GCR011

Overview
NameGCR011
Smed IDSMED30009809
Length (bp)1269
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of GCR011 (SMED30009809) t-SNE clustered cells

Violin plots show distribution of expression levels for GCR011 (SMED30009809) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of GCR011 (SMED30009809) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for GCR011 (SMED30009809) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of GCR011 vs. Ensembl Human
Match: HTR1A (5-hydroxytryptamine receptor 1A [Source:HGNC Symbol;Acc:HGNC:5286])

HSP 1 Score: 182.57 bits (462), Expect = 2.084e-52
Identity = 127/378 (33.60%), Postives = 206/378 (54.50%), Query Frame = 2
Query:  116 FC---GNSLILIAVLTTRHLQTVTNFYXXXXXXXXXXXXGTVLPLTIAKELHGKWVLGKHVCQFWVSMDILLCTASILNLCCISIDRYMAITKPLVYATKRSYKLAGCMILIAWILXXXXXXXXXXGW--SDHNFTNTTCEISIHLGFRIYSSLGSFFIPLILMIFVYLRIFAIANY--RKILLNSHQXXXXXXXXXXXXXXXXXXXLDFQTSNPSSQQRRQALDLESNPKHAQALKLNSYLCQRPIHRSCALQNL-IYKSGNLQNFTNL-----STGCAVLS--SGLSQSQKGKETAAFLREHKTAKVIAMVIGCFVVCWLPFFTIYVLESLCSQRILCPYPIGSLLVKSVTWLGYINSALNPFLYAFYNKEYARTF 1204
            FC   GN+ ++ A+   R LQ V N+ + SLA+ DL+VS  VLP+    ++  KW LG+  C  ++++D+L CT+SIL+LC I++DRY AIT P+ Y  KR+ + A  +I + W++  +IS+PP++GW   +       C IS   G+ IYS+ G+F+IPL+LM+ +Y RIF  A +  RK +    ++  + +   + +          ++ N  S  R   L +ES  K   AL  N  + Q       AL+ + +++ GN +    L      T CA  S      ++ + K   A  RE KT K + +++G F++CWLPFF + ++   C      P  +G++    + WLGY NS LNP +YA++NK++   F
Sbjct:   48 FCAVLGNACVVAAIALERSLQNVANYLIGSLAVTDLMVSVLVLPMAALYQVLNKWTLGQVTCDLFIALDVLCCTSSILHLCAIALDRYWAITDPIDYVNKRTPRRAAALISLTWLIGFLISIPPMLGWRTPEDRSDPDACTISKDHGYTIYSTFGAFYIPLLLMLVLYGRIFRAARFRIRKTVKKVEKTGADTRHGASPAPQPK------KSVNGESGSRNWRLGVES--KAGGALCANGAVRQG--DDGAALEVIEVHRVGNSKEHLPLPSEAGPTPCAPASFERKNERNAEAKRKMALARERKTVKTLGIIMGTFILCWLPFFIVALVLPFCESSCHMPTLLGAI----INWLGYSNSLLNPVIYAYFNKDFQNAF 411          
BLAST of GCR011 vs. Ensembl Human
Match: ADRA1A (adrenoceptor alpha 1A [Source:HGNC Symbol;Acc:HGNC:277])

HSP 1 Score: 160.229 bits (404), Expect = 5.295e-44
Identity = 111/362 (30.66%), Postives = 184/362 (50.83%), Query Frame = 2
Query:  122 GNSLILIAVLTTRHLQTVTNFYXXXXXXXXXXXXGTVLPLTIAKELHGKWVLGKHVCQFWVSMDILLCTASILNLCCISIDRYMAITKPLVYATKRSYKLAGCMILIAWILXXXXXXXXXXGWSDHNFTNTT-CEISIHLGFRIYSSLGSFFIPLILMIFVYLRIFAIANYRKILLNSHQXXXXXXXXXXXXXXXXXXXLDFQTSNPSSQQRRQALDLESNPKHAQALKLNSYLCQRPIHRSCALQNLIYKSGNLQNFTNLSTGCAVLSSGLSQSQKGKETAAFLREHKTAKVIAMVIGCFVVCWLPFFTIYVLESLCSQRILCPYPIGSLLVKSVTWLGYINSALNPFLYAFYNKEYARTF 1204
            GN L++++V   RHL +VT++Y+V+LA+ADLL++ TVLP +   E+ G W  G+  C  W ++D+L CTASI+ LC ISIDRY+ ++ PL Y T  + +     +L  W LS++IS+ P+ GW      + T C+I+   G+ ++S+LGSF++PL +++ +Y R++ +A                                          +R++  L+S  K  ++   +S      IHR                  N   G + ++S  +++        F RE K AK + +V+GCFV+CWLPFF +  + S         +     + K V WLGY+NS +NP +Y   ++E+ + F
Sbjct:   43 GNILVILSVACHRHLHSVTHYYIVNLAVADLLLTSTVLPFSAIFEVLGYWAFGRVFCNIWAAVDVLCCTASIMGLCIISIDRYIGVSYPLRYPTIVTQRRGLMALLCVWALSLVISIGPLFGWRQPAPEDETICQINEEPGYVLFSALGSFYLPLAIILVMYCRVYVVA------------------------------------------KRESRGLKSGLKTDKS---DSEQVTLRIHRK-----------------NAPAGGSGMASAKTKTHFSVRLLKFSREKKAAKTLGIVVGCFVLCWLPFFLVMPIGSFFPD-----FKPSETVFKIVFWLGYLNSCINPIIYPCSSQEFKKAF 337          
BLAST of GCR011 vs. Ensembl Human
Match: ADRA1A (adrenoceptor alpha 1A [Source:HGNC Symbol;Acc:HGNC:277])

HSP 1 Score: 160.229 bits (404), Expect = 5.394e-44
Identity = 111/362 (30.66%), Postives = 184/362 (50.83%), Query Frame = 2
Query:  122 GNSLILIAVLTTRHLQTVTNFYXXXXXXXXXXXXGTVLPLTIAKELHGKWVLGKHVCQFWVSMDILLCTASILNLCCISIDRYMAITKPLVYATKRSYKLAGCMILIAWILXXXXXXXXXXGWSDHNFTNTT-CEISIHLGFRIYSSLGSFFIPLILMIFVYLRIFAIANYRKILLNSHQXXXXXXXXXXXXXXXXXXXLDFQTSNPSSQQRRQALDLESNPKHAQALKLNSYLCQRPIHRSCALQNLIYKSGNLQNFTNLSTGCAVLSSGLSQSQKGKETAAFLREHKTAKVIAMVIGCFVVCWLPFFTIYVLESLCSQRILCPYPIGSLLVKSVTWLGYINSALNPFLYAFYNKEYARTF 1204
            GN L++++V   RHL +VT++Y+V+LA+ADLL++ TVLP +   E+ G W  G+  C  W ++D+L CTASI+ LC ISIDRY+ ++ PL Y T  + +     +L  W LS++IS+ P+ GW      + T C+I+   G+ ++S+LGSF++PL +++ +Y R++ +A                                          +R++  L+S  K  ++   +S      IHR                  N   G + ++S  +++        F RE K AK + +V+GCFV+CWLPFF +  + S         +     + K V WLGY+NS +NP +Y   ++E+ + F
Sbjct:   43 GNILVILSVACHRHLHSVTHYYIVNLAVADLLLTSTVLPFSAIFEVLGYWAFGRVFCNIWAAVDVLCCTASIMGLCIISIDRYIGVSYPLRYPTIVTQRRGLMALLCVWALSLVISIGPLFGWRQPAPEDETICQINEEPGYVLFSALGSFYLPLAIILVMYCRVYVVA------------------------------------------KRESRGLKSGLKTDKS---DSEQVTLRIHRK-----------------NAPAGGSGMASAKTKTHFSVRLLKFSREKKAAKTLGIVVGCFVLCWLPFFLVMPIGSFFPD-----FKPSETVFKIVFWLGYLNSCINPIIYPCSSQEFKKAF 337          
BLAST of GCR011 vs. Ensembl Human
Match: ADRA2A (adrenoceptor alpha 2A [Source:HGNC Symbol;Acc:HGNC:281])

HSP 1 Score: 160.229 bits (404), Expect = 1.101e-43
Identity = 123/396 (31.06%), Postives = 196/396 (49.49%), Query Frame = 2
Query:  122 GNSLILIAVLTTRHLQTVTNFYXXXXXXXXXXXXGTVLPLTIAKELHGKWVLGKHVCQFWVSMDILLCTASILNLCCISIDRYMAITKPLVYATKRSYKLAGCMILIAWILXXXXXXXXXXG------WSDHNFTNTTCEISIHLGFRIYSSLGSFFIPLILMIFVYLRIFAIANYRKILLNSHQXXXXXXXXXXXXXXXXXXXLDFQTSNPSSQQRR---------------------QALDLE--SNPKHAQALKLNSYLCQRPIHRSCALQNLIYKSGNLQNFTNLSTGCAVLSSGLSQSQKGKETAAFL-----REHKTAKVIAMVIGCFVVCWLPFFTIYVLESL-CSQRILCPYPIGSLLVKSVTWLGYINSALNPFLYAFYNKEYARTF 1204
            GN L++IAV T+R L+   N ++VSLA AD+LV+  V+P ++A E+ G W  GK  C+ ++++D+L CT+SI++LC IS+DRY +IT+ + Y  KR+ +    +I+  W++S +IS PP+I                 CEI+    + I S +GSFF P ++MI VY+RI+ IA  R  +  S +    + +    +          +++ P   +                        ALDLE  S+  HA+         + P  +  A  + +    +L      +TG    ++G  + + G   A+       RE +   V+A+VIG FVVCW PFF  Y L ++ CS        +   L K   W GY NS+LNP +Y  +N ++ R F
Sbjct:   65 GNVLVIIAVFTSRALKAPQNLFLVSLASADILVATLVIPFSLANEVMGYWYFGKAWCEIYLALDVLFCTSSIVHLCAISLDRYWSITQAIEYNLKRTPRRIKAIIITVWVISAVISFPPLISIEKKGGGGGPQPAEPRCEINDQKWYVISSCIGSFFAPCLIMILVYVRIYQIAKRRTRVPPSRRGPDAVAAPPGGTERRPNGLGPERSAGPGGAEAEPLPTQLNGAPGEPAPAGPRDTDALDLEESSSSDHAERPPGPRRPERGPRGKGKARASQVKPGDSLPRRGPGATGIGTPAAGPGEERVGAAKASRWRGRQNREKRFTFVLAVVIGVFVVCWFPFFFTYTLTAVGCS--------VPRTLFKFFFWFGYCNSSLNPVIYTIFNHDFRRAF 452          
BLAST of GCR011 vs. Ensembl Human
Match: ADRA1A (adrenoceptor alpha 1A [Source:HGNC Symbol;Acc:HGNC:277])

HSP 1 Score: 159.844 bits (403), Expect = 1.372e-43
Identity = 111/362 (30.66%), Postives = 184/362 (50.83%), Query Frame = 2
Query:  122 GNSLILIAVLTTRHLQTVTNFYXXXXXXXXXXXXGTVLPLTIAKELHGKWVLGKHVCQFWVSMDILLCTASILNLCCISIDRYMAITKPLVYATKRSYKLAGCMILIAWILXXXXXXXXXXGWSDHNFTNTT-CEISIHLGFRIYSSLGSFFIPLILMIFVYLRIFAIANYRKILLNSHQXXXXXXXXXXXXXXXXXXXLDFQTSNPSSQQRRQALDLESNPKHAQALKLNSYLCQRPIHRSCALQNLIYKSGNLQNFTNLSTGCAVLSSGLSQSQKGKETAAFLREHKTAKVIAMVIGCFVVCWLPFFTIYVLESLCSQRILCPYPIGSLLVKSVTWLGYINSALNPFLYAFYNKEYARTF 1204
            GN L++++V   RHL +VT++Y+V+LA+ADLL++ TVLP +   E+ G W  G+  C  W ++D+L CTASI+ LC ISIDRY+ ++ PL Y T  + +     +L  W LS++IS+ P+ GW      + T C+I+   G+ ++S+LGSF++PL +++ +Y R++ +A                                          +R++  L+S  K  ++   +S      IHR                  N   G + ++S  +++        F RE K AK + +V+GCFV+CWLPFF +  + S         +     + K V WLGY+NS +NP +Y   ++E+ + F
Sbjct:   43 GNILVILSVACHRHLHSVTHYYIVNLAVADLLLTSTVLPFSAIFEVLGYWAFGRVFCNIWAAVDVLCCTASIMGLCIISIDRYIGVSYPLRYPTIVTQRRGLMALLCVWALSLVISIGPLFGWRQPAPEDETICQINEEPGYVLFSALGSFYLPLAIILVMYCRVYVVA------------------------------------------KRESRGLKSGLKTDKS---DSEQVTLRIHRK-----------------NAPAGGSGMASAKTKTHFSVRLLKFSREKKAAKTLGIVVGCFVLCWLPFFLVMPIGSFFPD-----FKPSETVFKIVFWLGYLNSCINPIIYPCSSQEFKKAF 337          
BLAST of GCR011 vs. Ensembl Celegans
Match: ser-2 (Tyramine receptor Ser-2 [Source:UniProtKB/Swiss-Prot;Acc:O02213])

HSP 1 Score: 180.259 bits (456), Expect = 4.701e-52
Identity = 133/364 (36.54%), Postives = 201/364 (55.22%), Query Frame = 2
Query:  122 GNSLILIAVLTTRHLQTVTNFYXXXXXXXXXXXXGTVLPLTIAKELHG-KWVLGKHVCQFWVSMDILLCTASILNLCCISIDRYMAITKPLVYATKRSYKLAGCMILIAWILXXXXXXXXXXGWSD--HNFTNTTCEISIHLGFRIYSSLGSFFIPLILMIFVYLRIFAIANYRKILLNSHQXXXXXXXXXXXXXXXXXXXLDFQTSNPSSQQRRQALDLESNPKHAQALKLNSYLCQRPIHRSCALQNLIYKSGNLQNFTNLSTGCAVLSSGLSQSQKGKETAAFLREHKTAKVIAMVIGCFVVCWLPFFTIYVLESLCSQRILCPYPIGSLLVKSVTWLGYINSALNPFLYAFYNKEYARTF 1204
            GN+L+++AV + R L+ V N+++VSLA +DL V+  V+PL +   L G KW+LG  VCQF+ + DILLCT+SILNLC I++DRY AI  P+ YA KR+ K    +I+I WILS++ISVPP+IGW++   N    +C +S    F ++S+ GSFF+PL++M+ VY++IF I+  ++I  N  +                   +  Q +      R+             ++K  S    R   R      L+   G     T ++T  A  +   +   + +E  +  +E + AK IA++I  F  CWLPFF  YV+   C     C   + + + ++ TWLGYINS+LNPFLY   N E+ R F
Sbjct:   74 GNTLVVVAVFSYRPLKKVQNYFLVSLAASDLAVAIFVMPLHVVTFLAGGKWLLGVTVCQFFTTADILLCTSSILNLCAIALDRYWAIHNPINYAQKRTTKFVCIVIVIVWILSMLISVPPIIGWNNWQENMMEDSCGLSTEKAFVVFSAAGSFFLPLLVMVVVYVKIF-ISARQRIRTNRGR----------------SALMRIQNAEGDDDYRK------------MSIKRASVESARTSSRVGEKTPLVIADGQ----TTVTTLAAHSNPNPTAVLRKREKISVAKEKRAAKTIAVIIFVFSFCWLPFFVAYVIRPFCET---C--KLHAKVEQAFTWLGYINSSLNPFLYGILNLEFRRAF 399          
BLAST of GCR011 vs. Ensembl Celegans
Match: ser-2 (Tyramine receptor Ser-2 [Source:UniProtKB/Swiss-Prot;Acc:O02213])

HSP 1 Score: 180.259 bits (456), Expect = 4.758e-52
Identity = 135/367 (36.78%), Postives = 209/367 (56.95%), Query Frame = 2
Query:  122 GNSLILIAVLTTRHLQTVTNFYXXXXXXXXXXXXGTVLPLTIAKELHG-KWVLGKHVCQFWVSMDILLCTASILNLCCISIDRYMAITKPLVYATKRSYKLAGCMILIAWILXXXXXXXXXXGWSD--HNFTNTTCEISIHLGFRIYSSLGSFFIPLILMIFVYLRIFAIANYRKILLNSHQXXXXXXXXXXXXXXXXXXXLDFQTSNPSSQQRRQALDLESNPKHAQALKL---NSYLCQRPIHRSCALQNLIYKSGNLQNFTNLSTGCAVLSSGLSQSQKGKETAAFLREHKTAKVIAMVIGCFVVCWLPFFTIYVLESLCSQRILCPYPIGSLLVKSVTWLGYINSALNPFLYAFYNKEYARTF 1204
            GN+L+++AV + R L+ V N+++VSLA +DL V+  V+PL +   L G KW+LG  VCQF+ + DILLCT+SILNLC I++DRY AI  P+ YA KR+ K    +I+I WILS++ISVPP+IGW++   N    +C +S    F ++S+ GSFF+PL++M+ VY++IF  A  R   + +++    +   +N+     Y+ +  + ++  S +     D  S PK      +   N+  C+        ++++    GN           AVL        + +E  +  +E + AK IA++I  F  CWLPFF  YV+   C     C   + + + ++ TWLGYINS+LNPFLY   N E+ R F
Sbjct:   63 GNTLVVVAVFSYRPLKKVQNYFLVSLAASDLAVAIFVMPLHVVTFLAGGKWLLGVTVCQFFTTADILLCTSSILNLCAIALDRYWAIHNPINYAQKRTTKFVCIVIVIVWILSMLISVPPIIGWNNWQENMMEDSCGLSTEKAFVVFSAAGSFFLPLLVMVVVYVKIFISARQR---IRTNRGRSALMRIQNAEGDDDYRKMSIKRASVESARTSSRTDGGSLPKDETTKHMKYHNNGSCK------VKVKDVKEDEGN-------PNPTAVL--------RKREKISVAKEKRAAKTIAVIIFVFSFCWLPFFVAYVIRPFCET---C--KLHAKVEQAFTWLGYINSSLNPFLYGILNLEFRRAF 400          
BLAST of GCR011 vs. Ensembl Celegans
Match: ser-2 (Tyramine receptor Ser-2 [Source:UniProtKB/Swiss-Prot;Acc:O02213])

HSP 1 Score: 180.259 bits (456), Expect = 6.310e-52
Identity = 135/367 (36.78%), Postives = 209/367 (56.95%), Query Frame = 2
Query:  122 GNSLILIAVLTTRHLQTVTNFYXXXXXXXXXXXXGTVLPLTIAKELHG-KWVLGKHVCQFWVSMDILLCTASILNLCCISIDRYMAITKPLVYATKRSYKLAGCMILIAWILXXXXXXXXXXGWSD--HNFTNTTCEISIHLGFRIYSSLGSFFIPLILMIFVYLRIFAIANYRKILLNSHQXXXXXXXXXXXXXXXXXXXLDFQTSNPSSQQRRQALDLESNPKHAQALKL---NSYLCQRPIHRSCALQNLIYKSGNLQNFTNLSTGCAVLSSGLSQSQKGKETAAFLREHKTAKVIAMVIGCFVVCWLPFFTIYVLESLCSQRILCPYPIGSLLVKSVTWLGYINSALNPFLYAFYNKEYARTF 1204
            GN+L+++AV + R L+ V N+++VSLA +DL V+  V+PL +   L G KW+LG  VCQF+ + DILLCT+SILNLC I++DRY AI  P+ YA KR+ K    +I+I WILS++ISVPP+IGW++   N    +C +S    F ++S+ GSFF+PL++M+ VY++IF  A  R   + +++    +   +N+     Y+ +  + ++  S +     D  S PK      +   N+  C+        ++++    GN           AVL        + +E  +  +E + AK IA++I  F  CWLPFF  YV+   C     C   + + + ++ TWLGYINS+LNPFLY   N E+ R F
Sbjct:   71 GNTLVVVAVFSYRPLKKVQNYFLVSLAASDLAVAIFVMPLHVVTFLAGGKWLLGVTVCQFFTTADILLCTSSILNLCAIALDRYWAIHNPINYAQKRTTKFVCIVIVIVWILSMLISVPPIIGWNNWQENMMEDSCGLSTEKAFVVFSAAGSFFLPLLVMVVVYVKIFISARQR---IRTNRGRSALMRIQNAEGDDDYRKMSIKRASVESARTSSRTDGGSLPKDETTKHMKYHNNGSCK------VKVKDVKEDEGN-------PNPTAVL--------RKREKISVAKEKRAAKTIAVIIFVFSFCWLPFFVAYVIRPFCET---C--KLHAKVEQAFTWLGYINSSLNPFLYGILNLEFRRAF 408          
BLAST of GCR011 vs. Ensembl Celegans
Match: ser-2 (Tyramine receptor Ser-2 [Source:UniProtKB/Swiss-Prot;Acc:O02213])

HSP 1 Score: 180.259 bits (456), Expect = 6.955e-52
Identity = 135/367 (36.78%), Postives = 209/367 (56.95%), Query Frame = 2
Query:  122 GNSLILIAVLTTRHLQTVTNFYXXXXXXXXXXXXGTVLPLTIAKELHG-KWVLGKHVCQFWVSMDILLCTASILNLCCISIDRYMAITKPLVYATKRSYKLAGCMILIAWILXXXXXXXXXXGWSD--HNFTNTTCEISIHLGFRIYSSLGSFFIPLILMIFVYLRIFAIANYRKILLNSHQXXXXXXXXXXXXXXXXXXXLDFQTSNPSSQQRRQALDLESNPKHAQALKL---NSYLCQRPIHRSCALQNLIYKSGNLQNFTNLSTGCAVLSSGLSQSQKGKETAAFLREHKTAKVIAMVIGCFVVCWLPFFTIYVLESLCSQRILCPYPIGSLLVKSVTWLGYINSALNPFLYAFYNKEYARTF 1204
            GN+L+++AV + R L+ V N+++VSLA +DL V+  V+PL +   L G KW+LG  VCQF+ + DILLCT+SILNLC I++DRY AI  P+ YA KR+ K    +I+I WILS++ISVPP+IGW++   N    +C +S    F ++S+ GSFF+PL++M+ VY++IF  A  R   + +++    +   +N+     Y+ +  + ++  S +     D  S PK      +   N+  C+        ++++    GN           AVL        + +E  +  +E + AK IA++I  F  CWLPFF  YV+   C     C   + + + ++ TWLGYINS+LNPFLY   N E+ R F
Sbjct:   74 GNTLVVVAVFSYRPLKKVQNYFLVSLAASDLAVAIFVMPLHVVTFLAGGKWLLGVTVCQFFTTADILLCTSSILNLCAIALDRYWAIHNPINYAQKRTTKFVCIVIVIVWILSMLISVPPIIGWNNWQENMMEDSCGLSTEKAFVVFSAAGSFFLPLLVMVVVYVKIFISARQR---IRTNRGRSALMRIQNAEGDDDYRKMSIKRASVESARTSSRTDGGSLPKDETTKHMKYHNNGSCK------VKVKDVKEDEGN-------PNPTAVL--------RKREKISVAKEKRAAKTIAVIIFVFSFCWLPFFVAYVIRPFCET---C--KLHAKVEQAFTWLGYINSSLNPFLYGILNLEFRRAF 411          
BLAST of GCR011 vs. Ensembl Celegans
Match: ser-2 (Tyramine receptor Ser-2 [Source:UniProtKB/Swiss-Prot;Acc:O02213])

