testis-expressed protein 52

Overview
Nametestis-expressed protein 52
Smed IDSMED30009817
Length (bp)1083
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of testis-expressed protein 52 (SMED30009817) t-SNE clustered cells

Violin plots show distribution of expression levels for testis-expressed protein 52 (SMED30009817) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of testis-expressed protein 52 (SMED30009817) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for testis-expressed protein 52 (SMED30009817) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30009817

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30009817SMESG000070302.1 SmedASXL_019756SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30009817SMESG000070302.1 dd_Smed_v4_6766_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30009817SMESG000070302.1 dd_Smed_v4_6766_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30009817SMESG000070302.1 dd_Smed_v4_6766_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30009817SMESG000070302.1 dd_Smed_v6_6766_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30009817SMESG000070302.1 dd_Smed_v4_6766_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of testis-expressed protein 52 vs. Ensembl Human
Match: TEX52 (testis expressed 52 [Source:HGNC Symbol;Acc:HGNC:53643])

HSP 1 Score: 65.855 bits (159), Expect = 2.016e-11
Identity = 40/132 (30.30%), Postives = 63/132 (47.73%), Query Frame = 1
Query:  334 FKLWLEAGKIKPSSLPLNVDVSYNSNMWRNFKHCFLDNQLNKNEDGAIIEEVAKLYPVSVPKPSKMDENSIIKYTESTKLINDPIRKKLILEKLKQNKQLMDQLKLKSLNRNPPLDEQGNIQPPEGYKKYEH 729
            F  WL+  ++ P++ P   D  Y+SN+WR       D+  ++                     S M +NS + +        D  RKK ++ +  +  + +++LKL+S  R PPLD QGNIQPP  +KKY H
Sbjct:   95 FHTWLDVCRL-PATFPTQPDRPYDSNVWR----WLTDSNAHRCPPTEHPIPPP----------SWMGQNSFLTFIHCYPTFVDMKRKKQVIFRTVKELKEVEKLKLRSEARAPPLDAQGNIQPPASFKKYRH 211          
BLAST of testis-expressed protein 52 vs. Ensembl Mouse
Match: Tex52 (testis expressed 52 [Source:MGI Symbol;Acc:MGI:1918399])

HSP 1 Score: 76.2554 bits (186), Expect = 3.821e-15
Identity = 42/132 (31.82%), Postives = 73/132 (55.30%), Query Frame = 1
Query:  334 FKLWLEAGKIKPSSLPLNVDVSYNSNMWRNFKHCFLDNQLNKNEDGAIIEEVAKLYPVSVPKPSKMDENSIIKYTESTKLINDPIRKKLILEKLKQNKQLMDQLKLKSLNRNPPLDEQGNIQPPEGYKKYEH 729
            F  WL+ G++ P++ P   DV Y+SN+WR+  H    ++L   + G             +P PS M  +S + +  ++ ++ D  R+K I+ +  +  + +++LKL+S  R PPLD  GNI PP  +KKY++
Sbjct:   98 FHTWLDVGRL-PATFPTRPDVPYDSNVWRHLTHAN-AHRLPAAQPG-------------IPPPSWMGPHSFLSFISASPIVVDLKRRKQIIVRTVKELKEVEKLKLRSELRAPPLDANGNILPPPNFKKYQY 214          
BLAST of testis-expressed protein 52 vs. Ensembl Mouse
Match: Tex52 (testis expressed 52 [Source:MGI Symbol;Acc:MGI:1918399])

HSP 1 Score: 73.559 bits (179), Expect = 1.057e-14
Identity = 41/130 (31.54%), Postives = 71/130 (54.62%), Query Frame = 1
Query:  334 FKLWLEAGKIKPSSLPLNVDVSYNSNMWRNFKHCFLDNQLNKNEDGAIIEEVAKLYPVSVPKPSKMDENSIIKYTESTKLINDPIRKKLILEKLKQNKQLMDQLKLKSLNRNPPLDEQGNIQPPEGYKKY 723
            F  WL+ G++ P++ P   DV Y+SN+WR+  H    ++L   + G             +P PS M  +S + +  ++ ++ D  R+K I+ +  +  + +++LKL+S  R PPLD  GNI PP  +KK+
Sbjct:   98 FHTWLDVGRL-PATFPTRPDVPYDSNVWRHLTHAN-AHRLPAAQPG-------------IPPPSWMGPHSFLSFISASPIVVDLKRRKQIIVRTVKELKEVEKLKLRSELRAPPLDANGNILPPPNFKKH 212          
BLAST of testis-expressed protein 52 vs. UniProt/SwissProt
Match: sp|Q3TTI8|TEX52_MOUSE (Testis-expressed protein 52 OS=Mus musculus OX=10090 GN=Tex52 PE=2 SV=1)

