVGY IRF+   S  T IKYMTDG+LL EC+ D +L  Y ++M+DEAHER++ +D+L GLLK   + R+++K+I+TSAT+ A KFSQ+F ++ I TI GR +PVEI+Y      D +D S   V +IH+   PGDILVFLTG+E+I+  C++L         +V  LI+ P+Y A+  + Q  +F     G RKVV+ATNIAETS+TIDGI YV+D G++KQ  ++S+ GI+ L    IS+AQA+QR GR+GRTGPG CYRLY+E +Y D  +   VPEI+R +L+   L +    +N    F+F+D PP E L  +  +L  L  +  EG LT  G+ M  FP+EP L K+L+ S++  C+ +++ I++MLS + +F +    +   D  K +F   +GDH TLL +YN W ++K +  WC  + I   S++ A +I  Q+  I+ ++     + G+    ++K++ SGFF+N   K  +  Y  L  ++V+YIHP S+LF+  P+ ++++E+  TTK +M  V  +D   + EF
Sbjct:  565 LPIYKLKEQLVQAVHDNQILIVIGETGSGKTTQITQYLAEAGYTSRGKIGCTQPRRVAAMSVAKRVSEEFGCCLGQEVGYTIRFEDCTSPETVIKYMTDGMLLRECLIDPDLTQYAIIMLDEAHERTIHTDVLFGLLKKTVQKRQDMKLIVTSATLDAVKFSQYFYEAPIFTIPGRTYPVEILYTKEPETDYLDASLITVMQIHLTEPPGDILVFLTGQEEIDTACEILYERMKSLGPDVPELIILPVYSALPSEMQTRIFDPAPPGSRKVVIATNIAETSLTIDGIYYVVDPGFVKQKVYNSKTGIDQLVVTPISQAQAKQRAGRAGRTGPGKCYRLYTERAYRDEMLTTNVPEIQRTNLASTVLSLKAMGINDLLSFDFMDAPPMETLITAMEQLYTLGALDDEGLLTRLGRRMAEFPLEPMLCKMLIMSVHLGCSEEMLTIVSMLSVQNVFYRPKDKQALADQKKAKFHQTEGDHLTLLAVYNSWKNNKFSNPWCYENFIQARSLRRAQDIRKQMLGIMDRHKLDVVSCGKSTVRVQKAICSGFFRNAAKKDPQEGYRTLIDQQVVYIHPSSALFNRQPEWVVYHELVLTTKEYMREVTTIDPRWLVEF 1176          
BLAST of ATP-dependent RNA helicase DHX8 vs. UniProt/SwissProt
Match: sp|A2A4P0|DHX8_MOUSE (ATP-dependent RNA helicase DHX8 OS=Mus musculus OX=10090 GN=Dhx8 PE=2 SV=1)

HSP 1 Score: 478.789 bits (1231), Expect = 2.353e-153
Identity = 264/612 (43.14%), Postives = 395/612 (64.54%), Query Frame = 2
Query:  146 LPIYEYKDQIVELIRNNQIVIIQGQTGCGKTTQIPQFVLEANLNNGNMIGITQSRRIAAVSMAKRVAQEKQCNLGSEVGYEIRFDKKCSASTKIKYMTDGILLNECVTDANLKDYGVVMIDEAHERXXXXXXXXXXXXXVCKSRENLKIIITSATICAEKFSQFFDDSKILTIEGRLFPVEIIYEGYI-MDLIDYSAKLVRRIHIGNEPGDILVFLTGEEDIERCCKLL--------RNVGNLIVTPLYGAIDFQEQQEVFRTMDCGDRKVVVATNIAETSITIDGIRYVIDCGYMKQNKFDSRRGIETLESIKISKAQAEQRKGRSGRTGPGWCYRLYSEGSYND-FIQEAVPEIKRKDLSEIYLRIIEFNLNP-KDFNFIDXXXXXXXXXXXXXXXDLKIITKEGKLTPSGQNMLGFPVEPRLGKVLMESLNNKCTNDIIKIMAMLSERFIFRKHHKGRGRGDPLK-EFSDHDGDHFTLLNIYNDWISHKQNKQWCISSSIDYNSMQNAYNIFIQLCKILKKNHSFKETVGEKNA-IKKSLISGFFKNICVKTNRGAYTRLYGREVMYIHPQSSLFHSSPKIILFNEVRKTTKTFMHGVLRLDEEIIREF 1942
            LPIY+ K+Q+V+ + +NQI+I+ G+TG GKTTQI Q++ EA   +   IG TQ RR+AA+S+AKRV++E  C LG EVGY IRF+   S  T IKYMTDG+LL EC+ D +L  Y ++M+DEAHER++ +D+L GLLK   + R+++K+I+TSAT+ A KFSQ+F ++ I TI GR +PVEI+Y      D +D S   V +IH+   PGDILVFLTG+E+I+  C++L         +V  LI+ P+Y A+  + Q  +F     G RKVV+ATNIAETS+TIDGI YV+D G++KQ  ++S+ GI+ L    IS+AQA+QR GR+GRTGPG CYRLY+E +Y D  +   VPEI+R +L+   L +    +N    F+F+D PP E L  +  +L  L  +  EG LT  G+ M  FP+EP L K+L+ S++  C+ +++ I++MLS + +F +    +   D  K +F   +GDH TLL +YN W ++K +  WC  + I   S++ A +I  Q+  I+ ++     + G+    ++K++ SGFF+N   K  +  Y  L  ++V+YIHP S+LF+  P+ ++++E+  TTK +M  V  +D   + EF
Sbjct:  589 LPIYKLKEQLVQAVHDNQILIVIGETGSGKTTQITQYLAEAGYTSRGKIGCTQPRRVAAMSVAKRVSEEFGCCLGQEVGYTIRFEDCTSPETVIKYMTDGMLLRECLIDPDLTQYAIIMLDEAHERTIHTDVLFGLLKKTVQKRQDMKLIVTSATLDAVKFSQYFYEAPIFTIPGRTYPVEILYTKEPETDYLDASLITVMQIHLTEPPGDILVFLTGQEEIDTACEILYERMKSLGPDVPELIILPVYSALPSEMQTRIFDPAPPGSRKVVIATNIAETSLTIDGIYYVVDPGFVKQKVYNSKTGIDQLVVTPISQAQAKQRAGRAGRTGPGKCYRLYTERAYRDEMLTTNVPEIQRTNLASTVLSLKAMGINDLLSFDFMDAPPMETLITAMEQLYTLGALDDEGLLTRLGRRMAEFPLEPMLCKMLIMSVHLGCSEEMLTIVSMLSVQNVFYRPKDKQALADQKKAKFHQTEGDHLTLLAVYNSWKNNKFSNPWCYENFIQARSLRRAQDIRKQMLGIMDRHKLDVVSCGKSTVRVQKAICSGFFRNAAKKDPQEGYRTLIDQQVVYIHPSSALFNRQPEWVVYHELVLTTKEYMREVTTIDPRWLVEF 1200          
BLAST of ATP-dependent RNA helicase DHX8 vs. UniProt/SwissProt
Match: sp|A1Z9L3|DHX8_DROME (ATP-dependent RNA helicase DHX8 OS=Drosophila melanogaster OX=7227 GN=pea PE=1 SV=1)

HSP 1 Score: 474.937 bits (1221), Expect = 6.305e-152
Identity = 262/613 (42.74%), Postives = 393/613 (64.11%), Query Frame = 2
Query:  146 LPIYEYKDQIVELIRNNQIVIIQGQTGCGKTTQIPQFVLEANLNNGNMIGITQSRRIAAVSMAKRVAQEKQCNLGSEVGYEIRFDKKCSASTKIKYMTDGILLNECVTDANLKDYGVVMIDEAHERXXXXXXXXXXXXXVCKSRENLKIIITSATICAEKFSQFFDDSKILTIEGRLFPVEIIYEGYI-MDLIDYSAKLVRRIHIGNEPGDILVFLTGEEDIERCCKLL--------RNVGNLIVTPLYGAIDFQEQQEVFRTMDCGDRKVVVATNIAETSITIDGIRYVIDCGYMKQNKFDSRRGIETLESIKISKAQAEQRKGRSGRTGPGWCYRLYSEGSYND-FIQEAVPEIKRKDLSEIYLRIIEFNLNP-KDFNFIDXXXXXXXXXXXXXXXDLKIITKEGKLTPSGQNMLGFPVEPRLGKVLMESLNNKCTNDIIKIMAMLSERFIFRKHHKGRGRGDPLK-EFSDHDGDHFTLLNIYNDWISHKQNKQWCISSSIDYNSMQNAYNIFIQLCKILKKNHSFKETVGEKNA--IKKSLISGFFKNICVKTNRGAYTRLYGREVMYIHPQSSLFHSSPKIILFNEVRKTTKTFMHGVLRLDEEIIREF 1942
            LPIY+ +D +++ + +NQI+I+ G+TG GKTTQI Q++ E        IG TQ RR+AA+S+AKRVA+E  C LG EVGY IRF+   S  T IKYMTDG+LL EC+ +A LK Y V+M+DEAHER++ +D+L GLLK   + R  LK+I+TSAT+ A KFSQ+F  + I TI GR FPVE++Y      D +D S   V +IH+   PGDIL+FLTG+E+I+  C++L         +V  LI+ P+Y A+  + Q  +F     G RKVV+ATNIAETS+TIDGI YV+D G++KQ  ++S+ G+++L    IS+A A+QR GR+GRTGPG  YRLY+E +Y D  +   VPEI+R +L+   L++    +N    F+F+D PP E L  +  +L  L  +  EG LT  G+ M  FP+EP L K+L+ S+  +C+++I+ I++MLS + +F +    +   D  K +F+  +GDH TLL +YN W ++K +  WC  + +   +++ + ++  QL  I+ + H        KN+  I+K++ SGFF+N   K  +  Y  L   +V+YIHP S+LF+  P+ ++++E+ +TTK +M  V  +D + + EF
Sbjct:  586 LPIYKLRDDLIKAVTDNQILIVIGETGSGKTTQITQYLGECGFTARGKIGCTQPRRVAAMSVAKRVAEEYGCRLGQEVGYTIRFEDCTSPETIIKYMTDGMLLRECLMEAELKSYSVIMLDEAHERTIHTDVLFGLLKTAVQKRPELKLIVTSATLDAVKFSQYFFKAPIFTIPGRTFPVEVLYTKEPETDYLDASLITVMQIHLREPPGDILLFLTGQEEIDTACEILYERMKSLGPDVPELIILPVYSALPSEMQTRIFDPAPAGSRKVVIATNIAETSLTIDGIFYVVDPGFVKQKVYNSKTGMDSLVVTPISQAAAKQRAGRAGRTGPGKTYRLYTERAYRDEMLPTPVPEIQRTNLATTVLQLKTMGINDLLHFDFMDAPPVESLVMALEQLHSLSALDDEGLLTRLGRRMAEFPLEPNLSKMLIMSVALQCSDEILTIVSMLSVQNVFYRPKDKQALADQKKAKFNQAEGDHLTLLAVYNSWKNNKFSNAWCYENFVQIRTLKRSQDVRKQLLGIMDR-HKLDVVSAGKNSVRIQKAICSGFFRNAAKKDPQEGYRTLVDSQVVYIHPSSALFNRQPEWVIYHELVQTTKEYMREVTTIDPKWLVEF 1197          
BLAST of ATP-dependent RNA helicase DHX8 vs. UniProt/SwissProt
Match: sp|Q09530|MOG5_CAEEL (Probable pre-mRNA-splicing factor ATP-dependent RNA helicase mog-5 OS=Caenorhabditis elegans OX=6239 GN=mog-5 PE=1 SV=1)

HSP 1 Score: 469.159 bits (1206), Expect = 4.835e-150
Identity = 257/619 (41.52%), Postives = 394/619 (63.65%), Query Frame = 2
Query:  146 LPIYEYKDQIVELIRNNQIVIIQGQTGCGKTTQIPQFVLEANLNNGNMIGITQSRRIAAVSMAKRVAQEKQCNLGSEVGYEIRFDKKCSASTKIKYMTDGILLNECVTDANLKDYGVVMIDEAHERXXXXXXXXXXXXXVCKSRENLKIIITSATICAEKFSQFFDDSKILTIEGRLFPVEIIYEGYI-MDLIDYSAKLVRRIHIGNEPGDILVFLTGEEDIERCCKLL--------RNVGNLIVTPLYGAIDFQEQQEVFRTMDCGDRKVVVATNIAETSITIDGIRYVIDCGYMKQNKFDSRRGIETLESIKISKAQAEQRKGRSGRTGPGWCYRLYSEGSYND-FIQEAVPEIKRKDLSEIYLRIIEFNLNPK-DFNFIDXXXXXXXXXXXXXXXDLKIITKEGKLTPSGQNMLGFPVEPRLGKVLMESLNNKCTNDIIKIMAMLSERFIFRKHHKGRGRGDPLK-EFSDHDGDHFTLLNIYNDWISHKQNKQWCISSSIDYNSMQNAYNIFIQLCKILKKNHSFKETVG-EKNAIKKSLISGFFKNICVKTNRGAYTRLYGREVMYIHPQSSLFHSSPKIILFNEVRKTTKTFMHGVLRLDEEIIREF-PEELKI 1960
            LPI+  K  ++E + +NQI+++ G+TG GKTTQ+ Q+ +EA L     IG TQ RR+AA+S+AKRVA+E  C LG++VGY IRF+   S  T IKYMTDG+LL EC+ D +L  Y ++M+DEAHER++ +D+L GLLK   + R  LK+IITSAT+ + KFS++F ++ I TI GR FPVEI+Y      D ++ +   V +IH+   PGD+LVFLTG+E+I+  C++L         +V  LI+ P+YGA+  + Q  +F     G RKVV+ATNIAETS+TIDGI YV+D G++KQ  ++ + G+++L    IS+A A+QR GR+GRTGPG CYRLY+E ++ D  +   VPEI+R +L+   L++    +N   DF+F+D PP + +  +   L  L  +  +G LT  G+ M  FP+EP L K+L+ S++  C+ +++ I+AML+ + IF +  + +   D  K +F   +GDH TLL +YN W +H  ++ WC  + I   SM+ A +I  QL  I+ ++     + G + + ++K++ SGFF+N   +  +  Y  L   + +YIHP S+ F   P+ ++++E+  TTK +M  V  +D + + EF P   KI
Sbjct:  540 LPIFALKKNLMEAMIDNQILVVVGETGSGKTTQMTQYAIEAGLGRRGKIGCTQPRRVAAMSVAKRVAEEYGCKLGTDVGYTIRFEDCTSQDTIIKYMTDGMLLRECLIDPDLSGYSLIMLDEAHERTIHTDVLFGLLKAAARKRPELKLIITSATLDSVKFSEYFLEAPIFTIPGRTFPVEILYTREPESDYLEAAHITVMQIHLTEPPGDVLVFLTGQEEIDTSCEVLYERMKSMGPDVPELIILPVYGALPSEMQTRIFDPAPAGKRKVVIATNIAETSLTIDGIFYVVDPGFVKQKIYNPKSGMDSLVVTPISQAAAKQRSGRAGRTGPGKCYRLYTERAFRDEMLPTPVPEIQRTNLASTLLQLKAMGINNLIDFDFMDAPPLDSMITALNTLHTLSALDGDGLLTKLGRRMAEFPLEPSLSKLLIMSVDLGCSEEVLTIVAMLNVQNIFYRPKEKQDHADQKKAKFHQPEGDHLTLLAVYNSWKNHHFSQPWCFENFIQVRSMKRAQDIRKQLLGIMDRHKLLMVSCGRDVSRVQKAICSGFFRNAAKRDPQEGYRTLTDGQNVYIHPSSACFQQQPEWVVYHELVMTTKEYMREVTAIDPKWLVEFAPSFFKI 1158          
BLAST of ATP-dependent RNA helicase DHX8 vs. UniProt/SwissProt
Match: sp|Q54F05|DHX8_DICDI (ATP-dependent RNA helicase dhx8 OS=Dictyostelium discoideum OX=44689 GN=dhx8 PE=3 SV=1)

HSP 1 Score: 457.603 bits (1176), Expect = 5.620e-146
Identity = 254/630 (40.32%), Postives = 394/630 (62.54%), Query Frame = 2
Query:  146 LPIYEYKDQIVELIRNNQIVIIQGQTGCGKTTQIPQFVLEANLNNGNMIGITQSRRIAAVSMAKRVAQEKQCNLGSEVGYEIRFDKKCSASTKIKYMTDGILLNECVTDANLKDYGVVMIDEAHERXXXXXXXXXXXXXVCKSRENLKIIITSATICAEKFSQFFDDSKILTIEGRLFPVEIIY-EGYIMDLIDYSAKLVRRIHIGNEPGDILVFLTGEEDIERCCKLL--------RNVGNLIVTPLYGAIDFQEQQEVFRTMDCGDRKVVVATNIAETSITIDGIRYVIDCGYMKQNKFDSRRGIETLESIKISKAQAEQRKGRSGRTGPGWCYRLYSEGSY-NDFIQEAVPEIKRKDLSEIYLRIIEFNLNP-KDFNFIDXXXXXXXXXXXXXXXDLKIITKEGKLTPSGQNMLGFPVEPRLGKVLMESLNNKCTNDIIKIMAMLSERFIFRKHHKGRGRGDPLK-EFSDHDGDHFTLLNIYNDWISHKQNKQWCISSSIDYNSMQNAYNIFIQLCKILKKNHSFKETVGEK-NAIKKSLISGFFKNICVKTNRGAYTRLYGREVMYIHPQSSLFHSSPKIILFNEVRKTTKTFMHGVLRLDEEIIREFPEELKIINYPDNIDSLTR 1996
            LPI+  ++  ++ +  +Q++++ G+TG GKTTQ+ Q++ EA       IG TQ RR+AA+S++KRVA+E  C LG EVGY IRF+   S  T IK+MTDGILL EC+ D NL  Y V+++DEAHER++S+D+L GLLK   + R  LK++ITSAT+ AEKFS++F ++++  I GR FPV+I Y +    D +D S   V +IH+   PGDIL+FLTG+E+I+  C++L         NV +LI+ P+Y A+  + Q ++F     G RKVV+ATNIAETS+TIDGI YVID G+ KQ  F+ + G+++L    IS+A A QR GR+GRTGPG CYRLY+E ++ N+ +  ++PEI+R +L    L +    +N   +F+F+D PP + L  +  +L  L  + +EG LT  G+ M  FP++P+L K+L+ S++  C+++I+ ++AMLS + +F +  + +   D  K +F   +GDH TLLN+Y  W + K +  WC  + +   S++ A ++  QL  I+ +      + G     I+K++ SGFF N   K     Y  L   + +YIHP S+LF+ +P  ++++E+  TTK +M  V  +D + + E   +    + P+ I    R
Sbjct:  508 LPIFPLREAFLQAVSEHQLLVVIGETGSGKTTQMAQYLAEAGYGTRGKIGCTQPRRVAAMSVSKRVAEEFGCQLGQEVGYAIRFEDCTSPETIIKFMTDGILLRECLLDPNLSAYSVIILDEAHERTISTDVLFGLLKQALQRRPELKVLITSATLEAEKFSKYFMNAQLFIIPGRTFPVDIRYTKDPEADYLDASLITVMQIHLSEPPGDILLFLTGQEEIDAACQILYERMKSLGSNVPDLIILPVYSALPSEMQTKIFEPAPPGSRKVVIATNIAETSLTIDGIYYVIDPGFSKQKCFNPKNGMDSLVVAPISQAAARQRSGRAGRTGPGKCYRLYTESAFKNEMLASSIPEIQRTNLGNTVLTMKAMGINDLLNFDFMDPPPVQTLVSAMEQLYSLGALDEEGLLTRLGRKMAEFPLDPQLSKMLIASVDLGCSDEILTVVAMLSVQNVFYRPKEKQALADQKKAKFFQPEGDHLTLLNVYESWKNSKFSNPWCFENFVQARSLRRAQDVRKQLITIMDRYKLDIISAGRNYTKIQKAICSGFFANASKKDPNEGYKTLVEGQPVYIHPSSTLFNRNPDWVIYHELVMTTKEYMREVCTIDPKWLVELAPKFFKTSDPNKISKRKR 1137          
BLAST of ATP-dependent RNA helicase DHX8 vs. TrEMBL
Match: A0A4Y2HUD2 (ATP-dependent RNA helicase DHX8 OS=Araneus ventricosus OX=182803 GN=DHX8_0 PE=4 SV=1)

