Macrophage mannose receptor 1

Overview
NameMacrophage mannose receptor 1
Smed IDSMED30009805
Length (bp)740
Neoblast Clusters

Zeng et. al., 2018




 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30009805

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 13

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parapharyngeal regionSMED30009805h1SMcG0021533 SmedASXL_006580SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
parapharyngeal regionSMED30009805h1SMcG0021533 SmedASXL_061342SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neoblastSMED30009805h1SMcG0021533 dd_Smed_v4_3193_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30009805h1SMcG0021533 dd_Smed_v4_3193_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30009805h1SMcG0021533 dd_Smed_v6_3193_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
reproductive organSMED30009805h1SMcG0021533 Contig33177uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30009805h1SMcG0021533 Contig33177newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30009805h1SMcG0021533 Contig37615uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30009805h1SMcG0021533 Contig37615newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30009805h1SMcG0021533 Contig50688uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30009805h1SMcG0021533 Contig50688newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30009805h1SMcG0021533 Contig36065newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30009805h1SMcG0021533 Contig36065uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Macrophage mannose receptor 1 vs. Ensembl Human
Match: MRC2 (mannose receptor C type 2 [Source:HGNC Symbol;Acc:HGNC:16875])

HSP 1 Score: 67.781 bits (164), Expect = 2.563e-12
Identity = 60/223 (26.91%), Postives = 108/223 (48.43%), Query Frame = 3
Query:   96 FSGQKGTFQQAKELCQKSGYNVVRIDNDQFNVMIYNMAVKYKLGRYWIDGNDIQQDRNFVNSDGKRLTFSKFYPGEPNNYQNS-EHCLQGLFYPNGLWXXXXXXXXXXXXXSKDIQNTVSRFYEVTVSNKK--------LLIIPEKRTFVQAQALCHSKGLQLIKITDNNF-----NTQIYNLAVQYRIGRYWIDANDRQNEGNFVYTDGQKITFNKFAQGEP 722
               +K ++Q++K+ C + G ++V I +    +      +K ++   WI  ND++   NF  SDG  ++F+ ++P EPNN+++S E C+  ++ P G WND  CN     IC K  Q +     E     K           +  ++ T+ +A+ LC   G QL+ IT N F     ++ IYN   +Y    +W    D  + G+F +  G ++ +  + + +P
Sbjct:  396 LQAEKRSWQESKKACLRGGGDLVSI-HSMAELEFITKQIKQEVEELWIGLNDLKLQMNFEWSDGSLVSFTHWHPFEPNNFRDSLEDCVT-IWGPEGRWNDSPCNQSLPSICKKAGQLSQGAAEEDHGCRKGWTWHSPSCYWLGEDQVTYSEARRLCTDHGSQLVTIT-NRFEQAFVSSLIYNWEGEY----FWTALQDLNSTGSFFWLSGDEVMYTHWNRDQP 611          
BLAST of Macrophage mannose receptor 1 vs. Ensembl Human
Match: COLEC11 (collectin subfamily member 11 [Source:HGNC Symbol;Acc:HGNC:17213])

HSP 1 Score: 58.5362 bits (140), Expect = 1.294e-9
Identity = 34/99 (34.34%), Postives = 50/99 (50.51%), Query Frame = 3
Query:  435 IQNTVSRFYEVTVSNKKLLIIPEKRTFVQAQALCHSKGLQLIKITDNNFNTQIYNLAVQYRIGRYWIDANDRQNEGNFVYTDGQKI-TFNKFAQGEPNN 728
            I+N V+   E    +K  L++ E++ +  AQ  C  +G  L    D   N  +     Q  + R +I  ND + EG FVY+D   + TFNK+  GEPNN
Sbjct:  113 IKNAVAGVRET--ESKIYLLVKEEKRYADAQLSCQGRGGTLSMPKDEAANGLMAAYLAQAGLARVFIGINDLEKEGAFVYSDHSPMRTFNKWRSGEPNN 209          
BLAST of Macrophage mannose receptor 1 vs. Ensembl Human
Match: COLEC11 (collectin subfamily member 11 [Source:HGNC Symbol;Acc:HGNC:17213])

HSP 1 Score: 58.151 bits (139), Expect = 1.387e-9
Identity = 34/99 (34.34%), Postives = 50/99 (50.51%), Query Frame = 3
Query:  435 IQNTVSRFYEVTVSNKKLLIIPEKRTFVQAQALCHSKGLQLIKITDNNFNTQIYNLAVQYRIGRYWIDANDRQNEGNFVYTDGQKI-TFNKFAQGEPNN 728
            I+N V+   E    +K  L++ E++ +  AQ  C  +G  L    D   N  +     Q  + R +I  ND + EG FVY+D   + TFNK+  GEPNN
Sbjct:   89 IKNAVAGVRET--ESKIYLLVKEEKRYADAQLSCQGRGGTLSMPKDEAANGLMAAYLAQAGLARVFIGINDLEKEGAFVYSDHSPMRTFNKWRSGEPNN 185          
BLAST of Macrophage mannose receptor 1 vs. Ensembl Human
Match: COLEC11 (collectin subfamily member 11 [Source:HGNC Symbol;Acc:HGNC:17213])

HSP 1 Score: 58.151 bits (139), Expect = 1.400e-9
Identity = 34/99 (34.34%), Postives = 50/99 (50.51%), Query Frame = 3
Query:  435 IQNTVSRFYEVTVSNKKLLIIPEKRTFVQAQALCHSKGLQLIKITDNNFNTQIYNLAVQYRIGRYWIDANDRQNEGNFVYTDGQKI-TFNKFAQGEPNN 728
            I+N V+   E    +K  L++ E++ +  AQ  C  +G  L    D   N  +     Q  + R +I  ND + EG FVY+D   + TFNK+  GEPNN
Sbjct:   89 IKNAVAGVRET--ESKIYLLVKEEKRYADAQLSCQGRGGTLSMPKDEAANGLMAAYLAQAGLARVFIGINDLEKEGAFVYSDHSPMRTFNKWRSGEPNN 185          
BLAST of Macrophage mannose receptor 1 vs. Ensembl Human
Match: COLEC11 (collectin subfamily member 11 [Source:HGNC Symbol;Acc:HGNC:17213])

HSP 1 Score: 57.3806 bits (137), Expect = 1.751e-9
Identity = 35/101 (34.65%), Postives = 51/101 (50.50%), Query Frame = 3
Query:  429 KDIQNTVSRFYEVTVSNKKLLIIPEKRTFVQAQALCHSKGLQLIKITDNNFNTQIYNLAVQYRIGRYWIDANDRQNEGNFVYTDGQKI-TFNKFAQGEPNN 728
            K I+N V+   E    +K  L++ E++ +  AQ  C  +G  L    D   N  +     Q  + R +I  ND + EG FVY+D   + TFNK+  GEPNN
Sbjct:   63 KFIKNAVAGVRET--ESKIYLLVKEEKRYADAQLSCQGRGGTLSMPKDEAANGLMAAYLAQAGLARVFIGINDLEKEGAFVYSDHSPMRTFNKWRSGEPNN 161          
BLAST of Macrophage mannose receptor 1 vs. Ensembl Fly
Match: CG15358 (gene:FBgn0031373 transcript:FBtr0473589)

HSP 1 Score: 48.9062 bits (115), Expect = 1.309e-6
Identity = 24/64 (37.50%), Postives = 41/64 (64.06%), Query Frame = 3
Query:  207 AVKYKLGR---YWIDGNDIQQDRNF-VNSDGKRLTFSKFYPGEPNNYQNSEHC---LQGLFYPN 377
            A++ KL +   YW+D  D++++ +F +++ GKR  F K+  G+PNN+  ++HC   L GL Y N
Sbjct:  171 ALRAKLNKERHYWLDITDLEKEGDFRISASGKRPNFLKWRAGQPNNFSGNQHCVDLLDGLMYDN 234          
BLAST of Macrophage mannose receptor 1 vs. Ensembl Fly
Match: CG15358 (gene:FBgn0031373 transcript:FBtr0473590)

HSP 1 Score: 48.9062 bits (115), Expect = 1.309e-6
Identity = 24/64 (37.50%), Postives = 41/64 (64.06%), Query Frame = 3
Query:  207 AVKYKLGR---YWIDGNDIQQDRNF-VNSDGKRLTFSKFYPGEPNNYQNSEHC---LQGLFYPN 377
            A++ KL +   YW+D  D++++ +F +++ GKR  F K+  G+PNN+  ++HC   L GL Y N
Sbjct:  171 ALRAKLNKERHYWLDITDLEKEGDFRISASGKRPNFLKWRAGQPNNFSGNQHCVDLLDGLMYDN 234          
BLAST of Macrophage mannose receptor 1 vs. Ensembl Fly
Match: tfc (gene:FBgn0035199 transcript:FBtr0072661)

HSP 1 Score: 45.8246 bits (107), Expect = 8.766e-6
Identity = 24/80 (30.00%), Postives = 39/80 (48.75%), Query Frame = 3
Query:  504 KRTFVQAQALCHSKGLQLIKITDNNFNTQIYNLAVQYRIGR--YWIDANDRQNEGNFVY-TDGQKITFNKFAQGEPNNYQ 734
            K  + +A   C   G+ L  I+    N ++      + +G   +WI   D  +EGNF +   G+ ITF  +  GEPNN++
Sbjct:   69 KANWFKATQYCRYHGMHLASISSQEENDRLEKHIRDFGLGHEHFWISGTDLADEGNFFWMATGRPITFTNWNAGEPNNFR 148          
BLAST of Macrophage mannose receptor 1 vs. Ensembl Fly
Match: tfc (gene:FBgn0035199 transcript:FBtr0072660)

HSP 1 Score: 45.8246 bits (107), Expect = 8.766e-6
Identity = 24/80 (30.00%), Postives = 39/80 (48.75%), Query Frame = 3
Query:  504 KRTFVQAQALCHSKGLQLIKITDNNFNTQIYNLAVQYRIGR--YWIDANDRQNEGNFVY-TDGQKITFNKFAQGEPNNYQ 734
            K  + +A   C   G+ L  I+    N ++      + +G   +WI   D  +EGNF +   G+ ITF  +  GEPNN++
Sbjct:   69 KANWFKATQYCRYHGMHLASISSQEENDRLEKHIRDFGLGHEHFWISGTDLADEGNFFWMATGRPITFTNWNAGEPNNFR 148          
BLAST of Macrophage mannose receptor 1 vs. Ensembl Zebrafish
Match: colec11 (collectin sub-family member 11 [Source:NCBI gene;Acc:492459])

HSP 1 Score: 55.8398 bits (133), Expect = 6.458e-9
Identity = 30/99 (30.30%), Postives = 51/99 (51.52%), Query Frame = 3
Query:  435 IQNTVSRFYEVTVSNKKLLIIPEKRTFVQAQALCHSKGLQLIKITDNNFNTQIYNLAVQYRIGRYWIDANDRQNEGNFVYTDGQKI-TFNKFAQGEPNN 728
            I+N V+   E    +K  L++ E++ + +A+  C  +G  L    D   N  I        + R +I  ND + EG+FVY +   + TF+++ +GEPNN
Sbjct:  139 IKNAVAGIKET--DSKVYLLVKEEKRYREAEVFCQGRGGHLAMPKDAAANRAIAGYVTDAGLSRVYIGINDLEREGHFVYVERSPMTTFSRWREGEPNN 235          
BLAST of Macrophage mannose receptor 1 vs. Ensembl Zebrafish
Match: colec11 (collectin sub-family member 11 [Source:NCBI gene;Acc:492459])

HSP 1 Score: 55.8398 bits (133), Expect = 7.490e-9
Identity = 30/99 (30.30%), Postives = 51/99 (51.52%), Query Frame = 3
Query:  435 IQNTVSRFYEVTVSNKKLLIIPEKRTFVQAQALCHSKGLQLIKITDNNFNTQIYNLAVQYRIGRYWIDANDRQNEGNFVYTDGQKI-TFNKFAQGEPNN 728
            I+N V+   E    +K  L++ E++ + +A+  C  +G  L    D   N  I        + R +I  ND + EG+FVY +   + TF+++ +GEPNN
Sbjct:  150 IKNAVAGIKET--DSKVYLLVKEEKRYREAEVFCQGRGGHLAMPKDAAANRAIAGYVTDAGLSRVYIGINDLEREGHFVYVERSPMTTFSRWREGEPNN 246          
BLAST of Macrophage mannose receptor 1 vs. Ensembl Zebrafish
Match: zmp:0000000729 (zmp:0000000729 [Source:ZFIN;Acc:ZDB-GENE-130530-732])