HSP 1 Score: 76.2554 bits (186), Expect = 2.673e-14
Identity = 42/132 (31.82%), Postives = 73/132 (55.30%), Query Frame = 1
Query:  334 FKLWLEAGKIKPSSLPLNVDVSYNSNMWRNFKHCFLDNQLNKNEDGAIIEEVAKLYPVSVPKPSKMDENSIIKYTESTKLINDPIRKKLILEKLKQNKQLMDQLKLKSLNRNPPLDEQGNIQPPEGYKKYEH 729
            F  WL+ G++ P++ P   DV Y+SN+WR+  H    ++L   + G             +P PS M  +S + +  ++ ++ D  R+K I+ +  +  + +++LKL+S  R PPLD  GNI PP  +KKY++
Sbjct:   98 FHTWLDVGRL-PATFPTRPDVPYDSNVWRHLTHAN-AHRLPAAQPG-------------IPPPSWMGPHSFLSFISASPIVVDLKRRKQIIVRTVKELKEVEKLKLRSELRAPPLDANGNILPPPNFKKYQY 214          
BLAST of testis-expressed protein 52 vs. UniProt/SwissProt
Match: sp|A6NCN8|TEX52_HUMAN (Testis-expressed protein 52 OS=Homo sapiens OX=9606 GN=TEX52 PE=4 SV=2)

HSP 1 Score: 65.855 bits (159), Expect = 9.682e-11
Identity = 40/132 (30.30%), Postives = 63/132 (47.73%), Query Frame = 1
Query:  334 FKLWLEAGKIKPSSLPLNVDVSYNSNMWRNFKHCFLDNQLNKNEDGAIIEEVAKLYPVSVPKPSKMDENSIIKYTESTKLINDPIRKKLILEKLKQNKQLMDQLKLKSLNRNPPLDEQGNIQPPEGYKKYEH 729
            F  WL+  ++ P++ P   D  Y+SN+WR       D+  ++                     S M +NS + +        D  RKK ++ +  +  + +++LKL+S  R PPLD QGNIQPP  +KKY H
Sbjct:   95 FHTWLDVCRL-PATFPTQPDRPYDSNVWR----WLTDSNAHRCPPTEHPIPPP----------SWMGQNSFLTFIHCYPTFVDMKRKKQVIFRTVKELKEVEKLKLRSEARAPPLDAQGNIQPPASFKKYRH 211          
BLAST of testis-expressed protein 52 vs. TrEMBL
Match: A0A0B6ZEU2 (Uncharacterized protein OS=Arion vulgaris OX=1028688 GN=ORF57875 PE=4 SV=1)

HSP 1 Score: 123.635 bits (309), Expect = 4.401e-29
Identity = 66/194 (34.02%), Postives = 107/194 (55.15%), Query Frame = 1
Query:  310 ANERKSLEFKLWLEAGKIKPSSLPLNVDVSYNSNMWRNFKHCFLDNQLNKNEDG-AIIEEVAKLYPVSVPKPSKMDENSIIKYTESTKLINDPIRKKLILEKLKQNKQLMDQLKLKSLNRNPPLDEQGNIQPPEGYKKYEHYFFPEPICVADSLNGSADGDPDVFGRVMNKRYKPSVWKLTHKSCNSSYQEVME 888
             ++  ++E +LW EAGK     +P   D SYNSN+WRNF   +    LN + DG  + E VA LYP+++P PS++ + +  KY   T +  +   K + + +   +  L   LK ++  RNPPL+E+G+I PPE +KKY H F               +  PD+FG++   R +P +WKL++K  +  +Q++ E
Sbjct:   61 THQHPTVEHRLWTEAGKTA-VPIPSRPDTSYNSNIWRNFCRQY---GLNVSADGRTMTESVAALYPLNIPAPSQIGDYTFDKYLRETNVFQNKTAKSIAIRRAATDINLFKNLKYRTQARNPPLNEKGDILPPENFKKYAHRFV--SFPSPPPTPPPPEQRPDMFGQLYTPRTRPHMWKLSYKLNHPKFQKLQE 248          
BLAST of testis-expressed protein 52 vs. TrEMBL
Match: A0A2T7PKF9 (Uncharacterized protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_05181 PE=4 SV=1)