HSP 1 Score: 174.096 bits (440), Expect = 2.513e-49
Identity = 132/373 (35.39%), Postives = 205/373 (54.96%), Query Frame = 2
Query:  122 GNSLILIAVLTTRHLQTVTNFYXXXXXXXXXXXXGTVLPLTIAKELHG-KWVLGKHVCQFWVSMDILLCTASILNLCCISIDRYMAITKPLVYATKRSYKLAGCMILIAWILXXXXXXXXXXGWSD--HNFTNTTCEISIHLGFRIYSSLGSFFIPLILMIFVYLRIFAIANYRKILLNSHQXXXXXXXXXXXXXXXXXXXLDFQTSNPSSQQRRQALDLESNPKHAQALKLNSYLCQRPIHRSCALQNLIYKSGNLQNFTNLSTGCAVLSSGLSQSQKGKETAAFLR---------EHKTAKVIAMVIGCFVVCWLPFFTIYVLESLCSQRILCPYPIGSLLVKSVTWLGYINSALNPFLYAFYNKEYARTF 1204
            GN+L+++AV + R L+ V N+++VSLA +DL V+  V+PL +   L G KW+LG  VCQF+ + DILLCT+SILNLC I++DRY AI  P+ YA KR+ K    +I+I WILS++ISVPP+IGW++   N    +C +S    F ++S+ GSFF+PL++M+ VY++IF  A  R   + +++    +   +N+     Y+ +  + ++  S +    +  ++    A      + L           ++   K     N    +  C V    + + +      A LR         E + AK IA++I  F  CWLPFF  YV+   C     C   + + + ++ TWLGYINS+LNPFLY   N E+ R F
Sbjct:   74 GNTLVVVAVFSYRPLKKVQNYFLVSLAASDLAVAIFVMPLHVVTFLAGGKWLLGVTVCQFFTTADILLCTSSILNLCAIALDRYWAIHNPINYAQKRTTKFVCIVIVIVWILSMLISVPPIIGWNNWQENMMEDSCGLSTEKAFVVFSAAGSFFLPLLVMVVVYVKIFISARQR---IRTNRGRSALMRIQNAEGDDDYRKMSIKRASVESARTSSRVGEKTPLVIADGQTTVTTLAAHSTDGGSLPKDETTKHMKYHN----NGSCKVKVKDVKEDEGNPNPTAVLRKREKISVAKEKRAAKTIAVIIFVFSFCWLPFFVAYVIRPFCET---C--KLHAKVEQAFTWLGYINSSLNPFLYGILNLEFRRAF 434          
BLAST of GCR011 vs. Ensembl Fly
Match: 5-HT7 (gene:FBgn0004573 transcript:FBtr0334508)

HSP 1 Score: 147.902 bits (372), Expect = 5.651e-39
Identity = 117/377 (31.03%), Postives = 180/377 (47.75%), Query Frame = 2
Query:  122 GNSLILIAVLTTRHLQTVTNFYXXXXXXXXXXXXGTVLPLTIAKELHGKWVLGKHVCQFWVSMDILLCTASILNLCCISIDRYMAITKPLVYATKRSYKLAGCMILIAWILXX---XXXXXXXXGWSDHNFTNTTCEISIHLGFRIYSSLGSFFIPLILMIFVYLRIFAIANYRKILLNSHQXXXXXXXXXXXXXXXXXXXLDFQTSNPSSQQRRQALDLESNPKHAQALKL------NSYLCQRPIHRSCALQNLIYKSGNLQNFTNLSTGCAVLSSG-------LSQSQKGKETAAFLREHKTAKVIAMVIGCFVVCWLPFFTIYVLESLCSQRILCPYPIGSLLVKSVTWLGYINSALNPFLYAFYNKEYARTF 1204
            GN L+ IAV   R L+   N+ +VSLAL+DL V+  V+P+ +  E+  KW  G  +C  WVS D+L CTASILNLC IS+DRY+AITKPL Y  KR+ +     + I W+ +    +  +  +    +       C +  +  ++IY++LGSF+IPL +M+FVY +IF  A  R+I+L   +                           +    +QAL+   +P   QA  L      +S   QR  H S    +L Y +    +    +        G       L      K      +E K +  + +++  F VCWLPFF + ++    +  +  P  + SL +    WLGY NS LNP +YA  N+++ + F
Sbjct:  179 GNVLVCIAVCMVRKLRRPCNYLLVSLALSDLCVALLVMPMALLYEVLEKWNFGPLLCDIWVSFDVLCCTASILNLCAISVDRYLAITKPLEYGVKRTPRRMMLCVGIVWLAAACISLPPLLILGNEHEDEEGQPICTVCQNFAYQIYATLGSFYIPLSVMLFVYYQIFRAA--RRIVLEEKR---------------------------AQTHLQQALNGTGSPSAPQAPPLGHTELASSGNGQR--HSSVGNTSLTYSTCGGLSSGGGALAGHGSGGGVSGSTGLLGSPHHKKLRFQLAKEKKASTTLGIIMSAFTVCWLPFFILALIRPFETMHV--PASLSSLFL----WLGYANSLLNPIIYATLNRDFRKPF 518          
BLAST of GCR011 vs. Ensembl Fly
Match: 5-HT7 (gene:FBgn0004573 transcript:FBtr0085746)

HSP 1 Score: 147.902 bits (372), Expect = 5.651e-39
Identity = 117/377 (31.03%), Postives = 180/377 (47.75%), Query Frame = 2
Query:  122 GNSLILIAVLTTRHLQTVTNFYXXXXXXXXXXXXGTVLPLTIAKELHGKWVLGKHVCQFWVSMDILLCTASILNLCCISIDRYMAITKPLVYATKRSYKLAGCMILIAWILXX---XXXXXXXXGWSDHNFTNTTCEISIHLGFRIYSSLGSFFIPLILMIFVYLRIFAIANYRKILLNSHQXXXXXXXXXXXXXXXXXXXLDFQTSNPSSQQRRQALDLESNPKHAQALKL------NSYLCQRPIHRSCALQNLIYKSGNLQNFTNLSTGCAVLSSG-------LSQSQKGKETAAFLREHKTAKVIAMVIGCFVVCWLPFFTIYVLESLCSQRILCPYPIGSLLVKSVTWLGYINSALNPFLYAFYNKEYARTF 1204
            GN L+ IAV   R L+   N+ +VSLAL+DL V+  V+P+ +  E+  KW  G  +C  WVS D+L CTASILNLC IS+DRY+AITKPL Y  KR+ +     + I W+ +    +  +  +    +       C +  +  ++IY++LGSF+IPL +M+FVY +IF  A  R+I+L   +                           +    +QAL+   +P   QA  L      +S   QR  H S    +L Y +    +    +        G       L      K      +E K +  + +++  F VCWLPFF + ++    +  +  P  + SL +    WLGY NS LNP +YA  N+++ + F
Sbjct:  179 GNVLVCIAVCMVRKLRRPCNYLLVSLALSDLCVALLVMPMALLYEVLEKWNFGPLLCDIWVSFDVLCCTASILNLCAISVDRYLAITKPLEYGVKRTPRRMMLCVGIVWLAAACISLPPLLILGNEHEDEEGQPICTVCQNFAYQIYATLGSFYIPLSVMLFVYYQIFRAA--RRIVLEEKR---------------------------AQTHLQQALNGTGSPSAPQAPPLGHTELASSGNGQR--HSSVGNTSLTYSTCGGLSSGGGALAGHGSGGGVSGSTGLLGSPHHKKLRFQLAKEKKASTTLGIIMSAFTVCWLPFFILALIRPFETMHV--PASLSSLFL----WLGYANSLLNPIIYATLNRDFRKPF 518          
BLAST of GCR011 vs. Ensembl Fly
Match: Dop2R (gene:FBgn0053517 transcript:FBtr0343167)

HSP 1 Score: 147.902 bits (372), Expect = 2.214e-38
Identity = 117/386 (30.31%), Postives = 202/386 (52.33%), Query Frame = 2
Query:  122 GNSLILIAVLTTRHLQTVTNFYXXXXXXXXXXXXGTVLPLTIAKELHGKWVLGKHVCQFWVSMDILLCTASILNLCCISIDRYMAITKPLVYATKRSYKLAGCMILIAWILXXXXXXXXXXGWSDHNFTNTTCEISI--HLGFRIYSSLGSFFIPLILMIFVYLRIFAIANYR------------------KILLNSHQXXXXXXXXXXXXXXXXXXXLDFQTSNPSSQQRRQALDLESNPKHAQALKLNSYLCQRPIHRSCA---LQNLIYKSGNLQNFTNLSTGCAVLSSGLSQSQKGK-ETAAFLREHKTAKVIAMVIGCFVVCWLPFFTIYVLESLCSQ-RILCPYPIGSLLVKSVTWLGYINSALNPFLYAFYNKEYARTF 1204
            GN L++++V   R LQTVTN+++VSLA+ADLLV+  V+P  +   ++G W L   VC F+++MD++  T+SI NL  ISIDRY+A+T+P+ YA  ++ +     IL+ W +S  I  P V+G   +N  N   ++    +  F +YSSL SF+IP I+M+F+Y  IF     R                   ++ N  Q+ R  ++  +SS   S    D   +N +S    +        +   A+  +   C   ++       L  ++ ++G    +             + ++ K K E ++  +E K  K +A+V+G F+ CWLPFF+  +++++C++ +  C   + + ++   TWLGYINS +NP +Y  +N E+ + F
Sbjct:  392 GNILVILSVCRERSLQTVTNYFIVSLAIADLLVAVVVMPFAVYFLVNGAWALPDVVCDFYIAMDVICSTSSIFNLVAISIDRYIAVTQPIKYAKHKNSRRVCLTILLVWAISAAIGSPIVLGL--NNTPNREPDVCAFYNADFILYSSLSSFYIPCIIMVFLYWNIFKALRSRARKQRAARKPHLSELTGGSVIENIAQTRRLAETALDSSRHASRILPDEAATNTASGSNEE--------EDENAISPDIDDCHVIVNDKSTEFMLATVVEETGKFTIYK------------VHKASKKKREKSSAKKERKATKTLAIVLGVFLFCWLPFFSCNIMDAMCAKFKKDCRPGLTAYMM--TTWLGYINSFVNPVIYTIFNPEFRKAF 753          
BLAST of GCR011 vs. Ensembl Fly
Match: TyrR (gene:FBgn0038542 transcript:FBtr0344474)

HSP 1 Score: 144.05 bits (362), Expect = 3.036e-37
Identity = 85/166 (51.20%), Postives = 125/166 (75.30%), Query Frame = 2
Query:  122 GNSLILIAVLTTRHLQTVTNFYXXXXXXXXXXXXGTVLPLTIAKELHGKWVLGKHVCQFWVSMDILLCTASILNLCCISIDRYMAITKPLVYATK-RSYKLAGCMILIAWILXXXXXXXXXXGWSDHNFTN-TTCEISIHLGFRIYSSLGSFFIPLILMIFVYLRI 613
            GN+L+++A+LTTR L+T+TN +V+SLA+ADLLV   V+P  +A  L G W LG  +C  W+S+D+LLCTASIL+LC IS+DRY+A+T+PL Y+ K RS +LA  MILI W+L++ I+ PP++GW +    +   C  + + G+ I+S++GSFFIP+ +MI+VY RI
Sbjct:  133 GNTLVILAILTTRRLRTITNCFVMSLAVADLLVGIFVMPPAVAVHLIGSWQLGWVLCDIWISLDVLLCTASILSLCAISVDRYLAVTRPLTYSRKRRSKRLALIMILIVWLLALAITCPPMLGWYEPGRRDLRECRYNQNEGYVIFSAMGSFFIPMAVMIYVYARI 298          

HSP 2 Score: 74.7146 bits (182), Expect = 4.013e-14
Identity = 31/77 (40.26%), Postives = 51/77 (66.23%), Query Frame = 2
Query:  974 REHKTAKVIAMVIGCFVVCWLPFFTIYVLESLCSQRILCPYPIGSLLVKSVTWLGYINSALNPFLYAFYNKEYARTF 1204
            +E+KT + +++V+G F+ CWLPFF  Y++        L  +    +L K++TWLG+ NSA+NPF+YAFY+ ++   F
Sbjct:  534 KENKTTQTLSIVVGGFIACWLPFFINYLITPF-----LAEHQASQMLAKALTWLGWFNSAINPFIYAFYSVDFRAAF 605          
BLAST of GCR011 vs. Ensembl Fly
Match: TyrR (gene:FBgn0038542 transcript:FBtr0083532)

HSP 1 Score: 144.05 bits (362), Expect = 3.036e-37
Identity = 85/166 (51.20%), Postives = 125/166 (75.30%), Query Frame = 2
Query:  122 GNSLILIAVLTTRHLQTVTNFYXXXXXXXXXXXXGTVLPLTIAKELHGKWVLGKHVCQFWVSMDILLCTASILNLCCISIDRYMAITKPLVYATK-RSYKLAGCMILIAWILXXXXXXXXXXGWSDHNFTN-TTCEISIHLGFRIYSSLGSFFIPLILMIFVYLRI 613
            GN+L+++A+LTTR L+T+TN +V+SLA+ADLLV   V+P  +A  L G W LG  +C  W+S+D+LLCTASIL+LC IS+DRY+A+T+PL Y+ K RS +LA  MILI W+L++ I+ PP++GW +    +   C  + + G+ I+S++GSFFIP+ +MI+VY RI
Sbjct:  133 GNTLVILAILTTRRLRTITNCFVMSLAVADLLVGIFVMPPAVAVHLIGSWQLGWVLCDIWISLDVLLCTASILSLCAISVDRYLAVTRPLTYSRKRRSKRLALIMILIVWLLALAITCPPMLGWYEPGRRDLRECRYNQNEGYVIFSAMGSFFIPMAVMIYVYARI 298          

HSP 2 Score: 74.7146 bits (182), Expect = 4.013e-14
Identity = 31/77 (40.26%), Postives = 51/77 (66.23%), Query Frame = 2
Query:  974 REHKTAKVIAMVIGCFVVCWLPFFTIYVLESLCSQRILCPYPIGSLLVKSVTWLGYINSALNPFLYAFYNKEYARTF 1204
            +E+KT + +++V+G F+ CWLPFF  Y++        L  +    +L K++TWLG+ NSA+NPF+YAFY+ ++   F
Sbjct:  534 KENKTTQTLSIVVGGFIACWLPFFINYLITPF-----LAEHQASQMLAKALTWLGWFNSAINPFIYAFYSVDFRAAF 605          
BLAST of GCR011 vs. Ensembl Zebrafish
Match: htr1aa (5-hydroxytryptamine (serotonin) receptor 1A a [Source:ZFIN;Acc:ZDB-GENE-071203-1])

HSP 1 Score: 176.022 bits (445), Expect = 1.877e-50
Identity = 118/365 (32.33%), Postives = 192/365 (52.60%), Query Frame = 2
Query:  122 GNSLILIAVLTTRHLQTVTNFYXXXXXXXXXXXXGTVLPLTIAKELHGKWVLGKHVCQFWVSMDILLCTASILNLCCISIDRYMAITKPLVYATKRSYKLAGCMILIAWILXXXXXXXXXXGW--SDHNFTNTTCEISIHLGFRIYSSLGSFFIPLILMIFVYLRIFAIANY--RKILLNSHQXXXXXXXXXXXXXXXXXXXLDFQTSNPSSQQRRQALDLESNPKHAQALKLNSYLCQRPIHRSCALQNLIYKSGNLQNFTNLSTGCAVLSSGLSQSQKGKETAAFLREHKTAKVIAMVIGCFVVCWLPFFTIYVLESLCSQRILCPYPIGSLLVKSVTWLGYINSALNPFLYAFYNKEYARTF 1204
            GN+ ++ A+   R LQ V N+ + SLA+ DL+VS  VLP+    ++  KW LG+ +C  ++S+D+L CT+SIL+LC I++DRY AIT P+ Y  KR+ + A  +I + W++   IS+PP++GW   +       C IS   G+ IYS+ G+F+IPLILM+ +Y RIF  A +  RK +  + ++    K                   +P+   R+   ++    + +     N  L       S  +  +   S N  +  N    C    +   ++ + K   A  RE KT K + +++G F+ CWLPFF + ++   C Q    P  +G++    + WLGY NS LNP +YA++NK++   F
Sbjct:   45 GNACVIAAIALERSLQNVANYLIGSLAVTDLMVSVLVLPMAALYQVLNKWTLGQEMCDIFISLDVLCCTSSILHLCAIALDRYWAITDPIDYVNKRTPRRAAILISLTWLIGFSISIPPMLGWRKPEDRADPDACTISQDHGYTIYSTFGAFYIPLILMLVLYGRIFRAARFRIRKTVKKTEKAKIADKCLAV---------------SPALFPRKANGEVGKTWRRSVEPCANGALKNSDDGESFEITEVQSISKNHLSLPNNPQPC--FENRNEKNTEAKRKVALARERKTVKTLGIIMGTFIFCWLPFFIVALVLPFC-QDCFMPEWLGAV----INWLGYSNSLLNPVIYAYFNKDFQNAF 387          
BLAST of GCR011 vs. Ensembl Zebrafish
Match: htr7c (5-hydroxytryptamine (serotonin) receptor 7c [Source:ZFIN;Acc:ZDB-GENE-060526-5])

HSP 1 Score: 167.933 bits (424), Expect = 2.290e-47
Identity = 119/363 (32.78%), Postives = 192/363 (52.89%), Query Frame = 2
Query:  122 GNSLILIAVLTTRHLQTVTNFYXXXXXXXXXXXXGTVLPLTIAKEL-HGKWVLGKHVCQFWVSMDILLCTASILNLCCISIDRYMAITKPLVYATKRSYKLAGCMILIAWILXXXXXXXXXXGWSDHNFTNTTCEISIHLGFRIYSSLGSFFIPLILMIFVYLRIFAIANYRKILLNSHQXXXXXXXXXXXXXXXXXXXLDFQTSNPSSQQRRQALDLESNPKHAQALKLNSYLCQRPIHRSCALQNLIYKSGNLQNFTNLSTGCAVLSSGLSQSQKGKETAAFLREHKTAKVIAMVIGCFVVCWLPFFTIYVLES-LCSQRILCPYPIGSLLVKSVTWLGYINSALNPFLYAFYNKEYARTF 1204
            GN L++IAV   + L+  +N+ +VSLA+ADL V+  V+P  I  +L  GKW+ G+  C  ++ MD++ CTASI+ LC IS+DRY+ IT+PL Y  +++ +L   MI   W++S  I++PP  GW+ +  T   C IS   G+ IYS+  +F+IP+I+M+F+Y +IF  A         H+ +                  DF         RR+ L+  +    ++AL++      +P H                    ++  CA LS  LS+ +  +  + F RE K A  + +++G F +CWLPFF +      +C  +  C  PI   L +++ W GY NS +NPF+YAF+N++   T+
Sbjct:   70 GNMLVVIAVCVVKKLRQPSNYLLVSLAVADLSVAIVVMPFVIVTDLTGGKWLFGEVFCNIFIGMDVMCCTASIMTLCVISVDRYLGITRPLTYPARQNGQLMAKMIFGVWLVSASITLPPFCGWAKNVNTAGVCLISQDFGYTIYSTAVAFYIPMIVMLFMYYKIFKAARKSG---AKHRFT------------------DF--------SRRERLETVA----SEALRMQGL---KPQHTP-----------------GVAEECAALSRLLSRER--QNISIFKREQKAATTLGVIVGVFGICWLPFFILSTARPFICGVKCSC-IPI--WLERTLLWFGYANSLMNPFIYAFFNRDLRSTY 374          
BLAST of GCR011 vs. Ensembl Zebrafish
Match: FP236542.1 (alpha-2B adrenergic receptor-like [Source:NCBI gene;Acc:100330650])

HSP 1 Score: 164.081 bits (414), Expect = 1.156e-45
Identity = 118/388 (30.41%), Postives = 203/388 (52.32%), Query Frame = 2
Query:  122 GNSLILIAVLTTRHLQTVTNFYXXXXXXXXXXXXGTVLPLTIAKELHGKWVLGKHVCQFWVSMDILLCTASILNLCCISIDRYMAITKPLVYATKRS-YKLAGCMI---LIAWILXXXXXXXXXXGWSDHNFTNTTCEISIHLGFRIYSSLGSFFIPLILMIFVYLRIFAIANYR---------------KILLNSHQXXXXXXXXXXXXXXXXXXXLDFQTSNPSSQQRRQALDLESNPKHAQALK-----LNSYLCQRPIHRSCALQNLIYKSGNLQNFTNL---STGCAVLSSGLSQSQKGKETAAFLREHKTAKVIAMVIGCFVVCWLPFFTIYVLESLCSQRILCPYPIGSLLVKSVTWLGYINSALNPFLYAFYNKEYARTF 1204
            GN +++IAVLT R L+   N ++VSLA AD+LV+  V+P ++AKEL G W      C+  +++D+L CT+SI++LC IS+DRY++I++P+ Y T+R+  K+ G ++   LI+ I+S    V             TTCE++    + +YS++GSFF P ++MI VY+RI+ IA                  + L N      +  +N N + S S           S+Q+ +++   + N + + +       +  +           L+ +       Q++ N+   S G  + ++  + +   +  A  +RE +   V+A+VIG F++CW PFF  Y L+++C    +C  P G  L     W+GY NSALNP +Y  +N+++ + F
Sbjct:   35 GNIMVIIAVLTCRSLRGPQNLFLVSLAAADILVATLVIPFSLAKELMGCWYFESLWCEIILALDVLFCTSSIIHLCAISLDRYLSISRPVQYGTQRTPRKIKGAIVVVWLISAIISFPPLVSMDKPQQAKGDPRTTCELNEDKWYILYSTIGSFFAPCLIMILVYVRIYQIAKKHTRCPPGEPRKDSAVGRELQNGKDGGVDSANNPNIAPSKSEAVKQPPVITESAQKTKRSRRCKENKEESSSSGSDVEVVGGHDANGTNSNMAPLETVNKTPAQSQSYRNIIATSKGSQLANAKATGTPNTRRKAMIVREKRFTFVLAVVIGVFIICWFPFFFSYSLQAICPD--MCKVPEG--LFTFFFWIGYCNSALNPLIYTIFNRDFRKAF 418          
BLAST of GCR011 vs. Ensembl Zebrafish
Match: FP236542.1 (alpha-2B adrenergic receptor-like [Source:NCBI gene;Acc:100330650])