HSP 1 Score: 490.73 bits (1262), Expect = 1.485e-161
Identity = 268/612 (43.79%), Postives = 397/612 (64.87%), Query Frame = 2
Query:  146 LPIYEYKDQIVELIRNNQIVIIQGQTGCGKTTQIPQFVLEANLNNGNMIGITQSRRIAAVSMAKRVAQEKQCNLGSEVGYEIRFDKKCSASTKIKYMTDGILLNECVTDANLKDYGVVMIDEAHERXXXXXXXXXXXXXVCKSRENLKIIITSATICAEKFSQFFDDSKILTIEGRLFPVEIIYEGYIM-DLIDYSAKLVRRIHIGNEPGDILVFLTGEEDIERCCKLL--------RNVGNLIVTPLYGAIDFQEQQEVFRTMDCGDRKVVVATNIAETSITIDGIRYVIDCGYMKQNKFDSRRGIETLESIKISKAQAEQRKGRSGRTGPGWCYRLYSEGSYND-FIQEAVPEIKRKDLSEIYLRIIEFNLNP-KDFNFIDXXXXXXXXXXXXXXXDLKIITKEGKLTPSGQNMLGFPVEPRLGKVLMESLNNKCTNDIIKIMAMLSERFIFRKHHKGRGRGDPLK-EFSDHDGDHFTLLNIYNDWISHKQNKQWCISSSIDYNSMQNAYNIFIQLCKILKKNHSFKETVGEKNA-IKKSLISGFFKNICVKTNRGAYTRLYGREVMYIHPQSSLFHSSPKIILFNEVRKTTKTFMHGVLRLDEEIIREF 1942
            LPIY+ KD +++ + +NQI+I+ G+TG GKTTQ+ Q++ EA       IG TQ RR+AA+S+AKRVA+E  C LG EVGY IRF+   S  T IKYMTDG+LL EC+ D +LK Y VVM+DEAHER++ +D+L GLLK   K R  LK+I+TSAT+ A KFSQ+F ++ I TI GR +PVEI+Y      D +D S   V +IH+   PGDIL+FLTG+E+I+  C++L          V  LI+ P+Y A+  + Q  +F     G RKVV+ATNIAETS+TIDGI YV+D G++KQN ++S+ G+++L    IS+AQA+QR GR+GRTGPG CYRLY+E SY D  +   VPEI+R +L+   L++    +N    F+F+D PP E L  +  +L  L  +  EG LT  G+ M  FP+EP L K+L+ S++  C+ +I+ I++MLS + +F +    +   D  K +F+  +GDH TLL +YN W ++K +  WC  + +   +++ A ++  QL  I+ ++     + G+  A ++K++ SGFF+N   K  +  Y  L   +V+YIHP S+LF+  P+ ++++E+ +TTK +M  V  +D + + EF
Sbjct:   41 LPIYKLKDDLIKAVTDNQILIVIGETGSGKTTQMTQYLAEAGFTARGKIGCTQPRRVAAMSVAKRVAEEFGCRLGQEVGYTIRFEDCTSPETVIKYMTDGMLLRECLVDPDLKSYAVVMLDEAHERTIHTDVLFGLLKNAVKRRPELKLIVTSATLDAVKFSQYFFEAPIFTIPGRTYPVEILYTKEPENDYLDASLITVMQIHLTEPPGDILLFLTGQEEIDTACEILYERMKSLGPEVPELIILPVYSALPSEMQTRIFEPAPPGSRKVVIATNIAETSLTIDGIYYVVDPGFVKQNVYNSKTGMDSLVVTPISQAQAKQRAGRAGRTGPGKCYRLYTERSYRDEMLTTPVPEIQRTNLAHTVLQLKAMGINDLLSFDFMDAPPPESLIMALEQLHSLSALDDEGLLTRLGRRMAEFPMEPNLSKMLIMSVHLACSEEILTIVSMLSVQNVFYRPKDKQALADQKKAKFNQPEGDHLTLLAVYNSWKNNKFSNAWCYENFVQIRTLKRAQDVRKQLLGIMDRHKLDVVSCGKTTARVQKAICSGFFRNAAKKDPQEGYRTLVDGQVVYIHPSSALFNRQPEWVVYHELVQTTKEYMREVTTIDPKWMVEF 652          
BLAST of ATP-dependent RNA helicase DHX8 vs. TrEMBL
Match: H8X8V7 (Prp22 RNA-dependent ATPase OS=Candida orthopsilosis (strain 90-125) OX=1136231 GN=CORT_0F00260 PE=4 SV=1)

HSP 1 Score: 496.893 bits (1278), Expect = 1.422e-160
Identity = 274/627 (43.70%), Postives = 401/627 (63.96%), Query Frame = 2
Query:  146 LPIYEYKDQIVELIRNNQIVIIQGQTGCGKTTQIPQFVLEANLN--NG--NMIGITQSRRIAAVSMAKRVAQEKQCNLGSEVGYEIRFDKKCSASTKIKYMTDGILLNECVTDANLKDYGVVMIDEAHERXXXXXXXXXXXXXVCKSRENLKIIITSATICAEKFSQFFDDSKILTIEGRLFPVEIIYEGYI-MDLIDYSAKLVRRIHIGNEPGDILVFLTGEEDIERCCKLLRN--------VGNLIVTPLYGAIDFQEQQEVFRTMDCGDRKVVVATNIAETSITIDGIRYVIDCGYMKQNKFDSRRGIETLESIKISKAQAEQRKGRSGRTGPGWCYRLYSEGSY-NDFIQEAVPEIKRKDLSEIYLRIIEFNLNPKD---FNFIDXXXXXXXXXXXXXXXDLKIITKEGKLTPSGQNMLGFPVEPRLGKVLMESLNNKCTNDIIKIMAMLSERFIFRKHHKGRGRGDPLK-EFSDHDGDHFTLLNIYNDWISHKQNKQWCISSSIDYNSMQNAYNIFIQLCKILKKN-HSFKETVGEKNAIKKSLISGFFKNICVKTNRGAYTRLYGREVMYIHPQSSLFHSSPKIILFNEVRKTTKTFMHGVLRLDEEIIREF-PEELKIIN 1966
            LP+Y+ +  +++ IR+NQ ++I G+TG GKTTQI Q++ E  LN  NG   +IG TQ RR+AA S+AKRV++E  C+LG EVGY +RFD K +  TKIKYMTDG+L  E +TD  +  Y V+M+DEAHER++++D+L  LLK    +  NLKII+TSAT+ ++KFS FF++  IL I GR +PVE++Y     MD +  +   V +IHI    GDILVFLTG+E+I+  C++L             LI+ P+Y A+  + Q ++F     G RKV++ATNIAETSITIDGI YV+D GY+K N +DS+ G++TL+   ISKAQA QR GR+GRTGPG CYRLY+E SY N+ +   +PEI+R++LS   L +    +  KD   F F+D P +  +  S  +L  L+ +  +G+LTP G+ M  FP+EP L K L++S++  CT +I+ I+AMLS + IF +    +   D  K  F    GDH TLLN+YN W + K NK WC  + I   SM++A  +  QL  I+ K+ +S      + +A++K+L  G+FKN+  + +   Y  L   E +Y+HP SS F  +P+ +L++ +  T++ +MH V  +D E + EF P+  K+ +
Sbjct:  320 LPVYDMRGDLIQSIRDNQFIVIVGETGSGKTTQIVQYIYEEGLNVINGESKIIGCTQPRRVAATSVAKRVSEEVGCDLGDEVGYNVRFDDKTTLKTKIKYMTDGMLEREALTDPEMSKYAVIMLDEAHERTIATDVLFALLKKAALTNPNLKIIVTSATLDSDKFSVFFNECPILNIPGRTYPVEVLYTKEPEMDYLSAALDTVMQIHISEPSGDILVFLTGQEEIDTSCEVLAERVKVLGDVASELIILPVYSALPAEMQTKIFEPTPPGSRKVILATNIAETSITIDGIYYVVDPGYVKLNAYDSKSGMDTLKISPISKAQANQRSGRAGRTGPGKCYRLYTEQSYTNEMLPNTIPEIQRQNLSHTILMLKAIGI--KDVIQFEFMDPPSKNSMMTSLEDLYMLEALDDDGELTPLGRKMADFPMEPALAKTLIKSVDLNCTEEILTIVAMLSVQTIFHRPKDRQNLADQRKARFHSTKGDHLTLLNVYNRWCASKYNKDWCRDNFIQERSMRHAKEVRKQLQTIMTKHKYSVNSCGPDLDAVRKTLCCGYFKNVAKRDSGEGYKTLSKNETVYLHPSSSQFGKNPEYLLYHAIVMTSREYMHHVTVIDPEWLCEFAPKYFKLAD 944          
BLAST of ATP-dependent RNA helicase DHX8 vs. TrEMBL
Match: A0A1B6HVV1 (Uncharacterized protein (Fragment) OS=Homalodisca liturata OX=320908 GN=g.44546 PE=4 SV=1)

HSP 1 Score: 489.96 bits (1260), Expect = 2.511e-159
Identity = 265/613 (43.23%), Postives = 397/613 (64.76%), Query Frame = 2
Query:  146 LPIYEYKDQIVELIRNNQIVIIQGQTGCGKTTQIPQFVLEANLNNGNMIGITQSRRIAAVSMAKRVAQEKQCNLGSEVGYEIRFDKKCSASTKIKYMTDGILLNECVTDANLKDYGVVMIDEAHERXXXXXXXXXXXXXVCKSRENLKIIITSATICAEKFSQFFDDSKILTIEGRLFPVEIIYEGYI-MDLIDYSAKLVRRIHIGNEPGDILVFLTGEEDIERCCKLL--------RNVGNLIVTPLYGAIDFQEQQEVFRTMDCGDRKVVVATNIAETSITIDGIRYVIDCGYMKQNKFDSRRGIETLESIKISKAQAEQRKGRSGRTGPGWCYRLYSEGSYND-FIQEAVPEIKRKDLSEIYLRIIEFNLNP-KDFNFIDXXXXXXXXXXXXXXXDLKIITKEGKLTPSGQNMLGFPVEPRLGKVLMESLNNKCTNDIIKIMAMLSERFIFRKHHKGRGRGDPLK-EFSDHDGDHFTLLNIYNDWISHKQNKQWCISSSIDYNSMQNAYNIFIQLCKILKKNHSFKETVGEKNAIK--KSLISGFFKNICVKTNRGAYTRLYGREVMYIHPQSSLFHSSPKIILFNEVRKTTKTFMHGVLRLDEEIIREF 1942
            LPIY+ KD++ + + +NQI+I+ G+TG GKTTQI Q++ EA       IG TQ RR+AA+S+AKRVA+E  C LG EVGY IRF+   S  T IKYMTDG+LL EC+ D +LK Y V+M+DEAHER++ +D+L GLLK   K R  LK+I+TSAT+ A KFSQ+F ++ I TI GR FPVE++Y      D +D S   V +IH+   PGDIL+FLTG+E+I+  C++L         +V  LI+ P+Y A+  + Q  +F     G RKVV+ATNIAETS+TIDGI YV+D G++KQ  ++S+ G+++L    IS+AQA+QR GR+GRTGPG CYRLY+E +Y D  +   VPEI+R +L+   L++    +N    F+F+D PP E L  +  +L  L  +  EG LT  G+ M  FP+EP L K+L+ S++ +C+++++ +++MLS + +F +    +   D  K +F+  +GDH TLL +YN W ++K +  WC  + +   +++ A ++  QL  I+ + H        KN ++  K++ SGFF+N   K  +  Y  L   +V+YIHP S+LF+  P+ ++++E+ +TTK +M  V  +D + + EF
Sbjct:  197 LPIYKLKDELTKAVTDNQILIVIGETGSGKTTQITQYLAEAGFTARGKIGCTQPRRVAAMSVAKRVAEEFGCRLGQEVGYTIRFEDCTSPETVIKYMTDGMLLRECLVDLDLKSYSVIMLDEAHERTIHTDVLFGLLKQAVKKRAELKLIVTSATLDAVKFSQYFFEAPIFTIPGRTFPVEVLYTKEPETDYLDASLITVMQIHLREPPGDILLFLTGQEEIDTACEILYERMKSLGPDVPELIILPVYSALPSEMQTRIFEAAPPGSRKVVIATNIAETSLTIDGIYYVVDPGFVKQKVYNSKTGMDSLVVTPISQAQAKQRAGRAGRTGPGKCYRLYTERAYRDEMLPTPVPEIQRTNLATTVLQLKTMGINDLLHFDFMDAPPVESLIMALEQLHSLSALDNEGLLTRLGRRMAEFPLEPNLSKMLIMSVHLQCSDEVLTVVSMLSVQNVFYRPKDKQALADQKKAKFNQAEGDHLTLLAVYNSWKNNKFSNAWCYENFVQIRTLKRAQDVRKQLLGIMDR-HKLDVVSAGKNTVRVQKTVCSGFFRNAAKKDPQEGYRTLVDSQVVYIHPSSALFNRQPEWVIYHELVQTTKEYMREVTTIDPKWLVEF 808          
BLAST of ATP-dependent RNA helicase DHX8 vs. TrEMBL
Match: A0A1B6K1L5 (Uncharacterized protein (Fragment) OS=Homalodisca liturata OX=320908 GN=g.44542 PE=4 SV=1)

HSP 1 Score: 489.96 bits (1260), Expect = 2.875e-159
Identity = 265/613 (43.23%), Postives = 397/613 (64.76%), Query Frame = 2
Query:  146 LPIYEYKDQIVELIRNNQIVIIQGQTGCGKTTQIPQFVLEANLNNGNMIGITQSRRIAAVSMAKRVAQEKQCNLGSEVGYEIRFDKKCSASTKIKYMTDGILLNECVTDANLKDYGVVMIDEAHERXXXXXXXXXXXXXVCKSRENLKIIITSATICAEKFSQFFDDSKILTIEGRLFPVEIIYEGYI-MDLIDYSAKLVRRIHIGNEPGDILVFLTGEEDIERCCKLL--------RNVGNLIVTPLYGAIDFQEQQEVFRTMDCGDRKVVVATNIAETSITIDGIRYVIDCGYMKQNKFDSRRGIETLESIKISKAQAEQRKGRSGRTGPGWCYRLYSEGSYND-FIQEAVPEIKRKDLSEIYLRIIEFNLNP-KDFNFIDXXXXXXXXXXXXXXXDLKIITKEGKLTPSGQNMLGFPVEPRLGKVLMESLNNKCTNDIIKIMAMLSERFIFRKHHKGRGRGDPLK-EFSDHDGDHFTLLNIYNDWISHKQNKQWCISSSIDYNSMQNAYNIFIQLCKILKKNHSFKETVGEKNAIK--KSLISGFFKNICVKTNRGAYTRLYGREVMYIHPQSSLFHSSPKIILFNEVRKTTKTFMHGVLRLDEEIIREF 1942
            LPIY+ KD++ + + +NQI+I+ G+TG GKTTQI Q++ EA       IG TQ RR+AA+S+AKRVA+E  C LG EVGY IRF+   S  T IKYMTDG+LL EC+ D +LK Y V+M+DEAHER++ +D+L GLLK   K R  LK+I+TSAT+ A KFSQ+F ++ I TI GR FPVE++Y      D +D S   V +IH+   PGDIL+FLTG+E+I+  C++L         +V  LI+ P+Y A+  + Q  +F     G RKVV+ATNIAETS+TIDGI YV+D G++KQ  ++S+ G+++L    IS+AQA+QR GR+GRTGPG CYRLY+E +Y D  +   VPEI+R +L+   L++    +N    F+F+D PP E L  +  +L  L  +  EG LT  G+ M  FP+EP L K+L+ S++ +C+++++ +++MLS + +F +    +   D  K +F+  +GDH TLL +YN W ++K +  WC  + +   +++ A ++  QL  I+ + H        KN ++  K++ SGFF+N   K  +  Y  L   +V+YIHP S+LF+  P+ ++++E+ +TTK +M  V  +D + + EF
Sbjct:  198 LPIYKLKDELTKAVTDNQILIVIGETGSGKTTQITQYLAEAGFTARGKIGCTQPRRVAAMSVAKRVAEEFGCRLGQEVGYTIRFEDCTSPETVIKYMTDGMLLRECLVDLDLKSYSVIMLDEAHERTIHTDVLFGLLKQAVKKRAELKLIVTSATLDAVKFSQYFFEAPIFTIPGRTFPVEVLYTKEPETDYLDASLITVMQIHLREPPGDILLFLTGQEEIDTACEILYERMKSLGPDVPELIILPVYSALPSEMQTRIFEAAPPGSRKVVIATNIAETSLTIDGIYYVVDPGFVKQKVYNSKTGMDSLVVTPISQAQAKQRAGRAGRTGPGKCYRLYTERAYRDEMLPTPVPEIQRTNLATTVLQLKTMGINDLLHFDFMDAPPVESLIMALEQLHSLSALDNEGLLTRLGRRMAEFPLEPNLSKMLIMSVHLQCSDEVLTVVSMLSVQNVFYRPKDKQALADQKKAKFNQAEGDHLTLLAVYNSWKNNKFSNAWCYENFVQIRTLKRAQDVRKQLLGIMDR-HKLDVVSAGKNTVRVQKTVCSGFFRNAAKKDPQEGYRTLVDSQVVYIHPSSALFNRQPEWVIYHELVQTTKEYMREVTTIDPKWLVEF 809          
BLAST of ATP-dependent RNA helicase DHX8 vs. TrEMBL
Match: A0A1B6CNN0 (Uncharacterized protein OS=Clastoptera arizonana OX=38151 GN=g.13966 PE=4 SV=1)

HSP 1 Score: 488.804 bits (1257), Expect = 1.719e-158
Identity = 264/613 (43.07%), Postives = 398/613 (64.93%), Query Frame = 2
Query:  146 LPIYEYKDQIVELIRNNQIVIIQGQTGCGKTTQIPQFVLEANLNNGNMIGITQSRRIAAVSMAKRVAQEKQCNLGSEVGYEIRFDKKCSASTKIKYMTDGILLNECVTDANLKDYGVVMIDEAHERXXXXXXXXXXXXXVCKSRENLKIIITSATICAEKFSQFFDDSKILTIEGRLFPVEIIYEGYI-MDLIDYSAKLVRRIHIGNEPGDILVFLTGEEDIERCCKLL--------RNVGNLIVTPLYGAIDFQEQQEVFRTMDCGDRKVVVATNIAETSITIDGIRYVIDCGYMKQNKFDSRRGIETLESIKISKAQAEQRKGRSGRTGPGWCYRLYSEGSYND-FIQEAVPEIKRKDLSEIYLRIIEFNLNP-KDFNFIDXXXXXXXXXXXXXXXDLKIITKEGKLTPSGQNMLGFPVEPRLGKVLMESLNNKCTNDIIKIMAMLSERFIFRKHHKGRGRGDPLK-EFSDHDGDHFTLLNIYNDWISHKQNKQWCISSSIDYNSMQNAYNIFIQLCKILKKNHSFKETVGEKNAIK--KSLISGFFKNICVKTNRGAYTRLYGREVMYIHPQSSLFHSSPKIILFNEVRKTTKTFMHGVLRLDEEIIREF 1942
            LPIY+ KD++ + + +NQI+I+ G+TG GKTTQI Q++ E+   +   IG TQ RR+AA+S+AKRVA+E  C LG EVGY IRF+   S  T IKYMTDG+LL EC+ D +LK Y V+M+DEAHER++ +D+L GLLK   K R  LK+I+TSAT+ A KFSQ+F ++ I TI GR FPVE++Y      D +D S   V +IH+   PGDIL+FLTG+E+I+  C++L         +V  LI+ P+Y A+  + Q  +F     G RKVV+ATNIAETS+TIDGI YV+D G++KQ  ++S+ G+++L    IS+AQA+QR GR+GRTGPG CYRLY+E +Y D  +   VPEI+R +L+   L++    +N    F+F+D PP E L  +  +L  L  +  EG LT  G+ M  FP+EP L K+L+ S++ +C+++++ +++MLS + +F +    +   D  K +F+  +GDH TLL +YN W ++K +  WC  + +   +++ A ++  QL  I+ + H        KN ++  K++ SGFF+N   K  +  Y  L   +V+YIHP S+LF+  P+ ++++E+ +TTK +M  V  +D + + EF
Sbjct:  231 LPIYKLKDELTKAVTDNQILIVIGETGSGKTTQITQYLAESGFTSRGKIGCTQPRRVAAMSVAKRVAEEFGCRLGQEVGYTIRFEDCTSPETVIKYMTDGMLLRECLVDLDLKSYSVIMLDEAHERTIHTDVLFGLLKQAVKKRTELKLIVTSATLDAVKFSQYFFEAPIFTIPGRTFPVEVLYTKEPETDYLDASLITVMQIHLREPPGDILLFLTGQEEIDTACEILYERMKSLGPDVPELIILPVYSALPSEMQTRIFEAAPPGSRKVVIATNIAETSLTIDGIYYVVDPGFVKQKVYNSKTGMDSLVVTPISQAQAKQRAGRAGRTGPGKCYRLYTERAYRDEMLPTPVPEIQRTNLATTVLQLKTMGINDLLHFDFMDAPPVESLIMALEQLHSLSALDNEGLLTRLGRRMAEFPLEPNLSKMLIMSVHLQCSDEVLTVVSMLSVQNVFYRPKDKQALADQKKAKFNQAEGDHLTLLAVYNSWKNNKFSNAWCYENFVQIRTLKRAQDVRKQLLGIMDR-HKLDVVSAGKNTVRVQKTVCSGFFRNAAKKDPQEGYRTLVDSQVVYIHPSSALFNRQPEWVIYHELVQTTKEYMREVTTIDPKWLVEF 842          
BLAST of ATP-dependent RNA helicase DHX8 vs. Ensembl Cavefish
Match: dhx8 (DEAH-box helicase 8 [Source:NCBI gene;Acc:103035799])

HSP 1 Score: 475.707 bits (1223), Expect = 1.504e-153
Identity = 262/612 (42.81%), Postives = 393/612 (64.22%), Query Frame = 2
Query:  146 LPIYEYKDQIVELIRNNQIVIIQGQTGCGKTTQIPQFVLEANLNNGNMIGITQSRRIAAVSMAKRVAQEKQCNLGSEVGYEIRFDKKCSASTKIKYMTDGILLNECVTDANLKDYGVVMIDEAHERXXXXXXXXXXXXXVCKSRENLKIIITSATICAEKFSQFFDDSKILTIEGRLFPVEIIYEGYI-MDLIDYSAKLVRRIHIGNEPGDILVFLTGEEDIERCCKLL--------RNVGNLIVTPLYGAIDFQEQQEVFRTMDCGDRKVVVATNIAETSITIDGIRYVIDCGYMKQNKFDSRRGIETLESIKISKAQAEQRKGRSGRTGPGWCYRLYSEGSYND-FIQEAVPEIKRKDLSEIYLRIIEFNLNP-KDFNFIDXXXXXXXXXXXXXXXDLKIITKEGKLTPSGQNMLGFPVEPRLGKVLMESLNNKCTNDIIKIMAMLSERFIFRKHHKGRGRGDPLK-EFSDHDGDHFTLLNIYNDWISHKQNKQWCISSSIDYNSMQNAYNIFIQLCKILKKNHSFKETVGEKNA-IKKSLISGFFKNICVKTNRGAYTRLYGREVMYIHPQSSLFHSSPKIILFNEVRKTTKTFMHGVLRLDEEIIREF 1942
            LPIY+ K+Q+++ + +NQI+I+ G+TG GKTTQI Q++ EA       IG TQ RR+AA+S+AKRV++E  C LG EVGY IRF+   S  T IKYMTDG+LL EC+ D +L  Y ++M+DEAHER++ +D+L GLLK   + R ++K+I+TSAT+ A KFSQ+F ++ I TI GR +PVE++Y      D +D S   V +IH+   PGDILVFLTG+E+I+  C++L         +V  LI+ P+Y A+  + Q  +F     G RKVV+ATNIAETS+TIDGI YV+D G++KQ  ++S+ GI+ L    IS+AQA+QR GR+GRTGPG CYRLY+E +Y D  +   VPEI+R +L+   L +    +N    F+F+D PP E L  +  +L  L  +  EG LT  G+ M  FP+EP L K+L+ S++  C+ +++ I++MLS + +F +    +   D  K +F   +GDH TLL +YN W ++K +  WC  + I   S++ A +I  Q+  I+ ++     + G+    ++K++ SGFF+N   K  +  Y  L  ++V+YIHP S+LF+  P+ ++++E+  TTK +M  V  +D   + EF
Sbjct:  546 LPIYKLKEQLIQAVHDNQILIVIGETGSGKTTQITQYLAEAGYTTRGKIGCTQPRRVAAMSVAKRVSEEYGCCLGQEVGYTIRFEDCTSPETVIKYMTDGMLLRECLIDPDLGQYAIIMLDEAHERTIHTDVLFGLLKKTVQKRTDMKLIVTSATLDAVKFSQYFYEAPIFTIPGRTYPVEVLYTKEPETDYLDASLITVMQIHLTEPPGDILVFLTGQEEIDTACEILYERMKSLGPDVPELIILPVYSALPSEMQTRIFDPAPPGSRKVVIATNIAETSLTIDGIYYVVDPGFVKQKVYNSKTGIDQLVVTPISQAQAKQRAGRAGRTGPGKCYRLYTERAYRDEMLTTNVPEIQRTNLASTVLSLKAMGINDLLSFDFMDAPPMETLITAMEQLYTLGALDDEGLLTRLGRRMAEFPLEPMLCKMLIMSVHLGCSEEMLTIVSMLSVQNVFYRPKDKQALADQKKAKFHQPEGDHLTLLAVYNSWKNNKFSNPWCYENFIQARSLRRAQDIRKQMLGIMDRHKLDVFSCGKATVRVQKAICSGFFRNAAKKDPQEGYRTLIDQQVVYIHPSSALFNRQPEWVVYHELVLTTKEYMREVTTIDPRWLVEF 1157          
BLAST of ATP-dependent RNA helicase DHX8 vs. Ensembl Cavefish
Match: dhx8 (DEAH-box helicase 8 [Source:NCBI gene;Acc:103035799])