HSP 1 Score: 53.1434 bits (126), Expect = 5.421e-8
Identity = 29/94 (30.85%), Postives = 51/94 (54.26%), Query Frame = 3
Query:  111 GTFQQAKELCQKSGYNVVRIDNDQFNVMIYNMAVKYKL--GRYWIDGNDIQQDRNFVNSDGKRLTFSKFYPGEPNNYQNSEHCLQGLFYPNGLW 386
            GTF    +LC+ S   +V   +   N  +  +A    L   + +I   D + +  FV+ +GK+LTF+K+ PG+P++YQ ++ C  G+   +G W
Sbjct:  145 GTFDNGIKLCESSSGTLVVPKSSAENQALVRVAASSGLINEKPYIGVTDKETEGQFVDIEGKQLTFTKWGPGQPDDYQGAQDC--GVIDVSGTW 236          
BLAST of Macrophage mannose receptor 1 vs. Ensembl Zebrafish
Match: hbl2 (hexose-binding lectin 2 [Source:ZFIN;Acc:ZDB-GENE-070912-286])

HSP 1 Score: 53.1434 bits (126), Expect = 5.686e-8
Identity = 29/94 (30.85%), Postives = 51/94 (54.26%), Query Frame = 3
Query:  111 GTFQQAKELCQKSGYNVVRIDNDQFNVMIYNMAVKYKL--GRYWIDGNDIQQDRNFVNSDGKRLTFSKFYPGEPNNYQNSEHCLQGLFYPNGLW 386
            GTF    +LC+ S   +V   +   N  +  +A    L   + +I   D + +  FV+ +GK+LTF+K+ PG+P++YQ ++ C  G+   +G W
Sbjct:  148 GTFDNGIKLCESSSGTLVVPKSSAENQALVRVAASSGLINEKPYIGVTDKETEGQFVDIEGKQLTFTKWGPGQPDDYQGAQDC--GVIDVSGTW 239          
BLAST of Macrophage mannose receptor 1 vs. Ensembl Zebrafish
Match: mrc2 (mannose receptor, C type 2 [Source:ZFIN;Acc:ZDB-GENE-090915-5])

HSP 1 Score: 51.2174 bits (121), Expect = 5.523e-7
Identity = 56/219 (25.57%), Postives = 94/219 (42.92%), Query Frame = 3
Query:   96 FSGQKGTFQQAKELCQKSGYNVVRIDN-DQFNVMIYNMAVKYKLGRYWIDGNDIQQDRNFVNSDGKRLTFSKFYPGEPNNYQN-SEHCLQGLFYPNGLWXXXXXXXXXXXXXSKDIQNTVSRFYEVTV-------SNKKLLIIPEKRTFVQAQALCHSKGLQLIKITDNNFNTQIYNLAVQYRI-GRYWIDANDRQNEGNFVYTDGQKITFNKFAQGEP 722
             +  K  ++ A   CQK   N+V I    +   +  +M  K  +   WI  +D     NF  +D   + F+ ++P EPNN++  +E C+  ++ P G WND  CN     IC K  Q    R  +          S     +  E  TF  A+ +C S    L  I +N F     +  V  R   ++W+  N+  + G F +  G ++T+  + + +P
Sbjct:  402 LNSDKLDWRSADRTCQKMEANLVSIHTLPELEYITKHM--KKDIEELWIGLHDTAMQMNFEWTDRTPVIFTYWHPFEPNNFREVNEDCVT-IWGPEGRWNDSPCNYSLPSICKKPAQKADDRIQDHGCKRGWKWHSPSCFKVGEESLTFKDAKEMCISNNATL-AIINNRFEQAFVSSLVFGRTDDQFWLGLNNENSSGTFGWITGDELTYTNWNRDQP 616          
BLAST of Macrophage mannose receptor 1 vs. Ensembl Xenopus
Match: ptpn11b (protein tyrosine phosphatase, non-receptor type 11, b [Source:Xenbase;Acc:XB-GENE-6054495])

HSP 1 Score: 60.8474 bits (146), Expect = 2.078e-10
Identity = 35/99 (35.35%), Postives = 54/99 (54.55%), Query Frame = 3
Query:  435 IQNTVSRFYEVTVSNKKLLIIPEKRTFVQAQALCHSKGLQLIKITDNNFNTQIYNLAVQYRIGRYWIDANDRQNEGNFVYTDGQKI-TFNKFAQGEPNN 728
            ++N V+   E     K  L++ E++ ++ AQ  C  +G  L    D   N+ I +   Q  + R +I  ND + EG+FVY+D   + TFNK+ QGEPNN
Sbjct:  139 VKNVVAGVRET--DTKIYLLVKEEKKYIDAQDYCQGRGGTLSMPKDETTNSLIASYINQAGLSRVFIGINDLEREGHFVYSDRSPMQTFNKWRQGEPNN 235          
BLAST of Macrophage mannose receptor 1 vs. Ensembl Xenopus
Match: ptpn11b (protein tyrosine phosphatase, non-receptor type 11, b [Source:Xenbase;Acc:XB-GENE-6054495])

HSP 1 Score: 59.3066 bits (142), Expect = 7.177e-10
Identity = 32/85 (37.65%), Postives = 48/85 (56.47%), Query Frame = 3
Query:  477 NKKLLIIPEKRTFVQAQALCHSKGLQLIKITDNNFNTQIYNLAVQYRIGRYWIDANDRQNEGNFVYTDGQKI-TFNKFAQGEPNN 728
             K  L++ E++ ++ AQ  C  +G  L    D   N+ I +   Q  + R +I  ND + EG+FVY+D   + TFNK+ QGEPNN
Sbjct:  154 TKIYLLVKEEKKYIDAQDYCQGRGGTLSMPKDETTNSLIASYINQAGLSRVFIGINDLEREGHFVYSDRSPMQTFNKWRQGEPNN 238          
BLAST of Macrophage mannose receptor 1 vs. Ensembl Xenopus
Match: ptpn11b (protein tyrosine phosphatase, non-receptor type 11, b [Source:Xenbase;Acc:XB-GENE-6054495])

HSP 1 Score: 59.3066 bits (142), Expect = 7.654e-10
Identity = 31/81 (38.27%), Postives = 47/81 (58.02%), Query Frame = 3
Query:  489 LIIPEKRTFVQAQALCHSKGLQLIKITDNNFNTQIYNLAVQYRIGRYWIDANDRQNEGNFVYTDGQKI-TFNKFAQGEPNN 728
            L++ E++ ++ AQ  C  +G  L    D   N+ I +   Q  + R +I  ND + EG+FVY+D   + TFNK+ QGEPNN
Sbjct:  176 LLVKEEKKYIDAQDYCQGRGGTLSMPKDETTNSLIASYINQAGLSRVFIGINDLEREGHFVYSDRSPMQTFNKWRQGEPNN 256          
BLAST of Macrophage mannose receptor 1 vs. Ensembl Xenopus
Match: mrc2 (mannose receptor C type 2 [Source:NCBI gene;Acc:100036697])

HSP 1 Score: 58.9214 bits (141), Expect = 2.030e-9
Identity = 52/217 (23.96%), Postives = 96/217 (44.24%), Query Frame = 3
Query:   99 SGQKGTFQQAKELCQKSGYNVVRIDNDQFNVMIYNMAVKYKLGRYWIDGNDIQQDRNFVNSDGKRLTFSKFYPGEPNNYQNS-EHCLQGLFYPNGLWXXXXXXXXXXXXXSKDIQNTVSRFYEVTVSNKK--------LLIIPEKRTFVQAQALCHSKGLQLIKITDNNFNTQIYNLAVQYRIGRYWIDANDRQNEGNFVYTDGQKITFNKFAQGEP 722
            + +K T+Q+A++ C +   N+V I +    +   +  +K  +   WI  ND++   NF  SDG  +TF+ ++P EPNN+++S E C+  ++ P G WND  CN     IC K          +     K           +  E  T+ +A   C  +   L  + +      + +L        YW    D  + G F + +G+++ +  + + +P
Sbjct:  387 NSEKKTWQEARKACVRVEANLVSI-HSMLELEFVSKQIKQDVEELWIGLNDLKHQMNFEWSDGSSVTFTSWHPFEPNNFRDSMEDCVT-IWGPEGRWNDSPCNQTLPSICKKPGNFNQGGKVDTHGCQKGWSWHSPSCYWLSDESVTYSEATKACSDRQAMLATVHNRFDQAYVNSLLYGSEGSYYWTALQDINDTGTFRWLEGEEVIYTHWNRDQP 601          
BLAST of Macrophage mannose receptor 1 vs. Ensembl Xenopus
Match: mrc2 (mannose receptor C type 2 [Source:NCBI gene;Acc:100036697])

HSP 1 Score: 58.9214 bits (141), Expect = 2.453e-9
Identity = 52/217 (23.96%), Postives = 96/217 (44.24%), Query Frame = 3
Query:   99 SGQKGTFQQAKELCQKSGYNVVRIDNDQFNVMIYNMAVKYKLGRYWIDGNDIQQDRNFVNSDGKRLTFSKFYPGEPNNYQNS-EHCLQGLFYPNGLWXXXXXXXXXXXXXSKDIQNTVSRFYEVTVSNKK--------LLIIPEKRTFVQAQALCHSKGLQLIKITDNNFNTQIYNLAVQYRIGRYWIDANDRQNEGNFVYTDGQKITFNKFAQGEP 722
            + +K T+Q+A++ C +   N+V I +    +   +  +K  +   WI  ND++   NF  SDG  +TF+ ++P EPNN+++S E C+  ++ P G WND  CN     IC K          +     K           +  E  T+ +A   C  +   L  + +      + +L        YW    D  + G F + +G+++ +  + + +P
Sbjct:  399 NSEKKTWQEARKACVRVEANLVSI-HSMLELEFVSKQIKQDVEELWIGLNDLKHQMNFEWSDGSSVTFTSWHPFEPNNFRDSMEDCVT-IWGPEGRWNDSPCNQTLPSICKKPGNFNQGGKVDTHGCQKGWSWHSPSCYWLSDESVTYSEATKACSDRQAMLATVHNRFDQAYVNSLLYGSEGSYYWTALQDINDTGTFRWLEGEEVIYTHWNRDQP 613          
BLAST of Macrophage mannose receptor 1 vs. Ensembl Mouse
Match: Mrc2 (mannose receptor, C type 2 [Source:MGI Symbol;Acc:MGI:107818])

HSP 1 Score: 60.8474 bits (146), Expect = 3.415e-10
Identity = 57/223 (25.56%), Postives = 105/223 (47.09%), Query Frame = 3
Query:   96 FSGQKGTFQQAKELCQKSGYNVVRIDNDQFNVMIYNMAVKYKLGRYWIDGNDIQQDRNFVNSDGKRLTFSKFYPGEPNNYQNS-EHCLQGLFYPNGLWXXXXXXXXXXXXXSKDIQNTVSRFYEVTVSNKK--------LLIIPEKRTFVQAQALCHSKGLQLIKITDNNF-----NTQIYNLAVQYRIGRYWIDANDRQNEGNFVYTDGQKITFNKFAQGEP 722
               +K ++Q++K  C + G +++ I +    +      +K ++   WI  ND++   NF  SDG  ++F+ ++P EPNN+++S E C+  ++ P G WND  CN     IC K  + +     E     K           +  ++  +  A+ LC   G QL+ IT N F     ++ IYN   +Y    +W    D  + G+F +  G ++ +  + + +P
Sbjct:  395 LQAEKRSWQESKRACLRGGGDLLSI-HSMAELEFITKQIKQEVEELWIGLNDLKLQMNFEWSDGSLVSFTHWHPFEPNNFRDSLEDCVT-IWGPEGRWNDSPCNQSLPSICKKAGRLSQGAAEEDHGCRKGWTWHSPSCYWLGEDQVIYSDARRLCTDHGSQLVTIT-NRFEQAFVSSLIYNWEGEY----FWTALQDLNSTGSFRWLSGDEVIYTHWNRDQP 610          
BLAST of Macrophage mannose receptor 1 vs. Ensembl Mouse
Match: Mrc2 (mannose receptor, C type 2 [Source:MGI Symbol;Acc:MGI:107818])