HSP 1 Score: 164.081 bits (414), Expect = 1.156e-45
Identity = 118/388 (30.41%), Postives = 203/388 (52.32%), Query Frame = 2
Query:  122 GNSLILIAVLTTRHLQTVTNFYXXXXXXXXXXXXGTVLPLTIAKELHGKWVLGKHVCQFWVSMDILLCTASILNLCCISIDRYMAITKPLVYATKRS-YKLAGCMI---LIAWILXXXXXXXXXXGWSDHNFTNTTCEISIHLGFRIYSSLGSFFIPLILMIFVYLRIFAIANYR---------------KILLNSHQXXXXXXXXXXXXXXXXXXXLDFQTSNPSSQQRRQALDLESNPKHAQALK-----LNSYLCQRPIHRSCALQNLIYKSGNLQNFTNL---STGCAVLSSGLSQSQKGKETAAFLREHKTAKVIAMVIGCFVVCWLPFFTIYVLESLCSQRILCPYPIGSLLVKSVTWLGYINSALNPFLYAFYNKEYARTF 1204
            GN +++IAVLT R L+   N ++VSLA AD+LV+  V+P ++AKEL G W      C+  +++D+L CT+SI++LC IS+DRY++I++P+ Y T+R+  K+ G ++   LI+ I+S    V             TTCE++    + +YS++GSFF P ++MI VY+RI+ IA                  + L N      +  +N N + S S           S+Q+ +++   + N + + +       +  +           L+ +       Q++ N+   S G  + ++  + +   +  A  +RE +   V+A+VIG F++CW PFF  Y L+++C    +C  P G  L     W+GY NSALNP +Y  +N+++ + F
Sbjct:   35 GNIMVIIAVLTCRSLRGPQNLFLVSLAAADILVATLVIPFSLAKELMGCWYFESLWCEIILALDVLFCTSSIIHLCAISLDRYLSISRPVQYGTQRTPRKIKGAIVVVWLISAIISFPPLVSMDKPQQAKGDPRTTCELNEDKWYILYSTIGSFFAPCLIMILVYVRIYQIAKKHTRCPPGEPRKDSAVGRELQNGKDGGVDSANNPNIAPSKSEAVKQPPVITESAQKTKRSRRCKENKEESSSSGSDVEVVGGHDANGTNSNMAPLETVNKTPAQSQSYRNIIATSKGSQLANAKATGTPNTRRKAMIVREKRFTFVLAVVIGVFIICWFPFFFSYSLQAICPD--MCKVPEG--LFTFFFWIGYCNSALNPLIYTIFNRDFRKAF 418          
BLAST of GCR011 vs. Ensembl Zebrafish
Match: adra1aa (adrenoceptor alpha 1Aa [Source:ZFIN;Acc:ZDB-GENE-030131-2831])

HSP 1 Score: 165.236 bits (417), Expect = 1.327e-45
Identity = 111/362 (30.66%), Postives = 188/362 (51.93%), Query Frame = 2
Query:  122 GNSLILIAVLTTRHLQTVTNFYXXXXXXXXXXXXGTVLPLTIAKELHGKWVLGKHVCQFWVSMDILLCTASILNLCCISIDRYMAITKPLVYATKRSYKLAGCMILIAWILXXXXXXXXXXGWSDHNFTNTT-CEISIHLGFRIYSSLGSFFIPLILMIFVYLRIFAIANYRKILLNSHQXXXXXXXXXXXXXXXXXXXLDFQTSNPSSQQRRQALDLESNPKHAQALKLNSYLCQRPIHRSCALQNLIYKSGNLQNFTNLSTGCAVLSSGLSQSQKGKETAAFLREHKTAKVIAMVIGCFVVCWLPFFTIYVLESLCSQRILCPYPIGSLLVKSVTWLGYINSALNPFLYAFYNKEYARTF 1204
            GN L++++V   R+L+TVT++++V+LA+ADLL+S TVLP +   E+ G+W+ G+  C  W +MD+L CTASI++LC IS+DRY+ ++ PL Y +  + + A   ++  W+LS+ IS+ P+ GW +    + + C+I+   G+ I+S+LGSF++PL++++ +Y R++ +A                                 +T    S Q+ +  D      HA+ + L  +     +    AL+N  + +  L  F+                          RE K AK + +V+GCFV+CWLPFF +  + S     I   Y     + K   WLGY NS +NP +Y   ++E+ + F
Sbjct:   57 GNILVILSVACHRNLRTVTHYFIVNLAVADLLLSSTVLPFSTVFEMLGRWIFGRPFCDVWAAMDVLCCTASIMSLCVISVDRYIGVSYPLQYPSIVTERRALLALIALWVLSITISIGPLFGWKEPAPDDESICKITEEPGYAIFSALGSFYLPLVVILSMYCRVYVVARR-------------------------------ETRGLISGQKTEKSD------HAETVTLRIHRGNMTVSEDEALRNRTHFALRLLKFS--------------------------REKKAAKTLGIVVGCFVLCWLPFFLVLPIGS-----IFPTYRPSDTVFKITFWLGYFNSCINPIIYPCSSQEFKKAF 350          
BLAST of GCR011 vs. Ensembl Xenopus
Match: ENSXETT00000046867.1 (5-hydroxytryptamine (serotonin) receptor 1A, G protein-coupled [Source:NCBI gene;Acc:100488829])

HSP 1 Score: 175.252 bits (443), Expect = 7.301e-50
Identity = 124/373 (33.24%), Postives = 195/373 (52.28%), Query Frame = 2
Query:  122 GNSLILIAVLTTRHLQTVTNFYXXXXXXXXXXXXGTVLPLTIAKELHGKWVLGKHVCQFWVSMDILLCTASILNLCCISIDRYMAITKPLVYATKRSYKLAGCMILIAWILXXXXXXXXXXGW---SDHNFTNTTCEISIHLGFRIYSSLGSFFIPLILMIFVYLRIFAIANYRKILLNSHQXXXXXXXXXXXXXXXXXXXLDFQTSNPSSQQRRQALDLESNPKHAQALKLNSYLCQRPIH-RSCALQNLI-----YKSGNLQNFTNLSTGCAVLSSGLSQSQK---GKETAAFLREHKTAKVIAMVIGCFVVCWLPFFTIYVLESLCSQRILCPYPIGSLLVKSVTWLGYINSALNPFLYAFYNKEYARTF 1204
            GN+ ++ A+   R LQTV N+ + SLA+ DL+VS  VLP+    ++  KW LG+  C  ++S+D+L CT+SIL+LC I++DRY AIT P+ Y  KR+ + A  +I I WI+   IS+PP++GW    D +  N  C+IS   G+ IYS+ G+F+IPLILM+ +Y +IF  A +R          + +                  + +P+  +R+   +   N K     K ++ +     H    A+  +I       S +  +  N +   AV      ++ +    K   A  RE KT K + +++G F+ CWLPFF + ++   C     C  P   LL   + WLGY NS LNP +YA++NK++   F
Sbjct:   46 GNACVIAAIALERCLQTVANYLIGSLAVTDLMVSVLVLPMAAHNQVLNKWTLGQVTCDIFISLDVLCCTSSILHLCAIALDRYWAITDPIDYVNKRTPRRAAVLISITWIVGFSISIPPMLGWRTPEDRSDPN-ACKISEDPGYTIYSTFGAFYIPLILMLVLYGKIFKAARFRIRKTVKKAEKKKVADTCL-------------SVSPAVAERKSNGEPSKNWKRTVEPKPSACVNGAIRHGEDGAVLEIIEVHHYVNSKSHLDLPNHAHDMAVAPCSEKRNDRATDAKRKVALARERKTVKTLGIIMGTFIFCWLPFFIVALVLPFCET---CHMP--HLLFDVINWLGYSNSLLNPIIYAYFNKDFQSAF 399          
BLAST of GCR011 vs. Ensembl Xenopus
Match: ADRA2B (adrenoceptor alpha 2B [Source:NCBI gene;Acc:100485811])

HSP 1 Score: 167.162 bits (422), Expect = 1.037e-46
Identity = 125/379 (32.98%), Postives = 201/379 (53.03%), Query Frame = 2
Query:  122 GNSLILIAVLTTRHLQTVTNFYXXXXXXXXXXXXGTVLPLTIAKELHGKWVLGKHVCQFWVSMDILLCTASILNLCCISIDRYMAITKPLVYATKRSYKLAGCMILIAWILXXXXXX--XXXXGWSDHNFTNTTCEISIHLGFRIYSSLGSFFIPLILMIFVYLRIFAIANYRKILLNSHQXXXXXXXXXXXXXXXXXXXLDFQTSNPSSQ------QRRQALDLESNPKHAQALKLNSYLCQRPIH-RSCALQ----NLIYKSG---NLQNFTNLSTGCAVLSSGLSQSQ--KGKETAAFLREHKTAKVIAMVIGCFVVCWLPFFTIYVLESLCSQRILCPYPIGSLLVKSVTWLGYINSALNPFLYAFYNKEYARTF 1204
            GN L++IAVLT+R L+   N ++VSLA AD+LV+  ++P ++A EL G W  GK  C+ ++++D+L CT+SI++LC IS+DRY ++++ + Y +KR+ K   C+ILI W L+ +IS+      G S        C+++    + + SS+ SFF P ++MI VYLRI+ IA  R    N   S+                     +S+  +Q      Q +  L L+    H     L+S   +R  H  S  LQ    NL + +G    + +      G  ++  G   S     K+ +   RE +   V+A+VIG FV+CW PFF  Y L ++C++  LC  P    + +   W+GY NS+LNP +Y  +N+++ + F
Sbjct:   34 GNVLVIIAVLTSRSLKAPQNLFLVSLAAADILVATLIIPFSLANELMGYWYFGKTWCEMYLALDVLFCTSSIVHLCAISLDRYWSVSQAIEYNSKRTPKRIKCIILIVWTLAALISLPPLIYKGKSKDQNAKPECKLNEEPWYILSSSICSFFAPCLIMILVYLRIYLIAKRR----NRKNSTDKKLKKMAPGLFSRTNKHSLNSSHTQTQCGIISSQEKTGLALDD--LHCGVPVLSSTREERNGHSESFGLQPQGENLKHTNGCEPAVMDTVATVKGVMLMPKGAKDSDLSSAKKKSYINREKRFTFVLAVVIGVFVLCWFPFFFTYSLGAICTE--LCYIPDS--VFQFFFWIGYCNSSLNPVIYTIFNQDFRKAF 402          
BLAST of GCR011 vs. Ensembl Xenopus
Match: efr3b (EFR3 homolog B [Source:Xenbase;Acc:XB-GENE-6033491])

HSP 1 Score: 162.155 bits (409), Expect = 3.124e-44
Identity = 110/362 (30.39%), Postives = 177/362 (48.90%), Query Frame = 2
Query:  122 GNSLILIAVLTTRHLQTVTNFYXXXXXXXXXXXXGTVLPLTIAKELHGKWVLGKHVCQFWVSMDILLCTASILNLCCISIDRYMAITKPLVYATKRSYKLAGCMILIAWILXXXXXXXXXXGWSDHNFTNTT-CEISIHLGFRIYSSLGSFFIPLILMIFVYLRIFAIANYRKILLNSHQXXXXXXXXXXXXXXXXXXXLDFQTSNPSSQQRRQALDLESNPKHAQALKLNSYLCQRPIHRSCALQNLIYKSGNLQNFTNLSTGCAVLSSGLSQSQKGKETAAFLREHKTAKVIAMVIGCFVVCWLPFFTIYVLESLCSQRILCPYPIGSLLVKSVTWLGYINSALNPFLYAFYNKEYARTF 1204
            GN L++++V   RHLQTVT++++ +LA+ADLL+   VLP +   E+ G W+ G+  C  W ++D+L CTASI++LC ISIDRY+ ++ PL Y +  + K     +L  W+LS++IS+ P+ GW      +   CEI+   G+ ++S+ GSF++PL +++ +Y R++ +A     +L S                                     + LE +      L+         IHR    +++                    SS   ++Q       F RE K AK + +V+GCFV+CWLPFF +  + S     I  P      + K   WLGY NS +NP +Y   + E+ + F
Sbjct:   67 GNILVILSVACHRHLQTVTHYFIANLAVADLLLMSMVLPFSATFEIQGYWLFGRIFCNIWAAVDVLCCTASIMSLCAISIDRYIGVSYPLRYPSIMTEKRGVLALLCIWVLSLVISIGPLFGWKQPAPEDDKICEITKEPGYALFSAFGSFYLPLSIILVMYFRVYIVAKRESKVLTS------------------------------------GMKLEKSDSEEVTLR---------IHRKSTPESI-----------------GSTSSSKQKTQFSVRLLKFSREKKAAKTLGIVVGCFVLCWLPFFLVMPIGS-----IYPPANSSDTIFKITFWLGYFNSCINPVIYPCSSPEFRKAF 361          
BLAST of GCR011 vs. Ensembl Xenopus
Match: DRD2 (dopamine receptor D2 [Source:NCBI gene;Acc:100493063])

HSP 1 Score: 158.303 bits (399), Expect = 3.337e-43
Identity = 132/399 (33.08%), Postives = 208/399 (52.13%), Query Frame = 2
Query:  122 GNSLILIAVLTTRHLQTVTNFYXXXXXXXXXXXXGTVLPLTIAKELHGKWVLGKHVCQFWVSMDILLCTASILNLCCISIDRYMAITKPLVYATKRSYK-LAGCMILIAWILXXXXXXXXXXGWSDHNFTNTTCEISIHLGFRIYSSLGSFFIPLILMIFVYLRIFAIANYRKILL----NSHQXXXXXXXXXXXXXXXXXXXLDFQTSN---PSSQQR--------RQALDLE-----SNP---KHAQALKLNSYLCQRPIHRSCALQNL---------IYKSGNLQNFTNLST--GCAVLSSGLSQSQKGKETAAFLREHKTAK---VIAMVIGCFVVCWLPFFTIYVLESLCSQRILCPYPIGSLLVKSVTWLGYINSALNPFLYAFYNKEYARTF 1204
            GN L+ IAV   + LQT TN+ +VSLA+ADLLV+  V+P  +  E+ G+W   +  C  +V++D+++CTASILNLC ISIDRY A+  P++Y T+ S K     MI + W+LS  IS P + G +  N  +  C I  +  F IYSS+ SF++P I+ + VY++I+ +   R+  +    NSH    N   +K +          F  SN   P+ +++         + +D+E     S P   KH  A   +  L        C   NL           K+G+ ++ T  +       + +G +++     +   L +HK  K   ++A+V+G F++CWLPFF I++L   C+    C  P    L  + TWLGY+NSA+NP +Y  +N E+ + F
Sbjct:   45 GNVLVCIAVSREKALQTTTNYLIVSLAVADLLVATLVMPWVVYMEVVGEWRFSRIHCDIFVTLDVMMCTASILNLCAISIDRYTAVAMPMLYNTRYSSKRRVTVMISVVWVLSFAISCPLLFGLN--NTASKVCIID-NPAFVIYSSIVSFYVPFIVTLLVYVQIYIVLRKRRKRVNTKRNSHGVEVNAHKDKCTHPEDVKLCAVFVKSNGSFPTDKKKVVSEAGNHPEDMDVEMMSSTSPPEKTKHKSASPNHHQLAVPATSNQCNNANLPSPVDSPYKAEKNGHPKDSTKPAKVFEIQTMPNGKTRTSIKTMSKRKLSQHKEKKATQMLAIVLGVFIICWLPFFIIHILNMHCN----CNIP--QALYSAFTWLGYVNSAVNPIIYTTFNVEFRKAF 434          
BLAST of GCR011 vs. Ensembl Xenopus
Match: ADRA1D (adrenoceptor alpha 1D [Source:NCBI gene;Acc:100495969])

HSP 1 Score: 152.91 bits (385), Expect = 7.152e-41
Identity = 118/362 (32.60%), Postives = 186/362 (51.38%), Query Frame = 2
Query:  122 GNSLILIAVLTTRHLQTVTNFYXXXXXXXXXXXXGTVLPLTIAKELHGKWVLGKHVCQFWVSMDILLCTASILNLCCISIDRYMAITKPLVYATKRSYKLAGCMILIAWILXXXXXXXXXXGWSD-HNFTNTTCEISIHLGFRIYSSLGSFFIPLILMIFVYLRIFAIANYRKILLNSHQXXXXXXXXXXXXXXXXXXXLDFQTSNPSSQQRRQALDLESNPKHAQALKLNSYLCQRPIHRSCALQNLIYKSGNLQNFTNLSTGCAVLSSGLSQSQKGKETAAFLREHKTAKVIAMVIGCFVVCWLPFFTIYVLESLCSQRILCPYPIGSLLVKSVTWLGYINSALNPFLYAFYNKEYARTF 1204
            GN +++++V   R LQTVTN+++V+LA+ADLL+S TVLP +   E+ G W  G+  C  W ++D+L CTASI++LC ISIDRY+ +   L Y T  + K A  ++++ W+ S++IS+ P++GW +     ++ C I+   G+ ++SSL SF++PL++++ +Y R++ +A                                          RR    LE+  K  +   +   L    IH    L+     + N +  T  S+    LS  L +         F RE K AK +A+V+G F++CWLPFF I  L S          P  S+  K + WLGY NS +NP +Y   +KE+ R F
Sbjct:   59 GNIMVILSVACNRQLQTVTNYFIVNLAIADLLLSTTVLPFSATLEVLGFWAFGRVFCDIWAAVDVLCCTASIMSLCVISIDRYVGVKYSLKYPTIMTEKKAVVILILLWLSSMVISIGPLLGWKEPPPPDDSKCSITEEPGYALFSSLFSFYLPLLVILVMYFRVYIVA------------------------------------------RRTTKSLEAGVKKERNKSMEVVL---RIHCRSVLEESSSSTRNHKGHTFRSS----LSVRLLK---------FSREKKAAKTLAIVVGVFILCWLPFFLILPLGSFFPAL----KPTDSVF-KVIFWLGYFNSCVNPIIYPCSSKEFKRAF 357          
BLAST of GCR011 vs. Ensembl Mouse
Match: Htr1a (5-hydroxytryptamine (serotonin) receptor 1A [Source:MGI Symbol;Acc:MGI:96273])

HSP 1 Score: 176.792 bits (447), Expect = 1.993e-50
Identity = 127/378 (33.60%), Postives = 201/378 (53.17%), Query Frame = 2
Query:  116 FC---GNSLILIAVLTTRHLQTVTNFYXXXXXXXXXXXXGTVLPLTIAKELHGKWVLGKHVCQFWVSMDILLCTASILNLCCISIDRYMAITKPLVYATKRSYKLAGCMILIAWILXXXXXXXXXXGW---SDHNFTNTTCEISIHLGFRIYSSLGSFFIPLILMIFVYLRIFAIANYR-KILLNSHQXXXXXXXXXXXXXXXXXXXLDFQTSNPSSQQRRQALDLESNPKHAQALKLNSYLCQRPIHRSCALQNL-IYKSGNLQNFTNLSTGC-------AVLSSGLSQSQKGKETAAFLREHKTAKVIAMVIGCFVVCWLPFFTIYVLESLCSQRILCPYPIGSLLVKSVTWLGYINSALNPFLYAFYNKEYARTF 1204
            FC   GN+ ++ A+   R LQ V N+ + SLA+ DL+VS  VLP+    ++  KW LG+  C  ++++D+L CT+SIL+LC I++DRY AIT P+ Y  KR+ + A  +I + W++  +IS+PP++GW    D +  N  C IS   G+ IYS+ G+F+IPL+LM+ +Y RIF  A +R +  +   +      S   SS     KSL+ Q    S   RR A +       A           R       L+ + +++ GN +    L +         A L     ++ + K   A  RE KT K + +++G F++CWLPFF + ++   C      P  +G++    + WLGY NS LNP +YA++NK++   F
Sbjct:   48 FCAVLGNACVVAAIALERSLQNVANYLIGSLAVTDLMVSVLVLPMAALYQVLNKWTLGQVTCDLFIALDVLCCTSSILHLCAIALDRYWAITDPIDYVNKRTPRRAAALISLTWLIGFLISIPPMLGWRTPEDRSNPN-ECTISKDHGYTIYSTFGAFYIPLLLMLVLYGRIFRAARFRIRKTVKKVEKKGAGTSFGTSSAPPPKKSLNGQPG--SGDCRRSAENRAVGTPCANG-------AVRQGEDDATLEVIEVHRVGNSKGHLPLPSESGATSYVPACLERKNERTAEAKRKMALARERKTVKTLGIIMGTFILCWLPFFIVALVLPFCESSCHMPELLGAI----INWLGYSNSLLNPVIYAYFNKDFQNAF 411          
BLAST of GCR011 vs. Ensembl Mouse
Match: Adra1a (adrenergic receptor, alpha 1a [Source:MGI Symbol;Acc:MGI:104773])