HSP 1 Score: 473.781 bits (1218), Expect = 1.809e-152
Identity = 262/612 (42.81%), Postives = 393/612 (64.22%), Query Frame = 2
Query:  146 LPIYEYKDQIVELIRNNQIVIIQGQTGCGKTTQIPQFVLEANLNNGNMIGITQSRRIAAVSMAKRVAQEKQCNLGSEVGYEIRFDKKCSASTKIKYMTDGILLNECVTDANLKDYGVVMIDEAHERXXXXXXXXXXXXXVCKSRENLKIIITSATICAEKFSQFFDDSKILTIEGRLFPVEIIYEGYI-MDLIDYSAKLVRRIHIGNEPGDILVFLTGEEDIERCCKLL--------RNVGNLIVTPLYGAIDFQEQQEVFRTMDCGDRKVVVATNIAETSITIDGIRYVIDCGYMKQNKFDSRRGIETLESIKISKAQAEQRKGRSGRTGPGWCYRLYSEGSYND-FIQEAVPEIKRKDLSEIYLRIIEFNLNP-KDFNFIDXXXXXXXXXXXXXXXDLKIITKEGKLTPSGQNMLGFPVEPRLGKVLMESLNNKCTNDIIKIMAMLSERFIFRKHHKGRGRGDPLK-EFSDHDGDHFTLLNIYNDWISHKQNKQWCISSSIDYNSMQNAYNIFIQLCKILKKNHSFKETVGEKNA-IKKSLISGFFKNICVKTNRGAYTRLYGREVMYIHPQSSLFHSSPKIILFNEVRKTTKTFMHGVLRLDEEIIREF 1942
            LPIY+ K+Q+++ + +NQI+I+ G+TG GKTTQI Q++ EA       IG TQ RR+AA+S+AKRV++E  C LG EVGY IRF+   S  T IKYMTDG+LL EC+ D +L  Y ++M+DEAHER++ +D+L GLLK   + R ++K+I+TSAT+ A KFSQ+F ++ I TI GR +PVE++Y      D +D S   V +IH+   PGDILVFLTG+E+I+  C++L         +V  LI+ P+Y A+  + Q  +F     G RKVV+ATNIAETS+TIDGI YV+D G++KQ  ++S+ GI+ L    IS+AQA+QR GR+GRTGPG CYRLY+E +Y D  +   VPEI+R +L+   L +    +N    F+F+D PP E L  +  +L  L  +  EG LT  G+ M  FP+EP L K+L+ S++  C+ +++ I++MLS + +F +    +   D  K +F   +GDH TLL +YN W ++K +  WC  + I   S++ A +I  Q+  I+ ++     + G+    ++K++ SGFF+N   K  +  Y  L  ++V+YIHP S+LF+  P+ ++++E+  TTK +M  V  +D   + EF
Sbjct:  585 LPIYKLKEQLIQAVHDNQILIVIGETGSGKTTQITQYLAEAGYTTRGKIGCTQPRRVAAMSVAKRVSEEYGCCLGQEVGYTIRFEDCTSPETVIKYMTDGMLLRECLIDPDLGQYAIIMLDEAHERTIHTDVLFGLLKKTVQKRTDMKLIVTSATLDAVKFSQYFYEAPIFTIPGRTYPVEVLYTKEPETDYLDASLITVMQIHLTEPPGDILVFLTGQEEIDTACEILYERMKSLGPDVPELIILPVYSALPSEMQTRIFDPAPPGSRKVVIATNIAETSLTIDGIYYVVDPGFVKQKVYNSKTGIDQLVVTPISQAQAKQRAGRAGRTGPGKCYRLYTERAYRDEMLTTNVPEIQRTNLASTVLSLKAMGINDLLSFDFMDAPPMETLITAMEQLYTLGALDDEGLLTRLGRRMAEFPLEPMLCKMLIMSVHLGCSEEMLTIVSMLSVQNVFYRPKDKQALADQKKAKFHQPEGDHLTLLAVYNSWKNNKFSNPWCYENFIQARSLRRAQDIRKQMLGIMDRHKLDVFSCGKATVRVQKAICSGFFRNAAKKDPQEGYRTLIDQQVVYIHPSSALFNRQPEWVVYHELVLTTKEYMREVTTIDPRWLVEF 1196          
BLAST of ATP-dependent RNA helicase DHX8 vs. Ensembl Cavefish
Match: dhx16 (DEAH-box helicase 16 [Source:NCBI gene;Acc:103040087])

HSP 1 Score: 438.343 bits (1126), Expect = 6.438e-141
Identity = 247/613 (40.29%), Postives = 374/613 (61.01%), Query Frame = 2
Query:  146 LPIYEYKDQIVELIRNNQIVIIQGQTGCGKTTQIPQFVLEANLNNGNM-IGITQSRRIAAVSMAKRVAQEKQCNLGSEVGYEIRFDKKCSASTKIKYMTDGILLNECVTDANLKDYGVVMIDEAHERXXXXXXXXXXXXXVCKSRENLKIIITSATICAEKFSQFFDDSKILTIEGRLFPVEIIY-EGYIMDLIDYSAKLVRRIHIGNEPGDILVFLTGEEDIERCCKLLRN--------VGNLIVTPLYGAIDFQEQQEVFRTMDCGDRKVVVATNIAETSITIDGIRYVIDCGYMKQNKFDSRRGIETLESIKISKAQAEQRKGRSGRTGPGWCYRLYSEGSYNDFIQE-AVPEIKRKDLSEIYLRIIEFNLNPK-DFNFIDXXXXXXXXXXXXXXXDLKIITKEGKLTPSGQNMLGFPVEPRLGKVLMESLNNKCTNDIIKIMAMLS--ERFIFRKHHKGRGRGDPLKEFSDHDGDHFTLLNIYNDWISHKQNKQWCISSSIDYNSMQNAYNIFIQLCKILKK-NHSFKETVGEKNAIKKSLISGFFKNICVKTNRGAYTRLYGREVMYIHPQSSLFHSSPKIILFNEVRKTTKTFMHGVLRLDEEIIRE 1939
            LP++ Y+  ++  IR++QI++I+G+TG GKTTQIPQ+++E     G M IG TQ RR+AA+S++ RVAQE    LG+EVGY IRF+   S  T +KYMTDG+LL E +T+ +L  Y V++IDEAHER+L +DIL GL+K + + R +LK+++ SAT+  E+FS FFDD+ +  I GR FPV+I Y +    D +D     V +IH+   PGDILVFLTG+E+IE CC+ L+         +  L+V P+Y  +    Q ++F     G RKVVVATNIAETS+TIDGI YVID G+ KQ  +++R G+E+L     S+A A QR GR+GR   G C+RLY+  ++   ++E  VPEI+R +L  + L +    +N    F+F+D PP E L  +  +L  L  +   G+LT  G+ M   PV+P L K+++ S   KC+ +++ I AMLS      +R   K     +    F    GDH  LLN+Y  W+    + QWC  + I + SM+ A ++  QL  ++++         G+   I+KS+ +G+F +   + ++G Y  +  ++ +Y+HP SSLF   P+ ++++E+  TTK FM  V+ +D   + E
Sbjct:  378 LPVFPYRQDLLNAIRDHQILVIEGETGSGKTTQIPQYLMEDGYTKGGMKIGCTQPRRVAAMSVSARVAQEVGVKLGNEVGYSIRFEDCTSERTVLKYMTDGMLLREFLTEPDLASYSVIIIDEAHERTLHTDILFGLIKDIARFRPDLKVLVASATLDTERFSCFFDDAPVFRIPGRRFPVDIFYTKAPEADYLDACVVSVLQIHVTQPPGDILVFLTGQEEIESCCENLQERCRRLGSKISELLVLPIYANLPSDMQAKIFNPTPPGARKVVVATNIAETSLTIDGIIYVIDPGFCKQKSYNARTGMESLIVTPCSRASANQRAGRAGRVAAGKCFRLYTAWAFKHEMEETTVPEIQRTNLGNVVLLLKSLGINDLIHFDFMDPPPHETLVLALEQLYALGALNHLGELTKLGRRMAELPVDPMLSKMILASEQYKCSEEVLTIAAMLSVNNSIFYRPKDKVVHADNARMNFIVPGGDHLVLLNVYTQWVESGFSTQWCFENFIQFRSMKRARDVREQLEGLMERIEVEVCSANGDSTPIRKSITAGYFYHTA-RLSKGGYKTVKHQQTVYVHPNSSLFEEQPRWLIYHELVFTTKEFMRQVIEIDSAWLLE 989          
BLAST of ATP-dependent RNA helicase DHX8 vs. Ensembl Cavefish
Match: dhx16 (DEAH-box helicase 16 [Source:NCBI gene;Acc:103040087])

HSP 1 Score: 437.573 bits (1124), Expect = 2.292e-140
Identity = 247/613 (40.29%), Postives = 374/613 (61.01%), Query Frame = 2
Query:  146 LPIYEYKDQIVELIRNNQIVIIQGQTGCGKTTQIPQFVLEANLNNGNM-IGITQSRRIAAVSMAKRVAQEKQCNLGSEVGYEIRFDKKCSASTKIKYMTDGILLNECVTDANLKDYGVVMIDEAHERXXXXXXXXXXXXXVCKSRENLKIIITSATICAEKFSQFFDDSKILTIEGRLFPVEIIY-EGYIMDLIDYSAKLVRRIHIGNEPGDILVFLTGEEDIERCCKLLRN--------VGNLIVTPLYGAIDFQEQQEVFRTMDCGDRKVVVATNIAETSITIDGIRYVIDCGYMKQNKFDSRRGIETLESIKISKAQAEQRKGRSGRTGPGWCYRLYSEGSYNDFIQE-AVPEIKRKDLSEIYLRIIEFNLNPK-DFNFIDXXXXXXXXXXXXXXXDLKIITKEGKLTPSGQNMLGFPVEPRLGKVLMESLNNKCTNDIIKIMAMLS--ERFIFRKHHKGRGRGDPLKEFSDHDGDHFTLLNIYNDWISHKQNKQWCISSSIDYNSMQNAYNIFIQLCKILKK-NHSFKETVGEKNAIKKSLISGFFKNICVKTNRGAYTRLYGREVMYIHPQSSLFHSSPKIILFNEVRKTTKTFMHGVLRLDEEIIRE 1939
            LP++ Y+  ++  IR++QI++I+G+TG GKTTQIPQ+++E     G M IG TQ RR+AA+S++ RVAQE    LG+EVGY IRF+   S  T +KYMTDG+LL E +T+ +L  Y V++IDEAHER+L +DIL GL+K + + R +LK+++ SAT+  E+FS FFDD+ +  I GR FPV+I Y +    D +D     V +IH+   PGDILVFLTG+E+IE CC+ L+         +  L+V P+Y  +    Q ++F     G RKVVVATNIAETS+TIDGI YVID G+ KQ  +++R G+E+L     S+A A QR GR+GR   G C+RLY+  ++   ++E  VPEI+R +L  + L +    +N    F+F+D PP E L  +  +L  L  +   G+LT  G+ M   PV+P L K+++ S   KC+ +++ I AMLS      +R   K     +    F    GDH  LLN+Y  W+    + QWC  + I + SM+ A ++  QL  ++++         G+   I+KS+ +G+F +   + ++G Y  +  ++ +Y+HP SSLF   P+ ++++E+  TTK FM  V+ +D   + E
Sbjct:  411 LPVFPYRQDLLNAIRDHQILVIEGETGSGKTTQIPQYLMEDGYTKGGMKIGCTQPRRVAAMSVSARVAQEVGVKLGNEVGYSIRFEDCTSERTVLKYMTDGMLLREFLTEPDLASYSVIIIDEAHERTLHTDILFGLIKDIARFRPDLKVLVASATLDTERFSCFFDDAPVFRIPGRRFPVDIFYTKAPEADYLDACVVSVLQIHVTQPPGDILVFLTGQEEIESCCENLQERCRRLGSKISELLVLPIYANLPSDMQAKIFNPTPPGARKVVVATNIAETSLTIDGIIYVIDPGFCKQKSYNARTGMESLIVTPCSRASANQRAGRAGRVAAGKCFRLYTAWAFKHEMEETTVPEIQRTNLGNVVLLLKSLGINDLIHFDFMDPPPHETLVLALEQLYALGALNHLGELTKLGRRMAELPVDPMLSKMILASEQYKCSEEVLTIAAMLSVNNSIFYRPKDKVVHADNARMNFIVPGGDHLVLLNVYTQWVESGFSTQWCFENFIQFRSMKRARDVREQLEGLMERIEVEVCSANGDSTPIRKSITAGYFYHTA-RLSKGGYKTVKHQQTVYVHPNSSLFEEQPRWLIYHELVFTTKEFMRQVIEIDSAWLLE 1022          
BLAST of ATP-dependent RNA helicase DHX8 vs. Ensembl Cavefish
Match: dhx16 (DEAH-box helicase 16 [Source:NCBI gene;Acc:103040087])

HSP 1 Score: 434.491 bits (1116), Expect = 1.867e-139
Identity = 245/603 (40.63%), Postives = 369/603 (61.19%), Query Frame = 2
Query:  146 LPIYEYKDQIVELIRNNQIVIIQGQTGCGKTTQIPQFVLEANLNNGNM-IGITQSRRIAAVSMAKRVAQEKQCNLGSEVGYEIRFDKKCSASTKIKYMTDGILLNECVTDANLKDYGVVMIDEAHERXXXXXXXXXXXXXVCKSRENLKIIITSATICAEKFSQFFDDSKILTIEGRLFPVEIIY-EGYIMDLIDYSAKLVRRIHIGNEPGDILVFLTGEEDIERCCKLLR--------NVGNLIVTPLYGAIDFQEQQEVFRTMDCGDRKVVVATNIAETSITIDGIRYVIDCGYMKQNKFDSRRGIETLESIKISKAQAEQRKGRSGRTGPGWCYRLYSEGSYNDFIQE-AVPEIKRKDLSEIYLRIIEFNLNPK-DFNFIDXXXXXXXXXXXXXXXDLKIITKEGKLTPSGQNMLGFPVEPRLGKVLMESLNNKCTNDIIKIMAMLS--ERFIFRKHHKGRGRGDPLKEFSDHDGDHFTLLNIYNDWISHKQNKQWCISSSIDYNSMQNAYNIFIQLCKILKK-NHSFKETVGEKNAIKKSLISGFFKNICVKTNRGAYTRLYGREVMYIHPQSSLFHSSPKIILFNEVRKTTKTFMHGV 1909
            LP++ Y+  ++  IR++QI++I+G+TG GKTTQIPQ+++E     G M IG TQ RR+AA+S++ RVAQE    LG+EVGY IRF+   S  T +KYMTDG+LL E +T+ +L  Y V++IDEAHER+L +DIL GL+K + + R +LK+++ SAT+  E+FS FFDD+ +  I GR FPV+I Y +    D +D     V +IH+   PGDILVFLTG+E+IE CC+ L+         +  L+V P+Y  +    Q ++F     G RKVVVATNIAETS+TIDGI YVID G+ KQ  +++R G+E+L     S+A A QR GR+GR   G C+RLY+  ++   ++E  VPEI+R +L  + L +    +N    F+F+D PP E L  +  +L  L  +   G+LT  G+ M   PV+P L K+++ S   KC+ +++ I AMLS      +R   K     +    F    GDH  LLN+Y  W+    + QWC  + I + SM+ A ++  QL  ++++         G+   I+KS+ +G+F +   + ++G Y  +  ++ +Y+HP SSLF   P+ ++++E+  TTK FM  V
Sbjct:  411 LPVFPYRQDLLNAIRDHQILVIEGETGSGKTTQIPQYLMEDGYTKGGMKIGCTQPRRVAAMSVSARVAQEVGVKLGNEVGYSIRFEDCTSERTVLKYMTDGMLLREFLTEPDLASYSVIIIDEAHERTLHTDILFGLIKDIARFRPDLKVLVASATLDTERFSCFFDDAPVFRIPGRRFPVDIFYTKAPEADYLDACVVSVLQIHVTQPPGDILVFLTGQEEIESCCENLQERCRRLGSKISELLVLPIYANLPSDMQAKIFNPTPPGARKVVVATNIAETSLTIDGIIYVIDPGFCKQKSYNARTGMESLIVTPCSRASANQRAGRAGRVAAGKCFRLYTAWAFKHEMEETTVPEIQRTNLGNVVLLLKSLGINDLIHFDFMDPPPHETLVLALEQLYALGALNHLGELTKLGRRMAELPVDPMLSKMILASEQYKCSEEVLTIAAMLSVNNSIFYRPKDKVVHADNARMNFIVPGGDHLVLLNVYTQWVESGFSTQWCFENFIQFRSMKRARDVREQLEGLMERIEVEVCSANGDSTPIRKSITAGYFYHTA-RLSKGGYKTVKHQQTVYVHPNSSLFEEQPRWLIYHELVFTTKEFMRQV 1012          
BLAST of ATP-dependent RNA helicase DHX8 vs. Ensembl Sea Lamprey
Match: dhx8 (DEAH (Asp-Glu-Ala-His) box polypeptide 8 [Source:ZFIN;Acc:ZDB-GENE-050809-39])

HSP 1 Score: 475.707 bits (1223), Expect = 4.733e-159
Identity = 264/613 (43.07%), Postives = 393/613 (64.11%), Query Frame = 2
Query:  146 LPIYEYKDQIVELIRNNQIVIIQGQTGCGKTTQIPQFVLEANLNNGNMIGITQSRRIAAVSMAKRVAQEKQCNLGSEVGYEIRFDKKCSASTKIKYMTDGILLNECVTDANLKDYGVVMIDEAHERXXXXXXXXXXXXXVCKSRENLKIIITSATICAEKFSQFFDDSKILTIEGRLFPVEIIYEGYI-MDLIDYSAKLVRRIHIGNEPGDILVFLTGEEDIERCCKLL--------RNVGNLIVTPLYGAIDFQEQQEVFRTMDCGDRKVVVATNIAETSITIDGIRYVIDCGYMKQNKFDSRRGIETLESIKISKAQAEQRKGRSGRTGPGWCYRLYSEGSYND-FIQEAVPEIKRKDLSEIYLRIIEFNLNP-KDFNFIDXXXXXXXXXXXXXXXDLKIITKEGKLTPSGQNMLGFPVEPRLGKVLMESLNNKCTNDIIKIMAMLSERFIFRKHHKGRGRGDPLK-EFSDHDGDHFTLLNIYNDWISHKQNKQWCISSSIDYNSMQNAYNIFIQLCKILKKNHSFKETVGEKNAIK--KSLISGFFKNICVKTNRGAYTRLYGREVMYIHPQSSLFHSSPKIILFNEVRKTTKTFMHGVLRLDEEIIREF 1942
            LPIY+ K+Q+V+ + +NQI+I+ G+TG GKTTQI Q++ EA       IG TQ RR+AA+S+AKRV++E  C LG EVGY IRF+   S  TKIKYMTDG+LL EC+ D+ L  Y VVM+DEAHER++ +D+L GLLK   K R ++K+I+TSAT+ A KFSQ+F ++ I TI GR +PVEI+Y      D +D S   V +IH+   PGDIL+FLTG+E+I+  C++L          V  LI+ P+Y A+  + Q  +F     G RKVV+ATNIAETS+TIDGI YV+D G++KQ  ++S+ GI+ L    IS+AQA+QR GR+GRTGPG  YRLY+E +Y D  +   VPEI+R +L+   L +    +N    F+F+D PP E L  +  +L  L  +  EG LT  G+ M  FP+EP L K+L+ S++  C+ +++ I++MLS + +F +    +   D  K +F+  +GDH TLL +YN W ++K +  WC  + +   +++ A ++  Q+  I+ + H        K  ++  K+++SGFF+N   K  +  Y  L  ++V+YIHP S+LF+  P+ ++++E+  TTK +M  V  +D + + EF
Sbjct:  102 LPIYKLKEQLVQAVNDNQILIVIGETGSGKTTQITQYLAEAGYTTRGKIGCTQPRRVAAMSVAKRVSEEFGCCLGQEVGYTIRFEDCTSPETKIKYMTDGMLLRECLIDSELMQYSVVMLDEAHERTIHTDVLFGLLKKTIKRRLDMKLIVTSATLDAVKFSQYFYEAPIFTIPGRTYPVEILYTKEPETDYLDASLITVMQIHLTEPPGDILLFLTGQEEIDTACEILYERMKSLGPEVPELIILPVYSALPSEMQTRIFDPAPPGSRKVVIATNIAETSLTIDGIYYVVDPGFVKQKVYNSKTGIDQLVVTPISQAQAKQRAGRAGRTGPGKTYRLYTERAYRDEMLTTNVPEIQRTNLASTVLSLKAMGINDLLSFDFMDAPPMETLITAMEQLYQLGALDDEGLLTRLGRRMAEFPLEPMLCKMLIMSVHLGCSEEMLTIVSMLSVQNVFYRPKDKQALADQKKAKFNQAEGDHLTLLAVYNSWKNNKFSNAWCYENFVQARTLRRAQDVRKQMLGIMDR-HKLDVVSCAKATVRVQKAVLSGFFRNAAKKDPQEGYRTLVDQQVVYIHPSSALFNRQPEWVVYHELVLTTKEYMREVTTIDPKWLVEF 713          
BLAST of ATP-dependent RNA helicase DHX8 vs. Ensembl Sea Lamprey
Match: dhx34 (DEAH (Asp-Glu-Ala-His) box polypeptide 34 [Source:ZFIN;Acc:ZDB-GENE-061207-30])