HSP 1 Score: 60.4622 bits (145), Expect = 4.338e-10
Identity = 57/223 (25.56%), Postives = 105/223 (47.09%), Query Frame = 3
Query:   96 FSGQKGTFQQAKELCQKSGYNVVRIDNDQFNVMIYNMAVKYKLGRYWIDGNDIQQDRNFVNSDGKRLTFSKFYPGEPNNYQNS-EHCLQGLFYPNGLWXXXXXXXXXXXXXSKDIQNTVSRFYEVTVSNKK--------LLIIPEKRTFVQAQALCHSKGLQLIKITDNNF-----NTQIYNLAVQYRIGRYWIDANDRQNEGNFVYTDGQKITFNKFAQGEP 722
               +K ++Q++K  C + G +++ I +    +      +K ++   WI  ND++   NF  SDG  ++F+ ++P EPNN+++S E C+  ++ P G WND  CN     IC K  + +     E     K           +  ++  +  A+ LC   G QL+ IT N F     ++ IYN   +Y    +W    D  + G+F +  G ++ +  + + +P
Sbjct:  395 LQAEKRSWQESKRACLRGGGDLLSI-HSMAELEFITKQIKQEVEELWIGLNDLKLQMNFEWSDGSLVSFTHWHPFEPNNFRDSLEDCVT-IWGPEGRWNDSPCNQSLPSICKKAGRLSQGAAEEDHGCRKGWTWHSPSCYWLGEDQVIYSDARRLCTDHGSQLVTIT-NRFEQAFVSSLIYNWEGEY----FWTALQDLNSTGSFRWLSGDEVIYTHWNRDQP 610          
BLAST of Macrophage mannose receptor 1 vs. Ensembl Mouse
Match: Colec11 (collectin sub-family member 11 [Source:MGI Symbol;Acc:MGI:1918943])

HSP 1 Score: 59.3066 bits (142), Expect = 5.842e-10
Identity = 34/99 (34.34%), Postives = 52/99 (52.53%), Query Frame = 3
Query:  435 IQNTVSRFYEVTVSNKKLLIIPEKRTFVQAQALCHSKGLQLIKITDNNFNTQIYNLAVQYRIGRYWIDANDRQNEGNFVYTDGQKI-TFNKFAQGEPNN 728
            I+N V+   E    +K  L++ E++ +  AQ  C ++G  L    D   N  + +   Q  + R +I  ND + EG FVY+D   + TFNK+  GEPNN
Sbjct:  140 IKNAVAGVRET--ESKIYLLVKEEKRYADAQLSCQARGGTLSMPKDEAANGLMASYLAQAGLARVFIGINDLEKEGAFVYSDRSPMQTFNKWRSGEPNN 236          
BLAST of Macrophage mannose receptor 1 vs. Ensembl Mouse
Match: Colec11 (collectin sub-family member 11 [Source:MGI Symbol;Acc:MGI:1918943])

HSP 1 Score: 56.9954 bits (136), Expect = 3.638e-9
Identity = 32/99 (32.32%), Postives = 50/99 (50.51%), Query Frame = 3
Query:  435 IQNTVSRFYEVTVSNKKLLIIPEKRTFVQAQALCHSKGLQLIKITDNNFNTQIYNLAVQYRIGRYWIDANDRQNEGNFVYTDGQKI-TFNKFAQGEPNN 728
            ++ T S+ Y         L++ E++ +  AQ  C ++G  L    D   N  + +   Q  + R +I  ND + EG FVY+D   + TFNK+  GEPNN
Sbjct:  153 VRETESKIY---------LLVKEEKRYADAQLSCQARGGTLSMPKDEAANGLMASYLAQAGLARVFIGINDLEKEGAFVYSDRSPMQTFNKWRSGEPNN 242          
BLAST of Macrophage mannose receptor 1 vs. UniProt/SwissProt
Match: sp|Q9UBG0|MRC2_HUMAN (C-type mannose receptor 2 OS=Homo sapiens OX=9606 GN=MRC2 PE=1 SV=2)

HSP 1 Score: 67.781 bits (164), Expect = 1.231e-11
Identity = 60/223 (26.91%), Postives = 108/223 (48.43%), Query Frame = 3
Query:   96 FSGQKGTFQQAKELCQKSGYNVVRIDNDQFNVMIYNMAVKYKLGRYWIDGNDIQQDRNFVNSDGKRLTFSKFYPGEPNNYQNS-EHCLQGLFYPNGLWXXXXXXXXXXXXXSKDIQNTVSRFYEVTVSNKK--------LLIIPEKRTFVQAQALCHSKGLQLIKITDNNF-----NTQIYNLAVQYRIGRYWIDANDRQNEGNFVYTDGQKITFNKFAQGEP 722
               +K ++Q++K+ C + G ++V I +    +      +K ++   WI  ND++   NF  SDG  ++F+ ++P EPNN+++S E C+  ++ P G WND  CN     IC K  Q +     E     K           +  ++ T+ +A+ LC   G QL+ IT N F     ++ IYN   +Y    +W    D  + G+F +  G ++ +  + + +P
Sbjct:  396 LQAEKRSWQESKKACLRGGGDLVSI-HSMAELEFITKQIKQEVEELWIGLNDLKLQMNFEWSDGSLVSFTHWHPFEPNNFRDSLEDCVT-IWGPEGRWNDSPCNQSLPSICKKAGQLSQGAAEEDHGCRKGWTWHSPSCYWLGEDQVTYSEARRLCTDHGSQLVTIT-NRFEQAFVSSLIYNWEGEY----FWTALQDLNSTGSFFWLSGDEVMYTHWNRDQP 611          
BLAST of Macrophage mannose receptor 1 vs. UniProt/SwissProt
Match: sp|Q2LK94|COL11_CHICK (Collectin-11 OS=Gallus gallus OX=9031 GN=COLEC11 PE=2 SV=1)

HSP 1 Score: 65.855 bits (159), Expect = 1.742e-11
Identity = 39/99 (39.39%), Postives = 55/99 (55.56%), Query Frame = 3
Query:  435 IQNTVSRFYEVTVSNKKLLIIPEKRTFVQAQALCHSKGLQLIKITDNNFNTQIYNLAVQYRIGRYWIDANDRQNEGNFVYTDGQKI-TFNKFAQGEPNN 728
            I+N V+   E    NK  L++ E++ + +AQ  CH +G  L    D N N  I +   Q  + R +I  ND + EGNFVY+D   + TFNK+  GEPNN
Sbjct:  139 IKNAVAGVRET--DNKIYLLVKEEKRYKEAQLYCHGRGGTLSMPKDENANNLIASYINQAGLTRVFIGINDLEKEGNFVYSDRSPMQTFNKWRSGEPNN 235          
BLAST of Macrophage mannose receptor 1 vs. UniProt/SwissProt
Match: sp|Q4TU93|MRC2_RAT (C-type mannose receptor 2 OS=Rattus norvegicus OX=10116 GN=Mrc2 PE=1 SV=1)

HSP 1 Score: 61.6178 bits (148), Expect = 1.408e-9
Identity = 56/228 (24.56%), Postives = 103/228 (45.18%), Query Frame = 3
Query:   96 FSGQKGTFQQAKELCQKSGYNVVRIDNDQFNVMIYNMAVKYKLGRYWIDGNDIQQDRNFVNSDGKRLTFSKFYPGEPNNYQNS-EHCLQGLFYPNGLWXXXXXXXXXXXXXSKDIQNTVSRFYEVTV-------------SNKKLLIIPEKRTFVQAQALCHSKGLQLIKITDNNF-----NTQIYNLAVQYRIGRYWIDANDRQNEGNFVYTDGQKITFNKFAQGEP 722
               +K ++Q++K  C + G +++ I +    +      +K ++   WI  ND++   NF  SDG  ++F+ ++P EPNN+++S E C+  ++ P G WND  CN          I     R  + T              S     +  ++  +  A+ LC   G QL+ IT N F     ++ IYN   +Y    +W    D  + G+F +  G ++ +  + + +P
Sbjct:  395 LQAEKRSWQESKRACLRGGGDLLSI-HSMTELEFITKQIKQEVEELWIGLNDLKLQMNFEWSDGSLVSFTHWHPFEPNNFRDSLEDCVT-IWGPEGRWNDSPCNQSL-----PSICKKAGRLSQGTAEEDHGCRKGWTWHSPSCYWLGEDQVIYSDARRLCTDHGSQLVTIT-NRFEQAFVSSLIYNWEGEY----FWTALQDLNSTGSFRWLSGDEVMYTHWNRDQP 610          
BLAST of Macrophage mannose receptor 1 vs. UniProt/SwissProt
Match: sp|Q64449|MRC2_MOUSE (C-type mannose receptor 2 OS=Mus musculus OX=10090 GN=Mrc2 PE=1 SV=3)

HSP 1 Score: 60.8474 bits (146), Expect = 2.389e-9
Identity = 57/223 (25.56%), Postives = 105/223 (47.09%), Query Frame = 3
Query:   96 FSGQKGTFQQAKELCQKSGYNVVRIDNDQFNVMIYNMAVKYKLGRYWIDGNDIQQDRNFVNSDGKRLTFSKFYPGEPNNYQNS-EHCLQGLFYPNGLWXXXXXXXXXXXXXSKDIQNTVSRFYEVTVSNKK--------LLIIPEKRTFVQAQALCHSKGLQLIKITDNNF-----NTQIYNLAVQYRIGRYWIDANDRQNEGNFVYTDGQKITFNKFAQGEP 722
               +K ++Q++K  C + G +++ I +    +      +K ++   WI  ND++   NF  SDG  ++F+ ++P EPNN+++S E C+  ++ P G WND  CN     IC K  + +     E     K           +  ++  +  A+ LC   G QL+ IT N F     ++ IYN   +Y    +W    D  + G+F +  G ++ +  + + +P
Sbjct:  395 LQAEKRSWQESKRACLRGGGDLLSI-HSMAELEFITKQIKQEVEELWIGLNDLKLQMNFEWSDGSLVSFTHWHPFEPNNFRDSLEDCVT-IWGPEGRWNDSPCNQSLPSICKKAGRLSQGAAEEDHGCRKGWTWHSPSCYWLGEDQVIYSDARRLCTDHGSQLVTIT-NRFEQAFVSSLIYNWEGEY----FWTALQDLNSTGSFRWLSGDEVIYTHWNRDQP 610          
BLAST of Macrophage mannose receptor 1 vs. UniProt/SwissProt
Match: sp|Q3SXB8|COL11_MOUSE (Collectin-11 OS=Mus musculus OX=10090 GN=Colec11 PE=2 SV=2)

HSP 1 Score: 59.6918 bits (143), Expect = 2.437e-9
Identity = 34/99 (34.34%), Postives = 52/99 (52.53%), Query Frame = 3
Query:  435 IQNTVSRFYEVTVSNKKLLIIPEKRTFVQAQALCHSKGLQLIKITDNNFNTQIYNLAVQYRIGRYWIDANDRQNEGNFVYTDGQKI-TFNKFAQGEPNN 728
            I+N V+   E    +K  L++ E++ +  AQ  C ++G  L    D   N  + +   Q  + R +I  ND + EG FVY+D   + TFNK+  GEPNN
Sbjct:  140 IKNAVAGLRET--ESKIYLLVKEEKRYADAQLSCQARGGTLSMPKDEAANGLMASYLAQAGLARVFIGINDLEKEGAFVYSDRSPMQTFNKWRSGEPNN 236          
BLAST of Macrophage mannose receptor 1 vs. TrEMBL
Match: Q8WSX2 (Lectin 1 (Fragment) OS=Girardia tigrina OX=6162 GN=lec1 PE=2 SV=1)