HSP 1 Score: 158.688 bits (400), Expect = 1.448e-43
Identity = 111/362 (30.66%), Postives = 184/362 (50.83%), Query Frame = 2
Query:  122 GNSLILIAVLTTRHLQTVTNFYXXXXXXXXXXXXGTVLPLTIAKELHGKWVLGKHVCQFWVSMDILLCTASILNLCCISIDRYMAITKPLVYATKRSYKLAGCMILIAWILXXXXXXXXXXGWSDHNFTNTT-CEISIHLGFRIYSSLGSFFIPLILMIFVYLRIFAIANYRKILLNSHQXXXXXXXXXXXXXXXXXXXLDFQTSNPSSQQRRQALDLESNPKHAQALKLNSYLCQRPIHRSCALQNLIYKSGNLQNFTNLSTGCAVLSSGLSQSQKGKETAAFLREHKTAKVIAMVIGCFVVCWLPFFTIYVLESLCSQRILCPYPIGSLLVKSVTWLGYINSALNPFLYAFYNKEYARTF 1204
            GN L++++V   RHL +VT++Y+V+LA+ADLL++ TVLP +   E+ G W  G+  C  W ++D+L CTASI+ LC ISIDRY+ ++ PL Y T  + +     +L  W LS++IS+ P+ GW      + T C+I+   G+ ++S+LGSF++PL +++ +Y R++ +A                                          +R++  L+S  K  ++   +S      IHR                  N+    + +SS  +++        F RE K AK + +V+GCFV+CWLPFF +  + S         +     + K V WLGY+NS +NP +Y   ++E+ + F
Sbjct:   43 GNILVILSVACHRHLHSVTHYYIVNLAVADLLLTSTVLPFSAIFEILGYWAFGRVFCNIWAAVDVLCCTASIMGLCIISIDRYIGVSYPLRYPTIVTQRRGVRALLCVWALSLVISIGPLFGWRQQAPEDETICQINEEPGYVLFSALGSFYVPLTIILVMYCRVYVVA------------------------------------------KRESRGLKSGLKTDKS---DSEQVTLRIHRK-----------------NVPAEGSGVSSAKNKTHFSVRLLKFSREKKAAKTLGIVVGCFVLCWLPFFLVMPIGSFFPN-----FKPPETVFKIVFWLGYLNSCINPIIYPCSSQEFKKAF 337          
BLAST of GCR011 vs. Ensembl Mouse
Match: Adra1a (adrenergic receptor, alpha 1a [Source:MGI Symbol;Acc:MGI:104773])

HSP 1 Score: 158.688 bits (400), Expect = 3.164e-43
Identity = 111/362 (30.66%), Postives = 184/362 (50.83%), Query Frame = 2
Query:  122 GNSLILIAVLTTRHLQTVTNFYXXXXXXXXXXXXGTVLPLTIAKELHGKWVLGKHVCQFWVSMDILLCTASILNLCCISIDRYMAITKPLVYATKRSYKLAGCMILIAWILXXXXXXXXXXGWSDHNFTNTT-CEISIHLGFRIYSSLGSFFIPLILMIFVYLRIFAIANYRKILLNSHQXXXXXXXXXXXXXXXXXXXLDFQTSNPSSQQRRQALDLESNPKHAQALKLNSYLCQRPIHRSCALQNLIYKSGNLQNFTNLSTGCAVLSSGLSQSQKGKETAAFLREHKTAKVIAMVIGCFVVCWLPFFTIYVLESLCSQRILCPYPIGSLLVKSVTWLGYINSALNPFLYAFYNKEYARTF 1204
            GN L++++V   RHL +VT++Y+V+LA+ADLL++ TVLP +   E+ G W  G+  C  W ++D+L CTASI+ LC ISIDRY+ ++ PL Y T  + +     +L  W LS++IS+ P+ GW      + T C+I+   G+ ++S+LGSF++PL +++ +Y R++ +A                                          +R++  L+S  K  ++   +S      IHR                  N+    + +SS  +++        F RE K AK + +V+GCFV+CWLPFF +  + S         +     + K V WLGY+NS +NP +Y   ++E+ + F
Sbjct:   43 GNILVILSVACHRHLHSVTHYYIVNLAVADLLLTSTVLPFSAIFEILGYWAFGRVFCNIWAAVDVLCCTASIMGLCIISIDRYIGVSYPLRYPTIVTQRRGVRALLCVWALSLVISIGPLFGWRQQAPEDETICQINEEPGYVLFSALGSFYVPLTIILVMYCRVYVVA------------------------------------------KRESRGLKSGLKTDKS---DSEQVTLRIHRK-----------------NVPAEGSGVSSAKNKTHFSVRLLKFSREKKAAKTLGIVVGCFVLCWLPFFLVMPIGSFFPN-----FKPPETVFKIVFWLGYLNSCINPIIYPCSSQEFKKAF 337          
BLAST of GCR011 vs. Ensembl Mouse
Match: Adra1a (adrenergic receptor, alpha 1a [Source:MGI Symbol;Acc:MGI:104773])

HSP 1 Score: 158.688 bits (400), Expect = 3.164e-43
Identity = 111/362 (30.66%), Postives = 184/362 (50.83%), Query Frame = 2
Query:  122 GNSLILIAVLTTRHLQTVTNFYXXXXXXXXXXXXGTVLPLTIAKELHGKWVLGKHVCQFWVSMDILLCTASILNLCCISIDRYMAITKPLVYATKRSYKLAGCMILIAWILXXXXXXXXXXGWSDHNFTNTT-CEISIHLGFRIYSSLGSFFIPLILMIFVYLRIFAIANYRKILLNSHQXXXXXXXXXXXXXXXXXXXLDFQTSNPSSQQRRQALDLESNPKHAQALKLNSYLCQRPIHRSCALQNLIYKSGNLQNFTNLSTGCAVLSSGLSQSQKGKETAAFLREHKTAKVIAMVIGCFVVCWLPFFTIYVLESLCSQRILCPYPIGSLLVKSVTWLGYINSALNPFLYAFYNKEYARTF 1204
            GN L++++V   RHL +VT++Y+V+LA+ADLL++ TVLP +   E+ G W  G+  C  W ++D+L CTASI+ LC ISIDRY+ ++ PL Y T  + +     +L  W LS++IS+ P+ GW      + T C+I+   G+ ++S+LGSF++PL +++ +Y R++ +A                                          +R++  L+S  K  ++   +S      IHR                  N+    + +SS  +++        F RE K AK + +V+GCFV+CWLPFF +  + S         +     + K V WLGY+NS +NP +Y   ++E+ + F
Sbjct:   43 GNILVILSVACHRHLHSVTHYYIVNLAVADLLLTSTVLPFSAIFEILGYWAFGRVFCNIWAAVDVLCCTASIMGLCIISIDRYIGVSYPLRYPTIVTQRRGVRALLCVWALSLVISIGPLFGWRQQAPEDETICQINEEPGYVLFSALGSFYVPLTIILVMYCRVYVVA------------------------------------------KRESRGLKSGLKTDKS---DSEQVTLRIHRK-----------------NVPAEGSGVSSAKNKTHFSVRLLKFSREKKAAKTLGIVVGCFVLCWLPFFLVMPIGSFFPN-----FKPPETVFKIVFWLGYLNSCINPIIYPCSSQEFKKAF 337          
BLAST of GCR011 vs. Ensembl Mouse
Match: Adra1a (adrenergic receptor, alpha 1a [Source:MGI Symbol;Acc:MGI:104773])

HSP 1 Score: 158.688 bits (400), Expect = 3.164e-43
Identity = 111/362 (30.66%), Postives = 184/362 (50.83%), Query Frame = 2
Query:  122 GNSLILIAVLTTRHLQTVTNFYXXXXXXXXXXXXGTVLPLTIAKELHGKWVLGKHVCQFWVSMDILLCTASILNLCCISIDRYMAITKPLVYATKRSYKLAGCMILIAWILXXXXXXXXXXGWSDHNFTNTT-CEISIHLGFRIYSSLGSFFIPLILMIFVYLRIFAIANYRKILLNSHQXXXXXXXXXXXXXXXXXXXLDFQTSNPSSQQRRQALDLESNPKHAQALKLNSYLCQRPIHRSCALQNLIYKSGNLQNFTNLSTGCAVLSSGLSQSQKGKETAAFLREHKTAKVIAMVIGCFVVCWLPFFTIYVLESLCSQRILCPYPIGSLLVKSVTWLGYINSALNPFLYAFYNKEYARTF 1204
            GN L++++V   RHL +VT++Y+V+LA+ADLL++ TVLP +   E+ G W  G+  C  W ++D+L CTASI+ LC ISIDRY+ ++ PL Y T  + +     +L  W LS++IS+ P+ GW      + T C+I+   G+ ++S+LGSF++PL +++ +Y R++ +A                                          +R++  L+S  K  ++   +S      IHR                  N+    + +SS  +++        F RE K AK + +V+GCFV+CWLPFF +  + S         +     + K V WLGY+NS +NP +Y   ++E+ + F
Sbjct:   43 GNILVILSVACHRHLHSVTHYYIVNLAVADLLLTSTVLPFSAIFEILGYWAFGRVFCNIWAAVDVLCCTASIMGLCIISIDRYIGVSYPLRYPTIVTQRRGVRALLCVWALSLVISIGPLFGWRQQAPEDETICQINEEPGYVLFSALGSFYVPLTIILVMYCRVYVVA------------------------------------------KRESRGLKSGLKTDKS---DSEQVTLRIHRK-----------------NVPAEGSGVSSAKNKTHFSVRLLKFSREKKAAKTLGIVVGCFVLCWLPFFLVMPIGSFFPN-----FKPPETVFKIVFWLGYLNSCINPIIYPCSSQEFKKAF 337          
BLAST of GCR011 vs. UniProt/SwissProt
Match: sp|Q93127|GPR18_AMPAM (Probable G-protein coupled receptor No18 OS=Amphibalanus amphitrite OX=1232801 PE=3 SV=1)

HSP 1 Score: 196.052 bits (497), Expect = 2.260e-57
Identity = 138/366 (37.70%), Postives = 200/366 (54.64%), Query Frame = 2
Query:  122 GNSLILIAVLTTRHLQTVTNFYXXXXXXXXXXXXGTVLPLTIAKELHGKWVLGKHVCQFWVSMDILLCTASILNLCCISIDRYMAITKPLVYATKRSYKLAGCMILIAWILXXXXXXXXXXGWSD--HNFT-NTTCEISIHLGFRIYSSLGSFFIPLILMIFVYLRIFAIANYRKILLNSHQXXXXXXXXXXXXXXXXXXXLDFQTSNPSSQQRRQALDLESNPKHAQALKLNSYLCQRPIHRSCALQNLIYKSGNLQNFTNLSTGCAVLSSGLSQSQ--KGKETAAFLREHKTAKVIAMVIGCFVVCWLPFFTIYVLESLCSQRILCPYPIGSLLVKSVTWLGYINSALNPFLYAFYNKEYARTF 1204
            GNSL++I+V T R L++V NF+VVSLA+ADL V+  VLPL +A  L  +W+LG ++CQ W++ DIL CT+SILNLC I++DRY AIT P+ YA KR+ +    MI   W LS++ISVPP++GW+D    FT +T C ++    F +YSS GSFFIPLI+M  VY +IF  A  R++   + +                          P+  QR  +  L          +L S   Q            +    +              ++G+S  Q  + K+  +  +E K A+V+ +++G FVVCWLPFF +Y +   C+    C  P    +V  VTWLGY+NS+LNP +Y  YNK++   F
Sbjct:   49 GNSLVIISVFTYRPLRSVQNFFVVSLAVADLTVALFVLPLNVAYRLLNQWLLGSYLCQMWLTCDILCCTSSILNLCVIALDRYWAITDPINYAQKRTIRRVNTMIAAVWALSLVISVPPLLGWNDWPAQFTEDTPCTLTQERLFVVYSSSGSFFIPLIIMSVVYAKIF-FATKRRLRERTRKLGTLAV--------------------PAPPQRTSSRPLA---------ELESVASQEDETEPSPEPEPLSSRADKP------------ANGISVHQFIEEKQRISLSKERKAARVLGVIMGVFVVCWLPFFLMYAIVPFCTN---CAPP-SQRVVDFVTWLGYVNSSLNPIIYTIYNKDFRTAF 368          
BLAST of GCR011 vs. UniProt/SwissProt
Match: sp|Q9N298|5HT1A_PANTR (5-hydroxytryptamine receptor 1A OS=Pan troglodytes OX=9598 GN=HTR1A PE=3 SV=1)

HSP 1 Score: 183.726 bits (465), Expect = 3.364e-52
Identity = 124/383 (32.38%), Postives = 204/383 (53.26%), Query Frame = 2
Query:  116 FC---GNSLILIAVLTTRHLQTVTNFYXXXXXXXXXXXXGTVLPLTIAKELHGKWVLGKHVCQFWVSMDILLCTASILNLCCISIDRYMAITKPLVYATKRSYKLAGCMILIAWILXXXXXXXXXXGW--SDHNFTNTTCEISIHLGFRIYSSLGSFFIPLILMIFVYLRIFAIANYRKILLNSHQXXXXXXXXXXXXXXXXXXXLDFQTSNPSSQQRRQALDLESNPKH---AQALKLNSYLCQ----RPIHRSCALQNL-IYKSGNLQNFTNL-----STGCAVLS--SGLSQSQKGKETAAFLREHKTAKVIAMVIGCFVVCWLPFFTIYVLESLCSQRILCPYPIGSLLVKSVTWLGYINSALNPFLYAFYNKEYARTF 1204
            FC   GN+ ++ A+   R LQ V N+ + SLA+ DL+VS  VLP+    ++  KW LG+  C  ++++D+L CT+SIL+LC I++DRY AIT P+ Y  KR+ + A  +I + W++  +IS+PP++GW   +       C IS   G+ IYS+ G+F+IPL+LM+ +Y RIF  A +R                + +   +     D +     +QQ +++++ ES  ++       K    LC     R      AL+ + +++ GN +    L      T CA  S      ++ + K   A  RE KT K + +++G F++CWLPFF + ++   C      P  +G++    + WLGY NS LNP +YA++NK++   F
Sbjct:   48 FCAVLGNACVVAAIALERSLQNVANYLIGSLAVTDLMVSVLVLPMAALYQVLNKWTLGQVTCDLFIALDVLCCTSSILHLCAIALDRYWAITDPIDYVNKRTPRRAAALISLTWLIGFLISIPPMLGWRTPEDRSDPDACTISKDHGYTIYSTFGAFYIPLLLMLVLYGRIFRAARFR---------------IRKTVKKVEKTGADTRHGASPAQQPKKSVNGESGSRNWRLGVESKAGGALCANGAVRQGDDGAALEVIEVHRVGNSKEHLPLPSEAGPTPCAPASFERKNERNAEAKRKMALARERKTVKTLGIIMGTFILCWLPFFIVALVLPFCESSCHMPTLLGAI----INWLGYSNSLLNPVIYAYFNKDFQNAF 411          
BLAST of GCR011 vs. UniProt/SwissProt
Match: sp|Q17232|OAR_BOMMO (Octopamine receptor OS=Bombyx mori OX=7091 PE=2 SV=1)

HSP 1 Score: 184.882 bits (468), Expect = 4.675e-52
Identity = 139/410 (33.90%), Postives = 218/410 (53.17%), Query Frame = 2
Query:  122 GNSLILIAVLTTRHLQTVTNFYXXXXXXXXXXXXGTVLPLTIAKELHGKWVLGKHVCQFWVSMDILLCTASILNLCCISIDRYMAITKPLVYATKRSYKLAGCMILIAWILXXXXXXXXXXGWSDHNFT---NTTCEISIHLGFRIYSSLGSFFIPLILMIFVYLRIFAIANYRKILLNSHQXXXXXXXXXXXXXXXXXXXLDFQTS-----NPSSQQRRQALDLESNPKHAQALKLNSYLCQRPIHRS---------------CALQNLIYKSG-NLQNFTNLS---------------TGCAVL----------SSGLSQSQKGKETAAFLREHKTAKVIAMVIGCFVVCWLPFFTIYVLESLCSQRILCPYPIGSLLVKSVTWLGYINSALNPFLYAFYNKEYARTF 1204
            GN L++++V T + L+ V NF++VSLA+ADL V+  VLPL +A  + G+WV G +VC+ W++ DI+ CT+SILNLC I++DRY AIT P+ YA KR+ +    MI I WILS++IS PP++GW+D       +T C ++   GF I+SS GSF+IPL++M  VY  I+ +A  +++   +  +  +  S+  +         + Q S     NP+  Q    L  E+  KH +  KL     ++P  R                 + +N +   G NL+N    S               T  A +          ++ + Q  + K+  +  RE + A+ + +++G FVVCWLPFF IY++   C    L      +  +  +TWLGY+NSALNP +Y  +N ++ R F
Sbjct:   71 GNILVILSVFTYKPLRIVQNFFIVSLAVADLTVAILVLPLNVAYSILGQWVFGIYVCKMWLTCDIMCCTSSILNLCAIALDRYWAITDPINYAQKRTLERVLFMIGIVWILSLVISSPPLLGWNDWPEVFEPDTPCRLTSQPGFVIFSSSGSFYIPLVIMTVVYFEIY-LATKKRLRDRAKATKISTISSGRNKYETKESDPNDQDSVSSDANPNEHQGGTRLVAENEKKH-RTRKLTPK--KKPKRRYWSKDDKSHNKLIIPILSNENSVTDIGENLENRNTSSESNSKETHEDNMIEITEAAPVKIQKRPKQNQTNAVYQFIEEKQRISLTRERRAARTLGIIMGVFVVCWLPFFVIYLVIPFCVSCCL-----SNKFINFITWLGYVNSALNPLIYTIFNMDFRRAF 471          
BLAST of GCR011 vs. UniProt/SwissProt
Match: sp|P08908|5HT1A_HUMAN (5-hydroxytryptamine receptor 1A OS=Homo sapiens OX=9606 GN=HTR1A PE=1 SV=3)

HSP 1 Score: 182.57 bits (462), Expect = 1.001e-51
Identity = 127/378 (33.60%), Postives = 206/378 (54.50%), Query Frame = 2
Query:  116 FC---GNSLILIAVLTTRHLQTVTNFYXXXXXXXXXXXXGTVLPLTIAKELHGKWVLGKHVCQFWVSMDILLCTASILNLCCISIDRYMAITKPLVYATKRSYKLAGCMILIAWILXXXXXXXXXXGW--SDHNFTNTTCEISIHLGFRIYSSLGSFFIPLILMIFVYLRIFAIANY--RKILLNSHQXXXXXXXXXXXXXXXXXXXLDFQTSNPSSQQRRQALDLESNPKHAQALKLNSYLCQRPIHRSCALQNL-IYKSGNLQNFTNL-----STGCAVLS--SGLSQSQKGKETAAFLREHKTAKVIAMVIGCFVVCWLPFFTIYVLESLCSQRILCPYPIGSLLVKSVTWLGYINSALNPFLYAFYNKEYARTF 1204
            FC   GN+ ++ A+   R LQ V N+ + SLA+ DL+VS  VLP+    ++  KW LG+  C  ++++D+L CT+SIL+LC I++DRY AIT P+ Y  KR+ + A  +I + W++  +IS+PP++GW   +       C IS   G+ IYS+ G+F+IPL+LM+ +Y RIF  A +  RK +    ++  + +   + +          ++ N  S  R   L +ES  K   AL  N  + Q       AL+ + +++ GN +    L      T CA  S      ++ + K   A  RE KT K + +++G F++CWLPFF + ++   C      P  +G++    + WLGY NS LNP +YA++NK++   F
Sbjct:   48 FCAVLGNACVVAAIALERSLQNVANYLIGSLAVTDLMVSVLVLPMAALYQVLNKWTLGQVTCDLFIALDVLCCTSSILHLCAIALDRYWAITDPIDYVNKRTPRRAAALISLTWLIGFLISIPPMLGWRTPEDRSDPDACTISKDHGYTIYSTFGAFYIPLLLMLVLYGRIFRAARFRIRKTVKKVEKTGADTRHGASPAPQPK------KSVNGESGSRNWRLGVES--KAGGALCANGAVRQG--DDGAALEVIEVHRVGNSKEHLPLPSEAGPTPCAPASFERKNERNAEAKRKMALARERKTVKTLGIIMGTFILCWLPFFIVALVLPFCESSCHMPTLLGAI----INWLGYSNSLLNPVIYAYFNKDFQNAF 411          
BLAST of GCR011 vs. UniProt/SwissProt
Match: sp|Q9N297|5HT1A_GORGO (5-hydroxytryptamine receptor 1A OS=Gorilla gorilla gorilla OX=9595 GN=HTR1A PE=3 SV=1)

HSP 1 Score: 182.57 bits (462), Expect = 1.054e-51
Identity = 127/378 (33.60%), Postives = 206/378 (54.50%), Query Frame = 2
Query:  116 FC---GNSLILIAVLTTRHLQTVTNFYXXXXXXXXXXXXGTVLPLTIAKELHGKWVLGKHVCQFWVSMDILLCTASILNLCCISIDRYMAITKPLVYATKRSYKLAGCMILIAWILXXXXXXXXXXGW--SDHNFTNTTCEISIHLGFRIYSSLGSFFIPLILMIFVYLRIFAIANY--RKILLNSHQXXXXXXXXXXXXXXXXXXXLDFQTSNPSSQQRRQALDLESNPKHAQALKLNSYLCQRPIHRSCALQNL-IYKSGNLQNFTNL-----STGCAVLS--SGLSQSQKGKETAAFLREHKTAKVIAMVIGCFVVCWLPFFTIYVLESLCSQRILCPYPIGSLLVKSVTWLGYINSALNPFLYAFYNKEYARTF 1204
            FC   GN+ ++ A+   R LQ V N+ + SLA+ DL+VS  VLP+    ++  KW LG+  C  ++++D+L CT+SIL+LC I++DRY AIT P+ Y  KR+ + A  +I + W++  +IS+PP++GW   +       C IS   G+ IYS+ G+F+IPL+LM+ +Y RIF  A +  RK +    ++  + +   + +          ++ N  S  R   L +ES  K   AL  N  + Q       AL+ + +++ GN +    L      T CA  S      ++ + K   A  RE KT K + +++G F++CWLPFF + ++   C      P  +G++    + WLGY NS LNP +YA++NK++   F
Sbjct:   48 FCAVLGNACVVAAIALERSLQNVANYLIGSLAVTDLMVSVLVLPMAALYQVLNKWTLGQVTCDLFIALDVLCCTSSILHLCAIALDRYWAITDPIDYVNKRTPRRAAALISLTWLIGFLISIPPMLGWRTPEDRSDPDACTISKDHGYTIYSTFGAFYIPLLLMLVLYGRIFRAARFRIRKTVKKVEKTGADTRHGASPAPQPK------KSVNGESGSRNWRLGVES--KAGGALCANGAVRQG--DDGAALEVIEVHRVGNSKEHLPLPSEAGPTPCAPASFERKNERNAEAKRKMALARERKTVKTLGIIMGTFILCWLPFFIVALVLPFCESSCHMPTLLGAI----INWLGYSNSLLNPVIYAYFNKDFQNAF 411          
BLAST of GCR011 vs. TrEMBL
Match: A0A193KU59 (GCR011 OS=Schmidtea mediterranea OX=79327 GN=gcr011 PE=2 SV=1)