HSP 1 Score: 120.553 bits (301), Expect = 4.310e-28
Identity = 69/211 (32.70%), Postives = 118/211 (55.92%), Query Frame = 1
Query:  256 DCDMVWNDPISPNNSELSANERKSLEFKLWLEAGKIKPSSLPLNVDVSYNSNMWRNFKHCFLDNQLNKNEDGAIIEEVAKLYPVSVPKPSKMDENSIIKYTESTKLINDPIRKKLILEKLKQNKQLMDQLKLKSLNRNPPLDEQGNIQPPEGYKKYEHYFFPEPICVADSLNGSADGDPDVFGRVMNKRYKPSVWKLTHKSCNSSYQEVME 888
            DC    N      +++ S +    ++++LWLEAGK  P   P N D +Y+SN+WRNF+  F     +K     I + +A +YP+++P PS++++++  +Y + T L  D  RK + +++++ + Q   +LK K+  RNPP+D++G I PPE +KKY H +FP P               D+FG+    R  P +WKL+HK  +  ++ + E
Sbjct:   41 DCQHFLN-----RSTKTSTHTYPCVQYQLWLEAGKHDPP-FPKNSDTNYDSNVWRNFRRNFGFQTSSKGR--KISDVIATMYPLNIPPPSQLNDHTFDRYIKETALFKDENRKAMAIKQIQSDLQEFRKLKFKTEARNPPIDKKGKILPPENFKKYVHQYFPLPTPPPSPPPPFQKT--DMFGQRYIPRSGPGLWKLSHKLNHPEFKRLQE 241          
BLAST of testis-expressed protein 52 vs. TrEMBL
Match: R7UNR0 (Uncharacterized protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_208890 PE=4 SV=1)

HSP 1 Score: 118.242 bits (295), Expect = 4.178e-27
Identity = 69/203 (33.99%), Postives = 118/203 (58.13%), Query Frame = 1
Query:  307 SANERKSLEFKLWLEAGKIKPSSLPLNVDVSYNSNMWRNFK--HCFLDNQLNKNEDGAIIEEVAKLYPVSVPKPSKMDENSIIKYTESTKLINDPIRKKLILEKLKQNKQLMDQLKLKSLNRNPPLDEQGNIQPPEGYKKYEHYFFP---EPI--CVADSLNGSADGDPDVFGRVM--NKRYKPSVWKLTHKSCNSSYQEVME 888
            SA+   S+ ++LW+EAGK + + +P   D +YNSN+WRNF+  + F  N   +N D    + +A +YP++VP PS++ + +  K+   T  I +   +KL +++  ++     +L+LK+ +RNPP+D+ GNI+PP  ++KY H F P   EP+           AD   D+FGR +   K   P +WK+++K  N  Y++V +
Sbjct:   61 SAHGHLSVPYRLWIEAGKHE-APIPDKPDPNYNSNVWRNFQRQYGFYPNTKGQNID----QMIASMYPLNVPAPSRVGQYNYAKFLTETPTIRNEKLRKLAIDRTTKDIVEFKRLRLKTESRNPPIDQTGNIKPPLNFRKYAHRFIPPDAEPVESSTPQPAPNPADTKIDMFGRQVPKGKTSGPYLWKISYKLTNPQYKQVHD 258          
BLAST of testis-expressed protein 52 vs. TrEMBL
Match: A0A210QGS3 (Uncharacterized protein OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT17961 PE=4 SV=1)