HSP 1 Score: 160.999 bits (406), Expect = 2.634e-41
Identity = 80/214 (37.38%), Postives = 135/214 (63.08%), Query Frame = 3
Query:  108 KGTFQQAKELCQKSGYNVVRIDNDQFNVMIYNMAVKYKLGRYWIDGNDIQQDRNFVNSDGKRLTFSKFYPGEPNNYQNSEHCLQGLFYPNGLWXX--XXXXXXXXXXXSKDIQNTVSRFYEVTVSNKKLL-----IIPEKRTFVQAQALCHSKGLQLIKITDNNFNTQIYNLAVQYRIGRYWIDANDRQNEGNFVYTDGQKITFNKFAQGEPNN 728
            K TF  A + C+    ++VRI N+  N++++N+A K  LGRYWI+GND +++  +V ++ + LT+  +  GEPNN+  S+HC+ G+++PNG W+D   +  +      +K   +  +  YE T S  K++     +   K+TF  A   C S+ + L++IT+ + N  +YNLAV+Y+IGRYWI+ ND++ EG +VYT+ +++T+  +  GEPNN
Sbjct:  153 KMTFDDAVKYCKDRKMDLVRIPNNSVNMIVFNLAAKNNLGRYWINGNDREKEGTWVYTNNRELTYKNWQAGEPNNWGGSQHCILGVYFPNGFWDDFNCDTKNAVICEIAKGDTDDANEEYEETDSTGKVVKRNYRVSNAKKTFDDAVKYCKSQPMDLVRITNADNNEFVYNLAVKYKIGRYWINGNDKEKEGTWVYTNNKELTYKNWQSGEPNN 366          

HSP 2 Score: 159.458 bits (402), Expect = 9.493e-41
Identity = 91/225 (40.44%), Postives = 137/225 (60.89%), Query Frame = 3
Query:   75 ILGKDVVFSGQKGTFQQAKELCQKSGYNVVRIDNDQFNVMIYNMAVKYKLGRYWIDGNDIQQDRNFVNSDGKRLTFSKFYPGEPNNYQNSEHCLQGLFYPNGLWXXXXXXXXXXXXXS--KDIQNTVSRFYEVTVSNKKLL-----IIPEKRTFVQAQALCHSKGLQLIKITDNNFNTQIYNLAVQYRIGRYWIDANDRQNEGNFVYTDGQKITFNKFAQGEPNN 728
            ++ ++   S  K TF  A + C+    ++VRI N   N  +YN+AVKYK+GRYWI+GND +++  +V ++ K LT+  +  GEPNN   S+HC+ G +YPNG W+D NC+  N ++C   K   +  +  YE T S  K++     +   K TF  A   C    + L+KIT+ N N  +YNLAV+Y+IGRYWI+ NDR  EG +V T+ +++T+  +  GEPNN
Sbjct:  281 VVKRNYRVSNAKKTFDDAVKYCKSQPMDLVRITNADNNEFVYNLAVKYKIGRYWINGNDKEKEGTWVYTNNKELTYKNWQSGEPNNSGGSQHCIVGAYYPNGFWDDFNCDTKNRVVCELVKGDTDDSNEEYEETDSTGKVVKRNYRVNNAKMTFDDAVKYCKDNQMDLVKITNANNNGFVYNLAVKYKIGRYWINGNDRAKEGTWVDTNNKELTYKNWQSGEPNN 505          

HSP 3 Score: 151.754 bits (382), Expect = 4.966e-38
Identity = 80/226 (35.40%), Postives = 127/226 (56.19%), Query Frame = 3
Query:  108 KGTFQQAKELCQKSGYNVVRIDNDQFNVMIYNMAVKYKLGRYWIDGNDIQQDRNFVNSDGKRLTFSKFYPGEPNNYQNSEHCLQGLFYPNGLWX---------------XXXXXXXXXXXXSKDIQNTVSRFYEVTVSNKKLLI----IPEKRTFVQAQALCHSKGLQLIKITDNNFNTQIYNLAVQYRIGRYWIDANDRQNEGNFVYTDGQKITFNKFAQGEPNN 728
            K TF  A + C+ +  ++V+I N   N  +YN+AVKYK+GRYWI+GND  ++  +V+++ K LT+  +  GEPNN   S+HC+ G +YPNG W+                           +  +    +  YE   +N K++     +   +TF  A   C  K + L++IT+ + N  +YNLAV+Y+IGRYWI+ NDR+ EG +V T+ +++T+  +  GEPNN
Sbjct:  431 KMTFDDAVKYCKDNQMDLVKITNANNNGFVYNLAVKYKIGRYWINGNDRAKEGTWVDTNNKELTYKNWQSGEPNNSGGSQHCIVGAYYPNGFWDDFNCDTKNAVICELVKGGSGTDEDNGDNGKVTEDSNEEYEEKDNNGKVVKRNYRVSNAKTFDDAVKYCKDKQMDLVRITNADNNKFVYNLAVKYKIGRYWINGNDREKEGTWVDTNNKELTYKNWQSGEPNN 656          

HSP 4 Score: 145.976 bits (367), Expect = 4.568e-36
Identity = 73/210 (34.76%), Postives = 123/210 (58.57%), Query Frame = 3
Query:  108 KGTFQQAKELCQKSGYNVVRIDNDQFNVMIYNMAVKYKLGRYWIDGNDIQQDRNFVNSDGKRLTFSKFYPGEPNNYQNSEHCLQGLFYPNGLWXX--XXXXXXXXXXXSKDIQNTVSRFYEVTVSNKKLLIIPEKRTFVQAQALCHSKGLQLIKITDNNFNTQIYNLAVQYRIGRYWIDANDRQNEGNFVYTDGQKITFNKFAQGEPNNY 731
            K T   A + C+    ++VRI N   N++++N+A K  LGRYWI+GND +++  +V ++ + LT+  +  GEPNN+  S+HC+ G ++PNG W+D   +  +       KD  N  +  Y +  +         K TF  A   C  + + L++I +N+ N  ++NLA +  +GRYWI+ NDR+ EG +VYT+ +++T+  +  GEPNN+
Sbjct:   28 KMTSNDAAKYCKDRKMDLVRIPNKDVNMIVFNLAAKNNLGRYWINGNDREKEGTWVYTNNRELTYKNWQAGEPNNWGGSQHCILGAYFPNGFWDDFNCDTKNSVICEVPKDTDNDNNEGYHMGNT---------KMTFDDAVKYCKDRKMDLVRIPNNSVNMIVFNLAAKNNLGRYWINGNDREKEGTWVYTNNRELTYKNWQAGEPNNW 228          

HSP 5 Score: 138.272 bits (347), Expect = 1.986e-33
Identity = 73/219 (33.33%), Postives = 121/219 (55.25%), Query Frame = 3
Query:  114 TFQQAKELCQKSGYNVVRIDNDQFNVMIYNMAVKYKLGRYWIDGNDIQQDRNFVNSDGKRLTFSKFYPGEPNNYQNSEHCLQGLFYPNGLWXX--------------XXXXXXXXXXXSKDIQNTVSRFYEVTVSNKKLLIIPEKRTFVQAQALCHSKGLQLIKITDNNFNTQIYNLAVQYRIGRYWIDANDRQNEGNFVYTDGQKITFNKFAQGEPNN 728
            TF  A + C+    ++VRI N   N  +YN+AVKYK+GRYWI+GND +++  +V+++ K LT+  +  GEPNN   S+HC+ G +YPNG W+D                     +   + D  N + +  E  V +    I   K  F  A   C  K + +++I++   NT ++ L+ +Y +G+YWI+ NDR  +G +V T+ +++ +  + +GEPNN
Sbjct:  584 TFDDAVKYCKDKQMDLVRITNADNNKFVYNLAVKYKIGRYWINGNDREKEGTWVDTNNKELTYKNWQSGEPNNSGGSQHCIVGAYYPNGFWDDFNCDTKNRVICELVRGDTGTASGKGTDDSNNVIFKDNEGKVISINYQINNAKMNFDDAVKYCKDKQMDVVRISNAEINTFVFKLSEKYGLGKYWINGNDRAVDGTWVDTNNKELPYKNWQKGEPNN 802          

HSP 6 Score: 81.6481 bits (200), Expect = 6.896e-14
Identity = 36/93 (38.71%), Postives = 56/93 (60.22%), Query Frame = 3
Query:  108 KGTFQQAKELCQKSGYNVVRIDNDQFNVMIYNMAVKYKLGRYWIDGNDIQQDRNFVNSDGKRLTFSKFYPGEPNNYQNSEHCLQGLFYPNGLW 386
            K  F  A + C+    +VVRI N + N  ++ ++ KY LG+YWI+GND   D  +V+++ K L +  +  GEPNN    +HC+QG +Y +G W
Sbjct:  728 KMNFDDAVKYCKDKQMDVVRISNAEINTFVFKLSEKYGLGKYWINGNDRAVDGTWVDTNNKELPYKNWQKGEPNNGGGVQHCIQGGYYSDGFW 820          

HSP 7 Score: 73.9442 bits (180), Expect = 2.615e-11
Identity = 34/97 (35.05%), Postives = 56/97 (57.73%), Query Frame = 3
Query:   96 FSGQKGTFQQAKELCQKSGYNVVRIDNDQFNVMIYNMAVKYKLGRYWIDGNDIQQDRNFVNSDGKRLTFSKFYPGEPNNYQNSEHCLQGLFYPNGLW 386
             +  K  F  A + C+    ++V+I N++ N +++  A KY L  YW++GND  ++  +V++D   LT+  +  GEPNN   ++HCLQG    NG W
Sbjct:  918 LTNAKMNFDDAVKYCKDKQMDLVKIPNEEVNAVVFKKAAKYNLETYWLNGNDRSKEGTWVDTDNNVLTYKNWSTGEPNNNGGNKHCLQGSNNLNGYW 1014          

HSP 8 Score: 62.003 bits (149), Expect = 2.732e-7
Identity = 29/94 (30.85%), Postives = 48/94 (51.06%), Query Frame = 3
Query:  447 VSRFYEVTVSNKKLLIIPEKRTFVQAQALCHSKGLQLIKITDNNFNTQIYNLAVQYRIGRYWIDANDRQNEGNFVYTDGQKITFNKFAQGEPNN 728
            +++  E  V +    +   K  F  A   C  K + L+KI +   N  ++  A +Y +  YW++ NDR  EG +V TD   +T+  ++ GEPNN
Sbjct:  903 ITKESETKVVSTSYHLTNAKMNFDDAVKYCKDKQMDLVKIPNEEVNAVVFKKAAKYNLETYWLNGNDRSKEGTWVDTDNNVLTYKNWSTGEPNN 996          
BLAST of Macrophage mannose receptor 1 vs. TrEMBL
Match: Q8WSW7 (Scarf3b OS=Girardia tigrina OX=6162 GN=scarf3b PE=2 SV=1)

HSP 1 Score: 128.257 bits (321), Expect = 3.808e-31
Identity = 64/211 (30.33%), Postives = 116/211 (54.98%), Query Frame = 3
Query:  108 KGTFQQAKELCQKSGYNVVRIDNDQFNVMIYNMAVKYKLGRYWIDGNDIQQDRNFVNSDGKRLTFSKFYPGEPNNYQNSEHCLQGLFYPNGLWXXXXXXXXXXXXXSKDIQNTVSRFYEVTVSNKKLLIIPEKRTFVQAQALCHSKGLQLIKITDNNFNTQIYNLAVQYRIGRYWIDANDRQNEGNFVYTDGQKITFNKFAQGEPNNYQKN 740
            K T+  A + C     ++V+I N + N+ +YN+A+K+ LG YW++GNDI  +  +V+++ K L +  +Y GEPNN+  +++CL   ++PN +W           I    + + +    E      K      K T+  A   C+ + + L+KI ++  N  +YNLA+++ +G YW++ ND   EG +V T+ + + +  + +GEPNN+  N
Sbjct:  146 KMTYNDAVKYCNDRNMDLVKIPNSEVNMNVYNLALKHNLGTYWMNGNDIAIEGTWVDTENKPLVYKNWYKGEPNNWGGNQNCLVVAYHPNEMW---------FDIGCNTLNSVICEVVEENCHTNK-----NKMTYNDAVKYCNDRNMDLVKIPNSEVNVNVYNLALKHNLGTYWMNGNDIAIEGTWVDTENKPLVYKNWYKGEPNNWGGN 342          