HSP 1 Score: 661.759 bits (1706), Expect = 0.000e+0
Identity = 383/383 (100.00%), Postives = 383/383 (100.00%), Query Frame = 2
Query:   56 MFVFIHVXXXXXXXXXXXXXFCGNSLILIAVLTTRHLQTVTNFYXXXXXXXXXXXXGTVLPLTIAKELHGKWVLGKHVCQFWVSMDILLCTASILNLCCISIDRYMAITKPLVYATKRSYKLAGCMILIAWILXXXXXXXXXXGWSDHNFTNTTCEISIHLGFRIYSSLGSFFIPLILMIFVYLRIFAIANYRKILLNSHQXXXXXXXXXXXXXXXXXXXLDFQTSNPSSQQRRQALDLESNPKHAQALKLNSYLCQRPIHRSCALQNLIYKSGNLQNFTNLSTGCAVLSSGLSQSQKGKETAAFLREHKTAKVIAMVIGCFVVCWLPFFTIYVLESLCSQRILCPYPIGSLLVKSVTWLGYINSALNPFLYAFYNKEYARTF 1204
            MFVFIHVLIIALLLITDIIIFCGNSLILIAVLTTRHLQTVTNFYVVSLALADLLVSGTVLPLTIAKELHGKWVLGKHVCQFWVSMDILLCTASILNLCCISIDRYMAITKPLVYATKRSYKLAGCMILIAWILSVIISVPPVIGWSDHNFTNTTCEISIHLGFRIYSSLGSFFIPLILMIFVYLRIFAIANYRKILLNSHQSSRNIKSNKNSSNSLSYKSLDFQTSNPSSQQRRQALDLESNPKHAQALKLNSYLCQRPIHRSCALQNLIYKSGNLQNFTNLSTGCAVLSSGLSQSQKGKETAAFLREHKTAKVIAMVIGCFVVCWLPFFTIYVLESLCSQRILCPYPIGSLLVKSVTWLGYINSALNPFLYAFYNKEYARTF
Sbjct:    1 MFVFIHVLIIALLLITDIIIFCGNSLILIAVLTTRHLQTVTNFYVVSLALADLLVSGTVLPLTIAKELHGKWVLGKHVCQFWVSMDILLCTASILNLCCISIDRYMAITKPLVYATKRSYKLAGCMILIAWILSVIISVPPVIGWSDHNFTNTTCEISIHLGFRIYSSLGSFFIPLILMIFVYLRIFAIANYRKILLNSHQSSRNIKSNKNSSNSLSYKSLDFQTSNPSSQQRRQALDLESNPKHAQALKLNSYLCQRPIHRSCALQNLIYKSGNLQNFTNLSTGCAVLSSGLSQSQKGKETAAFLREHKTAKVIAMVIGCFVVCWLPFFTIYVLESLCSQRILCPYPIGSLLVKSVTWLGYINSALNPFLYAFYNKEYARTF 383          
BLAST of GCR011 vs. TrEMBL
Match: R7V8L8 (G_PROTEIN_RECEP_F1_2 domain-containing protein (Fragment) OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_24565 PE=3 SV=1)

HSP 1 Score: 223.787 bits (569), Expect = 3.875e-66
Identity = 152/364 (41.76%), Postives = 208/364 (57.14%), Query Frame = 2
Query:  122 GNSLILIAVLTTRHLQTVTNFYXXXXXXXXXXXXGTVLPLTIAKELHGKWVLGKHVCQFWVSMDILLCTASILNLCCISIDRYMAITKPLVYATKRSYKLAGCMILIAWILXXXXXXXXXXGWSDH--NFTNTTCEISIHLGFRIYSSLGSFFIPLILMIFVYLRIFAIANYRKILLNSHQXXXXXXXXXXXXXXXXXXXLDFQTSNPSSQQRRQALDLESNPKHAQALKLNSYLCQRPIHRSCALQNLIYKSGNLQNFTNLSTGCAVLSSGLSQSQKGK-ETAAFLREHKTAKVIAMVIGCFVVCWLPFFTIYVLESLCSQRILCPYPIGSLLVKSVTWLGYINSALNPFLYAFYNKEYARTF 1204
            GN L++I+V     L+TVTN +VVSLA ADLLV   VLPL I  E+ G W LG  +C  W+S D++LCTASILNLCCIS+DRY AIT P+VY TKRS +LA  MI + W+ S+II+ PP+ GW +   N   + C ++   G+ IYSSLGSF+IPL++MIFVY RIF +A+ R+  L  ++ S                          + QRR A     NP +    +         IHR            +  ++T+ +T         S+S++   E      E KTAK +A+V+GCFVVCWLPFF +YV+E  C+     P     +L   +TWLGY NS +NPF+YAFYN+++  +F
Sbjct:   17 GNILVIISVAINPRLRTVTNCFVVSLASADLLVGILVLPLGIKVEIVGNWGLGTMLCDVWISFDVMLCTASILNLCCISLDRYFAITNPMVYVTKRSKRLALVMICVVWVASIIITCPPIFGWREEGRNELESQCFLTRDPGYIIYSSLGSFYIPLVIMIFVYARIFKVAHEREKRLRPYRRSFV------------------------NGQRRSA-----NPSNDGTPQRTPT-----IHR------------DPPSYTHEATE--------SESREDDMEDRLIETERKTAKTLAVVVGCFVVCWLPFFLMYVIEPFCAGCDFHP-----VLKTCITWLGYCNSVINPFIYAFYNRDFRSSF 321          
BLAST of GCR011 vs. TrEMBL
Match: A0A1J0F4P1 (Tyramine receptor 2 OS=Platynereis dumerilii OX=6359 PE=2 SV=1)

HSP 1 Score: 225.713 bits (574), Expect = 2.291e-65
Identity = 147/386 (38.08%), Postives = 222/386 (57.51%), Query Frame = 2
Query:  122 GNSLILIAVLTTRHLQTVTNFYXXXXXXXXXXXXGTVLPLTIAKELHGKWVLGKHVCQFWVSMDILLCTASILNLCCISIDRYMAITKPLVYATKRSYKLAGCMILIAWILXXXXXXXXXXGWSDHNF--TNTTCEISIHLGFRIYSSLGSFFIPLILMIFVYLRIFAIANYRKILLNSHQXXXXXXXXXXXXXXXXXXXLDFQTSNPSSQQRRQALD-LESNPKHAQALKLNSYLCQRPIHRSCALQNLIYKSGN---LQNFTNLSTG------------CAVLSS-------GLSQSQKGKETAAFLREHKTAKVIAMVIGCFVVCWLPFFTIYVLESLCSQRILCPYPIGSLLVKSVTWLGYINSALNPFLYAFYNKEYARTF 1204
            GN L++++V T + L+T+TN+YVVSLALADL+V+  V+PL+I  +L G+W  GK +C+ WVS D++LCTASILNLCCIS+DRY AITKPL Y TKRS +LA  MI + W+ +V+I+ PP+ GW +      +  C ++   G+ IYSSLGSF++PL++M+FVY+RIF +A+ R+  L   + S         +  ++ +++    S  S        D    N   A + +    +  + I     +     K  +   L+N  +++ G               LSS         S+  + +E    +REHK AK +A+V+G FVVCWLPFF +Y++E  C   +     I + +    TWLGY NS LNP +YA YN+++  +F
Sbjct:   64 GNILVVLSVFTNKRLRTITNYYVVSLALADLMVATMVMPLSIVVQLTGRWYFGKIICEIWVSFDVMLCTASILNLCCISLDRYFAITKPLEYTTKRSKRLALAMIAVVWVAAVVITCPPIFGWREEGRWKDDMACNLTKDPGYVIYSSLGSFYVPLLVMVFVYMRIFKVASQREKRLKPFRRSFKTHCGVGRNGMITLENIRLTESKESEDDTPSTTDCYPPNATIATSRRGGHCVTIKRIDDGMIMNVSSTKRSHDIPLENSDDITDGPLCRRKKKRQTRSPQLSSTSLDHFCSGSREDRRRERTLMIREHKAAKTLAIVVGGFVVCWLPFFLMYIIEPFCESCV-----IDAHMAAFFTWLGYFNSLLNPAIYALYNRDFRHSF 444          
BLAST of GCR011 vs. TrEMBL
Match: A0A0L8GS86 (G_PROTEIN_RECEP_F1_2 domain-containing protein OS=Octopus bimaculoides OX=37653 GN=OCBIM_22028857mg PE=3 SV=1)

HSP 1 Score: 216.083 bits (549), Expect = 2.028e-61
Identity = 147/370 (39.73%), Postives = 217/370 (58.65%), Query Frame = 2
Query:  122 GNSLILIAVLTTRHLQTVTNFYXXXXXXXXXXXXGTVLPLTIAKELHGKWVLGKHVCQFWVSMDILLCTASILNLCCISIDRYMAITKPLVYATKRSYKLAGCMILIAWILXXXXXXXXXXGWSDHNFT-NTTCEISIHLGFRIYSSLGSFFIPLILMIFVYLRIFAIANYRKILL--------NSHQXXXXXXXXXXXXXXXXXXXLDFQTSNPSSQQRRQALDLESNPKHAQALKLNSYLCQRPIHRSCALQNLIYKSGNLQNFTNLSTGCAVLSSGLSQSQKGKETAAFLREHKTAKVIAMVIGCFVVCWLPFFTIYVLESLCSQRILCPYPIGSLLVKSVTWLGYINSALNPFLYAFYNKEYARTF 1204
            GN LI++AV   R L+TVTN +VVSLA ADLLVS  VLPL I  E+ G+W+    +C  WVS D+LLCTASILNLCCIS+DRY AITKPL+Y+T+RS +LA  M+ +AW L+ II+ PP++GW +        C ++   G+ IYS+ GSFFIPL +M+FVY RI+ +A  R+  L        +S Q   +  +++N S +    +     SN S +   ++   E++P     +   ++        S +  N+  K   L+  T +    ++       ++   E + +++E KTAK +A+V+GCF++CWLPFF +YV++  C+   + P      L   +TWLGY NS LNP +YA YN  +   F
Sbjct:  108 GNVLIILAVWKYRRLRTVTNCFVVSLASADLLVSILVLPLNITVEVTGQWLFSGLLCDLWVSCDVLLCTASILNLCCISLDRYFAITKPLLYSTRRSKRLAIFMVGVAWGLAAIITCPPILGWKEEGRDLANGCALTRDPGYIIYSASGSFFIPLFVMLFVYARIYHVARKREKRLRPYWRSFFSSRQKRCDSDNSENMSPTTEATTTKHIRSNSSFKAEHKS---ETSPSK-NNISNKTFSVGHSERNSSSWTNIFRKDIILEKQTLM---LSLFRKQTELNRNKVERSFYMKERKTAKTLAIVVGCFIICWLPFFLVYVIDVFCTTCNITP-----TLFSIITWLGYFNSTLNPLIYAMYNTTFRTAF 465          
BLAST of GCR011 vs. TrEMBL
Match: A0A1B0CD97 (Tyramine receptor OS=Lutzomyia longipalpis OX=7200 PE=3 SV=1)

HSP 1 Score: 210.305 bits (534), Expect = 6.962e-59
Identity = 147/397 (37.03%), Postives = 227/397 (57.18%), Query Frame = 2
Query:  122 GNSLILIAVLTTRHLQTVTNFYXXXXXXXXXXXXGTVLPLTIAKELHGKWVLGKHVCQFWVSMDILLCTASILNLCCISIDRYMAITKPLVYA-TKRSYKLAGCMILIAWILXXXXXXXXXXGWSDHNF-TNTTCEISIHLGFRIYSSLGSFFIPLILMIFVYLRIFAIANYRKILLNSHQXXXXXXXXXXXXXXXXXXXLDFQTS--NPSSQQRRQALDLESNPKHAQALKLNSYLCQRPIHRSCALQ--NLIY-------KSGNLQNFTNLSTG---CAVLSSGLSQSQKGKETAAFL--------------------REHKTAKVIAMVIGCFVVCWLPFFTIYVLESLCSQRILCPYPIGSLLVKSVTWLGYINSALNPFLYAFYNKEYARTF 1204
            GN+L++++V+TTR L+TVTN +V+SLA+AD LV   V+P  +A  L G W LG+ +C  W+S+D+LLCTASIL+LC ISIDRY+A+T+PL Y+  +RS +LA  MIL+ W+L++ I+ PP++GW +    ++  C  + + G+ ++S++GSFFIP+I+MI+VY+RI  +   R    + H +   +      +N  +   LD  TS   P S +R Q+    S  K     K NS      I RS   Q  N +Y       ++ +L+ +  L          S+  S + K   T+ F                     RE+KT + +++V+G F+ CWLPFF  Y++    S+RI     I  +LV  +TWLG+ NSA+NPF+YAFY+ ++   F
Sbjct:  105 GNTLVILSVITTRRLRTVTNCFVMSLAVADWLVGLFVMPPAVAVHLMGSWELGRVLCDIWISLDVLLCTASILSLCAISIDRYLAVTQPLNYSRRRRSKRLALLMILVVWVLALAITCPPILGWYEQGRGSSVECRYNQNQGYVVFSAMGSFFIPMIVMIYVYMRISCVVASR----HDHMAEIEVPKKYQKNNPEAEIYLDHDTSEQEPPSPKRSQSFGQLS--KRDLFTKTNS---AEDIDRSTTKQSRNGLYELVDCSSRTPSLKRYAGLPPKQPTTETWSNQFSANSKDVHTSGFAISKQIRVHQKSMSNRILSLKRENKTTQTLSIVVGGFIACWLPFFICYLITPFLSERI----KINPILVGFLTWLGWFNSAVNPFIYAFYSVDFRTAF 488          
BLAST of GCR011 vs. Ensembl Cavefish
Match: adra2b (adrenoceptor alpha 2B [Source:NCBI gene;Acc:266751])

HSP 1 Score: 169.088 bits (427), Expect = 1.221e-47
Identity = 121/385 (31.43%), Postives = 198/385 (51.43%), Query Frame = 2
Query:  122 GNSLILIAVLTTRHLQTVTNFYXXXXXXXXXXXXGTVLPLTIAKELHGKWVLGKHVCQFWVSMDILLCTASILNLCCISIDRYMAITKPLVYATKRSYKLAGCMILIAWILXXXXXXXXXXGWSDHNFTNTT----CEISIHLGFRIYSSLGSFFIPLILMIFVYLRIFAIANYR----------KILLNSHQXXXXXXXX----XXXXXXXXXXXLDFQTSNPSSQQRRQALDLESNPKHAQALKLNSYLCQRPIHRSCALQNLIYKSGNLQNFTNL-STGCAVLSSGLSQSQKG-----KETAAFLREHKTAKVIAMVIGCFVVCWLPFFTIYVLESLCSQRILCPYPIGSLLVKSVTWLGYINSALNPFLYAFYNKEYARTF 1204
            GN L++IAVLT+R L+   N ++VSLA AD+LV+  ++P ++A EL G W      C+ ++++D+L CT+SI++LC IS+DRY++I++ + Y  +R+ +   C ILI W++S +IS PP++  +    T+      CE++    + +YS++GSFF P ++MI VY+RI+ IA  R          +I  ++ Q      +        S   +    D +  N + +      D E                + P+  S      I+    +Q + ++ +T      +     Q G     +  A   RE +   V+A+VIG FVVCW PFF  Y L+++C +    P P    L K   W+GY NS LNP +Y  +NK++ R F
Sbjct:   37 GNILVIIAVLTSRSLRGPQNLFLVSLAAADILVATLIIPFSLANELMGFWYFKSVWCEIYLALDVLFCTSSIVHLCAISLDRYLSISRAVTYGAQRTPRRIKCAILIVWLISAVISFPPLLSMNKKKGTDEAGCPQCELNNERWYILYSTIGSFFAPCLIMILVYMRIYQIAKQRTRCPPGEPRKEIPASAKQQPATTPTTNNLLPPPSLGTALTPPDKKPDNNNGESSTSDSDTEQ----------GGVGTEMPMTPSGEPSAGIHSPATIQKYRDMIATAKGTRLASRKSKQDGTPNSARRKAMVNREKRFTFVLAVVIGVFVVCWFPFFFSYSLQAVCPRTCNLPEP----LFKFFFWIGYCNSCLNPVIYTIFNKDFRRAF 407          
BLAST of GCR011 vs. Ensembl Cavefish
Match: drd2b (D(2) dopamine receptor A [Source:NCBI gene;Acc:103035621])

HSP 1 Score: 165.236 bits (417), Expect = 3.115e-46
Identity = 123/381 (32.28%), Postives = 202/381 (53.02%), Query Frame = 2
Query:  122 GNSLILIAVLTTRHLQTVTNFYXXXXXXXXXXXXGTVLPLTIAKELHGKWVLGKHVCQFWVSMDILLCTASILNLCCISIDRYMAITKPLVYATKRSYK-LAGCMILIAWILXXXXXXXXXXGWSD-HNFTNTTCEISIHLGFRIYSSLGSFFIPLILMIFVYLRIFAIANYRKILLNSH----------QXXXXXXXXXXXXXXXXXXXLDFQTSNPSSQQRRQALDLESN------PKHAQAL--KLNSYLCQRPIHRSCALQNLIYKSGNLQNFTNLSTGCAVLSSGLSQSQKGKETAAFLREHKTAKVIAMVIGCFVVCWLPFFTIYVLESLCSQRILCPYPIGSLLVKSVTWLGYINSALNPFLYAFYNKEYARTF 1204
            GN L+ +AV   + LQT TN+ +VSLA+ADLLV+  V+P  +  E+ G+W   K  C  +V++D+++CTASILNLC ISIDRY A+  P++Y T+ S K     MI + W+LS  IS P + G ++     ++ CEI+ +  F +YSS+ SF++P I+ + VY++I+ +   R+  +N+           Q        K      +   +   TS    ++ + A     N      P HA  L  +   +  ++  H   A      KS   Q   N  T   V +  +S+ +  +      +E K  +++A+V+G F++CWLPFF  ++L++ C+    C  P+   +  + TWLGY+NSA+NP +Y  +N E+ + F
Sbjct:   49 GNVLVCMAVSREKALQTTTNYLIVSLAVADLLVATLVMPWVVYLEVVGEWRFSKIHCDIFVTLDVMMCTASILNLCAISIDRYTAVAMPMLYNTRYSSKRRVTVMISVVWVLSFAISCPLLFGLNNTATRDDSVCEIA-NPAFVVYSSIMSFYVPFIITLLVYVQIYVVLRKRRKRVNTKRNCQKADAEPQPPLKQLLIKEVVQPGTGVEMGLMTSTSPPEKMKLAAPPAVNLLATQSPSHASPLHEEWQPHDDEKNGHAKDAQTPKETKSFETQALPNGKTRTTV-TKTMSKRKMSQH-----KEKKATQMLAIVLGVFIICWLPFFITHILKTHCTS---CYVPLE--MYNAFTWLGYVNSAVNPIIYTTFNVEFRKAF 417          
BLAST of GCR011 vs. Ensembl Cavefish
Match: adra2a (adrenoceptor alpha 2A [Source:NCBI gene;Acc:266750])

HSP 1 Score: 162.54 bits (410), Expect = 1.737e-45
Identity = 117/363 (32.23%), Postives = 190/363 (52.34%), Query Frame = 2
Query:  122 GNSLILIAVLTTRHLQTVTNFYXXXXXXXXXXXXGTVLPLTIAKELHGKWVLGKHVCQFWVSMDILLCTASILNLCCISIDRYMAITKPLVYATKRSYKLAGCMILIAWILXXXXXXXXXXGWSDHNFTNT--TCEISIHLGFRIYSSLGSFFIPLILMIFVYLRIFAIANYRKILLNSHQXXXXXXXXXXXXXXXXXXXLDFQTSNPSSQQRRQALDLESNPKHAQALKLNSYLCQRPIHRSCALQNLIYKSGNLQNFTNLSTGCAVLSSGLSQSQKGKETAAFLREHKTAKVIAMVIGCFVVCWLPFFTIYVLESLCSQRILCPYPIGSLLVKSVTWLGYINSALNPFLYAFYNKEYARTF 1204
            GN L +IAV T+R L+   N ++VSLA AD+LV+  V+P ++A EL G W  G   C+ ++++D+L CTASI +LC IS+DRY +IT+ + Y  KR+ +   C+IL+ W+++ +IS PP+    +    N   +C+I+    + I S +GSFF+P I+M+ VY+RI+ IA  R       +  R+ +  +N              ++   +    A+D+E +      +  N    ++   +     + I    ++    N + G        S   KG++     RE +   V+A+VIG F++CW PFF  Y L +LC     C   +   L K   W GY NS+LNP +Y  +N ++ R F
Sbjct:   29 GNLLAVIAVFTSRALKAPQNLFLVSLASADILVATLVMPFSLANELMGYWYFGPVWCKIYLALDVLFCTASIAHLCAISLDRYWSITRAVEYNLKRTPRRIKCVILVVWVIAAVISFPPLTIMKEDEPINDPPSCQINKDKWYIISSCIGSFFLPCIIMVLVYIRIYQIAKSRTRTPPGDRRKRDDEKKENGHCHERLNGDAANGNDKDDKGDVNAVDMEESSSSDHKV-TNPCASKKKRAKGKTKLSQIKPGDDINKRENANRGTK------SSRWKGRQN----REKRFTFVLAVVIGVFMICWFPFFFTYTLRALCES--CC---VNETLFKFFFWFGYCNSSLNPIIYTIFNNDFRRAF 375          
BLAST of GCR011 vs. Ensembl Cavefish
Match: adra1aa (alpha-1A adrenergic receptor-like [Source:NCBI gene;Acc:103024013])