HSP 1 Score: 325.479 bits (833), Expect = 1.202e-98
Identity = 190/540 (35.19%), Postives = 313/540 (57.96%), Query Frame = 2
Query:  146 LPIYEYKDQIVELIRNNQIVIIQGQTGCGKTTQIPQFVLEANLNNGNMIGITQSRRIAAVSMAKRVAQEKQCNLGSEVGYEIRFDKKCSASTKIKYMTDGILLNECVTDANLKDYGVVMIDEAHERXXXXXXXXXXXXXVCKSRENLKIIITSATICAEKFSQFFDDSKILTIEGRLFPVEIIYEGY-------------------IMDLIDYSAKLVRRIHIGNEPGDILVFLTGEEDIERCCKLLRNVG----NLIVTPLYGAIDFQEQQEVFRTMDCGDRKVVVATNIAETSITIDGIRYVIDCGYMKQNKFDSRRGIETLESIKISKAQAEQRKGRSGRTGPGWCYRLYSEGSYNDFIQEAVPEIKRKDLSEIYLRIIEFNL-NPKDFNFIDXXXXXXXXXXXXXXXDLKIITKEGKLTPSGQNMLGFPVEPRLGKVLMESLNNKCTNDIIKIMAMLSERFIF-RKHHKGRGRGDPLKEFSDHDGDHFTLLNIYNDWISHKQNKQ-----WCISSSIDYNSMQNAYNIFIQLCKIL 1675
            LPI+EY+DQ+VEL+R +Q+V++ G TGCGK+TQ+PQ++L A ++    +  TQ RRIA +S+AKRV+ E     GS++GY+IRF+   +A+TK+ ++T+G+LL +  T+  +  Y V+++DE HER L  D+LLG+L+ +   R++L++++ SATI  + FS++  D+ +L + GRL+P+++IY                      IM  ID+        +  +E GD+LVFL+G  DI R  +  ++        IV  L+  +  ++Q +VF     G RK +V+TNIAETS+TIDG+R+++D G +K+  +D +  ++ L+   IS+A AEQRKGR+GRTGPG C+RLY+E  Y+     AVPE++R  L  + L++    L +P+ F F++ PP   L  S + L +   + ++ +LTP G+ +   P++   GK+L+          ++ I A +S +  F R  H         +      GD  TLLN++N+W+  K   Q     WC    ++   +    N+  Q  ++L
Sbjct:  105 LPIHEYRDQLVELVRAHQVVVVAGDTGCGKSTQVPQYLLSAGMSR---VACTQPRRIACMSLAKRVSYESLGEHGSQIGYQIRFETSKTAATKVLFLTEGLLLRQMQTEGFMSRYDVLILDEVHERHLHCDLLLGVLRELLPLRDDLRLVLMSATINIQLFSRYLGDAPVLQVPGRLYPIQVIYRPVPEEEKTGKSERIDPRPYLRIMQSIDHK-------YPADERGDLLVFLSGMADIARVAEAAQSYAVETKRWIVLQLHSTLSAEQQDKVFDLAPEGVRKCIVSTNIAETSVTIDGVRFIVDSGKVKEMSYDPKAKMQRLQEFWISRASAEQRKGRAGRTGPGVCFRLYAESEYDALEPYAVPEVQRVPLDSVVLQMKSMGLGDPRLFGFLEPPPASSLETSMQFLQEQGALDEQEELTPIGRVLATLPLDVLTGKMLLVGCVLGAVEPVLTIAAAMSVQSPFHRNAHTNPDCSRARRSLESDHGDPLTLLNVFNEWVQVKSGGQVPSRKWCKRHGLEEQRLYEIANLQRQFKELL 634          
BLAST of ATP-dependent RNA helicase DHX8 vs. Ensembl Sea Lamprey
Match: zgc:158828 (DEAH-box helicase 35 [Source:HGNC Symbol;Acc:HGNC:15861])

HSP 1 Score: 273.478 bits (698), Expect = 2.222e-82
Identity = 181/553 (32.73%), Postives = 298/553 (53.89%), Query Frame = 2
Query:  140 NKLPIYEYKDQIVELIRNNQIVIIQGQTGCGKTTQIPQFVLEANLN-NGNMIGITQSRRIAAVSMAKRVAQEKQCNLGSEVGYEIRFDKKCS--ASTKIKYMTDGILLNECVTDANLKDYGVVMIDEAHERXXXXXXXXXXXXXVCKSRENLKIIITSATICAEKFSQFFD-----DSKILTIEGR---------LFPVEIIYEGYIMDLIDYSAKLVRRIHIGNEPGDILVFLTGEEDIERCCKLL---------RNVGNLI----VTPLYGAIDFQEQQEVFRTMDCGDRKVVVATNIAETSITIDGIRYVIDCGYMKQNKFDSRRGIETLESIKISKAQAEQRKGRSGRTGPGWCYRLYSEGSYNDFIQEAVPEIKRKDLSEIYLRIIEFNL-NPKDFNFIDXXXXXXXXXXXXXXXDLKIITKEG-KLTPSGQNMLGFPVEPRLGKVLMESLNNKCTNDIIKIMAMLSERFIF-----RKHHKGRGRGDPLKEFSDHDGDHFTLLNIYNDWISHKQNKQWCISSSIDYNSMQNAYNIFIQLCKILKKNH 1687
             +LPI+ +++ ++ L+   + V+I G+TGCGK+TQIPQ++ EA     G+++ ITQ RR+AA ++A RVA+E+   LG EVGY IRFD  CS   +T+IK++TDG+L+ E + D  LK Y  +++                    C S     + +TS+TI    FS+ F+        IL   G+         ++PV         D +  + + + +IH     GDIL FLTG+E++E     +         R+ G+L       P+Y  + + +Q +VF  +    RKVVVATN+AETS+T+ GI +V+DCG++K   +D RR ++ L     S+A A+QR GR+GR+ PG CYRLY E  +    +   PE++R D++ + L++    + N   F+F+  PP E + ++   L  L    ++    +P G  M  FP+ P   K+L+ES    C+ +II I AM+  + +F     +K    R +    ++F+  +GDH T+LN++  ++ H ++  WC    ++Y  +  A  +  QL K+L++ H
Sbjct:   50 QRLPIFMHRNHVLYLVEKYRTVVIVGETGCGKSTQIPQYLAEAGWTAEGHVVAITQPRRVAATTVAARVAEERGALLGHEVGYCIRFDD-CSDPQATRIKFLTDGMLVREMMADPLLKKYSPLLL--------RFGDTTAPYPTACSSFNRSLVEVTSSTI-PSSFSRAFECQCCLADYILWRVGQCTNARSYILMYPVP--------DYVKTTVETIMKIHNDAADGDILAFLTGQEEVENVVSAVVEEVRAAAARSKGSLHRHVRALPMYAGLPYVDQMKVFERVGRNCRKVVVATNVAETSVTVPGIAFVVDCGFVKLRTYDPRRAVDALLVTPASRASAQQRAGRAGRSRPGKCYRLYPESEFAKLPEATEPEMRRSDMAPVILQLKALGIDNVLRFSFLSPPPAESMVQAVELLYALGGAWRDASSSSPLGVRMAEFPMGPMYAKMLLESGTFGCSKEIITIAAMMQIQNVFLSPPNQKIKAARQQ----RKFAVEEGDHMTMLNVFEAFVKHNKSSAWCQQHFLNYKGLVRAGALQDQLRKLLRRFH 580          
BLAST of ATP-dependent RNA helicase DHX8 vs. Ensembl Sea Lamprey
Match: dhx33 (DEAH (Asp-Glu-Ala-His) box polypeptide 33 [Source:NCBI gene;Acc:796505])

HSP 1 Score: 228.409 bits (581), Expect = 4.590e-68
Identity = 146/392 (37.24%), Postives = 220/392 (56.12%), Query Frame = 2
Query:  146 LPIYEYKDQIVELIRN-NQIVIIQGQTGCGKTTQIPQFVLEANLNNGNMIGITQSRRIAAVSMAKRVAQEKQCNLGSEVGYEIRFDKKCSASTKIKYMTDGILLNECVTDANLKDYGVVMIDEAHERXXXXXXXXXXXXXVCKSR-----ENLKIIITSATICAEKFSQFFDDSKILTIEGRLFPVEIIY--EGYIMDLIDYSAKLVRRIHIGNEP-GDILVFLTGEEDIE---RCCK-----LLRNVGNLIVTPLYGAIDFQEQQEVF-RTMDCGDRKVVVATNIAETSITIDGIRYVIDCGYMKQNKFDSRRGIETLESIKISKAQAEQRKGRSGRTGPGWCYRLYSEGSYNDFIQEAVPEIK-RKDLSEIYLRIIEFNLNP-KDFNFID 1261
            LPIY  + ++   ++  +  ++I G T  G TTQ+  +  E +   G  +   Q     AV +  R    +Q      VGY +RF+   SAST+++++TDG+LL E + D  L     V++DEAHERSL +D L G++K   + R       LK+I+ SAT+  ++F  +F+ + +L +EGR  P++I Y  E +  D +  +   + + H   E    IL FLTG+E+IE   R C+     L  +V  + V PLY A+   +QQ VF R    G RKV++ATNIAETSITI G+R VIDCG +K   F    G+E L   K+S+AQA QR GRSGR GPG C RLY+E  +    +   PE++ R +L+ + L ++   ++    F+F+D
Sbjct:   41 LPIYAVRAELTRRLQELHTAIVIFGITAQGSTTQVKSWTGEQDCPPGGEVAYMQPSHTTAVCVPSRRDFYRQNRGRDVVGYTVRFEDVRSASTRVRFVTDGMLLREALGDPLLLATSAVVLDEAHERSLHTDTLFGVVKGAQRQRWEQKLRPLKVIVMSATMDVDRFVSYFNGAPVLYVEGRQHPIQIFYTREPH-SDFLHATLITIFQTHQEQEAEHHILAFLTGQEEIEAMGRACRDLSRQLPPSVPRMCVVPLYAALPHAQQQRVFARAPPKGTRKVILATNIAETSITIPGVRTVIDCGLVKAKMFSPGTGMEVLALQKVSQAQAWQRAGRSGREGPGCCLRLYTEMHFQSLAENTTPELQSRCNLTSVLLHLLALGISDVASFDFMD 431          
BLAST of ATP-dependent RNA helicase DHX8 vs. Ensembl Sea Lamprey
Match: dhx30 (DEAH (Asp-Glu-Ala-His) box helicase 30 [Source:ZFIN;Acc:ZDB-GENE-130530-833])

HSP 1 Score: 226.098 bits (575), Expect = 5.104e-63
Identity = 162/557 (29.08%), Postives = 293/557 (52.60%), Query Frame = 2
Query:   89 PDDTFDDEQELISK----SPP-----NKLPIYEYKDQIVELIR--NNQIVIIQGQTGCGKTTQIPQFVLEANLN---NGNM--IGITQSRRIAAVSMAKRVAQEKQCNLGSEVGYEIRFDKKC-SASTKIKYMTDGILLNECVTDANLKDYGVVMIDEAHERXXXXXXXXXXXXXVCKSRENLKIIITSATICAEKFSQFFDDSKILTIEGRLFPVEIIYEGYIMDLID----------------YSAKLVRRIHIGNEPGDILVFLTGEEDI----ERCCKLLRN-VGNLIVTPLYGAIDFQEQQEVFRTMDCGDRKVVVATNIAETSITIDGIRYVIDCGYMKQNKFDSRRGIETLESIKISKAQAEQRKGRSGRTGPGWCYRLYSEGSYNDFIQEAVPEIKRKDLSEIYLRIIEFNLNPKDFNFIDXXX----XXXXXXXXXXXXDLKIITKEGKLTPSGQNMLGFPVEPRLGKVLMESLNNKCTNDIIKIMAMLSERFIFRKHHKGRGRGDPLKEF--SDHDGDHFTLLNIYNDW---ISHKQNKQWCISSSI 1618
            P+   +  +EL+S+    +PP     + LPI +Y+D+I+  +   + +++I+ G+TGCGKTT+IPQ +LE+ ++   NG    + +TQ RRI+AVS+ +RV QE   +L   +GY++R +    +    + + T GILL +  ++ +L     V++DE HER + +D LL LL+ V +    L++++ SAT   ++ +Q+F  + +L + G+L+PV   +   +  L+                 +  ++V  I     PG +L FL G ++I    +R  + L N +   ++ P++ ++   +QQ +F+    G RKVV+ATNIAET+ITID I +V+D G  K  ++D R  +  L+++ +SK    QR+GR+GR  PG+ Y L+SE  +    +   PEI R  L  + L++     +     F+D+      +  +  +   L ++ ++  +  LTP G  +    VEPRL K L+ +   +C   ++ I++ LS R  F+   + R   +  +     +   DH   +N   +W      + ++Q C S ++
Sbjct:  354 PEQAQELSEELLSRWRAANPPVTPGEDPLPILDYRDEILAALEAEDRRVLIVAGETGCGKTTKIPQLILESMVSRAGNGAHCNVVVTQPRRISAVSVCQRVRQELGPHLRRNIGYQVRMESSPPTPGGAVLFCTVGILLRKLQSNPDLLGVSHVLLDEVHERDVGTDFLLVLLRDVLRRNPRLRLLLASATPDTQRLAQYFGGATVLRVPGKLYPVTPYHLRNVCQLMQRHPPSKDSDDPSPDLDFVTEVVEFICSRGTPGGVLCFLPGWQEIRGVMDRLSQRLNNRLDKHLILPVHSSLSVVDQQAIFQRPPEGVRKVVLATNIAETAITIDDIVHVVDTGCHKLQQYDMRTQVSCLDTVWVSKTNVVQRRGRAGRCQPGFSYHLFSEEQFAAMPEFETPEILRTPLESLVLQVKLHTPHIPAAQFLDQALDRPNKYAVEEAVSILQEIGVLMMDESLTPLGARLAHMAVEPRLAKALVLATLFRCLYPVLVIISSLS-RDPFQSGLQQRAAVNKARRLLAGETRSDHLAFVNALEEWRHAYGDRADEQHCASENM 909          
BLAST of ATP-dependent RNA helicase DHX8 vs. Ensembl Yeast
Match: PRP22 (DEAH-box RNA-dependent ATPase/ATP-dependent RNA helicase; associates with lariat intermediates before the second catalytic step of splicing; mediates ATP-dependent mRNA release from the spliceosome and unwinds RNA duplexes; required for proofreading the exon ligation reaction [Source:SGD;Acc:S000000815])

HSP 1 Score: 454.907 bits (1169), Expect = 6.507e-147
Identity = 248/611 (40.59%), Postives = 387/611 (63.34%), Query Frame = 2
Query:  146 LPIYEYKDQIVELIRNNQIVIIQGQTGCGKTTQIPQFVLEANLNNGNMIGITQSRRIAAVSMAKRVAQEKQCNLGSEVGYEIRFDKKCSASTKIKYMTDGILLNECVTDANLKDYGVVMIDEAHERXXXXXXXXXXXXXVCKSRENLKIIITSATICAEKFSQFFDDSKILTIEGRLFPVEIIY-EGYIMDLIDYSAKLVRRIHIGNEPGDILVFLTGEEDIERCCKLLRN--------VGNLIVTPLYGAIDFQEQQEVFRTMDCGDRKVVVATNIAETSITIDGIRYVIDCGYMKQNKFDSRRGIETLESIKISKAQAEQRKGRSGRTGPGWCYRLYSEGS-YNDFIQEAVPEIKRKDLSEIYLRIIEFNLNP-KDFNFIDXXXXXXXXXXXXXXXDLKIITKEGKLTPSGQNMLGFPVEPRLGKVLMESLNNKCTNDIIKIMAMLSERFIFRKHHKGRGRGDPLK-EFSDHDGDHFTLLNIYNDWISHKQNKQWCISSSIDYNSMQNAYNIFIQLCKILKK-NHSFKETVGEKNAIKKSLISGFFKNICVKTNRGAYTRLYGREVMYIHPQSSLFHSSPKIILFNEVRKTTKTFMHGVLRLDEEIIRE 1939
            LP+Y  + ++++ +R+NQ ++I G+TG GKTTQI Q++ E   +N  MIG TQ RR+AAVS+AKRVA+E  C +G +VGY IRF+      T+IKYMTDG+L  E + D  +  Y V+M+DEAHER++++D+L  LLK     R  LK+I+TSAT+ + KFS++F +  I+ I G+ FPVE++Y +   MD I+ +   V  IHI   PGDILVFLTG+E+I+ CC++L +        +G L++ P+Y A+  + Q ++F     G RKVV ATNIAETSITIDGI YV+D G+ K N +++R GIE L    IS+AQA QRKGR+GRTGPG CYRLY+E + YN+ ++  VPEI+R++LS   L +    +N    F+F+D PP+  +  +  EL  L+ +  EGKLT  G+ M  FP++P L + L+ S++N+C+++I+ I++MLS + +F +    +   D  K +F    GDH TLLN+Y  W     ++Q+C ++ + +  ++ A ++  Q+  I KK          + + I+K+ +SGFF N   + ++  Y  + G   + IHP SSL+    + ++++ +  T++ +M  V  ++ + + E
Sbjct:  483 LPVYAMRSELIQAVRDNQFLVIVGETGSGKTTQITQYLDEEGFSNYGMIGCTQPRRVAAVSVAKRVAEEVGCKVGHDVGYTIRFEDVTGPDTRIKYMTDGMLQREALLDPEMSKYSVIMLDEAHERTVATDVLFALLKKAAIKRPELKVIVTSATLNSAKFSEYFLNCPIINIPGKTFPVEVLYSQTPQMDYIEAALDCVIDIHINEGPGDILVFLTGQEEIDSCCEILYDRVKTLGDSIGELLILPVYSALPSEIQSKIFEPTPKGSRKVVFATNIAETSITIDGIYYVVDPGFAKINIYNARAGIEQLIVSPISQAQANQRKGRAGRTGPGKCYRLYTESAFYNEMLENTVPEIQRQNLSHTILMLKAMGINDLLKFDFMDPPPKNLMLNALTELYHLQSLDDEGKLTNLGKEMSLFPMDPTLSRSLLSSVDNQCSDEIVTIISMLSVQNVFYRPKDRQLEADSKKAKFHHPYGDHLTLLNVYTRWQQANYSEQYCKTNFLHFRHLKRARDVKSQISMIFKKIGLKLISCHSDPDLIRKTFVSGFFMNAAKRDSQVGYKTINGGTEVGIHPSSSLYGKEYEYVMYHSIVLTSREYMSQVTSIEPQWLLE 1093          
BLAST of ATP-dependent RNA helicase DHX8 vs. Ensembl Yeast
Match: PRP43 (RNA helicase in the DEAH-box family; functions in both RNA polymerase I and polymerase II transcript metabolism; catalyzes removal of U2, U5, and U6 snRNPs from the postsplicing lariat-intron ribonucleoprotein complex; required for efficient biogenesis of both small- and large-subunit rRNAs; acts with Sqs1p to promote 20S to 18S rRNA processing catalyzed by endonuclease Nob1p [Source:SGD;Acc:S000003088])

HSP 1 Score: 411.379 bits (1056), Expect = 2.622e-134
Identity = 254/630 (40.32%), Postives = 384/630 (60.95%), Query Frame = 2
Query:  143 KLPIYEYKDQIVELIRNNQIVIIQGQTGCGKTTQIPQFVL--EANLNNGNMIGITQSRRIAAVSMAKRVAQEKQCNLGSEVGYEIRFDKKCSASTKIKYMTDGILLNECVTDANLKDYGVVMIDEAHERXXXXXXXXXXXXXVCKSRENLKIIITSATICAEKFSQFFDDSKILTIEGRLFPVEIIYEG-YIMDLIDYSAKLVRRIHIGNEPGDILVFLTGEEDIERCCK--------LLRN--VGNLIVTPLYGAIDFQEQQEVFRTMDCGD-----RKVVVATNIAETSITIDGIRYVIDCGYMKQNKFDSRRGIETLESIKISKAQAEQRKGRSGRTGPGWCYRLYSEGSYN-DFIQEAVPEIKRKDLSEIYLRIIEFNLNP-KDFNFIDXXXXXXXXXXXXXXXDLKIITKEGKLTPSGQNMLGFPVEPRLGKVLMESLNNKCTNDIIKIMAMLSERFIFRKHHKGRGRGDPLKE-FSDHDGDHFTLLNIYNDWISHKQNK----QWCISSSIDYNSMQNAYNIFIQLCKILKK-----NHSFKETVGEKNAIKKSLISGFFKNICVK-TNRGAYTRLYGREVMYIHPQSSLFHSSPKIILFNEVRKTTKTFMHGVLRLDEEIIRE 1939
            +LP++  +D+ ++L +NNQI++  G+TG GKTTQIPQFVL  E        +  TQ RR+AA+S+A+RVA+E    LG EVGY IRF+ K S  T +KYMTDG+LL E + D +L  Y  +++DEAHER+L++DIL+GLLK V K R +LKIII SAT+ AEKF ++F+D+ +L + GR +PVE+ Y   +  D +D + + V +IH   E GDIL+FLTGE++IE   +        L+R    G L V PLYG++   +QQ +F            RKVV++TNIAETS+TIDGI YV+D G+ KQ  ++ R  +E+L    ISKA A+QR GR+GRT PG C+RLY+E ++  + I+++ PEI R +LS   L + +  ++    F+F+D P  E + R+  EL  L  +  EG LTP G+    FP++P L  +L+ S   +C+ +I+ I+AMLS   +F +  K + R D  K  F+  DGDH TLLN+Y+ + S +  +    +WC    ++Y S+  A NI  QL +++ +     N +  E+    + I+K+L SGFF  +  K +    Y  +   + + IHP + L H + + +++NE   T+K ++  V  +  E + E
Sbjct:   92 ELPVHAQRDEFLKLYQNNQIMVFVGETGSGKTTQIPQFVLFDEMPHLENTQVACTQPRRVAAMSVAQRVAEEMDVKLGEEVGYSIRFENKTSNKTILKYMTDGMLLREAMEDHDLSRYSCIILDEAHERTLATDILMGLLKQVVKRRPDLKIIIMSATLDAEKFQRYFNDAPLLAVPGRTYPVELYYTPEFQRDYLDSAIRTVLQIHATEEAGDILLFLTGEDEIEDAVRKISLEGDQLVREEGCGPLSVYPLYGSLPPHQQQRIFEPAPESHNGRPGRKVVISTNIAETSLTIDGIVYVVDPGFSKQKVYNPRIRVESLLVSPISKASAQQRAGRAGRTRPGKCFRLYTEEAFQKELIEQSYPEILRSNLSSTVLELKKLGIDDLVHFDFMDPPAPETMMRALEELNYLACLDDEGNLTPLGRLASQFPLDPMLAVMLIGSFEFQCSQEILTIVAMLSVPNVFIRPTKDKKRADDAKNIFAHPDGDHITLLNVYHAFKSDEAYEYGIHKWCRDHYLNYRSLSAADNIRSQLERLMNRYNLELNTTDYESPKYFDNIRKALASGFFMQVAKKRSGAKGYITVKDNQDVLIHPSTVLGHDA-EWVIYNEFVLTSKNYIRTVTSVRPEWLIE 720          
BLAST of ATP-dependent RNA helicase DHX8 vs. Ensembl Yeast
Match: PRP16 (DEAH-box RNA helicase involved in second catalytic step of splicing and in exon ligation; exhibits ATP-dependent RNA unwinding activity; mediates the release of Yju2p and Cwc25p in the second step; in the absence of ATP, stabilizes the binding of Cwc25p to the spliceosome in the first catalytic step; missense mutation in human ortholog DHX38 associated with early-onset retinitis pigmentosa [Source:SGD;Acc:S000001794])