HSP 2 Score: 117.472 bits (293), Expect = 3.595e-27
Identity = 64/213 (30.05%), Postives = 113/213 (53.05%), Query Frame = 3
Query:  108 KGTFQQAKELCQKSGYNVVRIDNDQFNVMIYNMAVKYKLGRYWIDGNDIQQDRNFVNSDGKRLTFSKFYPGEPNNYQNSEHCLQGLFYPNGLWXXXXXXXXXXXXXSKDI-QNTV-SRFYEVTVSNKKLLIIPEKRTFVQAQALCHSKGLQLIKITDNNFNTQIYNLAVQYRIGRYWIDANDRQNEGNFVYTDGQKITFNKFAQGEPNNYQKN 740
            K  +  A + C      +V+I + Q N  ++ +A K  +G YW++GNDI  +  +V+++ K L +  +Y GEPNN+   ++CL   ++PN +W               DI  NT+ S   E+ + N        K T+  A   C+ + + L+KI ++  N  +YNLA+++ +G YW++ ND   EG +V T+ + + +  + +GEPNN+  N
Sbjct:   28 KMNYNDAVKYCNSKEMRLVKITDSQTNAAVFELASKNGMGTYWMNGNDIAIEGTWVDTENKPLVYKNWYKGEPNNWGGDQNCLVAAYHPNEMWF--------------DIGCNTLNSVICEIVIENYH--TNKNKMTYNDAVKYCNDRNMDLVKIPNSEVNMNVYNLALKHNLGTYWMNGNDIAIEGTWVDTENKPLVYKNWYKGEPNNWGGN 224          

HSP 3 Score: 85.1149 bits (209), Expect = 2.347e-15
Identity = 35/93 (37.63%), Postives = 61/93 (65.59%), Query Frame = 3
Query:  108 KGTFQQAKELCQKSGYNVVRIDNDQFNVMIYNMAVKYKLGRYWIDGNDIQQDRNFVNSDGKRLTFSKFYPGEPNNYQNSEHCLQGLFYPNGLW 386
            K T+  A + C     ++V+I N + NV +YN+A+K+ LG YW++GNDI  +  +V+++ K L +  +Y GEPNN+  +++CL   ++PN +W
Sbjct:  264 KMTYNDAVKYCNDRNMDLVKIPNSEVNVNVYNLALKHNLGTYWMNGNDIAIEGTWVDTENKPLVYKNWYKGEPNNWGGNQNCLVAAYHPNEMW 356          
BLAST of Macrophage mannose receptor 1 vs. TrEMBL
Match: Q8WSW8 (Scarf3a OS=Girardia tigrina OX=6162 GN=scarf3a PE=2 SV=1)

HSP 1 Score: 124.02 bits (310), Expect = 1.118e-29
Identity = 67/213 (31.46%), Postives = 117/213 (54.93%), Query Frame = 3
Query:  108 KGTFQQAKELCQKSGYNVVRIDNDQFNVMIYNMAVKYKLGRYWIDGNDIQQDRNFVNSDGKRLTFSKFYPGEPNNYQNSEHCLQGLFYPNGLWXXXXXXXXXXXXXSKDI-QNTV-SRFYEVTVSNKKLLIIPEKRTFVQAQALCHSKGLQLIKITDNNFNTQIYNLAVQYRIGRYWIDANDRQNEGNFVYTDGQKITFNKFAQGEPNNYQKN 740
            K T+  A + C     ++V+I N + N+ +YN+A+K+ LG YW++GNDI     +V+++ K L +  +Y GEPNN+  +++CL   ++PN +W               DI  NT+ S   E+ + N        K T+  A   C+ + + L+KI ++  N  +Y LA+++ +G YW++ ND   EG +V T+ + + +  +  GEPNN+  N
Sbjct:  146 KMTYNDAVKYCNDRNMDLVKIPNSEVNLNVYNLALKHNLGTYWMNGNDIAIKGTWVDTENKPLVYKNWYKGEPNNWGGNQNCLVAAYHPNEMWF--------------DIGCNTLNSVICEIVIENYH--TNKNKMTYNDAVKYCNDRNMDLVKIPNSEVNLNVYYLALKHNLGTYWMNGNDIAIEGTWVDTENKPLVYKNWYTGEPNNWGGN 342          

HSP 2 Score: 113.62 bits (283), Expect = 9.577e-26
Identity = 62/213 (29.11%), Postives = 112/213 (52.58%), Query Frame = 3
Query:  108 KGTFQQAKELCQKSGYNVVRIDNDQFNVMIYNMAVKYKLGRYWIDGNDIQQDRNFVNSDGKRLTFSKFYPGEPNNYQNSEHCLQGLFYPNGLWXXXXXXXXXXXXXSKDI-QNTV-SRFYEVTVSNKKLLIIPEKRTFVQAQALCHSKGLQLIKITDNNFNTQIYNLAVQYRIGRYWIDANDRQNEGNFVYTDGQKITFNKFAQGEPNNYQKN 740
            K  +  A + C      +V+I + Q    ++ +A K  +G YW++GNDI  +  +V+++ K L +  +Y GEPNN+   ++CL   ++PN +W               DI  NT+ S   E+ + N        K T+  A   C+ + + L+KI ++  N  +YNLA+++ +G YW++ ND   +G +V T+ + + +  + +GEPNN+  N
Sbjct:   28 KMNYSDAVKYCNSKEMRLVKITDSQTGAAVFELASKNGMGTYWMNGNDIAIEGTWVDTENKPLVYKNWYKGEPNNWGGDQNCLVAAYHPNEMWF--------------DIGCNTLNSVICEIVIENYH--TNKNKMTYNDAVKYCNDRNMDLVKIPNSEVNLNVYNLALKHNLGTYWMNGNDIAIKGTWVDTENKPLVYKNWYKGEPNNWGGN 224          

HSP 3 Score: 80.8777 bits (198), Expect = 6.699e-14
Identity = 33/93 (35.48%), Postives = 60/93 (64.52%), Query Frame = 3
Query:  108 KGTFQQAKELCQKSGYNVVRIDNDQFNVMIYNMAVKYKLGRYWIDGNDIQQDRNFVNSDGKRLTFSKFYPGEPNNYQNSEHCLQGLFYPNGLW 386
            K T+  A + C     ++V+I N + N+ +Y +A+K+ LG YW++GNDI  +  +V+++ K L +  +Y GEPNN+  +++CL   ++PN +W
Sbjct:  264 KMTYNDAVKYCNDRNMDLVKIPNSEVNLNVYYLALKHNLGTYWMNGNDIAIEGTWVDTENKPLVYKNWYTGEPNNWGGNQNCLVAAYHPNEMW 356          
BLAST of Macrophage mannose receptor 1 vs. TrEMBL
Match: Q8WTP3 (Scarf2 OS=Girardia tigrina OX=6162 GN=scarf2 PE=4 SV=1)

HSP 1 Score: 116.701 bits (291), Expect = 7.155e-28
Identity = 64/213 (30.05%), Postives = 113/213 (53.05%), Query Frame = 3
Query:  108 KGTFQQAKELCQKSGYNVVRIDNDQFNVMIYNMAVKYKLGRYWIDGNDIQQDRNFVNSDGKRLTFSKFYPGEPNNYQNSEHCLQGLFYPNGLWXXXXXXXXXXXXXSKDI-QNTV-SRFYEVTVSNKKLLIIPEKRTFVQAQALCHSKGLQLIKITDNNFNTQIYNLAVQYRIGRYWIDANDRQNEGNFVYTDGQKITFNKFAQGEPNNYQKN 740
            K  +  A + C      +V+I + Q N  ++ +A K  +G YW++GNDI  +  +V+++ K L +  +Y GEPNN+  +++CL   ++PN +W               DI  NT+ S   E+ + N        K T+  A   C+ + + L+KI ++  N  +YNLA+++ +G YW++ ND   EG +V T+ + + +  +  GEPNN+  N
Sbjct:   28 KMNYNDAVKYCNSKEIRLVKITDSQTNAAVFELASKNGMGTYWMNGNDIAIEGTWVDTENKPLVYKNWYKGEPNNWGGNQNCLVAAYHPNEMWF--------------DIGCNTLNSVICEIVIENYH--TNKNKMTYNDAVKYCNDRNMGLVKIPNSEVNVNVYNLALKHNLGTYWMNGNDIAIEGTWVNTENKPLVYKNWYTGEPNNWGGN 224          

HSP 2 Score: 86.2705 bits (212), Expect = 2.354e-16
Identity = 36/93 (38.71%), Postives = 60/93 (64.52%), Query Frame = 3
Query:  108 KGTFQQAKELCQKSGYNVVRIDNDQFNVMIYNMAVKYKLGRYWIDGNDIQQDRNFVNSDGKRLTFSKFYPGEPNNYQNSEHCLQGLFYPNGLW 386
            K T+  A + C      +V+I N + NV +YN+A+K+ LG YW++GNDI  +  +VN++ K L +  +Y GEPNN+  +++CL   ++PN +W
Sbjct:  146 KMTYNDAVKYCNDRNMGLVKIPNSEVNVNVYNLALKHNLGTYWMNGNDIAIEGTWVNTENKPLVYKNWYTGEPNNWGGNQNCLVAAYHPNEMW 238          
BLAST of Macrophage mannose receptor 1 vs. TrEMBL
Match: Q24696 (C-type lectin-like protein OS=Girardia tigrina OX=6162 GN=scarf PE=2 SV=3)

HSP 1 Score: 114.005 bits (284), Expect = 7.951e-27
Identity = 63/213 (29.58%), Postives = 112/213 (52.58%), Query Frame = 3
Query:  108 KGTFQQAKELCQKSGYNVVRIDNDQFNVMIYNMAVKYKLGRYWIDGNDIQQDRNFVNSDGKRLTFSKFYPGEPNNYQNSEHCLQGLFYPNGLWXXXXXXXXXXXXXSKDIQ-NTV-SRFYEVTVSNKKLLIIPEKRTFVQAQALCHSKGLQLIKITDNNFNTQIYNLAVQYRIGRYWIDANDRQNEGNFVYTDGQKITFNKFAQGEPNNYQKN 740
            K  +  A + C      +V+I + Q N  ++ +A K  +G YW++GNDI  +  +V+++ K L +  +Y GEPNN+  +++CL   ++PN +W               DI  NT+ S   E+ + N        K T+  A   C+ + + L+KI ++  N  +YNLA+++ +G YW++ ND    G +V T+ + + +  +  GEPNN+  N
Sbjct:   28 KMNYNDAVKYCNSKEIRLVKITDSQTNAAVFELASKNGMGTYWMNGNDIAIEGTWVDTENKPLVYKNWYKGEPNNWGGNQNCLVAAYHPNEMWF--------------DIGCNTLNSVICEIVIENYH--TNKNKMTYNDAVKYCNDRNMGLVKIPNSEVNVNVYNLALKHNLGTYWMNGNDIAIGGTWVNTENKPLVYKNWYTGEPNNWGGN 224          

HSP 2 Score: 85.1149 bits (209), Expect = 6.278e-16
Identity = 36/93 (38.71%), Postives = 59/93 (63.44%), Query Frame = 3
Query:  108 KGTFQQAKELCQKSGYNVVRIDNDQFNVMIYNMAVKYKLGRYWIDGNDIQQDRNFVNSDGKRLTFSKFYPGEPNNYQNSEHCLQGLFYPNGLW 386
            K T+  A + C      +V+I N + NV +YN+A+K+ LG YW++GNDI     +VN++ K L +  +Y GEPNN+  +++CL   ++PN +W
Sbjct:  146 KMTYNDAVKYCNDRNMGLVKIPNSEVNVNVYNLALKHNLGTYWMNGNDIAIGGTWVNTENKPLVYKNWYTGEPNNWGGNQNCLVAAYHPNEMW 238          
BLAST of Macrophage mannose receptor 1 vs. Ensembl Cavefish
Match: mrc1b (mannose receptor, C type 1b [Source:ZFIN;Acc:ZDB-GENE-070705-13])