HSP 1 Score: 164.466 bits (415), Expect = 1.912e-45
Identity = 118/362 (32.60%), Postives = 188/362 (51.93%), Query Frame = 2
Query:  122 GNSLILIAVLTTRHLQTVTNFYXXXXXXXXXXXXGTVLPLTIAKELHGKWVLGKHVCQFWVSMDILLCTASILNLCCISIDRYMAITKPLVYATKRSYKLAGCMILIAWILXXXXXXXXXXGWSDHNFTN-TTCEISIHLGFRIYSSLGSFFIPLILMIFVYLRIFAIANYRKILLNSHQXXXXXXXXXXXXXXXXXXXLDFQTSNPSSQQRRQALDLESNPKHAQALKLNSYLCQRPIHRSCALQNLIYKSGNLQNFTNLSTGCAVLSSGLSQSQKGKETAAFLREHKTAKVIAMVIGCFVVCWLPFFTIYVLESLCSQRILCPYPIGSLLVKSVTWLGYINSALNPFLYAFYNKEYARTF 1204
            GN L++++V   R+L+TVT++++ +LA+ADLL+S TVLP +   E+ G WV G+  C  W +MD+L CTASI++LC IS+DRY+ ++ PL Y T  + + A   ++  W LS+ ISV P+ GW +    + T C+I+   G+ I+S++GSF++PL++++ +Y R++ +A                                 +T      Q+ +  D      HA+A+ L        IHR           GN    T+ S   A+     S++        F RE K AK + +V+GCFV+CWLPFF +  + S     I   Y     + K   WLGY NS +NP +Y   ++E+ + F
Sbjct:   57 GNILVILSVACHRNLRTVTHYFIANLAVADLLLSSTVLPFSAIFEMLGHWVFGRAFCDVWAAMDVLCCTASIMSLCAISVDRYIGVSYPLRYPTIVTERRALLALMGVWALSITISVGPLFGWKEPAPEDETVCKITEEPGYAIFSAVGSFYLPLVVILVMYCRVYVVARR-------------------------------ETRGLRKGQKTEKSD------HAEAVTLR-------IHR-----------GN----TSASEDEAL----RSRTHFALRLLKFSREKKAAKTLGIVVGCFVLCWLPFFLVLPIGS-----IFPAYRPSDTVFKITFWLGYFNSCINPIIYPCSSQEFKKAF 350          
BLAST of GCR011 vs. Ensembl Cavefish
Match: drd3 (dopamine receptor D3 [Source:NCBI gene;Acc:103024755])

HSP 1 Score: 160.999 bits (406), Expect = 2.190e-44
Identity = 126/403 (31.27%), Postives = 202/403 (50.12%), Query Frame = 2
Query:  122 GNSLILIAVLTTRHLQTVTNFYXXXXXXXXXXXXGTVLPLTIAKEL-HGKWVLGKHVCQFWVSMDILLCTASILNLCCISIDRYMAITKPLVY-ATKRSYKLAGCMILIAWILXXXXXXXXXXGWSDHNFTNTTCEISIHLGFRIYSSLGSFFIPLILMIFVYLRIFAIANYRKILLNSHQXXXXXXXXXXXXXXXXXXXLDFQTSNPSSQQRRQALDLESNPKHAQALKLNSYLCQRPIHRSCALQNLIYKSGNLQNFTNLSTG--------------------------CAV--LSSG------------LSQSQKGKETAAFLREHKTAKVIAMVIGCFVVCWLPFFTIYVLESLCSQRILCPYPIGSLLVKSVTWLGYINSALNPFLYAFYNKEYARTF 1204
            GN L+ +AVL  + LQT TN+ VVSLA++DLLV+  V+P  +  E+  G W+  +  C  +V++D+++CTASILNLC ISIDRY A+  P++Y  T  S K    MI   WIL+  +S P + G++  +     C IS +  F IYSS+ SF++P ++ + VY+RI+     R+                        K + F+ ++   QQ       ES  K  +  +L S   +R   R+  ++N +    +LQN+ ++S                            C V  +S+G             +++ + +  +   RE K  +++A+V+G F++CWLPFF  ++L + C    + P      L  + TWLGY+NSALNP +Y  +N E+ R F
Sbjct:   71 GNVLVCMAVLREKSLQTTTNYLVVSLAVSDLLVASLVMPWAVYLEVVGGAWLFSRLYCNIFVTLDVMMCTASILNLCAISIDRYTAVVMPVLYNTTHSSRKRVSVMIATVWILAFAVSCPLLFGFNTTD-DPLVCSIS-NPDFVIYSSVVSFYLPFVVTLLVYVRIYVFLRKRR------------------------KKITFRQTSGEVQQGSAQPSAESTEKVVRP-RLLSGCLRRKRPRTVPVENSLLPPMDLQNYCSISQASFARTEQEPNREEEEGREEDQVTVRSCEVKEISNGRTHTTLRPAPRVTTRASQARYRSIHSREKKATQMLAIVLGVFLICWLPFFVTHILNTHCRSCYIPPE-----LYSAFTWLGYVNSALNPVIYTTFNIEFRRAF 441          
BLAST of GCR011 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009127.1 (pep scaffold:Pmarinus_7.0:GL478629:43196:44446:-1 gene:ENSPMAG00000008256.1 transcript:ENSPMAT00000009127.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 146.362 bits (368), Expect = 3.286e-40
Identity = 122/364 (33.52%), Postives = 182/364 (50.00%), Query Frame = 2
Query:  122 GNSLILIAVLTTRHLQTVTNFYXXXXXXXXXXXXGTVLPLTIAKELHGKWVLGKHVCQFWVSMDILLCTASILNLCCISIDRYMAITKPLVYATKRSYKLAGCMILIAWILXXXXXXXXXXGW--SDHNFTNTTCEISIHLGFRIYSSLGSFFIPLILMIFVYLRIFAIANYRKILLNSHQXXXXXXXXXXXXXXXXXXXLDFQTSNPSSQQRRQALDLESNPKHAQALKLNSYLCQRPIHRSCALQNLI-YKSGNLQNFTNLSTGCAVLSSGLSQSQKGKETAAFLREHKTAKVIAMVIGCFVVCWLPFFTIYVLESLCSQRILCPYPIGSLLVKSVTWLGYINSALNPFLYAFYNKEYARTF 1204
            GNS ++ A+   R LQ V N+ + SLA+ DLLVS  VLP+    ++  +W LG+ VC  ++++D+L CT+SIL+LC I++DRY AIT P+ Y  KR+ + A  MI + W++   IS+PP++GW   +       C+IS   G+ IYS+ G+F+IPLILM+ +Y RIF  A +R I  N  +++     +             F  SN +      A    + P        +S   QR  HR  AL   +  +S +    ++     +       Q Q G  T A     KTA +I+           PF         C +R  C  P G   V  + WLGY NS LNP +YA++NK++   F
Sbjct:   53 GNSCVIAAIALERTLQNVANYLIGSLAVTDLLVSILVLPMAALYQVLDRWTLGQVVCDIFIALDVLCCTSSILHLCVIALDRYWAITNPIDYVNKRTPRRAVIMISLTWLVGFSISIPPMLGWRTPEDRADPNACKISQDHGYTIYSTFGAFYIPLILMLVLYSRIFRAARFR-IRKNVKKATEKKSFDA-----------PFAISNRAEMPSAAAEAETAAPPSPAPCNGDSK--QRS-HRDLALPEAVGARSPSSLAHSSARPHLSPAMMPTQQQQHGNGTGADACRRKTALLIS-----------PF---------CGER--CHLPPGVFAV--INWLGYSNSLLNPIIYAYFNKDFQNAF 377          
BLAST of GCR011 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006953.1 (pep scaffold:Pmarinus_7.0:GL477632:7596:14007:1 gene:ENSPMAG00000006283.1 transcript:ENSPMAT00000006953.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 133.65 bits (335), Expect = 1.999e-35
Identity = 116/368 (31.52%), Postives = 190/368 (51.63%), Query Frame = 2
Query:  119 CGNSLILIAVLTTRHLQTVTNFYXXXXXXXXXXXXGTVLPLTIAKELHG-KWVLGKHVCQFWVSMDILLCTASILNLCCISIDRYMAITKPLVYATKRSYKLAGCMILIAWILXX-XXXXXXXXGWSD--HNFTNTTCEISIHLGFRIYSSLGSFFIPLILMIFVYLRIFAIANYRKILLNSHQXXXXXXXXXXXXXXXXXXXLDFQTSNPS--SQQRRQALDLESNPKHAQALKLNSYLCQRPIHRSCALQNLIYKSGNLQNFTNLSTGCAVLSSGLSQSQKGKETAAFLREHKTAKVIAMVIGCFVVCWLPFFTIYVLESLCSQRILCPYPIGSLLVKSVTWLGYINSALNPFLYAFYNKEYARTF 1204
             GN L+++AV   + LQT TN++++SLA+AD+LV   V+P+++   L+G KW L   +C  W+ +D+L  TASI++LC IS+DRY+AI KP+ ++   S   A   IL  W++SV I    PV+G  D  + +T+ +C+++I   F IY SL SFF+PLI+M+  Y+    +   + +L        N  S  +S +S    +   +    S  S    +A+ L     H     L+      P   +     L +++G  +            S  ++ SQK +   A   E + +KV+ +V   FV  W PFF   VL +LC       + + +LL     W+GY++S +NP +Y  +N+ Y + F
Sbjct:   40 AGNVLVILAVSLEKKLQTATNYFLMSLAVADMLVGILVMPISLLNILYGFKWPLPLSLCPVWIYLDVLFSTASIMHLCAISLDRYIAIKKPIEHSRFNSRTKALLKILAVWVISVGISMPVPVLGLQDLAYVYTDGSCQMNIS-DFIIYGSLSSFFLPLIIMVASYVSTTRVLRQQALLCEGMNGCSNSSSYSSSYSSGGGNNNHGRGRATSLTSATPPEAVGLPGGGPHVALSALDG--VSAPPEAAL----LPHRAGRAK------------SRSVTPSQK-RTMQAITNEQRASKVLGIVFLLFVGMWCPFFITNVLSALCPADACNRHAMAALL-DVFVWVGYVSSGVNPLVYTLFNRTYRQAF 386          
BLAST of GCR011 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001357.1 (pep scaffold:Pmarinus_7.0:GL478256:17157:19157:1 gene:ENSPMAG00000001226.1 transcript:ENSPMAT00000001357.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 132.88 bits (333), Expect = 2.028e-35
Identity = 79/175 (45.14%), Postives = 119/175 (68.00%), Query Frame = 2
Query:  116 FCGNSLILIAVLTTRHLQTVTNFYXXXXXXXXXXXXGTVLPLTIAKELHGKWVLGKHVCQFWVSMDILLCTASILNLCCISIDRYMAITKPLVYATKRSYKLAGCMILIAWILXXXXXXXXXXGW--SDHNFTNTTCEISIHLGFRIYSSLGSFFIPLILMIFVYLRIFAIANYR 634
              GN+ +L A+   R LQTV N+ + SLA+ DLLVS  VLP+    ++ G+W LG+ VC  ++++D+L CT+SIL+LC I++DRY AIT P+ Y  KR+ + A  MI I W++   IS+PP++GW  ++       C IS HLG+ IYS+ G+F+IPL+LM+ +Y +IF+ A +R
Sbjct:   17 IAGNAFVLAAIYLERSLQTVANYLIGSLAVTDLLVSVLVLPVAALYQVLGRWTLGQAVCDAFIALDVLCCTSSILHLCAIALDRYWAITDPVDYVNKRTPRRAALMIAITWVVGFSISIPPMLGWRQAEDRADPDACNISQHLGYTIYSTFGAFYIPLVLMLVLYGKIFSAARFR 191          
BLAST of GCR011 vs. Ensembl Sea Lamprey
Match: adra1bb (adrenoceptor alpha 1Bb [Source:ZFIN;Acc:ZDB-GENE-041114-51])

HSP 1 Score: 130.568 bits (327), Expect = 8.201e-35
Identity = 110/370 (29.73%), Postives = 170/370 (45.95%), Query Frame = 2
Query:  131 LILIAVLTTRHLQTVTNFYXXXXXXXXXXXXGTVLPLTIAKELHGKWVLGKHVCQFWVSMDILLCTASILNLCCISIDRYMAITKPLVYATKRSYKLAGCMILIA-WILXXXXXXXXXXGWSDHNFTN-TTCEISIHLGFRIYSSLGSFFIPLILMIFVYLRIFAIANYRKILLNSHQXXXXXXXXXXXXXXXXXXXLDFQTSNPSSQQRRQALDLESNPKHAQALKLNSYLCQRPIHRSCALQNLIYKSGNLQNFTNLSTGCAVLS-SGLSQSQKGKETAAFLREHKTAKVIAMVIGCFVVCWLPFFTIYVLESLCSQRILCPYPIGSL---------LVKSVTWLGYINSALNPFLYAFYNKEYARTF 1204
            L++++V+  +HL+TVTN+++++LA ADLL+S TVLP +   E+ G WV G+  C  W ++D+L CTASI++LC I +                       +ILIA W+L+++ISV P++GW +    + T CEI+   G+ ++S++GSF+IPL++++ +Y R++  A                                          RRQ   LE   K                           +S + +  T      AVL   GL +S        F RE K AK + +V+G F++CWLPFF            I  P   GS          + K V WLGY NS +NP +Y   ++E+ R F
Sbjct:   56 LVVLSVVCNKHLRTVTNYFIINLASADLLLSTTVLPFSATFEILGYWVFGRIFCDIWAALDVLCCTASIMSLCAIRV----------------------LLILIAVWVLAIVISVGPLLGWKEPAPPDETVCEITEVPGYALFSAMGSFYIPLVILLAMYCRVYVAA------------------------------------------RRQTKSLEEGIKRE-------------------------RSSSSEEVTLKEKKAAVLEIYGLFRSSLSVRFMKFSREKKAAKTLGIVVGVFILCWLPFF------------IALPIAPGSFFPSVRPSQTVFKVVFWLGYFNSCINPLIYPCSSQEFKRAF 324          
BLAST of GCR011 vs. Ensembl Sea Lamprey
Match: HTR1F (5-hydroxytryptamine receptor 1F [Source:HGNC Symbol;Acc:HGNC:5292])

HSP 1 Score: 110.153 bits (274), Expect = 7.088e-27
Identity = 71/169 (42.01%), Postives = 107/169 (63.31%), Query Frame = 2
Query:  125 NSLILIAVLTTRHLQTVTNFYXXXXXXXXXXXXGTVLPLTIAKELHGKWVLGKHVCQFWVSMDILLCTASILNLCCISIDRYMAITKPLVYATKRSYKLAGCMILIAWILXXXXXXXXXXGWSDHNFTNTTCEIS-IHLGFRIYSSLGSFFIPLILMIFVYLRIFAIAN 628
            N+L++ A+  TR L+   N+ + SLA+ADLLV+  V+P+  A  + G+W LG  +C  W+S+D+  CTASIL+LC I++DR+ AIT    YA KR+   A  MI  +W+L+  ISVPP+  W   +     C I   H+ + IYS+ G+F++PL L++ +Y RIF  A 
Sbjct:   65 NALVIAAISATRKLRQPANYLIGSLAVADLLVAALVMPVAAAYVVTGEWALGGALCDLWLSLDVTCCTASILHLCAIALDRFWAITDAAEYAHKRTPGRAALMIAASWLLAACISVPPLF-WRRRDPAKPRCIIEHDHVLYTIYSTFGAFYVPLALLLALYCRIFRAAK 232          

HSP 2 Score: 70.8626 bits (172), Expect = 1.234e-13
Identity = 31/77 (40.26%), Postives = 48/77 (62.34%), Query Frame = 2
Query:  974 REHKTAKVIAMVIGCFVVCWLPFFTIYVLESLCSQRILCPYPIGSLLVKSVTWLGYINSALNPFLYAFYNKEYARTF 1204
            RE + AK + +++G FVVCWLPFF   ++ +LC    + P  +  LL    TWLGY+NS +NP +Y  +N+++   F
Sbjct:  346 RERRAAKTLGLILGAFVVCWLPFFIKELVVNLCKSCAVSPE-VADLL----TWLGYMNSLINPLIYTMFNEDFKSAF 417          
BLAST of GCR011 vs. Ensembl Nematostella
Match: EDO47359 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RMJ9])

HSP 1 Score: 104.375 bits (259), Expect = 9.914e-25
Identity = 105/375 (28.00%), Postives = 173/375 (46.13%), Query Frame = 2
Query:  122 GNSLILIAVLTTRHLQTVTNFYXXXXXXXXXXXXGTVLPLTIAKELHGK-WV--LGKHVCQFWVSMDILLCTASILNLCCISIDRYMAITKPLVYATKRSYKLAGCMILIAWILXXXXXXXXXXGWSDHNFTNTTCEISIHLGFRIY---SSLGSFFIPLILMIFVYLRIFAIANYRKILLNSHQXXXXXXXXXXXXXXXXXXXLDFQTSNPSSQQRRQALDLESNP---KHAQALKLNSYLCQRPIHRSCALQNLIYKSGNLQNFTNLSTGCAVLSSGLSQSQKGKETAAFLREHKTAKVIAMVIGCFVVCWLPFFTIYVLESLCS-----QRILCPYPIGSLLVKSVTWLGYINSALNPFLYAFYNKEYARTF 1204
            GN L+  +V   R L++ TN+ VVSLA++DLLV    LP  +A+ L+ + W   LG+  CQFW+ +D+L   AS++NL  IS DR +AI +PL Y  K + K A  +IL+ WI +   +    + W   +      +  I    R+Y    +L +FF PL+++I  Y  +  +A                             +L  Q      ++ + AL++   P    H ++ + +  L   P+ R   L+    +S + +   N + G A              T   +++ K  K +A+V+G F++CW PFF I+V    C      +  + P     LL+  V  L   NSA NP +Y+ +N+E+   F
Sbjct:   40 GNLLVCYSVFYYRRLRSPTNYLVVSLAVSDLLVGTLSLPFRLAQLLNEENWPSHLGREGCQFWIWVDMLCSGASMVNLAGISFDRLLAIKQPLRYREKMTSKRALILILVVWIYAASCAFLSFVEWEGESTIAAYPQCGIRA--RVYITLMALAAFFCPLLIVIICYGMVLQVA--------------------------IRHALQVQ-----KEKEQIALNVSPEPNSNNHEESGETS--LASPPVIR---LKT--SRSSSHRKDINFANGHA------KHRNPASSTFHIMKQIKATKTLAVVVGVFILCWFPFFVIFVTFQYCDTECFGEERIPPAVKRVLLIIFVYVLPVSNSAANPIIYSCFNQEFRVAF 368          
BLAST of GCR011 vs. Ensembl Nematostella
Match: EDO32513 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SUW3])

HSP 1 Score: 96.6709 bits (239), Expect = 2.151e-22
Identity = 97/363 (26.72%), Postives = 154/363 (42.42%), Query Frame = 2
Query:  122 GNSLILIAVLTTRHLQTVTNFYXXXXXXXXXXXXG-TVLPLTIAKEL-----HGKWVLGKHVCQFWVSMDILLCTASILNLCCISIDRYMAITKPLVYATKRSYKLAGCMILIAWILXXXXXXXXXXGWSDHNFTNTTCEISIHLGFRIYSSLGSFFIPLILMIFVYLRIFAIANYRKILLNSHQXXXXXXXXXXXXXXXXXXXLDFQTSNPSSQQRRQALDLESNPKHAQALKLNSYLCQRPIHRSCALQNLIYKSGNLQNFTNLSTGCAVLSSGLSQSQKGKETAAFLREHKTAKVIAMVIGCFVVCWLPFFTIYVLESLCSQRILCPYPIGSLLVKSVTWLGYINSALNPFLYAFYNKEY 1192
            GN+L+   V  TR L   + FY+V+      L+ G ++LPL+IA  +      G+W     VC      +   C AS+ NLC +S DRY+A+T PL+Y  +         I + W++S+ +S   ++   +           + + + + S+L  F IPLI ++F   RI +IA  R  L    Q       +                 + SS+ R +A  L S       L+  +   Q P       QNL ++                 S  +  + K      F RE KT K+  +V G F+VCW P F   V+ S      +      +L+      LGY NSA N F+Y+++N+E+
Sbjct:   12 GNTLVFRTVFVTRRLH-FSAFYLVASLAIADLMVGVSLLPLSIAYTIIGEMKGGEWSFSPVVCHAGTLFNFWFCCASVFNLCAVSWDRYVAVTSPLLYTVRMDDAKVRWTIAVIWVVSLFMSFLIMVAVIESKTVFYCTATGLAVEYSLSSALVIFIIPLIFLVFANGRIMSIA--RAQLKKIKQQMPYGYDSY---------------EDSSSKSRTEAETLPSTT--VTNLEQITTKPQEP------EQNLDFQE----------------SIQIPNTSKKLYFQRFRREFKTFKLFVIVTGVFLVCWTPLFVTMVMSSFLRTWTMVSIMHFALI------LGYANSACNVFIYSYFNREF 326          
BLAST of GCR011 vs. Ensembl Nematostella
Match: EDO34093 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQD2])

HSP 1 Score: 93.5893 bits (231), Expect = 2.729e-21
Identity = 93/365 (25.48%), Postives = 164/365 (44.93%), Query Frame = 2
Query:  122 GNSLILIAVLTTRHLQTVT-NFYXXXXXXXXXXXXGTVLPLTIAKELHGK--WVLGKHVCQFWVSMDILLCTASILNLCCISIDRYMAITKPL---VYATKRSYKLAGCMILIAWILXXXXXXXXXXGW--SDHNFTNTTCEISIHLGFRIYSSLGSFFIPLILMIFVYLRIFAIANYRKILLNSHQXXXXXXXXXXXXXXXXXXXLDFQTSNPSSQQRRQALDLESNPKHAQALKLNSYLCQRPIHRSCALQNLIYKSGNLQNFTNLSTGCAVLSSGLSQSQKGKETAAFLREHKTAKVIAMVIGCFVVCWLPFFTIYVLESLCSQRILCPYPIGSLLVKSVTWLGYINSALNPFLYAFYNKEY 1192
            GN+++++ ++    L+ VT N +++SLA +DLL +   +P  + + L G   W  G  +C  W +M ++    SIL L  ++++R+  +  PL     +   +++ A   I   W  S++ +V P+IGW  SD +  +  C  +I   +   SS+ +F +P+IL  ++Y+RIF IA+       + Q                         N   ++  +     S     +A      +C R I  S   Q    K     +F   S          +   +  E  A  R  + A+ +A+++  F +CW PF  + V  + C     C + + S L  ++  LGY NSALNPFLY+F +K +
Sbjct:   15 GNAIVIVTIVRNTSLRRVTTNLFILSLAFSDLLTASLAMPFDL-EALAGSLPWKHGHVICDIWATMYLIAVPTSILTLLAVAVERFKTLKDPLNKFRESHSVTHRRAIIAIFTLWGYSIMFAVVPLIGWRRSDVSVIDGQCIFNITHVYSALSSVVNFLLPVILTAYLYVRIFMIAHRHAPGAATQQ-------------------------NTDHKRLAKTATFRSEKHKGKASVSRISVC-RVIRESLCSQG---KKKTRIDFHKSS----------ASVTRAAEAGAMYRNIRAARTVAVIVFAFFLCWAPFTVLSVTMATCYT---CTHAVSSELFSALLLLGYTNSALNPFLYSFKDKRF 336          
BLAST of GCR011 vs. Ensembl Nematostella
Match: EDO42463 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S1I2])