HSP 1 Score: 385.956 bits (990), Expect = 1.896e-121
Identity = 244/630 (38.73%), Postives = 369/630 (58.57%), Query Frame = 2
Query:  143 KLPIYEYKDQIVELIRNNQIVIIQGQTGCGKTTQIPQFVLEANLNN--GNMIGITQSRRIAAVSMAKRVAQEKQCNLGSEVGYEIRF-DKKCSASTKIKYMTDGILLNECVTDANLKDYGVVMIDEAHERXXXXXXXXXXXXXVCKSRENLKIIITSATICAEKFSQFFDDSKILTIEGRLFPVEIIY-EGYIMDLIDYSAKLVRRIHIGNE--PGDILVFLTGEEDIERCCKLLRN-----------------VGNLIVTPLYGAIDFQEQQEVFRTMDCGDRKVVVATNIAETSITIDGIRYVIDCGYMKQNKFDSRRGIETLESIKISKAQAEQRKGRSGRTGPGWCYRLYSEGSYN-DFIQEAVPEIKRKDLSEIYLRIIEFNLNPK--DFNFIDXXXXXXXXXXXXXXXDLKIITKEGKLTPSGQNMLGFPVEPRLGKVLMESLNNKCTNDIIKIMAMLSERFIFRKHHKGRGRGDPLK-EFSDHDGDHFTLLNIYNDWISHKQNKQWCISSSIDYNSMQNAYNIFIQLCKILKKNHSFKETVGEK-NAIKKSLISGFFKNICVKTNRGAYTRLYGREVMYIHPQSSL--FHSSPKIILFNEVRKTTKTFMHGVLRLDEEIIREF 1942
            +LP++  + Q++ LIR NQ+V+I G+TG GKTTQ+ Q++ E    N  G  I +TQ RR+AA+S+AKRVA E Q  LG EVGY IRF D   S  TK+K++TDGILL E + D  L  Y  V+IDEAHERSL++DILLG  K++   R +LK+IITSAT+ A+KFS FF ++   TI GR FPV+ IY    + D ++ +     +IH+ N+   GDIL+F+TG+EDIE     L+                  + ++ + P+Y A+    Q ++F+ +    RK+++ATNIAETS+TI GIRYVIDCGY K   ++ + G+++L    ISKA A+QR GR+GRT PG  YRLY+E ++  D   + +PEI+R +LS   L +   ++  +   F FID+PP +    S  EL  +  I   G+LTP G  M  FP++P L K+L+ ++ N C+++++ I++MLS   +F +  + +   D  + +F     DH TLLN++  W ++  +  WC    + Y S+  A +I  QL  ILK       + G+  + IKK + SGF       T    Y  L     + +HP S+L      P  ++++E+  T+K ++  V  +D   + E+
Sbjct:  349 QLPVFRCRSQLLSLIRENQVVVIIGETGSGKTTQLAQYLYEEGYANDRGKSIVVTQPRRVAAISVAKRVAMEMQVPLGKEVGYSIRFEDVTDSECTKLKFVTDGILLRETLLDDTLDKYSCVIIDEAHERSLNTDILLGFFKILLARRRDLKLIITSATMNAKKFSAFFGNAPQFTIPGRTFPVQTIYTSNPVQDYVEAAVSQAVKIHLANDCSSGDILIFMTGQEDIETTFDTLQEKFLQVYSKKFGTANFEEINDIEILPIYSALPADLQFKIFQDLHGTKRKIIIATNIAETSLTIKGIRYVIDCGYSKLKVYNPKIGLDSLVITPISKANADQRSGRAGRTAPGTAYRLYTEDTFKEDMYLQTIPEIQRTNLSNTLLLLKSLDVTDELSKFPFIDKPPLQTFLSSLYELWFIGAIDTSGQLTPLGLQMAKFPLQPSLSKILLIAVRNGCSDEMLTIVSMLSVPQVFYRPKERQKEADIARNKFFIAKSDHLTLLNVFEQWRANNFSSHWCNKHFVQYKSLVRARDIRDQLLTILKSQKIPVISSGKDWDIIKKCICSGFAHQAAKITGLRNYVHLKTGVSVQLHPTSALHGLGDLPPYVVYHELLMTSKEYICCVTSVDPFWLMEY 978          
BLAST of ATP-dependent RNA helicase DHX8 vs. Ensembl Yeast
Match: PRP2 (RNA-dependent DExD/H-box ATPase; required for activation of spliceosome before first transesterification step in RNA splicing; implicated in rearranging and proofreading snRNA structure in catalytic activation of spliceosome; ortholog of human protein DHX16 [Source:SGD;Acc:S000005294])

HSP 1 Score: 360.918 bits (925), Expect = 7.727e-114
Identity = 239/636 (37.58%), Postives = 357/636 (56.13%), Query Frame = 2
Query:  146 LPIYEYKDQIVELIRNNQIVIIQGQTGCGKTTQIPQFVLEANLNNGN--MIGITQSRRIAAVSMAKRVAQEKQCNLGSEVGYEIRF-DKKCSASTKIKYMTDGILLNECVTDANLKDYGVVMIDEAHERXXXXXXXXXXXXXVCKSRENLKIIITSATICAEKFSQFFDDSKILTIEGRLFPVEIIYEGYI-MDLIDYSAKLVRRIHIGNE-PGDILVFLTGEEDIERC--------CKLLRNVGNLIVTPLYGAIDFQEQQEVFRTMDCGDRKVVVATNIAETSITIDGIRYVIDCGYMKQNKFDSRRGIETLESIKISKAQAEQRKGRSGRTGPGWCYRLYSEGSY-NDFIQEAVPEIKRKDLSEIYLRIIEFNLNPK-DFNFIDXXXXXXXXXXXXXXXDLKIITKEGKLTPSGQNMLGFPVEPRLGKVLMESLNNKCTNDIIK----IMAMLSER---FIFRKHHKGRGRGDPLKEFSDHDGDHFTLLNIYNDWISHKQNKQWCISSSIDYNSMQNAYNIFIQLCK------ILKKNHSFKETVGE-----KNAIKKSLISGFFKNICVKTNRGAYT--RLYGREVMYIHPQSSLF-------HSSPKIILFNEVRKTTKTFMHGVLRLDEE 1927
            LP+++YKD++++ I+ NQ++II G+TG GKTTQ+PQ+++E    +     I ITQ RR+AA S+A RVA E    LG EVGY+IRF DK     T +KYMTDG+LL E +TD+ L  Y  +MIDEAHER+L++DIL+GLLK +   R  LK++I+SAT+ A+KFS+FFD+  I  + GR +PV+I Y      + I  +   + +IH     PGDILVFLTG+E+IER          KL      +I+TP+Y  +  ++Q ++F+      RKVV+ATNIAETS+TIDGIRYVID G++K+N +    G+  L ++  S+A  +QR GR+GR GPG C+R++++ SY ++      PEI R +LS   L ++   +     F  +D+P    L +S   L  L  +  +G +T  G+ M  FP EP   KVL  +  ++    +++    I++ML E    FI      G+ R       S+ + DH   L I+N W + K ++ WC    I + +M    NI  QL +      +++KN   +  +G         I +  ISGF  NI      G  T  R  G   + +HP S LF           K +L+ ++  T+K F+   L + +E
Sbjct:  223 LPVHQYKDELLQEIKKNQVLIIMGETGSGKTTQLPQYLVEDGFTDQGKLQIAITQPRRVAATSVAARVADEMNVVLGKEVGYQIRFEDKTTPNKTVLKYMTDGMLLREFLTDSKLSKYSCIMIDEAHERTLATDILIGLLKDILPQRPTLKLLISSATMNAKKFSEFFDNCPIFNVPGRRYPVDIHYTLQPEANYIHAAITTIFQIHTTQSLPGDILVFLTGQEEIERTKTKLEEIMSKLGSRTKQMIITPIYANLPQEQQLKIFQPTPENCRKVVLATNIAETSLTIDGIRYVIDPGFVKENSYVPSTGMTQLLTVPCSRASVDQRAGRAGRVGPGKCFRIFTKWSYLHELELMPKPEITRTNLSNTVLLLLSLGVTDLIKFPLMDKPSIPTLRKSLENLYILGALNSKGTITRLGKMMCEFPCEPEFAKVLYTAATHEQCQGVLEECLTIVSMLHETPSLFI------GQKRDAAASVLSEVESDHILYLEIFNQWRNSKFSRSWCQDHKIQFKTMLRVRNIRNQLFRCSEKVGLVEKNDQARMKIGNIAGYINARITRCFISGFPMNIVQLGPTGYQTMGRSSGGLNVSVHPTSILFVNHKEKAQRPSKYVLYQQLMLTSKEFIRDCLVIPKE 852          
BLAST of ATP-dependent RNA helicase DHX8 vs. Ensembl Yeast
Match: DHR2 (Predominantly nucleolar DEAH-box ATP-dependent RNA helicase; required for 18S rRNA synthesis [Source:SGD;Acc:S000001561])

HSP 1 Score: 328.561 bits (841), Expect = 6.754e-103
Identity = 218/638 (34.17%), Postives = 353/638 (55.33%), Query Frame = 2
Query:  146 LPIYEYKDQIVELIRNNQIVIIQGQTGCGKTTQIPQFVLEA--NLNNGNMIGITQSRRIAAVSMAKRVAQEKQCNLGSEVGYEIRFDKKCSASTKIKYMTDGILLNECVTDANLKDYGVVMIDEAHERXXXXXXXXXXXXXVCKS-RENLKIIITSATICAEKFSQFFDDSKILTIEGRLFPVEIIY-EGYIMDLIDYSAKLVRRIHIGNEPGDILVFLTGEEDIERCCKLLRNVGN---------LIVT-PLYGAIDFQEQQEVFRTMDCGDRKVVVATNIAETSITIDGIRYVIDCGYMKQNKFDSRRGIETLESIKISKAQAEQRKGRSGRTGPGWCYRLYSEGSYNDFIQEAVPEIKRKDLSEIYLRIIEFNLNP-KDFNFIDXXXXXXXXXXXXXXXDLKIITKEGKLTPSGQNMLGFPVEPRLGKVLMESLNNKCTNDIIKIMAMLS-ERFIFRKHHKGRG----RGDPLKEFSDHDGDHFTLLNIYNDWI--------SHKQNKQWCISSSIDYNSMQNAYNIFIQL---CKIL----KKNHSFKETVGEK----NAIKKSLISGFFKNICVKTNRGAYTRLYGREVMYIHPQSSLF-HSSPKIILFNEVRKTTKTFMHGVLRLDEEIIRE 1939
            LP+Y++K +I+  I +N + ++ G+TG GK+TQIPQFVLE   +      I +TQ RR+AA+++A RVAQE  C LG +VGY +RFD   +  T++KY+TDG+LL E + +++L++Y V++IDEAHER++ +D++LG LK + +  R +L+II+ SAT+ AEKFS+FF+++ IL +EGR F V+  Y +    D++D   +   +I+ G E GDIL FL G+E+I++   ++  +           LIV  PLY A+   +Q  VF  +    RKVV +TNIAETS+TI G+++V+D G  K   +  + G+ TL ++ IS+A A QR GR+GR   G  +RLY E  Y    +++ PEI R D++   L +  + ++   ++ + + P +E +    +EL +L  +   GK+T  GQ M   P++P L  VL+++    C + +I I++ LS E  +     + R     R   L       GD   L  +++ +         +  +   WC    I     +N   +  QL   CK L     +     + +GE     + I K  ++GF KN  +     +Y  +   E + IHP S LF + S   I++ E   TTK +   V R++   ++E
Sbjct:   81 LPVYQHKREIMSYIESNPVTVLIGETGSGKSTQIPQFVLEKLYDTKKHGSIAVTQPRRVAAINLATRVAQEHGCKLGEQVGYSVRFDNTTTTRTRLKYLTDGMLLRELMMNSDLREYSVIVIDEAHERTVLTDLILGFLKSLIQGPRPDLRIIVMSATLQAEKFSEFFNNAPILFVEGRKFDVKQYYLKAPTDDIVDAVIRCCIQINQGEELGDILCFLPGQEEIDKAVTIMEKIAKYVSDEAPVPLIVPYPLYAALPAVQQSLVFAPIKGFKRKVVFSTNIAETSVTISGVKFVVDSGLRKVKVWRHQLGLATLLTVPISQASAMQRSGRAGRESEGKSFRLYCESDYVKLPKQSEPEIARSDVTSPVLMLKRYGVDDLLNWTWFENPGKEAIVMGLQELYELGALDTRGKITKRGQQMALLPLQPHLSSVLIKASEVGCLSQVIDIVSCLSVENLLLNPSPEERDEVNERRLSLCNAGKRYGDLIMLKELFDIYFYELGKSQDASSERNDWCKGLCISIRGFKNVIRVRDQLRVYCKRLFSSISEEDEESKKIGEDGELISKILKCFLTGFIKNTAIGMPDRSYRTVSTGEPISIHPSSMLFMNKSCPGIMYTEYVFTTKGYARNVSRIELSWLQE 718          
BLAST of ATP-dependent RNA helicase DHX8 vs. Ensembl Nematostella
Match: EDO32531 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SUS3])

HSP 1 Score: 408.683 bits (1049), Expect = 1.377e-133
Identity = 242/611 (39.61%), Postives = 364/611 (59.57%), Query Frame = 2
Query:  146 LPIYEYKDQIVELIRNNQIVIIQGQTGCGKTTQIPQFVLEANLNNGNMIGITQSRRIAAVSMAKRVAQEKQCNLGSEVGYEIRFDKKCSASTKIKYMTDGILLNECVTDANLKDYGVVMIDEAHERXXXXXXXXXXXXXVCKSREN-----LKIIITSATICAEKFSQFFDDSKILTIEGRLFPVEIIYEGYIMDLIDY-SAKLVRRIHIGNEP---GDILVFLTGEEDIERCCKLLRNVG--------NLIVTPLYGAIDFQEQQEVFRTMDCGDRKVVVATNIAETSITIDGIRYVIDCGYMKQNKFDSRRGIETLESIKISKAQAEQRKGRSGRTGPGWCYRLYSEGSYNDFIQEAVPEIKRKDLSEIYLRIIEFNL-NPKDFNFIDXXXXXX---XXXXXXXXXDLKIITKEGKLTPSGQNMLGFPVEPRLGKVLMESLNNKCTNDIIKIMAMLSERFIFRKHHKGRGRGDPL-KEFSDHDGDHFTLLNIYNDWISHKQNKQWCISSSIDYNSMQNAYNIFIQLCKILKKNHSFKETVGEKNA-IKKSLISGFFKNICVKTNRGAYTRLYGREVMYIHPQSSLFHSSPKIILFNEVRKTTKTFMHGV 1909
            LPI+  +  ++  IRN Q VII G+TG GKTTQIPQ++ EA +   ++I  TQ RR+AA+S+A+RV++E    LG EVGY +RF+   S  T+IKYMTDG+LL E + D+ LK Y V+++DEAHER++ +D+L G++K    SR++     LKI++ SAT+ A +FS++F  +++L IEGR  PVE++Y   +   +DY  A L+  + +  E    GDILVFLTG+++IE   KL+ +           L+V P++ A+   +Q +VFR    G RKV+++TNIAETS+TI G++YVID GY+K   F  + G++ L    +SKAQA QR GR+GR   G CYRLY+E  +    +  VPEI+R +LS + L+++   + +   F+F+D+P  +      +    L  L+ I  + KLT  GQ M  FP+EPRL KV++ S    C+ +I+ ++A+LS   I       R     + K+F   +GD  TLLNIY  +     NK WC    I+   M+   +I  QL +I  +     ++ G+ +A +++ L  G F N       G Y  L  RE + IHP SSLF S P  +++NE+  T+K +M  V
Sbjct:   58 LPIFSARKSLITEIRNRQNVIIVGETGSGKTTQIPQYLYEAKVARNSVIACTQPRRVAAISIAQRVSREMGVQLGEEVGYTVRFEDVTSTKTRIKYMTDGMLLRESIGDSLLKRYSVIILDEAHERTIHTDVLFGIVKGAQISRKDKGMLPLKIVVMSATLEAHQFSEYFGSAEVLYIEGRQHPVELMYA--VEPQVDYMHAALITIMQLHQEKPLGGDILVFLTGQDEIESLSKLVSDCSLHCPPDCPQLLVCPMFAALPSSQQMQVFRPAIPGARKVILSTNIAETSVTIPGVKYVIDTGYVKAKGFHPKTGLDMLRVQPVSKAQARQRLGRAGRECSGVCYRLYTEEQFEQLAEATVPEIQRCNLSSVILQLMALGIADIASFDFMDKPSADAIDGALKQLVILEALQEINGDYKLTSLGQKMAQFPLEPRLAKVILASETLGCSEEILTVVALLSVDSITYTPQSKRDHALKVRKKFLSSEGDQITLLNIYRAYKQCGMNKSWCAEHFINTRVMKLVMDIRKQLREICIRLEIKLQSCGKDSATLRQCLCRGLFMNSAELQLDGTYQTLNHRETVAIHPSSSLFMSKPAYVVYNELVHTSKCYMRDV 666          
BLAST of ATP-dependent RNA helicase DHX8 vs. Ensembl Nematostella
Match: EDO45861 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRP1])

HSP 1 Score: 351.288 bits (900), Expect = 1.182e-112
Identity = 223/576 (38.72%), Postives = 341/576 (59.20%), Query Frame = 2
Query:  140 NKLPIYEYKDQIVELIRNNQIVIIQGQTGCGKTTQIPQFVLEANLN-NGNMIGITQSRRIAAVSMAKRVAQEKQCNLGSEVGYEIRFDKKCSAS-TKIKYMTDGILLNECVTDANLKDYGVVMIDEAHERXXXXXXXXXXXXXVCKSRENLKIIITSATICAEKFSQFF----------DDSKILTIEGRLFPVEIIYE-GYIMDLIDYSAKLVRRIHIGNEPGDILVFLTGEED--------IERCCKLLRNVGNLIVTPLYGAIDFQEQQEVFRTMDCGDRKVVVATNIAETSITIDGIRYVIDCGYMKQNKFDSRRGIETLESIKISKAQAEQRKGRSGRTGPGWCYRLYSEGSYNDFIQEAVPEIKRKDLSEIYLRIIEFNLNPKDFNFIDXXXXXXXXXXXXXXXDLKIITKEGKLT-PSGQNMLGFPVEPRLGKVLMESLNNKCTNDIIKIMAMLSERFIFRKHHKGRGRGD-PLKEFSDHDGDHFTLLNIYNDWISHKQNKQWCISSSIDYNSMQNAYNIFIQLCKILKKNHSFKETV----GEKNAIKKSLISGFFKNICVKTNRGAY 1786
             +LPI++++  I+ L+   + VII G+TGCGK+TQ+ +++LE+    +G  IGITQ RR+AA+++A RVA+E+    G EVGY +RF+       T IK+MTDGILL E + D  L  Y V+MIDEAHER+L +D+LLGLLK + K R +L+II++SAT+ AE F  FF          D + +L++EGR +PV I Y    + + +  + +    IH+   PGDILVFLTG+E+        IER   + +    L V P+Y  + ++EQ  VF+      RKV+VATN+AE SITIDGI YV+DCG++K   +    GIE+L   +IS+A AEQR GR+GR   G  YRLY+E + ++     VPE++R  +  I L+ +  + N   F+F  RPP + + R    L  L  +   GKL  P G  M  FP+EP + K+L+ S   KC+ +I+ I AML  + +F      +   +   ++FS ++GDH T LN++  ++ HK++ +WC  + ++Y  + ++  I  QL K+L+    FK  +    G+ + + + +++GFF N       G Y
Sbjct:   37 QRLPIFKHRTNILYLLEKYETVIIVGETGCGKSTQV-KYLLESGWTADGKKIGITQPRRVAAITVAIRVAEERDTFAGQEVGYCVRFNDCFDPKLTSIKFMTDGILLREVMGDPLLSSYSVIMIDEAHERTLHTDVLLGLLKKIKKKRPDLRIIVSSATLDAEMFKDFFNTNITNDKSKDTAAVLSVEGRSYPVNIEYAISPVANYLQSAVETAMGIHLEEGPGDILVFLTGQEEVESAVSKLIERARGMPKGSSYLKVLPMYSGLPYEEQMLVFKRPPPNTRKVIVATNVAEASITIDGIVYVVDCGFVKLRAYSPATGIESLVVTEISQASAEQRAGRAGRVRAGKAYRLYTEDALHELKPVTVPEMQRYFIG-ILLKSMGID-NVLRFDFPARPPAQSMVRGLELLYALDALDDNGKLVDPLGVQMAEFPLEPMIAKMLLISGEFKCSEEILTIAAMLQIKNVFVTPSSQKAASEHARRKFSVYEGDHLTQLNVHRAFLKHKKSSRWCHDNFVNYKGLMHSVKIREQLKKLLQH---FKIPIVSCDGDVDQVCRCIVAGFFSNAARYHPSGCY 606          
BLAST of ATP-dependent RNA helicase DHX8 vs. Ensembl Nematostella
Match: EDO49560 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGM4])