HSP 1 Score: 56.9954 bits (136), Expect = 5.997e-9
Identity = 57/228 (25.00%), Postives = 104/228 (45.61%), Query Frame = 3
Query:   81 GKDVVFSGQKGTFQQAKELCQKSGYNVVRIDN-DQFNVMIYNMAVKYKLGRYWIDGNDIQQDRNFVNSDGKRLTFSKFYPGEP-NNYQNSEHCLQGLFYPNGLWXXXXXXXXXXXXXSK--------DIQNTVSRFYEVTVSNKKLLIIPEKRTFVQAQALCHSKGLQLIKITDNNFNTQIYNLAVQYRIGRYWIDANDRQNEGNFVYTDGQKITFNKFAQGEPNNYQ 734
            G   + S  K T+ +A++ C++ G +++ I N ++ +  I  +    K    WI  ND++ +  F  SD  R+ +  +   EP NN    E C+  +    G W D  C +    IC K        +I N V +   V   N   L    ++TF +A+ +C + G  L  +T++  N  + +L        +WI  ++++++  F +T+ +K+ F  F  G P   Q
Sbjct:  448 GHCYLLSRTKRTWLEARDSCRREGGDLLSILNIEELSFTITQLGYA-KTDELWIGFNDLKTNMLFEWSDHSRVPYVLWDVNEPSNNVAIKEDCVM-MRGEEGKWADQICQNKYGYICKKKAQSESDTNITNPVCKPGWVRYGNYCYLTGSGRQTFEEAKQMCENAGSYLADVTNSVENAFLVSLIGAQPEKHFWIGLSNQEDQSTFEWTNTKKVPFTHFNHGMPGGKQ 673          
BLAST of Macrophage mannose receptor 1 vs. Ensembl Cavefish
Match: ENSAMXT00000053854.1 (pep primary_assembly:Astyanax_mexicanus-2.0:16:24939255:24949357:1 gene:ENSAMXG00000040947.1 transcript:ENSAMXT00000053854.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 55.0694 bits (131), Expect = 1.249e-8
Identity = 49/208 (23.56%), Postives = 95/208 (45.67%), Query Frame = 3
Query:  117 FQQAKELCQKSGYNVVRIDNDQFNVMIYNMAVKYKLG-RYWIDGNDIQQDRNFVNSDGKRLTFSKFYPGEPNNYQNSEHCLQGLFYPNGLWXXXXXXXXXXXXXSKDIQNTVSRFYEVTVSNKKLLIIPEKRTFVQAQALCHSKGLQLIKITDNNFNTQIYNLA--VQYRIGRYWIDANDRQNEGNFVYTDGQKITFNKFAQGEPNNY 731
            +  ++E C   G ++  + + + +  I N+ +        WI G+D  Q+  +V +DG   +++ +  GEP+NY   E+C++  ++  G WND+ C  +   +C+K  Q+   +F      +    +      F  ++  C S G  L  +  N  N  I +L           WI A D    G +V+TDG    ++ ++ G+P+ +
Sbjct:    9 WPASEENCVAMGGHLASVHSSEEHTFIVNLVLNASSSDSAWIGGSDTAQEGAWVWTDGSAFSYTYWNKGEPSNYGQWENCMEINYH--GKWNDLYCKLVLPSVCAK-CQDGWLQF-----KSHCFKVFTTNENFKTSEENCVSAGGHLASMHSNADNVFIKDLVWNTTNSNAVTWIGARDAGQLGKWVWTDGSAFDYSIWSNGQPDKH 208          
BLAST of Macrophage mannose receptor 1 vs. Ensembl Cavefish
Match: acana (aggrecan core protein-like [Source:NCBI gene;Acc:103021642])

HSP 1 Score: 55.0694 bits (131), Expect = 2.455e-8
Identity = 29/95 (30.53%), Postives = 53/95 (55.79%), Query Frame = 3
Query:  105 QKGTFQQAKELCQKSGYNVVRIDNDQFNVMIYNMAVKYKLGRYWIDGNDIQQDRNFVNSDGKRLTFSKFYPGEPNNYQNS-EHCLQGLFYPNGLW 386
            ++ T+++A++ C+  G ++V I N +    + + A  Y+    WI  ND   + +F  SDG  L +  + P +P+NY NS E C+  +++ NG W
Sbjct: 1314 ERQTWEEAEQHCRSLGAHLVSITNREEQFFVNSHAQDYQ----WIGLNDKTFENDFQWSDGTPLQYENWRPNQPDNYFNSGEDCVVMIWHENGQW 1404          
BLAST of Macrophage mannose receptor 1 vs. Ensembl Cavefish
Match: acana (aggrecan core protein-like [Source:NCBI gene;Acc:103021642])

HSP 1 Score: 55.0694 bits (131), Expect = 2.461e-8
Identity = 29/95 (30.53%), Postives = 53/95 (55.79%), Query Frame = 3
Query:  105 QKGTFQQAKELCQKSGYNVVRIDNDQFNVMIYNMAVKYKLGRYWIDGNDIQQDRNFVNSDGKRLTFSKFYPGEPNNYQNS-EHCLQGLFYPNGLW 386
            ++ T+++A++ C+  G ++V I N +    + + A  Y+    WI  ND   + +F  SDG  L +  + P +P+NY NS E C+  +++ NG W
Sbjct: 1352 ERQTWEEAEQHCRSLGAHLVSITNREEQFFVNSHAQDYQ----WIGLNDKTFENDFQWSDGTPLQYENWRPNQPDNYFNSGEDCVVMIWHENGQW 1442          
BLAST of Macrophage mannose receptor 1 vs. Ensembl Cavefish
Match: colec11 (collectin subfamily member 11 [Source:NCBI gene;Acc:103038988])

HSP 1 Score: 51.9878 bits (123), Expect = 1.230e-7
Identity = 27/85 (31.76%), Postives = 45/85 (52.94%), Query Frame = 3
Query:  477 NKKLLIIPEKRTFVQAQALCHSKGLQLIKITDNNFNTQIYNLAVQYRIGRYWIDANDRQNEGNFVYTDGQKI-TFNKFAQGEPNN 728
            +K  L++ E++ +  A+  C  +G  L    D   N  I     +  + R +I  ND + EG+FVY +   + TF+K+ +GEPNN
Sbjct:  157 SKVYLLVKEEKRYRDAELYCQGRGGHLAMPKDVAANRAIAGYITEAGLSRVYIGINDLEREGHFVYVERSPMSTFSKWREGEPNN 241          
BLAST of Macrophage mannose receptor 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005222.1 (pep scaffold:Pmarinus_7.0:GL492592:1201:2726:-1 gene:ENSPMAG00000004753.1 transcript:ENSPMAT00000005222.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 47.7506 bits (112), Expect = 1.683e-7
Identity = 26/54 (48.15%), Postives = 32/54 (59.26%), Query Frame = 3
Query:  228 RYWIDGNDIQQDRNFVNSDGKRL-TFSKFYPGEPNNYQNSEHCLQGLFYPNGLW 386
            R +I  NDIQ + NFV SDG RL  +  F  GEPN++   E C+    YPNG W
Sbjct:   70 RAFIGLNDIQHENNFVFSDGSRLGLYRNFALGEPNSFGGDEDCVN--IYPNGKW 121          
BLAST of Macrophage mannose receptor 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003237.1 (pep scaffold:Pmarinus_7.0:GL486820:4307:11265:1 gene:ENSPMAG00000002956.1 transcript:ENSPMAT00000003237.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 48.9062 bits (115), Expect = 1.699e-7
Identity = 23/79 (29.11%), Postives = 42/79 (53.16%), Query Frame = 3
Query:  495 IPEKRTFVQAQALCHSKGLQLIKITDNNFNTQIYNLAVQYRIGRYWIDANDRQNEGNFVYTDGQKITFNKFAQGEPNNY 731
            + E+  + +A+  C S G  L  I   + N  I  L   Y+    WI  NDR +EG+F ++DG +++F  +   +P+++
Sbjct:   17 VAERLPWAEAEEACRSVGGHLASIASRDENNFILALGSDYQ----WIGLNDRFSEGDFHWSDGSQLSFEHWRPQQPDSF 91          
BLAST of Macrophage mannose receptor 1 vs. Ensembl Nematostella
Match: EDO49509 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGD7])

HSP 1 Score: 65.0846 bits (157), Expect = 4.148e-12
Identity = 59/235 (25.11%), Postives = 95/235 (40.43%), Query Frame = 3
Query:  114 TFQQAKELCQKSGYNVVRIDNDQFNVMIYNMAVKYKLGRYWIDGNDIQQDRNFVNSDGKRLTFSKFYPGEPNNYQNSEHCLQGLFYPNGLWXXXXXXXXXXXXXSKDIQNTVSRFYEVTVSNKKLLIIP------------------------EKRTFVQAQALCHSKGLQLIKI---TDNNFNTQIYNLAVQYRIGRYWIDANDRQNEGNFVYT-DGQKITFNKFAQGEPNNYQ 734
            +++ A   CQ  G  +  I +      I    ++Y+  R+WI  ND   + NF   DG   +F  +  GEPNN+QN E C + + +  G W        N  +CS        R        +  ++ P                         ++T+  A+A CH  G  L+K+   T+ NF +       Q      WI A D   EG+FV+  DG  + +  + +GEPN++ 
Sbjct:   51 SWEDADIDCQSYGGRLTSILDRNEQSFITRSTIRYRNERFWIGFNDRGSEGNFSWVDGSNSSFKNWRKGEPNNWQN-EDCAEAV-WNTGQW--------NDELCSNTYGYICKRLASAPWPTQGTMVPPTTQSPIVCDFGWEFFGTSCYKFNTARKTWSMAKADCHGAGGYLVKVDDATEQNFLSYRSRTISQ----SMWIGATDEAAEGHFVWEGDGTVVNYTNWFRGEPNDHS 271          

HSP 2 Score: 61.2326 bits (147), Expect = 7.259e-11
Identity = 63/244 (25.82%), Postives = 106/244 (43.44%), Query Frame = 3
Query:   81 GKDVVFSG----QKGTFQQAKELCQKSGYNVVRIDNDQFNVMIYN-MAVKYKLGRYWIDGNDIQQDRNFVNSDGKRLTFSKFYPGEPNNYQNSEHCLQGLFYPNGLWXXXXXXXXXXXXXSKDIQNTVSRFYEVTVSNKKLL-----------------IIPEKRTFVQAQALC-----HSKGLQLIKITDNNFNTQIYNLAVQYRI-GRYWIDANDRQNEGNFVYTDGQKITFNKFAQGEPNN 728
            G   +FSG     + T+Q A+  CQ++G  ++ I +   N  +Y+    KY+    WI  ND+  +  +  SDG  L+++ +   EPN++Q  E CL+ + + NG WND  CN  N  IC K   N+V      + +    L                 +  E++ +  A+  C      S    L+ I +      I ++ + Y    R+WI  ND   EG F + D   + +  +   +P N
Sbjct: 1354 GMCYLFSGDDLVSRQTWQDARAACQQAGAELISIQSAAENAFVYSGFRAKYRSWTIWIGLNDLDDESVYEWSDGSPLSYTNYNWKEPNDWQGQEDCLEMVRW-NGKWNDNQCNRKNPYICKKQ-NNSVPIISTPSPTPGPALGRCNSGWLHYDKSCYKFVATERQNWANARLRCDRGTNSSMYGDLVTIDNQYEQAFISSMMLSYTSKPRFWIGMNDIHTEGAFYWADNSPVRYTNWNTRQPMN 1595          

HSP 3 Score: 56.9954 bits (136), Expect = 2.239e-9
Identity = 55/218 (25.23%), Postives = 95/218 (43.58%), Query Frame = 3
Query:   96 FSGQKGTFQQAKELCQKSGYNVVRIDN-DQFNVMIYNMAVKYKLGRYWIDGNDIQQDRNFV-NSDGKRLTFSKFYPGEPNNYQNSEHCLQGLF-YPNGLWXXXXXXXXXXXXXSKDIQNTVSRFYEVTVSNKKLLI---IPEKRTFVQAQALCH-SKGLQLIKITDNNFNTQIYNLAVQYRIGRYWIDANDRQNEGNFVYTDGQKITFNKFAQGEPNN 728
            F+  + T+  AK  C  +G  +V++D+  + N + Y      +    WI   D   + +FV   DG  + ++ ++ GEPN++   E C++ +  Y  G WND  C      IC K     +     VT+ +          +K T+ QAQ  C  + G  L  +   +    I +    +     WI  ND   EG FV++D  K+ +  ++  EP +
Sbjct:  191 FNTARKTWSMAKADCHGAGGYLVKVDDATEQNFLSYRSRTISQ--SMWIGATDEAAEGHFVWEGDGTVVNYTNWFRGEPNDHSGKEDCVEMMAGYFAGYWNDNFCEQFRNFICEKPFGENLCPVNWVTIGDSCFEFNTHPAQKLTWSQAQDSCRLNSGADLASVRTIDEQNAILSQLTDFGARNVWIGFNDIATEGVFVWSDRTKVDYTNWSPREPGS 406          