HSP 1 Score: 117.472 bits (293), Expect = 7.859e-27
Identity = 70/188 (37.23%), Postives = 107/188 (56.91%), Query Frame = 1
Query:  328 LEFKLWLEAGKIKPSSLPLNVDVSYNSNMWRNFKHCFLDNQLNKNEDGAIIEEV-AKLYPVSVPKPSKMDENSIIKYTESTKLINDPIRKKLILEKLKQNKQLMDQLKLKSLNRNPPLDEQGNIQPPEGYKKYEHYFFPEPICVADSLNGSADGDPDVFGRVMNKRYKPSVWKLTHKSCNSSYQEVME 888
            L +KLWLEAGK + +  P   D +YNSN+WRNF+  +     +   DG  I +V A +YP+++P PS++ ++S  K+   + L N+   K L +E+ K +     +L++KS  RNPPLDE G I PPE +KKYEH F P    +       A+   D  G+    + +P +WKL++K  N  Y+ V +
Sbjct:   70 LGYKLWLEAGKHE-APYPSRPDDNYNSNVWRNFRRQY---GFSATADGRKISDVIASMYPLNIPPPSQVGDHSFDKFIRESSLFNNEKMKSLAMERTKNDVVEFKRLRVKSDARNPPLDESGQIIPPENFKKYEHRFVPP--PLPPPTPPPANQKTDSLGQRYVPKSEPHLWKLSYKLSNPQYEHVRQ 251          
BLAST of testis-expressed protein 52 vs. TrEMBL
Match: A0A433TAG4 (Uncharacterized protein OS=Elysia chlorotica OX=188477 GN=EGW08_013666 PE=4 SV=1)

HSP 1 Score: 116.701 bits (291), Expect = 1.698e-26
Identity = 69/194 (35.57%), Postives = 108/194 (55.67%), Query Frame = 1
Query:  310 ANERKSLEFKLWLEAGKIKPSSLPLNVDVSYNSNMWRNFKHCFLDNQLNKNEDGAIIEE-VAKLYPVSVPKPSKMDENSIIKYTESTKLINDPIRKKLILEKLKQNKQLMDQLKLKSLNRNPPLDEQGNIQPPEGYKKYEHYFFPEPICVADSLNGSADGDPDVFGRVMNKRYKPSVWKLTHKSCNSSYQEVME 888
             +++ S+E +LW+EAGK   +  P   D SYNSN+WRNF+  +    L+   +G  I E +A +YP+++P  S++ EN+  KY   TKL  D   K L + +         +L+ K+  RNPPL+E+G+I PP+ YKKY H F   P+              D+FG+    R KP +WKL++K  +  Y+++ E
Sbjct:   62 THQQPSVEHRLWIEAGKPA-APFPARPDTSYNSNIWRNFRREY---GLSFKANGRKISEMIASMYPLNIPAASQVRENTFEKYVRETKLFQDEKGKSLAIRRSNTEVSEFKKLRCKTDARNPPLNERGDILPPDNYKKYAHRF--VPVPSPPPSPPPKGQKTDLFGQRYTPRSKPVLWKLSYKLNHPEYRKLRE 249          
BLAST of testis-expressed protein 52 vs. Ensembl Nematostella
Match: EDO49159 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RH47])

HSP 1 Score: 68.5514 bits (166), Expect = 2.254e-13
Identity = 46/163 (28.22%), Postives = 83/163 (50.92%), Query Frame = 1
Query:  325 SLEFKLWLEAGKIKPSSLPLNVDVSYNSNMWRNFKHCFLDN---------------QLNKNEDGAIIE---------EVAKLYPVSVPKPSKMDENSIIKYTESTKLINDPIRKKLILEKLKQNKQ--LMDQLKLKSLNRNPPLDEQGNIQPPEGYKKYEHYF 735
            +++ +LWL+  ++  +++  + D  YNSNMW+NFK                     ++ K  D  +I+          +A +YP+ VP PS++ +N+  K+    KL     RK+  + +  QN Q   + Q+K++S  R PPL+ +G I PP+ +++Y H F
Sbjct:   45 TVQQRLWLDITELDTTNIE-HKDEQYNSNMWKNFKFVRSKQSAAESSKTLSPQPKERILKQGDARLIDMETDHHVRGNIADIYPLKVPHPSRIGDNTYDKFLGEAKLTE---RKRNRIARQLQNSQDFRIRQMKIRSECRAPPLNWEGEIVPPQTFRRYPHRF 203          
BLAST of testis-expressed protein 52 vs. Planmine SMEST
Match: SMESG000070302.1 (SMESG000070302.1)