HSP 1 Score: 346.28 bits (887), Expect = 7.848e-112
Identity = 187/473 (39.53%), Postives = 293/473 (61.95%), Query Frame = 2
Query:  563 VCKSRENLKIIITSATICAEKFSQFFDDSKILTIEGRLFPVEIIYEGYI-MDLIDYSAKLVRRIHIGNEPGDILVFLTGEEDIERCCKLL--------RNVGNLIVTPLYGAIDFQEQQEVFRTMDCGDRKVVVATNIAETSITIDGIRYVIDCGYMKQNKFDSRRGIETLESIKISKAQAEQRKGRSGRTGPGWCYRLYSEGSYND-FIQEAVPEIKRKDLSEIYLRIIEFNLNP-KDFNFIDXXXXXXXXXXXXXXXDLKIITKEGKLTPSGQNMLGFPVEPRLGKVLMESLNNKCTNDIIKIMAMLSERFIFRKHHKGRGRGDPLK-EFSDHDGDHFTLLNIYNDWISHKQNKQWCISSSIDYNSMQNAYNIFIQLCKILKKNHSFKETVGEKNA-IKKSLISGFFKNICVKTNRGAYTRLYGREVMYIHPQSSLFHSSPKIILFNEVRKTTKTFMHGVLRLDEEIIREF 1942
              + R +LK+I+TSAT+ A KFS FF ++ I TI GR FPVEI+Y      D +D +   V +IH+   PGDILVFLTG+E+I+  C++L         +V  LI+ P+Y A+  + Q  +F     G RK V+ATNIAETS+TIDGI YV+D G++KQN ++S+ G++ L    IS+AQA+QR GR+GRTGPG CYRLY+E +Y D  +  AVPEI+R +L+   L +    +N    F+F+D PP E +  +   L  L  +  EG LT  G+ M  FP+EP+L K+L++S++  C+++I+ I++MLS + +F +    +   D  K +F   +GDH TLL +YN W ++K +  WC  + +   S++ A +I  Q+  ++ ++     + G+  A ++K++ SGFF+N   K  +  Y  +   +V+YIHP S+LF+  P+ ++++E+  TTK +M  V  +D + + EF
Sbjct:    4 AVQRRPDLKLIVTSATLDAVKFSTFFFEAPIFTIPGRTFPVEILYTKEAESDYLDAALITVMQIHLTEPPGDILVFLTGQEEIDTACEILYERTKSLGPDVPELIILPVYSALPSEMQTRIFDPAPPGSRKCVIATNIAETSLTIDGIYYVVDPGFVKQNVYNSKSGMDALVVTPISQAQAKQRSGRAGRTGPGKCYRLYTERAYRDEMLATAVPEIQRTNLASTILSLKAMGINDLLSFDFMDPPPMETMISAMEALHSLSALDNEGLLTRLGRRMAEFPLEPQLSKMLIQSVHLGCSDEILTIVSMLSVQNVFYRPKDKQALADQKKAKFHQPEGDHLTLLAVYNSWKNNKFSNAWCFENFVQARSLRRAQDIRKQMLGLMDRHKLDVVSCGKHTARVQKAITSGFFRNAARKDPQEGYRTVVDNQVVYIHPSSALFNRQPEWVVYHELVLTTKEYMREVTTIDPKWLVEF 476          
BLAST of ATP-dependent RNA helicase DHX8 vs. Ensembl Nematostella
Match: EDO32629 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SUG0])

HSP 1 Score: 297.745 bits (761), Expect = 1.024e-93
Identity = 186/468 (39.74%), Postives = 283/468 (60.47%), Query Frame = 2
Query:  428 KYMTDGILLNECVTDANLKDYGVVMIDEAHERXXXXXXXXXXXXXVCKSRENLKIIITSATICAEKFSQFFDDSKILTIEGRLFPVEIIYEGYI-MDLIDYSAKLVRRIHIGNE-PGDILVFLTGEEDIERCCKLLRN--------VGNLIVTPLYGAIDFQEQQEVF------RTMDCGDRKVVVATNIAETSITIDGIRYVIDCGYMKQNKFDSRRGIETLESIKISKAQAEQRKGRSGRTGPGWCYRLYSEGSYN-DFIQEAVPEIKRKDLSEIYLRIIEFNLNP-KDFNFIDXXXXXXXXXXXXXXXDLKIITKEGKLTPSGQNMLGFPVEPRLGKVLMESLNNKCTNDIIKIMAMLSERFIFRKHHKGRGRGDPLK-EFSDHDGDHFTLLNIYNDWISHKQNKQWCISSSIDYNSMQNAYNIFIQLCKILKKNHSFKETVGEKNA-----IKKSLISGFFKNI 1759
            +YMTDG+LL E +TD  L  Y V+++DEAHER+L++DIL+GLLK V K R++LKIII SAT+ A KF  +FD   ++TI GR  PVEI Y      D ++ + + V +IH+  E  GDIL+FLTG+E+IE  CK ++         +G L   PLY  +   +QQ +F      R      RK VVATNIAETS+TIDG+ +VID G+ KQ  ++ R  +E+L    IS+A A+QR GR+GRT PG C+RLY+E ++  +      PEI R +L  + L++ +  ++    F+F+D P  E L R+   L  L  +   G LT  G  M  FP++P+L K+++ S    C+N+I+ I +MLS   +F + ++ +   D  K +F+  DGDH TLLN+Y+ +  + ++ QWC  + I + SM++A N+  QL +I+ + +  + +    +      I+K+L+SGFF  +
Sbjct:    1 RYMTDGMLLREAMTDPLLDRYAVILLDEAHERTLATDILMGLLKEVAKQRDDLKIIIMSATLDAGKFQDYFDHCPLMTIPGRTHPVEIFYTPEPERDYLEAAIRTVIQIHMVEEVKGDILLFLTGQEEIEEACKRIKKEVDNLGSEIGELKCIPLYSTLPPTQQQRIFEAAPPDRPNGAIGRKCVVATNIAETSLTIDGVVFVIDPGFSKQKVYNPRIRVESLLVSAISRASAQQRAGRAGRTRPGKCFRLYTEKAFQEEMPPNTYPEILRSNLGTVVLQLKKLGIDDLVHFDFMDPPAPETLMRALELLNYLGALDDNGDLTELGSMMAEFPLDPQLAKMVIASCEFNCSNEILSITSMLSVPQVFLRPNEAKKAADESKMKFAHIDGDHLTLLNVYHAYKQNHEDTQWCYDNFIQHRSMKSADNVRGQLARIMDRFNLQRRSTDFNSRDYYLNIRKALVSGFFMQV 468          
BLAST of ATP-dependent RNA helicase DHX8 vs. Ensembl Nematostella
Match: EDO35622 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SKZ8])

HSP 1 Score: 298.13 bits (762), Expect = 6.218e-90
Identity = 160/332 (48.19%), Postives = 224/332 (67.47%), Query Frame = 2
Query:  146 LPIYEYKDQIVELIRNNQIVIIQGQTGCGKTTQIPQFVLEANLNNGNMIGITQSRRIAAVSMAKRVAQEKQCNLGSEVGYEIRFDKKCSASTKIKYMTDGILLNECVTDANLKDYGVVMIDEAHERXXXXXXXXXXXXXVCKSRENLKIIITSATICAEKFSQFFDDSKILTIEGRLFPVEIIYEGYIM-DLIDYSAKLVRRIHIGNEPGDILVFLTGEEDIERCCKLL-------RNVGNLIVTPLYGAIDFQEQQEVFRTMDCGDRKVVVATNIAETSITIDGIRYVIDCGYMKQNKFDSRRGIETLESIKISKAQAEQRKGRSGRTGPG 1117
            LPI+  + +++ ++R+NQ+VII G+TG GKTTQ+ Q++ E    N  MIG TQ RR+AA+S+AKRV++E  C+LG EVGY IRF+   S  T IKYMTDGILL E + +++L  Y V+++DEAHERSL++D+L GLL+ V   R +LK+I+TSAT+ A+KF+ FF +     I GR FPVEI +   +M D +D + K   +IH+    GDILVF+ G+EDIE  C+L+            L V P+Y  +    Q ++F+    G RK VVATNIAETS+T+DGI +VID GY K   ++ + G++ L+   IS+A A QR GR+GRTGPG
Sbjct:  527 LPIFAVRQELLSIVRDNQVVIIVGETGSGKTTQLTQYMHEDGYTNYGMIGCTQPRRVAAMSVAKRVSEEMDCSLGEEVGYAIRFEDVTSDKTMIKYMTDGILLRESLRESDLDHYSVIIMDEAHERSLNTDVLFGLLRDVVSRRRDLKLIVTSATMDAQKFADFFGNVPTYKIPGRTFPVEIFFTRTVMEDYVDSAVKQALQIHLTPSKGDILVFMPGQEDIEVTCELISERLAEVEEAPPLAVLPIYSQLPSDLQAKIFQKAPDGVRKCVVATNIAETSLTVDGIMFVIDAGYCKLKVYNPKIGMDALQVYPISQANANQRSGRAGRTGPG 858          
BLAST of ATP-dependent RNA helicase DHX8 vs. Ensembl Medaka
Match: dhx8 (DEAH-box helicase 8 [Source:NCBI gene;Acc:101162325])

HSP 1 Score: 476.478 bits (1225), Expect = 1.058e-153
Identity = 263/612 (42.97%), Postives = 393/612 (64.22%), Query Frame = 2
Query:  146 LPIYEYKDQIVELIRNNQIVIIQGQTGCGKTTQIPQFVLEANLNNGNMIGITQSRRIAAVSMAKRVAQEKQCNLGSEVGYEIRFDKKCSASTKIKYMTDGILLNECVTDANLKDYGVVMIDEAHERXXXXXXXXXXXXXVCKSRENLKIIITSATICAEKFSQFFDDSKILTIEGRLFPVEIIYEGYI-MDLIDYSAKLVRRIHIGNEPGDILVFLTGEEDIERCCKLL--------RNVGNLIVTPLYGAIDFQEQQEVFRTMDCGDRKVVVATNIAETSITIDGIRYVIDCGYMKQNKFDSRRGIETLESIKISKAQAEQRKGRSGRTGPGWCYRLYSEGSYND-FIQEAVPEIKRKDLSEIYLRIIEFNLNP-KDFNFIDXXXXXXXXXXXXXXXDLKIITKEGKLTPSGQNMLGFPVEPRLGKVLMESLNNKCTNDIIKIMAMLSERFIFRKHHKGRGRGDPLK-EFSDHDGDHFTLLNIYNDWISHKQNKQWCISSSIDYNSMQNAYNIFIQLCKILKKNHSFKETVGEKNA-IKKSLISGFFKNICVKTNRGAYTRLYGREVMYIHPQSSLFHSSPKIILFNEVRKTTKTFMHGVLRLDEEIIREF 1942
            LPIY+ K+Q+V+ + +NQI+I+ G+TG GKTTQI Q++ EA       IG TQ RR+AA+S+AKRV++E  C LG EVGY IRF+   S  T IKYMTDG+LL EC+ D+ L  Y ++M+DEAHER++ +D+L GLLK   + R ++K+I+TSAT+ A KFSQ+F ++ I TI GR +PVE++Y      D +D S   V +IH+   PGDILVFLTG+E+I+  C++L         +V  LI+ P+Y A+  + Q  +F     G RKVV+ATNIAETS+TIDGI YV+D G++KQ  ++S+ GI+ L    IS+AQA+QR GR+GRTGPG CYRLY+E +Y D  +   VPEI+R +L+   L +    +N    F+F+D PP E L  +  +L  L  +  EG LT  G+ M  FP+EP L K+L+ S++  C+ +++ I++MLS + +F +    +   D  K +F   +GDH TLL +YN W ++K +  WC  + I   S++ A +I  Q+  I+ ++     + G+    ++K++ SGFF+N   K  +  Y  L  ++V+YIHP S+LF+  P+ ++++E+  TTK +M  V  +D   + EF
Sbjct:  561 LPIYKLKEQLVQAVHDNQILIVIGETGSGKTTQITQYLAEAGYTARGKIGCTQPRRVAAMSVAKRVSEEYGCCLGQEVGYTIRFEDCTSPETVIKYMTDGMLLRECLIDSELGQYAIIMLDEAHERTIHTDVLFGLLKKTVQKRTDMKLIVTSATLDAVKFSQYFYEAPIFTIPGRTYPVEVLYTKEPETDYLDASLITVMQIHLTEPPGDILVFLTGQEEIDTACEILYERMKSLGPDVPELIILPVYSALPSEMQTRIFDPAPPGSRKVVIATNIAETSLTIDGIYYVVDPGFVKQKVYNSKTGIDQLVVTPISQAQAKQRAGRAGRTGPGKCYRLYTERAYRDEMLTTNVPEIQRTNLASTVLSLKAMGINDLLSFDFMDAPPMETLITAMEQLYTLGALDDEGLLTRLGRRMAEFPLEPMLCKMLIMSVHLGCSEEMLTIVSMLSVQNVFYRPKDKQALADQKKAKFHQPEGDHLTLLAVYNSWKNNKFSNPWCYENFIQARSLRRAQDIRKQMLGIMDRHKLDVVSCGKATVRVQKAICSGFFRNAAKKDPQEGYRTLIDQQVVYIHPSSALFNRQPEWVVYHELVLTTKEYMREVTTIDPRWLVEF 1172          
BLAST of ATP-dependent RNA helicase DHX8 vs. Ensembl Medaka
Match: dhx16 (DEAH-box helicase 16 [Source:NCBI gene;Acc:101168894])

HSP 1 Score: 437.573 bits (1124), Expect = 2.181e-140
Identity = 246/607 (40.53%), Postives = 372/607 (61.29%), Query Frame = 2
Query:  146 LPIYEYKDQIVELIRNNQIVIIQGQTGCGKTTQIPQFVLEANLNNGNM-IGITQSRRIAAVSMAKRVAQEKQCNLGSEVGYEIRFDKKCSASTKIKYMTDGILLNECVTDANLKDYGVVMIDEAHERXXXXXXXXXXXXXVCKSRENLKIIITSATICAEKFSQFFDDSKILTIEGRLFPVEIIY-EGYIMDLIDYSAKLVRRIHIGNEPGDILVFLTGEEDIERCCKLLRN--------VGNLIVTPLYGAIDFQEQQEVFRTMDCGDRKVVVATNIAETSITIDGIRYVIDCGYMKQNKFDSRRGIETLESIKISKAQAEQRKGRSGRTGPGWCYRLYSEGSYNDFIQE-AVPEIKRKDLSEIYLRIIEFNLNPK-DFNFIDXXXXXXXXXXXXXXXDLKIITKEGKLTPSGQNMLGFPVEPRLGKVLMESLNNKCTNDIIKIMAMLS--ERFIFRKHHKGRGRGDPLKEFSDHDGDHFTLLNIYNDWISHKQNKQWCISSSIDYNSMQNAYNIFIQLCKILKK-NHSFKETVGEKNAIKKSLISGFFKNICVKTNRGAYTRLYGREVMYIHPQSSLFHSSPKIILFNEVRKTTKTFMHGVLRLD 1921
            LPI+ Y++ ++  I  +Q+++I+G+TG GKTTQIPQ+++E    NG M IG TQ RR+AA+S+A RVA+E    LG+EVGY IRF+   S  T +KYMTDG+LL E +T+ +L  Y V++IDEAHER+L +DIL GL+K + + R +LK+++ SAT+  E+FS FFDD+ +  I GR FPV+I Y +    D +D     V +IH+   PGDILVFLTG+E+IE CC+LL+         +  L+V P+Y  +    Q ++F     G RKVVVATNIAETS+TIDGI YVID G+ KQ  +++R G+E+L     S+A A QR GR+GR   G C+RLY+  ++   ++E  VPEI+R +L  + L +    +N    F+F+D PP E L  +  +L  L  +   G+LT  G+ M   PV+P L K+++ S   KC+ +++ I AMLS      +R   K     +    F    GDH  LLN+Y  W+    + QWC  + I + SM+ A ++  QL  ++++         GE   I+K++ +G+F +   + ++G Y  +  ++ +Y HP SSLF   P+ ++++E+  TTK FM  V+ ++
Sbjct:  410 LPIFPYREDLLAAINEHQVLVIEGETGSGKTTQIPQYLMEEGYTNGGMKIGCTQPRRVAAMSVAARVAEEIGVKLGNEVGYSIRFEDCTSERTVLKYMTDGMLLREFLTEPDLASYSVILIDEAHERTLHTDILFGLIKDIARFRPDLKVLVASATLDTERFSSFFDDAPVFRIPGRRFPVDIFYTKAPEADYLDACVVSVLQIHVTQPPGDILVFLTGQEEIEACCELLQERCRRLGSKIAELLVLPIYANLPSDMQAKIFTPTPPGARKVVVATNIAETSLTIDGIIYVIDPGFCKQKSYNARTGMESLIVTPCSRASANQRAGRAGRVAAGKCFRLYTAWAFKHEMEETTVPEIQRTNLGNVVLLLKSLGINDLIHFDFMDPPPHETLVLALEQLYALGALNHLGELTKLGRRMAELPVDPMLSKMILASEQYKCSEEVLTIAAMLSVNNSIFYRPKDKVVHADNARMNFVVPGGDHLVLLNVYTQWVESGFSTQWCYENFIQFRSMRRARDVRDQLEGLMERIEVEVVSCQGENVPIRKAVTAGYFYHTA-RLSKGGYKTVKHQQTVYTHPNSSLFEEQPRWLIYHELVFTTKEFMRQVIEIE 1015          
BLAST of ATP-dependent RNA helicase DHX8 vs. Ensembl Medaka
Match: zgc:158828 (DEAH-box helicase 35 [Source:NCBI gene;Acc:101161239])

HSP 1 Score: 424.861 bits (1091), Expect = 1.759e-139
Identity = 244/633 (38.55%), Postives = 383/633 (60.51%), Query Frame = 2
Query:  140 NKLPIYEYKDQIVELIRNNQIVIIQGQTGCGKTTQIPQFVLEANL-NNGNMIGITQSRRIAAVSMAKRVAQEKQCNLGSEVGYEIRFDKKCS--ASTKIKYMTDGILLNECVTDANLKDYGVVMIDEAHERXXXXXXXXXXXXXVCKSRENLKIIITSATICAEKFSQFF----------DDSKILTIEGRLFPVEIIYE-GYIMDLIDYSAKLVRRIHIGNEPGDILVFLTGEEDIERCCKLLRNVG----------NLIVTPLYGAIDFQEQQEVFRTMDCGDRKVVVATNIAETSITIDGIRYVIDCGYMKQNKFDSRRGIETLESIKISKAQAEQRKGRSGRTGPGWCYRLYSEGSYNDFIQEAVPEIKRKDLSEIYLRIIEFNL-NPKDFNFIDXXXXXXXXXXXXXXXDLKIITKEGKLT-PSGQNMLGFPVEPRLGKVLMESLNNKCTNDIIKIMAMLSERFIF-RKHHKGRGRGDPLKEFSDHDGDHFTLLNIYNDWISHKQNKQWCISSSIDYNSMQNAYNIFIQLCKILKKNHSFK----ETVGEKNAIKKSLISGFFKNICVKTNRGAYTRLYGREVMYIHPQSSLF-HSSPKIILFNEVRKTTKTFMHGVLRLDEEIIREF 1942
             KLP++++++ I+ L+ + Q VI+ G+TGCGKTTQIPQ+++EA     G ++G+TQ RR+AA+S+A RVA+E+   LG EVGY IRFD  CS   +T+IK++TDG+L+ E + D  L  Y V+M+DEAHER+L +DI +GLLK + K R +L++I+ SAT+ A+KF +FF          D   ILT+EGR FPV+I Y    + D +  + + V +IH   + GD+L FLTG+E++E+   LL++            +L + P+Y  + + EQ  VF  +    RKVVVATNIAETSITI+GI +VIDC ++K   ++ R  IE+L    ISKA A QR GR+GR  PG C+RLY+E  Y+      VPE++R +L+ + L++    + N   F+F+  PP + + ++   L  L  +   G+LT P G  M  FP+ P   K+L+ES N  C+ +I+ I AM+  + IF    ++ +      ++F+  +GDH T+LN+Y  ++ H+++ QWC    ++Y  +  A  +  QL +++ K   FK     + G+ + I + +++GFF N     + G+Y  L     ++IHP S L+    PK ++FNEV +T+K +M  V  ++   + E 
Sbjct:   50 QKLPVFKHRNNILYLVESFQTVIVVGETGCGKTTQIPQYLVEAGWATEGKVVGVTQPRRVAAISVANRVAEERGALLGHEVGYTIRFDD-CSDPHATRIKFLTDGMLVREMMADPLLTKYSVLMLDEAHERTLYTDIAIGLLKKIQKKRRDLRVIVASATLDAKKFHEFFNLNESGDPNKDTCGILTVEGRCFPVDIFYTVSPVPDYVKATVETVMKIHETEDDGDVLAFLTGQEEVEKVVSLLQDQARSLSRYGMKKHLRILPMYSGLPYAEQMRVFERVPPTVRKVVVATNIAETSITINGIVFVIDCAFVKLRAYNPRTAIESLVVTPISKASASQRAGRAGRNRPGKCFRLYTEEDYDKLPASTVPEMQRTNLAPVILQLKALGIDNVLRFSFLSPPPAQTMVQALELLYALGGLDHYGRLTDPMGVRMAEFPLSPMFAKMLLESGNFGCSKEIVTIAAMMQIQNIFVVPPNQKKVAAREHRKFAVAEGDHLTMLNVYEAFMKHQKSSQWCQEHFLNYKGLLRAVTVREQLRRLMNK---FKVPRTSSEGDPDVILRCIVAGFFANAARIHHSGSYRTLRDDRELHIHPNSVLYVEKPPKWVVFNEVVQTSKYYMRDVTAVESSWLVEL 678          
BLAST of ATP-dependent RNA helicase DHX8 vs. Ensembl Medaka
Match: dhx15 (pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15 [Source:NCBI gene;Acc:101166992])