HSP 4 Score: 48.1358 bits (113), Expect = 1.964e-6
Identity = 23/79 (29.11%), Postives = 41/79 (51.90%), Query Frame = 3
Query:  501 EKRTFVQAQALCHSKGLQLIKITDNNFNTQIYN-LAVQYRIGRYWIDANDRQNEGNFVYTDGQKITFNKFAQGEPNNYQ 734
             ++T+  A+A C   G +LI I     N  +Y+    +YR    WI  ND  +E  + ++DG  +++  +   EPN++Q
Sbjct: 1366 SRQTWQDARAACQQAGAELISIQSAAENAFVYSGFRAKYRSWTIWIGLNDLDDESVYEWSDGSPLSYTNYNWKEPNDWQ 1444          
BLAST of Macrophage mannose receptor 1 vs. Ensembl Nematostella
Match: EDO49512 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGE1])

HSP 1 Score: 63.1586 bits (152), Expect = 2.023e-11
Identity = 55/220 (25.00%), Postives = 99/220 (45.00%), Query Frame = 3
Query:  114 TFQQAKELCQKSGYNVVRIDNDQFNVMIYNMAVKYKLGRYWIDGNDIQQDRNFVNSDGKRLTF-SKFYPGEPNNYQNSEHCLQGLFYPNGLWXXXXXXXXXXXXXSKDIQNTVS----------RFYEVTVSNKKLLIIPEKRTFVQAQALCHSKGLQLIKITDNNFNTQIYNLAVQYRIGRYWIDANDRQNEGNFVYT-DGQKI--TFNKFAQGEPNNY 731
            +++ A+ LCQ  G ++  I +      I     +Y    +W+  ND   + ++  +DG    F + +  GEPNN+Q++E C + L Y +GLW + +          K ++  +S            Y+ + S+K  LI         AQ  CH  G  L+K+ +++    +  +         WI  NDR  EG +V+  D  K+   ++ +  GEPN++
Sbjct:   50 SWENAENLCQSYGGHLASISDQSEQNFITGRIKQYTNEHFWVGFNDRANESSYNWTDGTAKPFYTNWRRGEPNNFQDNEDCTE-LLYQDGLW-NDDDCSKEYSFICKTLKAPLSCDAGWSQYGASCYKFSTSSKTWLI---------AQQDCHQSGGYLVKVDNSDEQHFLSYMMKTVMKQAAWIGLNDRAIEGTYVWEGDNTKLGQNYSHWYSGEPNDH 258          

HSP 2 Score: 50.8322 bits (120), Expect = 2.367e-7
Identity = 28/79 (35.44%), Postives = 43/79 (54.43%), Query Frame = 3
Query:  507 RTFVQAQALCHSKGLQLIKITDNNFNTQIYNLAVQYRIGRYWIDANDRQNEGNFVYTDG-QKITFNKFAQGEPNNYQKN 740
            +++  A+ LC S G  L  I+D +    I     QY    +W+  NDR NE ++ +TDG  K  +  + +GEPNN+Q N
Sbjct:   49 QSWENAENLCQSYGGHLASISDQSEQNFITGRIKQYTNEHFWVGFNDRANESSYNWTDGTAKPFYTNWRRGEPNNFQDN 127          
BLAST of Macrophage mannose receptor 1 vs. Ensembl Nematostella
Match: EDO36778 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SHQ8])

HSP 1 Score: 51.6026 bits (122), Expect = 5.964e-9
Identity = 25/73 (34.25%), Postives = 40/73 (54.79%), Query Frame = 3
Query:  510 TFVQAQALCHSKGLQLIKITDNNFNTQIYNLAVQYRIGRYWIDANDRQNEGNFVYTDGQKITFNKFAQGEPNN 728
            T+ +AQ  C S+G  L+ I D+  N  +  +   Y++   WI  NDR  EG + ++DG ++ F  +  GEP N
Sbjct:   24 TWSRAQQTCESEGGNLVSIHDSTQNLLVRKIKPDYKL--MWIRLNDRDAEGQYKWSDGSEVGFTPWDFGEPVN 94          

HSP 2 Score: 43.1282 bits (100), Expect = 6.998e-6
Identity = 25/83 (30.12%), Postives = 41/83 (49.40%), Query Frame = 3
Query:   99 SGQKGTFQQAKELCQKSGYNVVRIDNDQFNVMIYNMAVKYKLGRYWIDGNDIQQDRNFVNSDGKRLTFSKFYPGEPNNYQNSE 347
            S    T+ +A++ C+  G N+V I +   N+++  +   YKL   WI  ND   +  +  SDG  + F+ +  GEP N    E
Sbjct:   19 SSSMATWSRAQQTCESEGGNLVSIHDSTQNLLVRKIKPDYKL--MWIRLNDRDAEGQYKWSDGSEVGFTPWDFGEPVNVTGLE 99          
BLAST of Macrophage mannose receptor 1 vs. Ensembl Nematostella
Match: EDO31268 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SYE1])

HSP 1 Score: 45.0542 bits (105), Expect = 3.309e-6
Identity = 26/101 (25.74%), Postives = 50/101 (49.50%), Query Frame = 3
Query:   63 NGATILGKDVVFSGQKGTFQQAKELCQKSGYNVVRIDNDQFNVMIYNMAVKYKLGRYWIDGNDIQQDRNFVNSDGKRLTFSKFYPGEPNNYQNSEHCLQGL 365
            NG   L  +   S     ++Q++  C   G  +V + N + N+ I     ++  G+ W+  +D+  +  FV +DG    F+ + P +PN+Y+N + C+  L
Sbjct:    9 NGYCYLTSNTCLS-----WKQSESACAVLGSGLVSVHNHEENIFIQQ---QHNGGKSWVGLSDVTTEGRFVWADGSPTNFTNWAPNQPNDYKNQD-CVHTL 100          
BLAST of Macrophage mannose receptor 1 vs. Ensembl Nematostella
Match: EDO44638 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RVH3])

HSP 1 Score: 43.8986 bits (102), Expect = 6.941e-6
Identity = 25/91 (27.47%), Postives = 48/91 (52.75%), Query Frame = 3
Query:   90 VVFSGQKGTFQQAKELCQKSGYNVVRI-DNDQFNVMIYNMAVKYKLGRYWIDGNDIQQDRNFVNSDGKRLTFSKFYPGEPNNYQ-NSEHCL 356
            ++ +  K ++ +A+ELC++ G  +  I D ++F  +  +        +Y+I        + ++  DG +  F K+  GEPNNYQ N+E C+
Sbjct:   15 IIAANNKQSWYKAQELCEQDGAMLAYIEDEEEFQFLRRSRPPGSSTNQYFIGLRSANDSKTWLWPDGTKAKFFKWAKGEPNNYQGNTEDCV 105          
BLAST of Macrophage mannose receptor 1 vs. Ensembl Medaka
Match: ENSORLT00000003250.2 (ladderlectin [Source:NCBI gene;Acc:101164187])

HSP 1 Score: 57.7658 bits (138), Expect = 5.676e-10
Identity = 33/108 (30.56%), Postives = 52/108 (48.15%), Query Frame = 3
Query:   72 TILGKDVVFSGQKGTFQQAKELCQKSGYNVVRIDNDQFNVMIYNMAVKYKLGRY---WIDGNDIQQDRNFVNSDGKRLTFSKFYPGEPNNYQNSEHCLQGLFYPNGLW 386
             + G+   +     T+ QA+  C+  G N+  + N   N  +  + +K K GR+   WI G+D Q +  +  SDG    ++ + P EPNNY   +HCLQ  F     W
Sbjct:   52 VMRGRRFRYFSSPKTWAQAESFCRSIGANLASVRNRFENYKLLRL-IKKKQGRFTPTWIGGSDAQTNGVWFWSDGSNYQYTNWCPNEPNNYHGRQHCLQMNFSYRRCW 158          

HSP 2 Score: 46.2098 bits (108), Expect = 5.173e-6
Identity = 24/95 (25.26%), Postives = 45/95 (47.37%), Query Frame = 3
Query:  459 YEVTVSNKKLLIIPEKRTFVQAQALCHSKGLQLIKITDNNFNTQIYNLAVQYRIGRY---WIDANDRQNEGNFVYTDGQKITFNKFAQGEPNNYQ 734
            Y   +  ++       +T+ QA++ C S G  L  + +   N ++  L ++ + GR+   WI  +D Q  G + ++DG    +  +   EPNNY 
Sbjct:   49 YWTVMRGRRFRYFSSPKTWAQAESFCRSIGANLASVRNRFENYKLLRL-IKKKQGRFTPTWIGGSDAQTNGVWFWSDGSNYQYTNWCPNEPNNYH 142          
BLAST of Macrophage mannose receptor 1 vs. Ensembl Medaka
Match: ENSORLT00000003252.2 (ladderlectin-like [Source:NCBI gene;Acc:110013319])

HSP 1 Score: 57.3806 bits (137), Expect = 7.839e-10
Identity = 33/100 (33.00%), Postives = 54/100 (54.00%), Query Frame = 3
Query:   96 FSGQKGTFQQAKELCQKSGYNVVRIDNDQFNVMIYNMAVKYKLGRY---WIDGNDIQQDRNFVNSDGKRLTFSKFYPGEPNNYQNSEHCLQGLFYPNGLW 386
            FS  K T+ +A++ CQ  G N+  + N   N ++ ++ +K K G Y   WI G+D Q +  +  SDG +  ++ + P EPNN +  +HCLQ  +     W
Sbjct:   61 FSSPK-TWAEAEKFCQSIGANLASVRNRLENSILLSL-IKQKQGCYTPTWIGGSDAQTNGVWFWSDGSKYQYTNWCPKEPNNGRGQQHCLQMSYTKKRCW 158          
BLAST of Macrophage mannose receptor 1 vs. Ensembl Medaka
Match: ENSORLT00000003236.2 (ladderlectin-like [Source:NCBI gene;Acc:110013319])

HSP 1 Score: 51.2174 bits (121), Expect = 1.210e-7
Identity = 29/99 (29.29%), Postives = 50/99 (50.51%), Query Frame = 3
Query:   96 FSGQKGTFQQAKELCQKSGYNVVRIDNDQFNVMIYNMAVKYKLG--RYWIDGNDIQQDRNFVNSDGKRLTFSKFYPGEPNNYQNSEHCLQGLFYPNGLW 386
            FS  K T+ +A+  C+  G N+  + N   N  + ++  + K      WI G+D Q++  +  SDG +  ++ + P EPNN +  +HCLQ  +     W
Sbjct:   61 FSSPK-TWDEAENFCRSIGANLASVKNSLENTKLLSLINQQKANYTPTWIGGSDAQKNGVWFWSDGSKYQYTNWCPKEPNNGRGQQHCLQMSYTKKRCW 158          
BLAST of Macrophage mannose receptor 1 vs. Ensembl Medaka
Match: colec11 (collectin subfamily member 11 [Source:NCBI gene;Acc:101154823])

HSP 1 Score: 51.6026 bits (122), Expect = 1.544e-7
Identity = 29/99 (29.29%), Postives = 49/99 (49.49%), Query Frame = 3
Query:  435 IQNTVSRFYEVTVSNKKLLIIPEKRTFVQAQALCHSKGLQLIKITDNNFNTQIYNLAVQYRIGRYWIDANDRQNEGNFVYTDGQKIT-FNKFAQGEPNN 728
            I+N V+   E    +K  L++ E++ +  A+  C ++G  L    D   N  I     +  + R +I  +D   EG F Y D   +T F+++ +GEPNN
Sbjct:  141 IKNAVAGIKET--DSKVYLLVKEEKPYSDAKVSCQARGGHLAMPKDEGANQVIAGYITEASLSRVYIGIHDLDREGIFTYVDRSPMTTFSRWRKGEPNN 237          
BLAST of Macrophage mannose receptor 1 vs. Ensembl Medaka
Match: mrc1a (mannose receptor C-type 1 [Source:NCBI gene;Acc:101161518])