HSP 1 Score: 530.02 bits (1364), Expect = 0.000e+0
Identity = 259/259 (100.00%), Postives = 259/259 (100.00%), Query Frame = 1
Query:  142 MNFQINSAYKKDKIELPKLIHSNKLSTHSRLWIDNYYKDCDMVWNDPISPNNSELSANERKSLEFKLWLEAGKIKPSSLPLNVDVSYNSNMWRNFKHCFLDNQLNKNEDGAIIEEVAKLYPVSVPKPSKMDENSIIKYTESTKLINDPIRKKLILEKLKQNKQLMDQLKLKSLNRNPPLDEQGNIQPPEGYKKYEHYFFPEPICVADSLNGSADGDPDVFGRVMNKRYKPSVWKLTHKSCNSSYQEVMEYKERIVSTTK 918
            MNFQINSAYKKDKIELPKLIHSNKLSTHSRLWIDNYYKDCDMVWNDPISPNNSELSANERKSLEFKLWLEAGKIKPSSLPLNVDVSYNSNMWRNFKHCFLDNQLNKNEDGAIIEEVAKLYPVSVPKPSKMDENSIIKYTESTKLINDPIRKKLILEKLKQNKQLMDQLKLKSLNRNPPLDEQGNIQPPEGYKKYEHYFFPEPICVADSLNGSADGDPDVFGRVMNKRYKPSVWKLTHKSCNSSYQEVMEYKERIVSTTK
Sbjct:    1 MNFQINSAYKKDKIELPKLIHSNKLSTHSRLWIDNYYKDCDMVWNDPISPNNSELSANERKSLEFKLWLEAGKIKPSSLPLNVDVSYNSNMWRNFKHCFLDNQLNKNEDGAIIEEVAKLYPVSVPKPSKMDENSIIKYTESTKLINDPIRKKLILEKLKQNKQLMDQLKLKSLNRNPPLDEQGNIQPPEGYKKYEHYFFPEPICVADSLNGSADGDPDVFGRVMNKRYKPSVWKLTHKSCNSSYQEVMEYKERIVSTTK 259          
The following BLAST results are available for this feature:
BLAST of testis-expressed protein 52 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 1
Match NameE-valueIdentityDescription
TEX522.016e-1130.30testis expressed 52 [Source:HGNC Symbol;Acc:HGNC:5... [more]
back to top
BLAST of testis-expressed protein 52 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of testis-expressed protein 52 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of testis-expressed protein 52 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of testis-expressed protein 52 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of testis-expressed protein 52 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Tex523.821e-1531.82testis expressed 52 [Source:MGI Symbol;Acc:MGI:191... [more]
Tex521.057e-1431.54testis expressed 52 [Source:MGI Symbol;Acc:MGI:191... [more]
back to top
BLAST of testis-expressed protein 52 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 2
Match NameE-valueIdentityDescription
sp|Q3TTI8|TEX52_MOUSE2.673e-1431.82Testis-expressed protein 52 OS=Mus musculus OX=100... [more]
sp|A6NCN8|TEX52_HUMAN9.682e-1130.30Testis-expressed protein 52 OS=Homo sapiens OX=960... [more]
back to top
BLAST of testis-expressed protein 52 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0B6ZEU24.401e-2934.02Uncharacterized protein OS=Arion vulgaris OX=10286... [more]
A0A2T7PKF94.310e-2832.70Uncharacterized protein OS=Pomacea canaliculata OX... [more]
R7UNR04.178e-2733.99Uncharacterized protein OS=Capitella teleta OX=283... [more]
A0A210QGS37.859e-2737.23Uncharacterized protein OS=Mizuhopecten yessoensis... [more]
A0A433TAG41.698e-2635.57Uncharacterized protein OS=Elysia chlorotica OX=18... [more]