HSP 1 Score: 407.912 bits (1047), Expect = 1.070e-132
Identity = 241/638 (37.77%), Postives = 387/638 (60.66%), Query Frame = 2
Query:  143 KLPIYEYKDQIVELIRNNQIVIIQGQTGCGKTTQIPQF---VLEANLNNGNMIGITQSRRIAAVSMAKRVAQEKQCNLGSEVGYEIRFDKKCSASTKIKYMTDGILLNECVTDANLKDYGVVMIDEAHERXXXXXXXXXXXXXVCKSRENLKIIITSATICAEKFSQFFDDSKILTIEGRLFPVEIIYEGYI-MDLIDYSAKLVRRIHI-GNEPGDILVFLTGEEDIERCCKLLR--------NVGNLIVTPLYGAIDFQEQQEVFRTMDCGD------RKVVVATNIAETSITIDGIRYVIDCGYMKQNKFDSRRGIETLESIKISKAQAEQRKGRSGRTGPGWCYRLYSEGSYNDFIQE-AVPEIKRKDLSEIYLRIIEFNLNP-KDFNFIDXXXXXXXXXXXXXXXDLKIITKEGKLTPSGQNMLGFPVEPRLGKVLMESLNNKCTNDIIKIMAMLSERFIFRKHHKGRGRGDPLK-EFSDHDGDHFTLLNIYNDWISHKQNKQWCISSSIDYNSMQNAYNIFIQLCKILKKNHSFKETVGEKNA-----IKKSLISGFFKNICVKTNRGAYTRLYGREVMYIHPQSSLFHSSPKIILFNEVRKTTKTFMHGVLRLDEE-IIREFPEELKIINYP 1972
            +LP++EY+++  E++  NQ  ++ G+TG GKTTQIPQ+   ++ +       +  TQ RR+AA+S+A+RVA E    LG EVGY IRF+   SA T +KYMTDG+LL E + D  L+ YGV+++DEAHER+L++DIL+G+LK + + R +LK+I+ SAT+ A KF  +FD+  +LTI GR  PVEI Y      D ++ + + V ++H+   E GD+L+FLTG+E+I+  CK ++         VG++ + PLY  +  Q+QQ +F             RKVVV+TNIAETS+TIDG+ +VID G+ KQ  ++ R  +E+L    +SKA A+QR GR+GRT PG C+RLY+E +Y   +Q+   PEI R +L  + L++ +  ++    F+F+D P  E L R+   L  L  +  +G LT  G  M  FP++P+L K+++ S    C+N+I+ I AMLS    F +  + +   D  K  F+  DGDH TLLN+Y+ +  + ++ QWC  + ++Y S+ +A N+  QL +I+++ +  + +    +      I+++L++GFF  +      G Y  +   +V+ +HP + L H  P+ +L+NE   TTK ++     +  E ++R  P+   + N+P
Sbjct:   48 QLPVWEYRERFTEILMRNQSFVLVGETGSGKTTQIPQWCVDMVRSLQGPKRAVACTQPRRVAAMSVAQRVADEMDVMLGQEVGYSIRFEDCSSAKTVLKYMTDGMLLREAMNDPLLERYGVIILDEAHERTLATDILMGVLKEIVRQRTDLKVIVMSATLDAGKFQVYFDNCPLLTIPGRTHPVEIFYTPEPERDYLEAAIRTVIQLHMCEEEEGDVLLFLTGQEEIDEACKRIKREVEDLGPEVGDMKIIPLYSTLPPQQQQRIFEPSPPNKPNGAIGRKVVVSTNIAETSLTIDGVVFVIDPGFAKQKVYNPRIRVESLLVTAVSKASAQQRAGRAGRTRPGKCFRLYTEKAYKTEMQDNTYPEILRSNLGTVVLQLKKLGIDDLVHFDFMDPPAPETLMRALELLNFLAALNDDGDLTELGAMMAEFPLDPQLAKMVIASCEYNCSNEILTITAMLSVPQCFVRPTEAKKVADESKLRFAHIDGDHLTLLNVYHAFKQNHESTQWCYDNFVNYRSLMSADNVRQQLSRIMERFNLPRRSTEFSSRDYYINIRRALVTGFFMQVAHLERTGHYLTVKDNQVVQLHPSTVLDH-KPEWVLYNEFVLTTKNYIRTCTDVKPEWLMRIAPQYYDLGNFP 684          
BLAST of ATP-dependent RNA helicase DHX8 vs. Ensembl Medaka
Match: dhx15 (pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15 [Source:NCBI gene;Acc:101166992])

HSP 1 Score: 407.912 bits (1047), Expect = 1.931e-132
Identity = 241/638 (37.77%), Postives = 387/638 (60.66%), Query Frame = 2
Query:  143 KLPIYEYKDQIVELIRNNQIVIIQGQTGCGKTTQIPQF---VLEANLNNGNMIGITQSRRIAAVSMAKRVAQEKQCNLGSEVGYEIRFDKKCSASTKIKYMTDGILLNECVTDANLKDYGVVMIDEAHERXXXXXXXXXXXXXVCKSRENLKIIITSATICAEKFSQFFDDSKILTIEGRLFPVEIIYEGYI-MDLIDYSAKLVRRIHI-GNEPGDILVFLTGEEDIERCCKLLR--------NVGNLIVTPLYGAIDFQEQQEVFRTMDCGD------RKVVVATNIAETSITIDGIRYVIDCGYMKQNKFDSRRGIETLESIKISKAQAEQRKGRSGRTGPGWCYRLYSEGSYNDFIQE-AVPEIKRKDLSEIYLRIIEFNLNP-KDFNFIDXXXXXXXXXXXXXXXDLKIITKEGKLTPSGQNMLGFPVEPRLGKVLMESLNNKCTNDIIKIMAMLSERFIFRKHHKGRGRGDPLK-EFSDHDGDHFTLLNIYNDWISHKQNKQWCISSSIDYNSMQNAYNIFIQLCKILKKNHSFKETVGEKNA-----IKKSLISGFFKNICVKTNRGAYTRLYGREVMYIHPQSSLFHSSPKIILFNEVRKTTKTFMHGVLRLDEE-IIREFPEELKIINYP 1972
            +LP++EY+++  E++  NQ  ++ G+TG GKTTQIPQ+   ++ +       +  TQ RR+AA+S+A+RVA E    LG EVGY IRF+   SA T +KYMTDG+LL E + D  L+ YGV+++DEAHER+L++DIL+G+LK + + R +LK+I+ SAT+ A KF  +FD+  +LTI GR  PVEI Y      D ++ + + V ++H+   E GD+L+FLTG+E+I+  CK ++         VG++ + PLY  +  Q+QQ +F             RKVVV+TNIAETS+TIDG+ +VID G+ KQ  ++ R  +E+L    +SKA A+QR GR+GRT PG C+RLY+E +Y   +Q+   PEI R +L  + L++ +  ++    F+F+D P  E L R+   L  L  +  +G LT  G  M  FP++P+L K+++ S    C+N+I+ I AMLS    F +  + +   D  K  F+  DGDH TLLN+Y+ +  + ++ QWC  + ++Y S+ +A N+  QL +I+++ +  + +    +      I+++L++GFF  +      G Y  +   +V+ +HP + L H  P+ +L+NE   TTK ++     +  E ++R  P+   + N+P
Sbjct:   75 QLPVWEYRERFTEILMRNQSFVLVGETGSGKTTQIPQWCVDMVRSLQGPKRAVACTQPRRVAAMSVAQRVADEMDVMLGQEVGYSIRFEDCSSAKTVLKYMTDGMLLREAMNDPLLERYGVIILDEAHERTLATDILMGVLKEIVRQRTDLKVIVMSATLDAGKFQVYFDNCPLLTIPGRTHPVEIFYTPEPERDYLEAAIRTVIQLHMCEEEEGDVLLFLTGQEEIDEACKRIKREVEDLGPEVGDMKIIPLYSTLPPQQQQRIFEPSPPNKPNGAIGRKVVVSTNIAETSLTIDGVVFVIDPGFAKQKVYNPRIRVESLLVTAVSKASAQQRAGRAGRTRPGKCFRLYTEKAYKTEMQDNTYPEILRSNLGTVVLQLKKLGIDDLVHFDFMDPPAPETLMRALELLNFLAALNDDGDLTELGAMMAEFPLDPQLAKMVIASCEYNCSNEILTITAMLSVPQCFVRPTEAKKVADESKLRFAHIDGDHLTLLNVYHAFKQNHESTQWCYDNFVNYRSLMSADNVRQQLSRIMERFNLPRRSTEFSSRDYYINIRRALVTGFFMQVAHLERTGHYLTVKDNQVVQLHPSTVLDH-KPEWVLYNEFVLTTKNYIRTCTDVKPEWLMRIAPQYYDLGNFP 711          
BLAST of ATP-dependent RNA helicase DHX8 vs. Planmine SMEST
Match: SMESG000038861.1 (SMESG000038861.1)

HSP 1 Score: 624.78 bits (1610), Expect = 0.000e+0
Identity = 314/602 (52.16%), Postives = 436/602 (72.43%), Query Frame = 2
Query:  143 KLPIYEYKDQIVELIRNNQIVIIQGQTGCGKTTQIPQFVLEANLNNGNMIGITQSRRIAAVSMAKRVAQEKQCNLGSEVGYEIRFDKKCSASTKIKYMTDGILLNECVTDANLKDYGVVMIDEAHERXXXXXXXXXXXXXVCKSRENLKIIITSATICAEKFSQFFDDSKILTIEGRLFPVEIIYEGYI-MDLIDYSAKLVRRIHIGNEPGDILVFLTGEEDIERCCKLLRNVGNLIVTPLYGAIDFQEQQEVFRTMDCGDRKVVVATNIAETSITIDGIRYVIDCGYMKQNKFDSRRGIETLESIKISKAQAEQRKGRSGRTGPGWCYRLYSEGSYNDFIQEAVPEIKRKDLSEIYLRIIEFNLNPKDFNFIDXXXXXXXXXXXXXXXDLKIITKEGKLTPSGQNMLGFPVEPRLGKVLMESLNNKCTNDIIKIMAMLSERFIFRKHHKGRGRGDPLKEFSDHDGDHFTLLNIYNDWISHKQNKQWCISSSIDYNSMQNAYNIFIQLCKILKKNHSFKETVGE--KNAIKKSLISGFFKNICVKTNRGAYTRLYGREVMYIHPQSSLFHSSPKIILFNEVRKTTKTFMHGVLRLDEEIIRE 1939
            +LPIY +KD+I+  I +NQ+VII G+TG GKTTQIP+++ E  L+   MIGITQ RRI A++MAKRVA+E  C +G EVGYEIRFD    AST++KYMTDGILLN+C TD NLKDYG++MIDEAHER+L SD+LLGLLK +     N+K+I+ SAT+  +KFS++F ++ I+ I G+LFPVEIIYE     + ID S + V  IH   E GDILVFLT +E+IE+C  LLR + +L+V PL+ A+++ EQQ+VF  +   +RK +++TNIAETS+TIDG+R++IDCGY+KQ+ F++R GI+  E +KISKAQA QRKGR+GRT  GWCYRLY E  YN F  +  PEI+RK+LSEIYL+++ F LNPK F FID P  + L +SE+EL +LK + K G++T  G+ M  FPVEP +GK+++ S++NKC  D+I I++ML+ER IF    + R   D   EF D DGD FT+L +Y +W+ ++++++WC S  IDY  M+    +  QL  ILK+   + E   E  K AIKKS+ +G++KN+C +    +Y+R    E+++IHP SSLF  +P+ IL+ EVRKT K++MHG+++LDE   +E
Sbjct:   28 QLPIYSFKDEILNCIMDNQVVIIHGETGSGKTTQIPKYIYELGLHGNAMIGITQPRRIGAINMAKRVAEETNCAIGKEVGYEIRFDNSSGASTRVKYMTDGILLNQCTTDPNLKDYGIIMIDEAHERALRSDVLLGLLKSIVSRSSNIKVIVASATMDTKKFSRYFYNAPIIYITGKLFPVEIIYEPLQGENYIDASVRKVNEIHRKPEKGDILVFLTSQEEIEKCTDLLRGIKDLLVLPLFSALEYDEQQKVFEEVKDYERKAIISTNIAETSLTIDGVRFIIDCGYVKQSNFNARLGIDIWEDVKISKAQANQRKGRAGRTSNGWCYRLYGENEYNRFSDQEKPEIQRKNLSEIYLKVVSFGLNPKTFEFIDPPSSDALLKSEKELKELKFLDKFGEITEEGKLMENFPVEPTIGKIILSSISNKCVGDMIIILSMLTERNIFLSTRRDRFSKDTRSEFFDDDGDPFTMLKVYKEWLKNEKSEKWCKSYLIDYRKMEKVCLVQEQLILILKRQRQYSEPNPEINKEAIKKSIFAGYYKNVCQRKRGFSYSRCLDEEILFIHPSSSLFDKNPEYILYEEVRKTKKSYMHGIMKLDESYWKE 629          
BLAST of ATP-dependent RNA helicase DHX8 vs. Planmine SMEST
Match: SMESG000038864.1 (SMESG000038864.1)

HSP 1 Score: 594.349 bits (1531), Expect = 0.000e+0
Identity = 308/608 (50.66%), Postives = 432/608 (71.05%), Query Frame = 2
Query:  128 KSPPNKLPIYEYKDQIVELIRNNQIVIIQGQTGCGKTTQIPQFVLEANLNNGNMIGITQSRRIAAVSMAKRVAQEKQCNLGSEVGYEIRFDKKCSASTKIKYMTDGILLNECVTDANLKDYGVVMIDEAHERXXXXXXXXXXXXXVCKSRENLKIIITSATICAEKFSQFFDDSKILTIEGRLFPVEIIYEGY-IMDLIDYSAKLVRRIHIGNEPGDILVFLTGEEDIERCCKLLRNVG--NLIVTPLYGAIDFQEQQEVFRTMDCGDRKVVVATNIAETSITIDGIRYVIDCGYMKQNKFDSRRGIETLESIKISKAQAEQRKGRSGRTGPGWCYRLYSEGSYNDFIQEAVPEIKRKDLSEIYLRIIEFNLNPKDFNFIDXXXXXXXXXXXXXXXDLKIITKEGKLTPSGQNMLGFPVEPRLGKVLMESLNNKCTNDIIKIMAMLSERFIFRKHHKGRGRGDPLK-EFSDHDGDHFTLLNIYNDWISHKQNKQWCISSSIDYNSMQNAYNIFIQLCKILKKNHSFKE--TVGEKNAIKKSLISGFFKNICVKTNRGAYTRLYGREVMYIHPQSSLFHSSPKIILFNEVRKTTKTFMHGVLRLDEEII 1933
            KS  N+LPI  Y+D IV+ I  NQI+I+ G+TGCGKTTQ+P+F+ E  LN   +IG+TQ RRI A++MAKRVA E +C LG E+GYEIRFD K  ASTKIKYMTD ILLN+C+TD NL ++  +++DEAHERSL SD+LLGLLK +    E+LKIIITSATI + KFS++F D+ I+ IEGR + V+IIY  +   D ++ S   V +I    E GDIL+FLT +E+IE C + L+  G  NLI+ PL+GA++++EQQ++F  +   +RKV+++TNIAETS+TID +R+VIDCGY+KQ  F+ + GI+ LE ++ISK++A+QRKGR GRT  GWCYRLY E  Y+ F  +  PEI R++LSE+Y++++ F LNPK FNFID P  E L ++E EL +LK + + G LT  G+ M  FPVEPR+GK+L+ S+ N C  D++ I+A+L+E+ IFR+      + D +K  F D DGD F+LL +Y  WI  +++ +WC S+ ++  +++  Y +  QL  ILK++  +KE  +   K AIK+S+ +G+FKNIC K NRG Y+R      +YIHP SSLF  SP+ +L++EV K  K +M GVLR+DE  +
Sbjct:   21 KSSSNELPINAYRDFIVQSILENQIIIVHGETGCGKTTQMPKFIYELELNGDKVIGVTQPRRIGAINMAKRVAFETRCALGKEIGYEIRFDNKSGASTKIKYMTDAILLNKCITDRNLSEFSYIIVDEAHERSLQSDVLLGLLKDIVSHNEDLKIIITSATIDSIKFSKYFFDAPIINIEGRSYNVDIIYNPFDFTDYVESSVIQVLQISKNPEKGDILIFLTSQEEIENCVEQLKKPGIENLILLPLFGAMEYREQQKIFDPVKDNERKVIISTNIAETSLTIDSVRFVIDCGYVKQKNFNPKSGIDNLEDVRISKSEADQRKGRVGRTNNGWCYRLYGEIDYHQFSDQVKPEILRRNLSEVYMKVLNFGLNPKQFNFIDSPTTEALLQTENELKELKFLDESGNLTADGKWMCDFPVEPRIGKILLSSIANDCVGDMVIILALLTEKNIFRRPKPQAEKADKIKANFFDEDGDPFSLLVVYKSWILCEKSPEWCRSNFLNQKALEQIYLVHQQLISILKRHDVYKEPSSTTNKEAIKRSIFAGYFKNICKKRNRGEYSRCVDSLPLYIHPGSSLFKDSPEYVLYSEVIKIKKPYMLGVLRIDESFL 628          
BLAST of ATP-dependent RNA helicase DHX8 vs. Planmine SMEST
Match: SMESG000038860.1 (SMESG000038860.1)

HSP 1 Score: 583.948 bits (1504), Expect = 0.000e+0
Identity = 300/612 (49.02%), Postives = 429/612 (70.10%), Query Frame = 2
Query:  143 KLPIYEYKDQIVELIRNNQIVIIQGQTGCGKTTQIPQFVLEANLNNGNMIGITQSRRIAAVSMAKRVAQEKQCNLGSEVGYEIRFDKKCSASTKIKYMTDGILLNECVTDANLKDYGVVMIDEAHERXXXXXXXXXXXXXVCKSRENLKIIITSATICAEKFSQFFDDSKILTIEGRLFPVEIIYEGYIMDLIDYSAKLVRRIHIGNEPGDILVFLTGEEDIERCCKLLRNVGNLIVTPLYGAIDFQEQQEVFRTMDCGDRKVVVATNIAETSITIDGIRYVIDCGYMKQNKFDSRRGIETLESIKISKAQAEQRKGRSGRTGPGWCYRLYSEGSYNDFIQEAVPEIKRKDLSEIYLRIIEFNLNPKDFNFIDXXXXXXXXXXXXXXXDLKIITKEGKLTPSGQNMLGFPVEPRLGKVLMESLNNKCTNDIIKIMAMLSERFIFRKHHKGRGRGDPLKE-FSDHDGDHFTLLNIYNDWISHKQNKQWCISSSIDYNSMQNAYNIFIQLCKILKKNH-SFKET-VGEKNAIKKSLISGFFKNICVKTNRGAYTRLYGREVMYIHPQSSLFHSSPKIILFNEVRKTTKTFMHGVLRLDEEIIREFPEELKIINY 1969
            +LPI +YKD I++ +RNNQIVII G TG GKTTQIPQ++ EA +NN   IG+TQ RRIAA++MA RVAQE +  LG EVGYE+RF+KK S STKIKYMTDGILLN+C+ D  L +YGV+MIDEAHER++ +D+LLGL+K++   R +LK++ITSATI  EKFS +F  + +++ +G+++ V+IIYE      + +   +V+ IH G E GDIL+FLTG+EDIE CC+ L ++ +L V PLYGA+DF  QQ++F+  + G RKV+V+TNIAETSITIDGIR+VIDCGY+KQN FDSR GI++L +++IS+ QA QRKGR+GRT  GWCYRLY+E +Y    QE  PEI R++L   YL+I    ++P  F FID P  E L +   EL DL +I +  K+T  G+++  FPVEP++GK L  S    C  ++I IMAM+SER +F +  K   + D  K+ F   +GD F  LN Y  W  ++++KQWC  + +++ +M+    +  QL  ++K+   +++++ +   ++IKKSLI  F+KNIC + ++G Y     ++V+Y+HP S L ++   +IL+ EV +T K +M G++ L E ++ EFP+E K I Y
Sbjct:   21 ELPIEQYKDYIIKTVRNNQIVIIFGSTGSGKTTQIPQYLFEAGINNDKTIGVTQPRRIAAINMASRVAQEMRSCLGMEVGYEVRFNKKSSNSTKIKYMTDGILLNQCLEDPKLPEYGVLMIDEAHERTVDTDVLLGLIKILASRRTDLKVLITSATIICEKFSNYFSGAPVISFDGKMYDVQIIYEPMWSWSLYFITNIVQTIHNGIEKGDILLFLTGQEDIEECCQNLESIQSLTVLPLYGALDFDAQQDIFKPAEPGKRKVIVSTNIAETSITIDGIRFVIDCGYVKQNLFDSRSGIDSLTNVRISQDQAIQRKGRAGRTNTGWCYRLYTEETYRAMKQETTPEIYRRNLYGTYLKIAGIGIDPMSFKFIDSPEHETLRKCLSELQDLDLIDEFKKITELGKSIQDFPVEPKIGKALFASSKYFCITEVITIMAMMSERNVFIRPKKSAVKSDYSKQKFFSSEGDQFMYLNAYKAWSENRKSKQWCYDNFVNFKTMEQIDLVRTQLMGLVKRKFPNYQDSDLNLVDSIKKSLIPSFYKNICFRKSKGIYINYLNQQVLYMHPSSCLMNTFSPLILYYEVVQTKKPYMRGIMTLSESLLTEFPKESKKIGY 632          
BLAST of ATP-dependent RNA helicase DHX8 vs. Planmine SMEST
Match: SMESG000038834.1 (SMESG000038834.1)