HSP 1 Score: 91.6633 bits (226), Expect = 8.519e-21
Identity = 63/177 (35.59%), Postives = 100/177 (56.50%), Query Frame = 2
Query:  122 GNSLILIAVLTTRHLQTVTNFYXXXXXXXXXXXXGTVLPLTIAKELHG-KWVLGKHVCQFWVSMDILLCTASILNLCCISIDRYMAITKPLVYATKRSYKLAGCMILIAWILXXXXXXXXXXGWSDHN--------FTNTTCEISIHLGFRIYSSLGSFFIPLILMIFVYLRIFAIA 625
            GN ++ + V T +HLQ  TN+++VSLA AD L +   LP  +   L G KW LG H C++WV +D+L C+ASI NL  IS+DRY+ I+ PL Y ++ + K    ++++ W  S+I++   ++ WS             N  C +   +   I S +G FF P  +M+ +Y  +F +A
Sbjct:   16 GNGIVSLCVFTNKHLQVPTNYFIVSLAAADFLFAVLALPFRLYDVLAGYKWHLGLHTCRYWVWLDLLFCSASIANLAAISVDRYLKISSPLTYNSRMTPKRVVLVLVLLWGYSMILASLTLVQWSPDPKDQGRGTIVENGICRMEAKIYLTIISVIG-FFAPFAIMVLMYYFVFKVA 191          
BLAST of GCR011 vs. Ensembl Nematostella
Match: EDO35450 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLG6])

HSP 1 Score: 83.5741 bits (205), Expect = 5.054e-18
Identity = 64/175 (36.57%), Postives = 103/175 (58.86%), Query Frame = 2
Query:  119 CGNSLILIAVLTTRHLQTVTNFYXXXXXXXXXXXXGTVLPLTIAKELHGK-WVLGKHVCQFWVSMDILLCTASILNLCCISIDRYMAITKPLVYA---TKRSYKLAGCMILIAWILXXXXXXXXXXGWSDHNFTNT--TCEISIHLGFRIYSSLGSFFIPLILMIFVYLRIFAIA 625
            CGN L+  A+L+ R L+TVTN++++SLA++DLLV+G  +P  I   LH   W LG  VC+FW+ +D++  +ASI NL  IS+DR++A++ PL Y    TKR   LA  M+    +L  I ++   + WS          C +     +    ++G FF+PL++++  Y  +F +A
Sbjct:   25 CGNLLVCGAILSYRRLRTVTNYFIISLAVSDLLVAGLSMPFRIHHTLHSMCWDLGISVCEFWIFVDLVCSSASICNLSMISVDRFLALSYPLTYPSIMTKRRGLLAIAMVWGYSLL--ISALSFTLPWSPDGLMQDIPACSLKDKYYYTFVITVG-FFLPLVVLVIAYSLVFKVA 196          

HSP 2 Score: 59.3066 bits (142), Expect = 7.243e-10
Identity = 37/110 (33.64%), Postives = 54/110 (49.09%), Query Frame = 2
Query:  917 VLSSGLSQSQK------GKETAAFLREHKTAKVIAMVIGCFVVCWLPFFTIYVLESLCSQRILCPYPIGSLLVKSVTWLGYI--------NSALNPFLYAFYNKEYARTF 1204
            V    L Q++K      G    + +RE K  K +A+V+G F+VCWLPFF I      C +   C     SL VK+   +G +        NSA+NP +Y+ +N  + R F
Sbjct:  192 VFKVALHQARKLQLLSSGGFDPSIIRELKATKTLAIVVGSFIVCWLPFFVIMFTVQFCPE---CFQDHRSLPVKAQLAIGTVFVYVLPLLNSAVNPIIYSSFNANFRRAF 298          
BLAST of GCR011 vs. Ensembl Medaka
Match: ENSORLT00000005282.2 (pep primary_assembly:ASM223467v1:9:8571029:8576106:1 gene:ENSORLG00000004220.2 transcript:ENSORLT00000005282.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 173.711 bits (439), Expect = 2.499e-49
Identity = 118/364 (32.42%), Postives = 187/364 (51.37%), Query Frame = 2
Query:  122 GNSLILIAVLTTRHLQTVTNFYXXXXXXXXXXXXGTVLPLTIAKELHGKWVLGKHVCQFWVSMDILLCTASILNLCCISIDRYMAITKPLVYATKRSYKLAGCMILIAWILXXXXXXXXXXGW--SDHNFTNTTCEISIHLGFRIYSSLGSFFIPLILMIFVYLRIFAIANYRKILLNSHQXXXXXXXXXXXXXXXXXXXLDFQTSNPSSQQRRQALDLESNPKHAQALKLNSYLCQRPIHRSCALQNLIYKSGNLQNFTNLSTGCAVLSSGLSQSQKG-KETAAFLREHKTAKVIAMVIGCFVVCWLPFFTIYVLESLCSQRILCPYPIGSLLVKSVTWLGYINSALNPFLYAFYNKEYARTF 1204
            GN+ ++ A+   R LQ V N+ + SLA+ DL+VS  VLP+    ++  KW LG+ +C  ++S+D+L CT+SIL+LC I++DRY AIT P+ Y  KR+   A  +I   W++   IS+PP++GW  ++       C IS   G+ IYS+ G+F+IPLILM+ +Y RIF  A +R          +   +  +        +   + SN  S  R       S P       +N  +       S  +  +I  S       N     +     +++   G K   A  RE KT K + +++G F+ CWLPFF + ++   C +    P  +G++    + WLGY NS LNP +YA++NK++   F
Sbjct:   59 GNACVVAAIALERSLQNVANYLIGSLAVTDLMVSVLVLPMAALYQVLNKWTLGQEICDLFISLDVLCCTSSILHLCAIALDRYWAITDPIDYVNKRTPMRAVLLICATWLIGFSISIPPMLGWRSAEDRANPDACMISQDPGYTIYSTFGAFYIPLILMLVLYGRIFRAARFRI----RKTVKKIETAKVSDKCLAVSPAFFHKKSNGQSGGRGWKRCDGSKPSSPC---VNGAVMHGDEGESLEIIEVISNSKTHLPLPNTPQSSSHGYENMNERNSGAKRKLALSRERKTVKTLGIIMGTFIFCWLPFFIVALVLPFCPESCFMPDWLGAV----INWLGYSNSLLNPIIYAYFNKDFQNAF 411          
BLAST of GCR011 vs. Ensembl Medaka
Match: ADRA2C (adrenoceptor alpha 2C [Source:HGNC Symbol;Acc:HGNC:283])

HSP 1 Score: 166.392 bits (420), Expect = 1.508e-46
Identity = 121/377 (32.10%), Postives = 196/377 (51.99%), Query Frame = 2
Query:  122 GNSLILIAVLTTRHLQTVTNFYXXXXXXXXXXXXGTVLPLTIAKELHGKWVLGKHVCQFWVSMDILLCTASILNLCCISIDRYMAITKPLVYATKRSYKLAGCMILIAWILXXXXXXXXXXGWSDHN--FTNTTCEISIHLGFRIYSSLGSFFIPLILMIFVYLRIFAIANYRKILLNSHQXXXXXXXXXXXXXXXXXXXLDFQTSN------PSSQQR-------RQALDL-ESNPKHAQALKLNSYLCQRPIHRSCALQNLIYKSGNLQNFTNLSTGCAVLSSGLSQSQKGKETAAFLREHKTAKVIAMVIGCFVVCWLPFFTIYVLESLCSQRILCPYPIGSLLVKSVTWLGYINSALNPFLYAFYNKEYARTF 1204
            GN L++IAVLT+R L+   N ++VSLA AD+LV+  V+P ++A EL G W  GK  C  ++++D+L CT+SI++LC IS+DRY ++T+ + Y  KR+ +   C ILI W++S  IS PP++    +N   +   CE++    + + SS+ SFF P ++MI VY+RI+ +A  R   ++  +   +  +   +  S     L  +  N      P+  QR        Q +D+ ES+    +         QR   R     +    S ++   +N S           +S   ++  +  RE +   V+A+V+G FV+CW PFF  Y L  +C      P P    L K   W+GY NS+LNP +Y  +N+++   F
Sbjct:   52 GNILVVIAVLTSRALKAPQNLFLVSLATADILVATLVMPFSLANELMGYWYFGKVWCGIYLALDVLFCTSSIVHLCAISLDRYWSVTQAVEYNLKRTPRRIKCTILIVWLVSAFISSPPLVSIDRNNDISSQPQCELNDETWYILSSSIASFFAPCLIMILVYIRIYQVAKTRTRSMSEKKPKPDGVTQTENGLSKVSSPLHGEAENGHCHCPPTPSQRTVTTGPQTQEVDVEESSSSEGKGHNPQRQDSQRA--RKARKSSFSKHSAHISRVSNKSMDLFASRRKRRRSSFARKKVSQAREKRFTFVLAVVMGVFVMCWFPFFFSYSLYGVCRDSCRIPDP----LFKFFFWIGYCNSSLNPAIYTIFNRDFRHAF 422          
BLAST of GCR011 vs. Ensembl Medaka
Match: htr7c (5-hydroxytryptamine (serotonin) receptor 7c [Source:ZFIN;Acc:ZDB-GENE-060526-5])

HSP 1 Score: 166.007 bits (419), Expect = 2.660e-46
Identity = 117/363 (32.23%), Postives = 190/363 (52.34%), Query Frame = 2
Query:  122 GNSLILIAVLTTRHLQTVTNFYXXXXXXXXXXXXGTVLPLTIAKEL-HGKWVLGKHVCQFWVSMDILLCTASILNLCCISIDRYMAITKPLVYATKRSYKLAGCMILIAWILXXXXXXXXXXGWSDHNFTNTTCEISIHLGFRIYSSLGSFFIPLILMIFVYLRIFAIANYRKILLNSHQXXXXXXXXXXXXXXXXXXXLDFQTSNPSSQQRRQALDLESNPKHAQALKLNSYLCQRPIHRSCALQNLIYKSGNLQNFTNLSTGCAVLSSGLSQSQKGKETAAFLREHKTAKVIAMVIGCFVVCWLPFFTIYVLES-LCSQRILCPYPIGSLLVKSVTWLGYINSALNPFLYAFYNKEYARTF 1204
            GN+L++IAV   + L+  +N+ +VSLA+ADL V+  V+P  I  +L  GKW+ G+  C  ++ MD++ CTASI+ LC IS+DRY+ IT+PL Y  +++ +L   MIL  W++S  I++PP  GW+ +      C IS   G+ IYS+  +F+IP+++M+ +Y +IF  A         H+                           +   RR+ L+  +N    +AL++      +P                    + ++  CA LS  L++ +  K  + F RE K A  + +++G F VCWLPFF +      +C     C  PI   L +++ WLGY NS +NPF+YAF+N++   T+
Sbjct:  104 GNTLVVIAVCVVKKLRQPSNYLLVSLAVADLSVAIVVMPFVIVTDLTGGKWLFGEVFCNIFIGMDVMCCTASIMTLCVISVDRYLGITRPLTYPARQNGQLMAKMILGVWLVSASITLPPFCGWAKNVHKAGVCLISQDFGYTIYSTAVAFYIPMLVMLVMYYKIFRAARKSG---AKHRF--------------------------TDLLRRERLETVAN----EALRMQGL---KP--------------------SGVAEECATLSRLLNRER--KNISIFKREQKAATTLGVIVGVFAVCWLPFFILSTARPFICGVECSC-VPI--WLERTLLWLGYANSLMNPFIYAFFNRDLRSTY 405          
BLAST of GCR011 vs. Ensembl Medaka
Match: htr1ab (5-hydroxytryptamine (serotonin) receptor 1A b [Source:ZFIN;Acc:ZDB-GENE-090409-2])

HSP 1 Score: 164.851 bits (416), Expect = 3.146e-46
Identity = 112/369 (30.35%), Postives = 186/369 (50.41%), Query Frame = 2
Query:  122 GNSLILIAVLTTRHLQTVTNFYXXXXXXXXXXXXGTVLPLTIAKELHGKWVLGKHVCQFWVSMDILLCTASILNLCCISIDRYMAITKPLVYATKRSYKLAGCMILIAWIL-------XXXXXXXXXXGWSDHNFTNTTCEISIHLGFRIYSSLGSFFIPLILMIFVYLRIFAIANYRKILLNSHQXXXXXXXXXXXXXXXXXXXLDFQTSNPSSQQRRQALDLESNPKHAQALKLNSYLCQRPIHRSCALQNLIYKS-GNLQNFTNLSTGCAVLSSGLSQSQKGKETAAFLREHKTAKVIAMVIGCFVVCWLPFFTIYVLESLCSQRILCPYPIGSLLVKSVTWLGYINSALNPFLYAFYNKEYARTF 1204
            GN+ ++ A++  R LQ V N+ + SLA+ DL+VS  VLP+    ++   W LG+  C  ++S+D+L CT+SIL+LC I++DRY AIT+P+ Y  KR+ + A  +I + W++        +++        ++       C+I     + IYS+ G+F+IPL LM+ +Y RIF  A +R          +  K     S      SL  +T +  +Q +     +E  P    +  +N  +       S  +  +   S GNL    N  +   +  S   ++ + K   A  RE KT K + +++G F++CWLPFF + ++   C +    P      L   + WLGY NS LNP +YA++NK++   F
Sbjct:   35 GNACVVAAIVLERSLQNVANYLIGSLAVTDLMVSVLVLPMAALYQVLNSWTLGQVPCDIFISLDVLCCTSSILHLCAIALDRYWAITEPIDYMKKRTPRRAAVLISVTWLVGFSISVPPMLVMRSQPGSMAEDRANPKQCKIRQDPWYTIYSTFGAFYIPLTLMLVLYGRIFKAARFRI----RRTVRKTEKKKVADSCLAISPSLFHKTPHGDAQGKSWKRSVEPRPLALPS--VNGAVKHAEDGESLEIIEVHSNSRGNLP-LPNTPSTVPLFESRHDKATEAKRKIALARERKTVKTLGIIMGTFILCWLPFFIVALVMPFCQESCYMP----RWLEDVINWLGYSNSLLNPIIYAYFNKDFQSAF 392          
BLAST of GCR011 vs. Ensembl Medaka
Match: drd3 (dopamine receptor D3 [Source:NCBI gene;Acc:101163209])

HSP 1 Score: 163.696 bits (413), Expect = 9.971e-46
Identity = 130/368 (35.33%), Postives = 193/368 (52.45%), Query Frame = 2
Query:  122 GNSLILIAVLTTRHLQTVTNFYXXXXXXXXXXXXGTVLPLTIAKEL-HGKWVLGKHVCQFWVSMDILLCTASILNLCCISIDRYMAITKPLVYATKR-SYKLAGCMILIAWILXXXXXXXXXXGWSDHNFTNTTCEISIHLGFRIYSSLGSFFIPLILMIFVYLRIFAIANYRKILLNS--HQXXXXXXXXXXXXXXXXXXXLDFQT--SNPSSQQRRQALDLESNPKHAQALKLNSYLCQRPIHRSCALQNLIYKSGNLQNFTNLSTGCAVLSSGLSQSQKGKE-TAAFLREHKTAKVIAMVIGCFVVCWLPFFTIYVLESLCSQRILCPYPIGSLLVKSVTWLGYINSALNPFLYAFYNKEYARTF 1204
            GN L+ +AVL  R LQT TN+ VVSLA+ADLLV+  V+P  +  E+  G W+  +  C  +V++D+++CTASILNLC ISIDRY A+  P++Y T   S K    MI   W+L+  +S P + G++  +     C IS +  F IYSS+ SF++P I+ + VY+RI+     R+  + S         +     + +     +D Q   S   +   R   DLE       A   N  L   PI  +C ++ L     N +  T+L          +S SQ      +   RE K  +++A+V+G F++CWLPFF  ++L + C     C  P    L  + TWLGY+NSALNP +Y  +N E+ R F
Sbjct:   51 GNVLVCLAVLRERSLQTTTNYLVVSLAVADLLVASLVMPWAVYLEVVGGAWLFNRLYCNIFVTLDVMMCTASILNLCAISIDRYTAVVMPVLYNTTHCSRKRVFAMIATVWVLAFAVSCPLLFGFNTTD-DPMVCSIS-NPDFVIYSSVVSFYLPFIVTLLVYIRIYVFLRMRRKRIPSLLSGCLWRKRPKTGPAQNSGLPPVDMQNYCSISHASCGRTEFDLEQGQVEQDASDSNQ-LELPPIRMNCEVKEL----SNGRTHTSLRP--------ISHSQNNPRFRSMHAREKKATQMLAIVLGVFLICWLPFFVTHILNTHCRT---CQIPPA--LYGAFTWLGYVNSALNPVIYTTFNIEFRRAF 398          
BLAST of GCR011 vs. Planmine SMEST
Match: SMESG000025945.1 (SMESG000025945.1)

HSP 1 Score: 661.759 bits (1706), Expect = 0.000e+0
Identity = 382/383 (99.74%), Postives = 383/383 (100.00%), Query Frame = 2
Query:   56 MFVFIHVXXXXXXXXXXXXXFCGNSLILIAVLTTRHLQTVTNFYXXXXXXXXXXXXGTVLPLTIAKELHGKWVLGKHVCQFWVSMDILLCTASILNLCCISIDRYMAITKPLVYATKRSYKLAGCMILIAWILXXXXXXXXXXGWSDHNFTNTTCEISIHLGFRIYSSLGSFFIPLILMIFVYLRIFAIANYRKILLNSHQXXXXXXXXXXXXXXXXXXXLDFQTSNPSSQQRRQALDLESNPKHAQALKLNSYLCQRPIHRSCALQNLIYKSGNLQNFTNLSTGCAVLSSGLSQSQKGKETAAFLREHKTAKVIAMVIGCFVVCWLPFFTIYVLESLCSQRILCPYPIGSLLVKSVTWLGYINSALNPFLYAFYNKEYARTF 1204
            MFVFIHVLIIALLLITDIIIFCGNSLILIAVLTTRHLQTVTNFYVVSLA+ADLLVSGTVLPLTIAKELHGKWVLGKHVCQFWVSMDILLCTASILNLCCISIDRYMAITKPLVYATKRSYKLAGCMILIAWILSVIISVPPVIGWSDHNFTNTTCEISIHLGFRIYSSLGSFFIPLILMIFVYLRIFAIANYRKILLNSHQSSRNIKSNKNSSNSLSYKSLDFQTSNPSSQQRRQALDLESNPKHAQALKLNSYLCQRPIHRSCALQNLIYKSGNLQNFTNLSTGCAVLSSGLSQSQKGKETAAFLREHKTAKVIAMVIGCFVVCWLPFFTIYVLESLCSQRILCPYPIGSLLVKSVTWLGYINSALNPFLYAFYNKEYARTF
Sbjct:    1 MFVFIHVLIIALLLITDIIIFCGNSLILIAVLTTRHLQTVTNFYVVSLAIADLLVSGTVLPLTIAKELHGKWVLGKHVCQFWVSMDILLCTASILNLCCISIDRYMAITKPLVYATKRSYKLAGCMILIAWILSVIISVPPVIGWSDHNFTNTTCEISIHLGFRIYSSLGSFFIPLILMIFVYLRIFAIANYRKILLNSHQSSRNIKSNKNSSNSLSYKSLDFQTSNPSSQQRRQALDLESNPKHAQALKLNSYLCQRPIHRSCALQNLIYKSGNLQNFTNLSTGCAVLSSGLSQSQKGKETAAFLREHKTAKVIAMVIGCFVVCWLPFFTIYVLESLCSQRILCPYPIGSLLVKSVTWLGYINSALNPFLYAFYNKEYARTF 383          
BLAST of GCR011 vs. Planmine SMEST
Match: SMESG000070778.1 (SMESG000070778.1)

HSP 1 Score: 241.891 bits (616), Expect = 1.378e-75
Identity = 161/386 (41.71%), Postives = 234/386 (60.62%), Query Frame = 2
Query:  116 FCGNSLILIAVLTTRHLQTVTNFYXXXXXXXXXXXXGTVLPLTIAKELHGKWVLGKHVCQFWVSMDILLCTASILNLCCISIDRYMAITKPLVYATKRSYKLAGCMILIAWILXXXXXXXXXXGWSDHNFTNTTCEISIHLGFRIYSSLGSFFIPLILMIFVYLRIFAIANYRKILLNSHQXXXXXXXXXXXXXXXXXXXLDFQTSNPSSQQRRQALDLESNPKHAQA-------------LKLNSYLCQRPIHRSCALQNLIYKSGNLQNFTNLSTGCAVLSSGL----------SQSQKGKETAAFLREHKTAKVIAMVIGCFVVCWLPFFTIYVLESLCSQRILCPYPIGSLLVKSVTWLGYINSALNPFLYAFYNKEYARTF 1204
            F GNS++++AV+TT+ LQTVTN YV+SLA +D+ VS  VLPL I  ++   W L    C+ W+S DI LCT+SILNLCCISIDRYMAIT+PL YAT+RS KLA CMIL  WIL++ +++P + GWS H  +   C I+ H G+R++S+  SF IP +++IFVY+RIF +A Y++ LL+S + S+     K+  +S S    +        +  ++++ L  +P +  +              ++NS + + P  +   LQ ++  S ++     +   C   S                +K +E AAF +EHKTAK +A+V+GCF VCW+PFF +Y++E  C   I+ P+      V  VTWLGY+NS  NPF+YAFYNKEYA  F
Sbjct:   37 FIGNSMVILAVMTTKRLQTVTNLYVISLAFSDVFVSIFVLPLAIVTQIMKHWPLTPLACKLWLSSDICLCTSSILNLCCISIDRYMAITQPLKYATRRSKKLARCMILAVWILALSVTIPGIFGWSKHISSTGYCFITFHRGYRLFSAFCSFIIPFLIIIFVYIRIFWVA-YKRKLLSSPEPSKCFNRIKSDFHSYSNSISNIANQGYPEKSEKKSVCLLKSPNYNSSEVSVNIVEQNYFRFQINSVI-KMP-KKMNFLQRILADSNSITETVTVQLVCVGHSLQFPPLKKKVRFNENDKKKRERAAFRKEHKTAKTLALVVGCFSVCWIPFFCVYLVEPFCGC-IINPH-----FVAFVTWLGYVNSIFNPFIYAFYNKEYALAF 413          
BLAST of GCR011 vs. Planmine SMEST
Match: SMESG000044639.1 (SMESG000044639.1)