back to top
BLAST of testis-expressed protein 52 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of testis-expressed protein 52 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of testis-expressed protein 52 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of testis-expressed protein 52 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO491592.254e-1328.22Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of testis-expressed protein 52 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of testis-expressed protein 52 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000070302.10.000e+0100.00SMESG000070302.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30009817 ID=SMED30009817|Name=testis-expressed protein 52|organism=Schmidtea mediterranea sexual|type=transcript|length=1083bp
CAAACTGAGTTTATTCAAATTCTATTTCTAATTTTAAACGAATTGAATAT
AAAATAATATAATTTTCTTGCTGAAGAAAAATTTTCAAAAACCATTTAAT
GGAATTATAACAGGAACAAATAATCGGCCGATATCAACGTTATGAATTTT
CAAATTAATTCTGCTTATAAAAAAGACAAAATAGAATTACCAAAGTTGAT
ACATTCGAACAAATTGAGCACGCATTCGAGGCTCTGGATTGATAATTATT
ATAAGGATTGTGATATGGTTTGGAACGATCCGATTTCACCTAATAACTCC
GAGCTCAGCGCTAATGAGAGGAAATCTTTGGAGTTTAAACTTTGGCTGGA
AGCGGGCAAAATAAAACCGTCGAGTCTGCCATTAAATGTTGATGTGTCGT
ATAATTCCAATATGTGGCGCAATTTCAAGCATTGTTTCTTGGATAATCAG
CTAAATAAGAATGAAGATGGCGCGATTATTGAAGAAGTAGCCAAATTGTA
TCCAGTTTCCGTTCCGAAACCATCCAAAATGGACGAAAACTCGATAATTA
AATATACAGAAAGCACCAAGCTCATCAATGACCCAATAAGGAAAAAATTA
ATATTGGAAAAATTAAAACAAAATAAGCAATTAATGGATCAATTGAAATT
AAAATCCTTAAACAGAAATCCACCACTAGATGAGCAAGGAAATATTCAAC
CCCCAGAAGGATATAAAAAATATGAACATTATTTCTTTCCTGAACCAATT
TGCGTTGCGGATTCCTTGAACGGTTCTGCTGACGGAGATCCTGACGTATT
CGGCAGAGTCATGAACAAGCGATACAAGCCAAGCGTGTGGAAGCTGACTC
ACAAGTCCTGCAATTCCTCATATCAAGAGGTGATGGAATATAAGGAAAGA
ATCGTGTCAACAACGAAATAAAAGAATTCGACAGAACTTTGCAAAATTTT
ATTCATATTTCTTATAATAATTAAATTTCTCAAAGAATTTTGGTCGCATA
GAAATATAATTTGCATCGCTGTTGACCTGTATAACCATTGCTCTGTTAGT
TGCCTTATATCTTATGTATAATGAATATTATAT
back to top

protein sequence of SMED30009817-orf-1

>SMED30009817-orf-1 ID=SMED30009817-orf-1|Name=SMED30009817-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=260bp
MNFQINSAYKKDKIELPKLIHSNKLSTHSRLWIDNYYKDCDMVWNDPISP
NNSELSANERKSLEFKLWLEAGKIKPSSLPLNVDVSYNSNMWRNFKHCFL
DNQLNKNEDGAIIEEVAKLYPVSVPKPSKMDENSIIKYTESTKLINDPIR
KKLILEKLKQNKQLMDQLKLKSLNRNPPLDEQGNIQPPEGYKKYEHYFFP
EPICVADSLNGSADGDPDVFGRVMNKRYKPSVWKLTHKSCNSSYQEVMEY
KERIVSTTK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR029206DUF4532
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR029206Protein of unknown function DUF4532PFAMPF15046DUF4532coord: 61..197
e-value: 1.5E-19
score: 70.2
IPR029206Protein of unknown function DUF4532PANTHERPTHR35156FAMILY NOT NAMEDcoord: 55..199