HSP 1 Score: 547.74 bits (1410), Expect = 0.000e+0
Identity = 286/614 (46.58%), Postives = 422/614 (68.73%), Query Frame = 2
Query:  146 LPIYEYKDQIVELIRNNQIVIIQGQTGCGKTTQIPQFVLEANLNNGNMIGITQSRRIAAVSMAKRVAQEKQCNLGSEVGYEIRFDKKCSASTKIKYMTDGILLNECVTDANLKDYGVVMIDEAHERXXXXXXXXXXXXXVCKSRENLKIIITSATICAEKFSQFFDDSKILTIEGRLFPVEIIYEGYIMDLID----YSAKLVRRIHIGNEPGDILVFLTGEEDIERCCKLLRNVGNLIVTPLYGAIDFQEQQEVFRTMDCGDRKVVVATNIAETSITIDGIRYVIDCGYMKQNKFDSRRGIETLESIKISKAQAEQRKGRSGRTGPGWCYRLYSEGSYNDFIQEAVPEIKRKDLSEIYLRIIEFNLNPKDFNFIDXXXXXXXXXXXXXXXDLKIITKEGKLTPSGQNMLGFPVEPRLGKVLMESLNNKCTNDIIKIMAMLSERFIFRKHHKGRGRGDPLK-EFSDHDGDHFTLLNIYNDWISHKQNKQWCISSSIDYNSMQNAYNIFIQLCKILKKNHSFKETVGE---KNAIKKSLISGFFKNICVKTNRGAYTRLYGREVMYIHPQSSLFHSSPKIILFNEVRKTTKTFMHGVLRLDEEIIREFPEELKII 1963
            LPI +++D I+E +RNN I++I G+TG GKTTQIPQ++LEA +N+G MIGITQ RRIAA++MAKRVA+E  C LG+EVGYEIRFDK+ S  TKI ++TDGILLN CV D  L +YGV+++DEAHERS+S+D+ LG+LKL+ + R +L++IITSATI  E+FS +F+   +L IEG++FP+  IY+   +D ID       ++V  IH+  E GDILVFLTGEEDIE CC  L ++ NL+V PLYGAID++ QQ+VF+ ++  +RKVVVATNIAETSITIDGI++VID GY+K++ F+    +  LE+++IS++QA QRKGR+GRT  GWCYRLY++  +  F +E  PEI  KDL  I+L++   +++P +F+++D P    L +   EL DL  + K  K+T  G+ +  FPVEP +GKVL  S    C+ ++  + AM+ E+ +F    + R R   +K EFSD  GD+FT LNIYN W  + ++  WC+ + ID  +++    I  QL  +LK+N      +     ++ I+K+++SGFFKN+    +   Y  +Y ++++++H  S L+ S P +I+++   +  K F+H  L +   +++EF EE+K +
Sbjct:   14 LPIAKFRDDILEAVRNNPIIVIVGETGSGKTTQIPQYILEAGINDGKMIGITQPRRIAAINMAKRVAEEMHCELGAEVGYEIRFDKQSSEITKINFLTDGILLNYCVIDPKLSNYGVIIVDEAHERSVSTDVTLGILKLLVEKRPDLRVIITSATIDCERFSNYFNIVPVLWIEGKVFPILEIYKP--IDSIDCLTGVLKEVVNEIHLNKESGDILVFLTGEEDIENCCASLADIKNLVVFPLYGAIDYESQQKVFKPVEKNERKVVVATNIAETSITIDGIKFVIDSGYVKKSHFNLEDNVHVLETVRISQSQANQRKGRTGRTSSGWCYRLYTKDEFESFEKEIEPEIFLKDLCHIFLKLTAMDIDPFNFHYLDAPSMPVLLKCAEELRDLGCLDKYNKITDLGKIVNSFPVEPAIGKVLYASSKYGCSLNLATMFAMVLEKKLFMSSKEFRKRVFSIKSEFSDEAGDYFTFLNIYNSWKINGKSADWCLENCIDVETIEEISRIRHQLIGVLKRNDLSVNYLPPNLCQDPIQKAILSGFFKNVSRHESSEKYFNVYRKKIVHLHTSSCLYKSKPNLIVYHSAFQIKKPFIHAALSITPNVLKEFLEEIKTV 625          
BLAST of ATP-dependent RNA helicase DHX8 vs. Planmine SMEST
Match: SMESG000038834.1 (SMESG000038834.1)

HSP 1 Score: 531.946 bits (1369), Expect = 0.000e+0
Identity = 280/610 (45.90%), Postives = 411/610 (67.38%), Query Frame = 2
Query:  146 LPIYEYKDQIVELIRNNQIVIIQGQTGCGKTTQIPQFVLEANLNNGNMIGITQSRRIAAVSMAKRVAQEKQCNLGSEVGYEIRFDKKCSASTKIKYMTDGILLNECVTDANLKDYGVVMIDEAHERXXXXXXXXXXXXXVCKSRENLKIIITSATICAEKFSQFFDDSKILTIEGRLFPVEIIYEGYIMDLIDYSAKLVRRIHIGNEPGDILVFLTGEEDIERCCKLLRNVGNLIVTPLYGAIDFQEQQEVFRTMDCGDRKVVVATNIAETSITIDGIRYVIDCGYMKQNKFDSRRGIETLESIKISKAQAEQRKGRSGRTGPGWCYRLYSEGSYNDFIQEAVPEIKRKDLSEIYLRIIEFNLNPKDFNFIDXXXXXXXXXXXXXXXDLKIITKEGKLTPSGQNMLGFPVEPRLGKVLMESLNNKCTNDIIKIMAMLSERFIFRKHHKGRGRGDPLK-EFSDHDGDHFTLLNIYNDWISHKQNKQWCISSSIDYNSMQNAYNIFIQLCKILKKNHSFKETVGE---KNAIKKSLISGFFKNICVKTNRGAYTRLYGREVMYIHPQSSLFHSSPKIILFNEVRKTTKTFMHGVLRLDEEIIREFPEELKII 1963
            LPI +++D I+E +RNN I++I G+TG GKTTQIPQ++LEA +N+G MIGITQ RRIAA++MAKRVA+E  C LG+EVGYEIRFDK+ S  TKI ++TDGILLN CV D  L +YGV+++DEAHERS+S+D+ LG+LKL+ + R +L++IITSATI  E+FS +F+   +L IE  L  V                ++V  IH+  E GDILVFLTGEEDIE CC  L ++ NL+V PLYGAID++ QQ+VF+ ++  +RKVVVATNIAETSITIDGI++VID GY+K++ F+    +  LE+++IS++QA QRKGR+GRT  GWCYRLY++  +  F +E  PEI  KDL  I+L++   +++P +F+++D P    L +   EL DL  + K  K+T  G+ +  FPVEP +GKVL  S    C+ ++  + AM+ E+ +F    + R R   +K EFSD  GD+FT LNIYN W  + ++  WC+ + ID  +++    I  QL  +LK+N      +     ++ I+K+++SGFFKN+    +   Y  +Y ++++++H  S L+ S P +I+++   +  K F+H  L +   +++EF EE+K +
Sbjct:   14 LPIAKFRDDILEAVRNNPIIVIVGETGSGKTTQIPQYILEAGINDGKMIGITQPRRIAAINMAKRVAEEMHCELGAEVGYEIRFDKQSSEITKINFLTDGILLNYCVIDPKLSNYGVIIVDEAHERSVSTDVTLGILKLLVEKRPDLRVIITSATIDCERFSNYFNIVPVLWIEDCLTGV--------------LKEVVNEIHLNKESGDILVFLTGEEDIENCCASLADIKNLVVFPLYGAIDYESQQKVFKPVEKNERKVVVATNIAETSITIDGIKFVIDSGYVKKSHFNLEDNVHVLETVRISQSQANQRKGRTGRTSSGWCYRLYTKDEFESFEKEIEPEIFLKDLCHIFLKLTAMDIDPFNFHYLDAPSMPVLLKCAEELRDLGCLDKYNKITDLGKIVNSFPVEPAIGKVLYASSKYGCSLNLATMFAMVLEKKLFMSSKEFRKRVFSIKSEFSDEAGDYFTFLNIYNSWKINGKSADWCLENCIDVETIEEISRIRHQLIGVLKRNDLSVNYLPPNLCQDPIQKAILSGFFKNVSRHESSEKYFNVYRKKIVHLHTSSCLYKSKPNLIVYHSAFQIKKPFIHAALSITPNVLKEFLEEIKTV 609          
The following BLAST results are available for this feature:
BLAST of ATP-dependent RNA helicase DHX8 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DHX82.865e-15443.14DEAH-box helicase 8 [Source:NCBI gene;Acc:1659][more]
DHX82.865e-15443.14DEAH-box helicase 8 [Source:NCBI gene;Acc:1659][more]
DHX84.608e-14843.74DEAH-box helicase 8 [Source:NCBI gene;Acc:1659][more]
DHX164.250e-13639.48DEAH-box helicase 16 [Source:HGNC Symbol;Acc:HGNC:... [more]
DHX164.250e-13639.48DEAH-box helicase 16 [Source:HGNC Symbol;Acc:HGNC:... [more]
back to top
BLAST of ATP-dependent RNA helicase DHX8 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mog-53.801e-15141.52Probable pre-mRNA-splicing factor ATP-dependent RN... [more]
mog-48.973e-14240.83Probable pre-mRNA-splicing factor ATP-dependent RN... [more]
ddx-154.017e-13338.49Pre-mRNA-splicing factor ATP-dependent RNA helicas... [more]
ddx-151.455e-13139.10Pre-mRNA-splicing factor ATP-dependent RNA helicas... [more]
mog-11.942e-12738.22Probable pre-mRNA-splicing factor ATP-dependent RN... [more]
back to top
BLAST of ATP-dependent RNA helicase DHX8 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pea6.290e-15342.74gene:FBgn0086895 transcript:FBtr0087518[more]
l(2)37Cb1.043e-14139.63gene:FBgn0086444 transcript:FBtr0081163[more]
Dhx153.917e-12937.58gene:FBgn0033160 transcript:FBtr0336909[more]
Dhx153.917e-12937.58gene:FBgn0033160 transcript:FBtr0088966[more]
CG49016.765e-12136.38gene:FBgn0032194 transcript:FBtr0445415[more]
back to top
BLAST of ATP-dependent RNA helicase DHX8 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
AL833789.35.913e-15442.81DEAH (Asp-Glu-Ala-His) box polypeptide 8 [Source:N... [more]
dhx81.551e-15342.81DEAH (Asp-Glu-Ala-His) box polypeptide 8 [Source:Z... [more]
dhx81.692e-14740.94DEAH (Asp-Glu-Ala-His) box polypeptide 8 [Source:Z... [more]
dhx167.961e-14040.20DEAH (Asp-Glu-Ala-His) box polypeptide 16 [Source:... [more]
dhx167.961e-14040.20DEAH (Asp-Glu-Ala-His) box polypeptide 16 [Source:... [more]
back to top
BLAST of ATP-dependent RNA helicase DHX8 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rps15a1.233e-16042.20ribosomal protein S15a [Source:Xenbase;Acc:XB-GENE... [more]
rps15a1.939e-15942.63ribosomal protein S15a [Source:Xenbase;Acc:XB-GENE... [more]
rps15a4.938e-15942.95ribosomal protein S15a [Source:Xenbase;Acc:XB-GENE... [more]
rps15a8.406e-15943.21ribosomal protein S15a [Source:Xenbase;Acc:XB-GENE... [more]
rps15a1.904e-15843.70ribosomal protein S15a [Source:Xenbase;Acc:XB-GENE... [more]
back to top
BLAST of ATP-dependent RNA helicase DHX8 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dhx89.974e-15543.14DEAH (Asp-Glu-Ala-His) box polypeptide 8 [Source:M... [more]
Dhx83.363e-15443.14DEAH (Asp-Glu-Ala-His) box polypeptide 8 [Source:M... [more]
Dhx351.960e-13638.83DEAH (Asp-Glu-Ala-His) box polypeptide 35 [Source:... [more]
Dhx161.028e-13539.48DEAH (Asp-Glu-Ala-His) box polypeptide 16 [Source:... [more]
Dhx151.161e-13138.24DEAH (Asp-Glu-Ala-His) box polypeptide 15 [Source:... [more]
back to top
BLAST of ATP-dependent RNA helicase DHX8 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q14562|DHX8_HUMAN1.376e-15343.14ATP-dependent RNA helicase DHX8 OS=Homo sapiens OX... [more]
sp|A2A4P0|DHX8_MOUSE2.353e-15343.14ATP-dependent RNA helicase DHX8 OS=Mus musculus OX... [more]
sp|A1Z9L3|DHX8_DROME6.305e-15242.74ATP-dependent RNA helicase DHX8 OS=Drosophila mela... [more]
sp|Q09530|MOG5_CAEEL4.835e-15041.52Probable pre-mRNA-splicing factor ATP-dependent RN... [more]
sp|Q54F05|DHX8_DICDI5.620e-14640.32ATP-dependent RNA helicase dhx8 OS=Dictyostelium d... [more]
back to top
BLAST of ATP-dependent RNA helicase DHX8 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4Y2HUD21.485e-16143.79ATP-dependent RNA helicase DHX8 OS=Araneus ventric... [more]
H8X8V71.422e-16043.70Prp22 RNA-dependent ATPase OS=Candida orthopsilosi... [more]
A0A1B6HVV12.511e-15943.23Uncharacterized protein (Fragment) OS=Homalodisca ... [more]
A0A1B6K1L52.875e-15943.23Uncharacterized protein (Fragment) OS=Homalodisca ... [more]
A0A1B6CNN01.719e-15843.07Uncharacterized protein OS=Clastoptera arizonana O... [more]
back to top
BLAST of ATP-dependent RNA helicase DHX8 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dhx81.504e-15342.81DEAH-box helicase 8 [Source:NCBI gene;Acc:10303579... [more]
dhx81.809e-15242.81DEAH-box helicase 8 [Source:NCBI gene;Acc:10303579... [more]
dhx166.438e-14140.29DEAH-box helicase 16 [Source:NCBI gene;Acc:1030400... [more]
dhx162.292e-14040.29DEAH-box helicase 16 [Source:NCBI gene;Acc:1030400... [more]
dhx161.867e-13940.63DEAH-box helicase 16 [Source:NCBI gene;Acc:1030400... [more]
back to top
BLAST of ATP-dependent RNA helicase DHX8 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dhx84.733e-15943.07DEAH (Asp-Glu-Ala-His) box polypeptide 8 [Source:Z... [more]
dhx341.202e-9835.19DEAH (Asp-Glu-Ala-His) box polypeptide 34 [Source:... [more]
zgc:1588282.222e-8232.73DEAH-box helicase 35 [Source:HGNC Symbol;Acc:HGNC:... [more]
dhx334.590e-6837.24DEAH (Asp-Glu-Ala-His) box polypeptide 33 [Source:... [more]
dhx305.104e-6329.08DEAH (Asp-Glu-Ala-His) box helicase 30 [Source:ZFI... [more]
back to top
BLAST of ATP-dependent RNA helicase DHX8 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
PRP226.507e-14740.59DEAH-box RNA-dependent ATPase/ATP-dependent RNA he... [more]
PRP432.622e-13440.32RNA helicase in the DEAH-box family; functions in ... [more]
PRP161.896e-12138.73DEAH-box RNA helicase involved in second catalytic... [more]
PRP27.727e-11437.58RNA-dependent DExD/H-box ATPase; required for acti... [more]
DHR26.754e-10334.17Predominantly nucleolar DEAH-box ATP-dependent RNA... [more]
back to top
BLAST of ATP-dependent RNA helicase DHX8 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO325311.377e-13339.61Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO458611.182e-11238.72Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO495607.848e-11239.53Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO326291.024e-9339.74Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO356226.218e-9048.19Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of ATP-dependent RNA helicase DHX8 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dhx81.058e-15342.97DEAH-box helicase 8 [Source:NCBI gene;Acc:10116232... [more]
dhx162.181e-14040.53DEAH-box helicase 16 [Source:NCBI gene;Acc:1011688... [more]
zgc:1588281.759e-13938.55DEAH-box helicase 35 [Source:NCBI gene;Acc:1011612... [more]
dhx151.070e-13237.77pre-mRNA-splicing factor ATP-dependent RNA helicas... [more]
dhx151.931e-13237.77pre-mRNA-splicing factor ATP-dependent RNA helicas... [more]
back to top
BLAST of ATP-dependent RNA helicase DHX8 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000038861.10.000e+052.16SMESG000038861.1[more]
SMESG000038864.10.000e+050.66SMESG000038864.1[more]
SMESG000038860.10.000e+049.02SMESG000038860.1[more]
SMESG000038834.10.000e+046.58SMESG000038834.1[more]
SMESG000038834.10.000e+045.90SMESG000038834.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30009820 ID=SMED30009820|Name=ATP-dependent RNA helicase DHX8|organism=Schmidtea mediterranea sexual|type=transcript|length=2028bp
AGCCAATGAAATCAAATTATTAACTGAAATTTATTATTCTTGGAACTAAA
TATTGATTTATACTTGTGATTTTTCAATGAATAATTTACCTGATGATACA
TTTGATGATGAGCAGGAACTTATTTCCAAAAGTCCACCAAACAAATTACC
AATATATGAATACAAGGATCAGATTGTTGAACTTATCCGAAACAACCAAA
TCGTCATCATTCAAGGACAAACGGGATGTGGTAAAACTACTCAAATTCCC
CAGTTCGTTCTTGAGGCCAATCTTAATAATGGTAATATGATTGGTATCAC
ACAGTCCAGAAGGATTGCTGCTGTAAGTATGGCTAAAAGGGTTGCTCAAG
AAAAACAGTGTAATCTTGGATCTGAAGTTGGATATGAAATAAGATTTGAT
AAGAAATGCAGCGCGTCAACAAAAATTAAATATATGACTGATGGAATTCT
ATTAAATGAATGTGTAACGGACGCAAACTTAAAGGATTATGGCGTAGTAA
TGATCGATGAAGCACATGAAAGGTCTTTGAGTTCTGATATTCTTCTTGGA
CTATTAAAATTAGTTTGCAAATCAAGAGAAAATCTTAAAATCATAATCAC
TTCAGCAACAATATGCGCTGAAAAGTTTTCACAGTTTTTTGATGACTCTA
AAATTTTAACTATCGAAGGTCGATTGTTTCCTGTTGAGATCATTTATGAA
GGATATATAATGGATCTAATTGATTATTCGGCTAAATTAGTACGGAGAAT
TCACATTGGAAATGAACCGGGCGATATTTTGGTATTTCTCACTGGAGAAG
AAGACATCGAAAGATGTTGTAAGCTTCTGAGAAACGTGGGTAATTTAATT
GTAACGCCATTGTATGGAGCTATAGATTTTCAAGAACAGCAAGAAGTTTT
TAGGACGATGGATTGTGGAGATAGGAAAGTAGTAGTAGCTACAAACATTG
CTGAAACCAGTATAACAATTGATGGTATAAGATATGTAATTGATTGTGGA
TATATGAAACAAAATAAATTTGATTCTCGACGAGGAATAGAAACTTTGGA
ATCGATAAAAATATCCAAAGCTCAAGCAGAACAAAGAAAAGGTAGATCAG
GTAGAACAGGTCCTGGATGGTGTTATCGACTATATTCTGAAGGCTCGTAT
AATGATTTTATTCAAGAGGCTGTTCCTGAAATTAAAAGAAAAGATTTATC
CGAAATATATTTAAGAATAATAGAGTTTAATTTGAATCCGAAGGATTTTA
ATTTTATAGATCGTCCACCAGAAGAAGAATTGAATCGAAGTGAACGGGAG
TTGCTAGATTTAAAAATAATCACTAAAGAGGGGAAATTAACTCCCTCTGG
ACAGAACATGTTAGGATTTCCAGTGGAACCTCGGTTAGGTAAAGTATTAA
TGGAATCTTTGAATAATAAATGCACTAATGATATTATAAAGATAATGGCT
ATGCTTTCTGAAAGATTTATTTTCCGAAAGCATCACAAAGGTCGAGGAAG
AGGGGACCCGTTGAAAGAATTTAGCGATCATGATGGAGATCATTTCACAT
TACTGAATATATACAATGATTGGATTTCTCATAAGCAGAATAAACAGTGG
TGTATATCATCTTCAATTGACTACAACAGTATGCAAAATGCCTATAATAT
CTTTATACAACTTTGTAAAATTTTAAAGAAAAATCATTCATTCAAAGAAA
CTGTAGGTGAAAAGAATGCAATTAAAAAGTCATTAATATCTGGATTTTTC
AAAAACATCTGTGTCAAAACGAATAGAGGTGCTTACACAAGATTATATGG
GAGAGAAGTTATGTATATTCATCCTCAAAGCAGTTTGTTTCACTCGAGTC
CAAAAATAATACTATTTAATGAAGTTCGAAAAACGACAAAGACATTTATG
CATGGAGTCCTGAGATTGGATGAAGAAATTATCAGAGAATTTCCCGAAGA
ACTGAAAATTATAAACTATCCTGATAACATAGACAGCTTGACAAGATTTT
TTTAATAAATAATTGAATCTTATTGAAA
back to top

protein sequence of SMED30009820-orf-1

>SMED30009820-orf-1 ID=SMED30009820-orf-1|Name=SMED30009820-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=643bp
MNNLPDDTFDDEQELISKSPPNKLPIYEYKDQIVELIRNNQIVIIQGQTG
CGKTTQIPQFVLEANLNNGNMIGITQSRRIAAVSMAKRVAQEKQCNLGSE
VGYEIRFDKKCSASTKIKYMTDGILLNECVTDANLKDYGVVMIDEAHERS
LSSDILLGLLKLVCKSRENLKIIITSATICAEKFSQFFDDSKILTIEGRL
FPVEIIYEGYIMDLIDYSAKLVRRIHIGNEPGDILVFLTGEEDIERCCKL
LRNVGNLIVTPLYGAIDFQEQQEVFRTMDCGDRKVVVATNIAETSITIDG
IRYVIDCGYMKQNKFDSRRGIETLESIKISKAQAEQRKGRSGRTGPGWCY
RLYSEGSYNDFIQEAVPEIKRKDLSEIYLRIIEFNLNPKDFNFIDRPPEE
ELNRSERELLDLKIITKEGKLTPSGQNMLGFPVEPRLGKVLMESLNNKCT
NDIIKIMAMLSERFIFRKHHKGRGRGDPLKEFSDHDGDHFTLLNIYNDWI
SHKQNKQWCISSSIDYNSMQNAYNIFIQLCKILKKNHSFKETVGEKNAIK
KSLISGFFKNICVKTNRGAYTRLYGREVMYIHPQSSLFHSSPKIILFNEV
RKTTKTFMHGVLRLDEEIIREFPEELKIINYPDNIDSLTRFF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000101muscle cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR014001Helicase_ATP-bd
IPR007502Helicase-assoc_dom
IPR001650Helicase_C
IPR011545DEAD/DEAH_box_helicase_dom
IPR011709DUF1605
IPR027417P-loop_NTPase
IPR002464DNA/RNA_helicase_DEAH_CS
Vocabulary: molecular function
TermDefinition
GO:0004386helicase activity
GO:0003676nucleic acid binding
GO:0005524ATP binding
GO:0008026ATP-dependent helicase activity
GO:0000166nucleotide binding
GO:0016787hydrolase activity