HSP 1 Score: 176.792 bits (447), Expect = 7.690e-51
Identity = 127/375 (33.87%), Postives = 203/375 (54.13%), Query Frame = 2
Query:  122 GNSLILIAVLTTRHLQTVTNFYXXXXXXXXXXXXGTVLPLTIAKELHGKWVLGKHVCQFWVSMDILLCTASILNLCCISIDRYMAITKPLVYATKRSYKLAGCMILIAWILXXXXXXXXXXGWSDH--NFT----NTTCEISIHLGFRIYSSLGSFFIPLILMIFVYLRIF----AIANYRKILLNSHQXXXXXXXXXXXXXXXXXXXLDFQTSNPSSQQRRQAL----DLESNPKHAQALKLNSYLCQRPIHRSCALQNLIYKSGNLQNFTNLSTGCAVLSSGLSQSQKGKETAAFLREHKTAKVIAMVIGCFVVCWLPFFTIYVLESLCSQRILCPYPIGSLLVKSVTWLGYINSALNPFLYAFYNKEYARTF 1204
            GNSL+LIA+ T   L+ + N+++ SLA+ADLL+   +LP ++  E+ G+W+ G+ +C  W+++D+LLCTASI++LC ISIDRY +I +P+ Y T R+      MI+ AWI+S +I +PP+ GWS H  NF+       CE++ +  + +YSS+GSF+IPL+++I VYL++F      AN + ++             K     +  +  + Q +   +Q   +A+    D +          LNS   Q+  HR   +Q+            N+ +  A+  S L +           RE +T  V+ +V+G F+VCWLPFFT Y++   C     C   +   L     WLGY NS LNP +Y  YN+++ + F
Sbjct:   39 GNSLVLIAISTDYRLKNIQNWFLGSLAIADLLLGILILPFSLFNEIFGRWIFGRLLCSLWLAIDVLLCTASIMHLCLISIDRYYSIVRPIQYKTSRTPNRVLAMIIAAWIISGLICLPPLFGWSSHSLNFSISSNEQKCELTQNRAYVLYSSIGSFYIPLLIIIIVYLQVFIEAKRRANRKYVVKKPEVKKNPELFRKKEVVEVDIEYTEIQQNCNCNQVDSEAISCIVDDDDPSVTNNQEPLNS---QK--HRIDRIQS-----------KNIISKLAIRKSKLVR----------YRERRTIVVLGVVVGAFIVCWLPFFTSYLIVIFCK----C---MNEHLFGFFFWLGYCNSGLNPIIYTVYNRDFRKAF 380          
BLAST of GCR011 vs. Planmine SMEST
Match: SMESG000056795.1 (SMESG000056795.1)

HSP 1 Score: 167.548 bits (423), Expect = 8.271e-48
Identity = 122/362 (33.70%), Postives = 194/362 (53.59%), Query Frame = 2
Query:  122 GNSLILIAVLTTRHLQTVTNFYXXXXXXXXXXXXGTVLPLTIAKELHGKWVLGKHVCQFWVSMDILLCTASILNLCCISIDRYMAITKPLVYATKRSYKLAGCMILIAWILXXXXXXXXXXGWSDHNFTNTTCEISIHLGFRIYSSLGSFFIPLILMIFVYLRI-FAIANYRKILLNSHQXXXXXXXXXXXXXXXXXXXLDFQTSNPSSQQRRQALDLESNPKHAQALKLNSYLCQRPIHRSCALQNLIYKSGNLQNFTNLSTGCAVLSSGLSQSQKGKETAAFLREHKTAKVIAMVIGCFVVCWLPFFTIYVLESLCSQRILCPYPIGSLLVKSVTWLGYINSALNPFLYAFYNKEYARTF 1204
            GN L++++V+  R L+ V NF ++SLA ADL V+  V+P  +   + G+W+ G  +C FW++ D+  CTASILNLC I++DRY AI  PL Y  KR+ +    +I  A+ILS +IS+PP++GW +       C +S +  + ++S+ GSF IP +++ FVY+RI FAI   RK L +  +                            +Q  R  +  E+     +  K NS L     + +C +        N +N TN S+     S  L+Q    ++  +  +E K+A+ + +++G FV+CW PFF +YV+   CS  + C      + V  + WLGY+NSALNP +Y  +NK++   F
Sbjct:   32 GNILVILSVIYHRPLRKVQNFLIISLAAADLSVASLVMPFALINYILGRWIFGSVLCDFWLTSDVFCCTASILNLCAIALDRYWAINYPLDYVNKRTIRTILSVICGAYILSGLISIPPLLGWKEEMKNLYVCSLSDNRIYVLFSAFGSFIIPTVVIFFVYIRIYFAI---RKRLRDKIKFI--------------------------NQNDRLLMKKETVKNKRKDSKENSSLE----NETCKITPTCSNKVNNEN-TNFSSVNN--SDKLNQFWNERQKISLSKERKSARTMGIIMGVFVICWSPFFLMYVIVPFCSASV-CQNRNQRVEV-FLVWLGYVNSALNPIIYTIFNKDFRDAF 355          
BLAST of GCR011 vs. Planmine SMEST
Match: SMESG000017736.1 (SMESG000017736.1)

HSP 1 Score: 167.162 bits (422), Expect = 1.132e-46
Identity = 125/368 (33.97%), Postives = 192/368 (52.17%), Query Frame = 2
Query:  122 GNSLILIAVLTTRHLQTVTNFYXXXXXXXXXXXXGTVLPLTIAKEL-HGKWVLGKHVCQFWVSMDILLCTASILNLCCISIDRYMAITKPLVYATKRSYKLAGCMILIAWILXXXXXXXXXXGWSDHNFTNTTCEISIHLGFRIYSSLGSFFIPLILMIFVYLRIFAIANYRKILLNSHQXXXXXXXXXXXXXXXXXXXLDFQTSNPSSQQRRQALDLESNPKHAQALKLNSYLCQRPIHRSCALQNLIYKSGNLQNFTNLSTGCAVLSSGLSQSQKGKETAAFLREHKTAKVIAMVIGCFVVCWLPFFTIYVLESLC------SQRILCPYPIGSLLVKSVTWLGYINSALNPFLYAFYNKEYARTF 1204
            GN L+++A+   + LQT +N+ ++SLA +D  VS  V+P+ +  +L   +W   +  C F++  D+LLCT+SILNLC ISIDRY+ IT+P+ Y  +R+  L G  I  AWI+S +IS+PPVI W +  F   TC+++ +LG++IY++LG+F+IPLI+M+ +Y RIF +A       N  Q     K            SL  Q+   +S +  + L L  +P             QRP              GN  N      G  V  +G       ++      E K    + +++GCF +CWLPFF I +L+ +        ++ L P+     L     WLGY+NS LNP +YA +N+E+   F
Sbjct:   54 GNFLVILAIFLVKKLQTPSNWLILSLAFSDFFVSVLVMPVAVYNQLMRFRWPFSELFCDFFIICDVLLCTSSILNLCAISIDRYLVITRPMQYVVRRTPLLIGGFIAGAWIISGLISIPPVIVWKEP-FRPGTCQLTENLGYQIYATLGAFYIPLIIMLVLYYRIFKLAR------NMAQEDAKRKLGTGQMTDEEQTSLPNQSGRTNSAEEDRKL-LRFDP------------TQRP------------SEGNQGN------GFDVEKTGTGPKTNPRKKKQSNNESKAITTLGVIMGCFTLCWLPFFIIQILKPILIVSKVDHEKYLLPWCYELFL-----WLGYLNSFLNPVIYAKFNREFRNPF 378          
The following BLAST results are available for this feature:
BLAST of GCR011 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
HTR1A2.084e-5233.605-hydroxytryptamine receptor 1A [Source:HGNC Symbo... [more]
ADRA1A5.295e-4430.66adrenoceptor alpha 1A [Source:HGNC Symbol;Acc:HGNC... [more]
ADRA1A5.394e-4430.66adrenoceptor alpha 1A [Source:HGNC Symbol;Acc:HGNC... [more]
ADRA2A1.101e-4331.06adrenoceptor alpha 2A [Source:HGNC Symbol;Acc:HGNC... [more]
ADRA1A1.372e-4330.66adrenoceptor alpha 1A [Source:HGNC Symbol;Acc:HGNC... [more]
back to top
BLAST of GCR011 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ser-24.701e-5236.54Tyramine receptor Ser-2 [Source:UniProtKB/Swiss-P... [more]
ser-24.758e-5236.78Tyramine receptor Ser-2 [Source:UniProtKB/Swiss-P... [more]
ser-26.310e-5236.78Tyramine receptor Ser-2 [Source:UniProtKB/Swiss-P... [more]
ser-26.955e-5236.78Tyramine receptor Ser-2 [Source:UniProtKB/Swiss-P... [more]
ser-22.513e-4935.39Tyramine receptor Ser-2 [Source:UniProtKB/Swiss-P... [more]
back to top
BLAST of GCR011 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
5-HT75.651e-3931.03gene:FBgn0004573 transcript:FBtr0334508[more]
5-HT75.651e-3931.03gene:FBgn0004573 transcript:FBtr0085746[more]
Dop2R2.214e-3830.31gene:FBgn0053517 transcript:FBtr0343167[more]
TyrR3.036e-3751.20gene:FBgn0038542 transcript:FBtr0344474[more]
TyrR3.036e-3751.20gene:FBgn0038542 transcript:FBtr0083532[more]
back to top
BLAST of GCR011 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
htr1aa1.877e-5032.335-hydroxytryptamine (serotonin) receptor 1A a [Sou... [more]
htr7c2.290e-4732.785-hydroxytryptamine (serotonin) receptor 7c [Sourc... [more]
FP236542.11.156e-4530.41alpha-2B adrenergic receptor-like [Source:NCBI gen... [more]
FP236542.11.156e-4530.41alpha-2B adrenergic receptor-like [Source:NCBI gen... [more]
adra1aa1.327e-4530.66adrenoceptor alpha 1Aa [Source:ZFIN;Acc:ZDB-GENE-0... [more]
back to top
BLAST of GCR011 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000046867.17.301e-5033.245-hydroxytryptamine (serotonin) receptor 1A, G pro... [more]
ADRA2B1.037e-4632.98adrenoceptor alpha 2B [Source:NCBI gene;Acc:100485... [more]
efr3b3.124e-4430.39EFR3 homolog B [Source:Xenbase;Acc:XB-GENE-6033491... [more]
DRD23.337e-4333.08dopamine receptor D2 [Source:NCBI gene;Acc:1004930... [more]
ADRA1D7.152e-4132.60adrenoceptor alpha 1D [Source:NCBI gene;Acc:100495... [more]
back to top
BLAST of GCR011 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Htr1a1.993e-5033.605-hydroxytryptamine (serotonin) receptor 1A [Sourc... [more]
Adra1a1.448e-4330.66adrenergic receptor, alpha 1a [Source:MGI Symbol;A... [more]
Adra1a3.164e-4330.66adrenergic receptor, alpha 1a [Source:MGI Symbol;A... [more]
Adra1a3.164e-4330.66adrenergic receptor, alpha 1a [Source:MGI Symbol;A... [more]
Adra1a3.164e-4330.66adrenergic receptor, alpha 1a [Source:MGI Symbol;A... [more]
back to top
BLAST of GCR011 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q93127|GPR18_AMPAM2.260e-5737.70Probable G-protein coupled receptor No18 OS=Amphib... [more]
sp|Q9N298|5HT1A_PANTR3.364e-5232.385-hydroxytryptamine receptor 1A OS=Pan troglodytes... [more]
sp|Q17232|OAR_BOMMO4.675e-5233.90Octopamine receptor OS=Bombyx mori OX=7091 PE=2 SV... [more]
sp|P08908|5HT1A_HUMAN1.001e-5133.605-hydroxytryptamine receptor 1A OS=Homo sapiens OX... [more]
sp|Q9N297|5HT1A_GORGO1.054e-5133.605-hydroxytryptamine receptor 1A OS=Gorilla gorilla... [more]
back to top
BLAST of GCR011 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A193KU590.000e+0100.00GCR011 OS=Schmidtea mediterranea OX=79327 GN=gcr01... [more]
R7V8L83.875e-6641.76G_PROTEIN_RECEP_F1_2 domain-containing protein (Fr... [more]
A0A1J0F4P12.291e-6538.08Tyramine receptor 2 OS=Platynereis dumerilii OX=63... [more]
A0A0L8GS862.028e-6139.73G_PROTEIN_RECEP_F1_2 domain-containing protein OS=... [more]
A0A1B0CD976.962e-5937.03Tyramine receptor OS=Lutzomyia longipalpis OX=7200... [more]
back to top
BLAST of GCR011 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
adra2b1.221e-4731.43adrenoceptor alpha 2B [Source:NCBI gene;Acc:266751... [more]
drd2b3.115e-4632.28D(2) dopamine receptor A [Source:NCBI gene;Acc:103... [more]
adra2a1.737e-4532.23adrenoceptor alpha 2A [Source:NCBI gene;Acc:266750... [more]
adra1aa1.912e-4532.60alpha-1A adrenergic receptor-like [Source:NCBI gen... [more]
drd32.190e-4431.27dopamine receptor D3 [Source:NCBI gene;Acc:1030247... [more]
back to top
BLAST of GCR011 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000009127.13.286e-4033.52pep scaffold:Pmarinus_7.0:GL478629:43196:44446:-1 ... [more]
ENSPMAT00000006953.11.999e-3531.52pep scaffold:Pmarinus_7.0:GL477632:7596:14007:1 ge... [more]
ENSPMAT00000001357.12.028e-3545.14pep scaffold:Pmarinus_7.0:GL478256:17157:19157:1 g... [more]
adra1bb8.201e-3529.73adrenoceptor alpha 1Bb [Source:ZFIN;Acc:ZDB-GENE-0... [more]
HTR1F7.088e-2742.015-hydroxytryptamine receptor 1F [Source:HGNC Symbo... [more]
back to top
BLAST of GCR011 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of GCR011 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO473599.914e-2528.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO325132.151e-2226.72Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO340932.729e-2125.48Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO424638.519e-2135.59Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO354505.054e-1836.57Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of GCR011 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000005282.22.499e-4932.42pep primary_assembly:ASM223467v1:9:8571029:8576106... [more]
ADRA2C1.508e-4632.10adrenoceptor alpha 2C [Source:HGNC Symbol;Acc:HGNC... [more]
htr7c2.660e-4632.235-hydroxytryptamine (serotonin) receptor 7c [Sourc... [more]
htr1ab3.146e-4630.355-hydroxytryptamine (serotonin) receptor 1A b [Sou... [more]
drd39.971e-4635.33dopamine receptor D3 [Source:NCBI gene;Acc:1011632... [more]
back to top
BLAST of GCR011 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000025945.10.000e+099.74SMESG000025945.1[more]
SMESG000070778.11.378e-7541.71SMESG000070778.1[more]
SMESG000044639.17.690e-5133.87SMESG000044639.1[more]
SMESG000056795.18.271e-4833.70SMESG000056795.1[more]
SMESG000017736.11.132e-4633.97SMESG000017736.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30009809 ID=SMED30009809|Name=GCR011|organism=Schmidtea mediterranea sexual|type=transcript|length=1269bp
CTCAGATCCAAGCAAATAATTAAATCAAACTTTAAAGTTTTCCTTAAATT
TGGTCATGTTTGTCTTCATCCATGTTTTAATAATTGCATTATTACTCATT
ACAGATATTATCATTTTCTGCGGTAACAGCCTGATTCTGATCGCAGTTCT
TACTACCCGGCATTTACAGACGGTGACCAACTTCTATGTTGTCTCATTGG
CACTTGCTGACCTTTTGGTATCTGGAACGGTTTTACCACTGACAATAGCA
AAAGAATTGCATGGAAAATGGGTCCTAGGGAAGCATGTCTGCCAGTTTTG
GGTGTCAATGGATATTTTACTTTGTACAGCATCTATTCTTAATTTGTGCT
GCATTTCGATTGATCGATATATGGCGATCACTAAGCCCTTGGTATATGCC
ACAAAACGATCATATAAATTAGCAGGTTGTATGATATTAATCGCTTGGAT
CTTGTCAGTAATTATATCGGTGCCCCCGGTAATCGGTTGGTCAGATCATA
ATTTTACCAACACTACTTGTGAAATCAGTATTCATCTTGGATTTAGAATC
TATTCATCACTGGGATCGTTTTTTATCCCGTTAATCCTCATGATTTTTGT
TTACTTGAGAATCTTCGCCATAGCCAACTATCGTAAAATTTTACTCAACA
GTCATCAATCTTCGAGAAACATTAAATCAAATAAAAATTCTTCTAATTCT
TTATCATATAAATCCCTCGATTTCCAAACATCCAATCCCTCGTCTCAACA
ACGTCGACAAGCGTTAGATTTGGAGTCCAATCCGAAACACGCTCAAGCTT
TGAAATTAAATTCTTATCTTTGCCAGAGGCCCATTCATAGAAGCTGCGCA
CTTCAGAATCTAATTTACAAATCTGGAAATCTACAGAATTTCACCAATCT
TTCAACTGGGTGTGCAGTTTTGAGTTCGGGATTAAGTCAAAGCCAAAAAG
GCAAAGAAACCGCAGCATTTTTGCGAGAACATAAAACTGCCAAAGTCATT
GCAATGGTAATTGGATGCTTTGTAGTGTGCTGGCTGCCATTTTTCACTAT
TTACGTGCTGGAAAGCTTATGTTCTCAACGGATTCTCTGTCCATATCCCA
TCGGATCGTTGTTGGTAAAATCAGTGACTTGGCTAGGATACATTAACAGC
GCTTTGAATCCGTTTCTCTATGCATTTTATAATAAAGAATATGCAAGGAC
ATTTAAGAAAATTCTCAGCTGTAAAAAGTGTCTCAAATGAATTTATTGGA
GTAAAATCTGTATAATTTG
back to top

protein sequence of SMED30009809-orf-1

>SMED30009809-orf-1 ID=SMED30009809-orf-1|Name=SMED30009809-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=395bp
MFVFIHVLIIALLLITDIIIFCGNSLILIAVLTTRHLQTVTNFYVVSLAL
ADLLVSGTVLPLTIAKELHGKWVLGKHVCQFWVSMDILLCTASILNLCCI
SIDRYMAITKPLVYATKRSYKLAGCMILIAWILSVIISVPPVIGWSDHNF
TNTTCEISIHLGFRIYSSLGSFFIPLILMIFVYLRIFAIANYRKILLNSH
QSSRNIKSNKNSSNSLSYKSLDFQTSNPSSQQRRQALDLESNPKHAQALK
LNSYLCQRPIHRSCALQNLIYKSGNLQNFTNLSTGCAVLSSGLSQSQKGK
ETAAFLREHKTAKVIAMVIGCFVVCWLPFFTIYVLESLCSQRILCPYPIG
SLLVKSVTWLGYINSALNPFLYAFYNKEYARTFKKILSCKKCLK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0045202synapse
GO:0005887integral component of plasma membrane
GO:0016021integral component of membrane
GO:0016020membrane
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000074oocyte
PLANA:0000231vitelline gland
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR000995Musac_Ach_rcpt
IPR000276GPCR_Rhodpsn
IPR017452GPCR_Rhodpsn_7TM
IPR006665OmpA-like
Vocabulary: biological process
TermDefinition
GO:0007186G-protein coupled receptor signaling pathway
GO:0007165signal transduction
GO:0007213G-protein coupled acetylcholine receptor signaling pathway
Vocabulary: molecular function
TermDefinition
GO:0016907G-protein coupled acetylcholine receptor activity
GO:0004930G-protein coupled receptor activity
GO:0004871signal transducer activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000995Muscarinic acetylcholine receptor familyPRINTSPR00243MUSCARINICRcoord: 4..16
score: 37.46
coord: 375..389
score: 40.29
coord: 87..96
score: 30.87
coord: 106..120
score: 43.19
IPR000276G protein-coupled receptor, rhodopsin-likePRINTSPR00237GPCRRHODOPSNcoord: 311..335
score: 30.1
coord: 354..380
score: 31.03
coord: 164..187
score: 30.11
coord: 41..62
score: 39.31
coord: 8..32
score: 22.7
coord: 122..143
score: 27.58
coord: 86..108
score: 39.54
IPR000276G protein-coupled receptor, rhodopsin-likeSMARTSM013817TM_GPCR_Srsx_2coord: 18..387
e-value: 0.0039
score: -63.4
IPR000276G protein-coupled receptor, rhodopsin-likePFAMPF000017tm_1coord: 23..372
e-value: 7.2E-73
score: 245.1
IPR000276G protein-coupled receptor, rhodopsin-likePROSITEPS00237G_PROTEIN_RECEP_F1_1coord: 92..108
NoneNo IPR availableGENE3DG3DSA:1.20.1070.10coord: 13..386
e-value: 1.4E-105
score: 355.5
NoneNo IPR availableGENE3DG3DSA:1.20.120.10coord: 194..304
e-value: 1.4E-105
score: 355.5
NoneNo IPR availablePANTHERPTHR24247:SF134OCTOPAMINE RECEPTOR OAMBcoord: 7..391
NoneNo IPR availablePANTHERPTHR242475-HYDROXYTRYPTAMINE RECEPTORcoord: 7..391
NoneNo IPR availableCDDcd150617tmA_tyramine_R-likecoord: 8..383
e-value: 1.24632E-88
score: 266.534
NoneNo IPR availableSUPERFAMILYSSF81321Family A G protein-coupled receptor-likecoord: 4..393
NoneNo IPR availableTMHMMTMhelixcoord: 80..102
NoneNo IPR availableTMHMMTMhelixcoord: 314..336
NoneNo IPR availableTMHMMTMhelixcoord: 123..145
NoneNo IPR availableTMHMMTMhelixcoord: 43..65
NoneNo IPR availableTMHMMTMhelixcoord: 356..375
NoneNo IPR availableTMHMMTMhelixcoord: 10..32
NoneNo IPR availableTMHMMTMhelixcoord: 165..187
IPR017452GPCR, rhodopsin-like, 7TMPROSITEPS50262G_PROTEIN_RECEP_F1_2coord: 23..372
score: 45.588