HSP 1 Score: 51.9878 bits (123), Expect = 2.936e-7
Identity = 54/221 (24.43%), Postives = 99/221 (44.80%), Query Frame = 3
Query:  108 KGTFQQAKELCQKSGYNVVRIDNDQFNVMIYNMAVKYKLGRYWIDGNDIQQDRNFVNSDGKRLTFSKFYPGEPNNYQNSEHCLQGLFYPNGLWXXXXXXXXXXXXXSKDIQNTVSRFYEVTVSNKKLL-----------IIPEKRTFVQAQALCHSKGLQLIKITDNNFNTQIYNLAVQYRIGRY-WIDANDRQNEGNFVYTDGQKITFNKFAQGEPNNYQ 734
            K  ++ A   C+K G ++  I + +    + +     +    WI  ND +    F  SD  ++TF+++  GEP++  N +     +   +G W D  C  ++  IC K    T+S   +  V+    L           I  E +TF +A+  C + G  L+ I +   N  + +L V  R  +Y W   ++ +++  F +T  +K+TF  F  G+P+  Q
Sbjct:  377 KKMWRDALAACRKDGGDLASIHSIEEQSFVISQTGYSQTDMLWIGFNDQRNQLLFEWSDHSQVTFTQWDTGEPSHIINHQEDCVLIRGKDGKWADHTCEKMHGYICKKKASTTMSEGNQEEVNPGCKLGSFRFGSFCYNIGSETKTFEEAKQACANSGGNLLDIANRYENAFLVSL-VGLRPEKYFWTGFSNTEDKTIFKWTTNRKVTFTHFNAGQPDRLQ 596          

HSP 2 Score: 49.2914 bits (116), Expect = 1.905e-6
Identity = 53/227 (23.35%), Postives = 94/227 (41.41%), Query Frame = 3
Query:   96 FSGQKGTFQQAKELCQKSGYNVVRIDNDQFNVMIYNMAVKYKLGRYWIDGNDIQQDRNFVNSDGKRLTFSKFYPGEPNNYQNSEHCLQGLF----------YPNGLWXXXXXXXXXXXXXSKDIQN-------TVSRFYEVTVSNKKLLIIPEKRTFVQAQALCHSKGLQLIKITDNNFNTQIY-NLAVQYRIGRYWIDANDRQNEGNFVYTDGQKITFNKFAQGEP 722
            F G    ++ A+E C   G N+V I N+     +      Y    +WI  ND+  + +FV +DGK ++++ +  G P +  +  + +   F             G W   +C      IC K++ +       T   FY++   + KL++  +K  + +A+  C +    L  I   N  TQ Y  L +       WI  N+    G F + D   + + K+ + EP
Sbjct:  946 FLGNNKNWRDAREFCTNEGGNLVSILNENEQAFLTIQMFHYN-EDFWIGMNDVNWEMHFVWTDGKGISYTNWAKGHPVSSPDGRYMMDEAFDCVIMTGNPAKLKGNWKVEDCGAKRGFICKKNVDSQIVPPPTTPQNFYKLGNDSYKLIV--QKMRWDEARRQCQADDADLASIL--NPVTQAYMTLQMSSHNEPVWIGLNNNVTGGRFKWVDNWSLFYTKWGKDEP 1167          
BLAST of Macrophage mannose receptor 1 vs. Planmine SMEST
Match: SMESG000078340.1 (SMESG000078340.1)

HSP 1 Score: 434.491 bits (1116), Expect = 3.281e-142
Identity = 226/226 (100.00%), Postives = 226/226 (100.00%), Query Frame = 3
Query:   63 NGATILGKDVVFSGQKGTFQQAKELCQKSGYNVVRIDNDQFNVMIYNMAVKYKLGRYWIDGNDIQQDRNFVNSDGKRLTFSKFYPGEPNNYQNSEHCLQGLFYPNGLWXXXXXXXXXXXXXSKDIQNTVSRFYEVTVSNKKLLIIPEKRTFVQAQALCHSKGLQLIKITDNNFNTQIYNLAVQYRIGRYWIDANDRQNEGNFVYTDGQKITFNKFAQGEPNNYQKN 740
            NGATILGKDVVFSGQKGTFQQAKELCQKSGYNVVRIDNDQFNVMIYNMAVKYKLGRYWIDGNDIQQDRNFVNSDGKRLTFSKFYPGEPNNYQNSEHCLQGLFYPNGLWNDINCNDINAIICSKDIQNTVSRFYEVTVSNKKLLIIPEKRTFVQAQALCHSKGLQLIKITDNNFNTQIYNLAVQYRIGRYWIDANDRQNEGNFVYTDGQKITFNKFAQGEPNNYQKN
Sbjct:   20 NGATILGKDVVFSGQKGTFQQAKELCQKSGYNVVRIDNDQFNVMIYNMAVKYKLGRYWIDGNDIQQDRNFVNSDGKRLTFSKFYPGEPNNYQNSEHCLQGLFYPNGLWNDINCNDINAIICSKDIQNTVSRFYEVTVSNKKLLIIPEKRTFVQAQALCHSKGLQLIKITDNNFNTQIYNLAVQYRIGRYWIDANDRQNEGNFVYTDGQKITFNKFAQGEPNNYQKN 245          

HSP 2 Score: 229.95 bits (585), Expect = 9.272e-69
Identity = 114/222 (51.35%), Postives = 161/222 (72.52%), Query Frame = 3
Query:   69 ATILGKDVVFSGQKGTFQQAKELCQKSGYNVVRIDNDQFNVMIYNMAVKYKLGRYWIDGNDIQQDRNFVNSDGKRLTFSKFYPGEPNNYQNSEHCLQGLFYPNGLWXXXXXXXXXXXXXSKDIQNTVSRFYEVTVSNKKLLIIPEKRTFVQAQALCHSKGLQLIKITDNNFNTQIYNLAVQYRIGRYWIDANDRQNEGNFVYTDGQKITFNKFAQGEPNNYQ 734
             T+  K ++   +K TF QA+ LC   G  +++I ++ FN  IYN+AV+Y++GRYWID ND Q + NFV +DG+++TF+KF  GEPNNYQ +EHC+ GL+YPN LWND +C D +A+IC K+ +  +S   E+ + +K ++I  EK TF +A  LC +KG  LIKI D+ FNTQ+YNLA+QY  GR+WIDAND + EG F Y +GQ+I ++KFA+GEPNNY+
Sbjct:  154 VTVSNKKLLIIPEKRTFVQAQALCHSKGLQLIKITDNNFNTQIYNLAVQYRIGRYWIDANDRQNEGNFVYTDGQKITFNKFAQGEPNNYQKNEHCVHGLYYPNALWNDFSCEDPSAVICYKETEPKISA--EIELQSKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYR 373          

HSP 3 Score: 225.713 bits (574), Expect = 2.333e-67
Identity = 117/220 (53.18%), Postives = 161/220 (73.18%), Query Frame = 3
Query:   81 GKDVVFSGQKGTFQQAKELCQKSGYNVVRIDNDQFNVMIYNMAVKYKLGRYWIDGNDIQQDRNFVNSDGKRLTFSKFYPGEPNNYQNSEHCLQGLFYPNGLWXXXXXXXXXXXXXSKDIQNTVSRFYEVTVSNKKLLIIPEKRTFVQAQALCHSKGLQLIKITDNNFNTQIYNLAVQYRIGRYWIDANDRQNEGNFVYTDGQKITFNKFAQGEPNNYQKN 740
             K V+   +K TF +A +LCQ  GYN+++I++DQFN  +YN+A++Y  GR+WID NDI+ +  F   +G+R+ + KF  GEPNNY+N E C+ G+FY +G WNDI+C+D N++IC K+ Q   S    + + N++L+I+ EK T+  A A C SKG QLIKI D+  N+ +YNLAVQY+IGRYWIDAND QNEGNF+ +DG+KI + KFA GEPNNYQKN
Sbjct:  288 SKYVIIFQEKTTFTEANKLCQAKGYNLIKIEDDQFNTQVYNLAIQYHAGRFWIDANDIKVEGTFEYVNGQRIKYHKFAKGEPNNYRN-EDCVHGMFYKDGFWNDISCDDTNSVICYKNTQPKTSHV--IKLLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKN 504          

HSP 4 Score: 223.787 bits (569), Expect = 1.289e-66
Identity = 112/220 (50.91%), Postives = 162/220 (73.64%), Query Frame = 3
Query:   75 ILGKDVVFSGQKGTFQQAKELCQKSGYNVVRIDNDQFNVMIYNMAVKYKLGRYWIDGNDIQQDRNFVNSDGKRLTFSKFYPGEPNNYQNSEHCLQGLFYPNGLWXXXXXXXXXXXXXSKDIQNTVSRFYEVTVSNKKLLIIPEKRTFVQAQALCHSKGLQLIKITDNNFNTQIYNLAVQYRIGRYWIDANDRQNEGNFVYTDGQKITFNKFAQGEPNNYQ 734
            +L ++++   +K T++ A   C+  G+ +++ID+DQ N M+YN+AV+Y++GRYWID ND+Q + NF++SDGK++ + KF PGEPNNYQ +EHC+ GL+Y N LWNDI+C D NA+IC K  ++ +    ++TV NK+L+I  E+ T+ +AQ LC S+G +L+KI D  FN+ +YN AVQ  IGRYWIDAND + EG F  +D  KI F+K+A GEPNNYQ
Sbjct:  415 LLNRELIILQEKTTYENAIAHCKSKGFQLIKIDDDQLNSMVYNLAVQYQIGRYWIDANDMQNEGNFISSDGKKIVYRKFAPGEPNNYQKNEHCVHGLYYSNALWNDISCADSNAVICYK--ESKIEVLKKITVLNKELVIFKERLTYYKAQDLCKSQGYKLVKIDDEQFNSIVYNYAVQNNIGRYWIDANDVRIEGTFEDSDKNKIKFSKWAAGEPNNYQ 632          

HSP 5 Score: 198.749 bits (504), Expect = 5.345e-58
Identity = 108/222 (48.65%), Postives = 157/222 (70.72%), Query Frame = 3
Query:   72 TILGKDVVFSGQKGTFQQAKELCQKSGYNVVRIDNDQFNVMIYNMAVKYKLGRYWIDGNDIQQDRNFVNSDGKRLTFSKFYPGEPNNYQNSEHCLQGLFYPNGLWXXXXXXXXXXXXXSKDIQNTVSR-FYEVTVSNKKLLIIPEKRTFVQAQALCHSKGLQLIKITDNNFNTQIYNLAVQYRIGRYWIDANDRQNEGNFVYTDGQKITFNKFAQGEPNNYQ 734
            T+L K++V   ++ T+ +A++LC+  GY +V+ID++QFN ++YN AV+  +GRYWID ND++ +  F +SD  ++ FSK+  GEPNNYQN E C+ GL+Y N LWNDI C D+NA+IC K+I    SR F +  +SNK+++I  EK  F  AQ LC + G +L+KI  +  N+ IY+ AV++ IG YWIDAND Q E  FVY+D +KI++ K+  GEPNNY+
Sbjct:  544 TVLNKELVIFKERLTYYKAQDLCKSQGYKLVKIDDEQFNSIVYNYAVQNNIGRYWIDANDVRIEGTFEDSDKNKIKFSKWAAGEPNNYQN-EDCVHGLYYKNALWNDIKCEDLNAVICYKNIG---SRGFTKFEISNKEIVIFEEKVVFKHAQLLCKNNGYELLKIDSDEINSMIYDFAVKHNIGTYWIDANDIQTENTFVYSDSKKISYQKWYPGEPNNYE 761          

HSP 6 Score: 169.088 bits (427), Expect = 1.332e-47
Identity = 93/219 (42.47%), Postives = 141/219 (64.38%), Query Frame = 3
Query:   75 ILGKDVVFSGQKGTFQQAKELCQKSGYNVVRIDNDQFNVMIYNMAVKYKLGRYWIDGNDIQQDRNFVNSDGKRLTFSKFYPGEPNNYQNSEHCLQGLFYPNGLWXXXXXXXXXXXXXSKDIQNTVSRFYEVTVSNKKLLIIPEKRTFVQAQALCHSKGLQLIKITDNNFNTQIYNLAVQYRIGRYWIDANDRQNEGNFVYTDGQKITFNKFAQGEPNNY 731
            I  K++V   +K  F+ A+ LC+ +GY +++ID+D+ N MIY+ AVK+ +G YWID NDIQ +  FV SD K++++ K+YPGEPNNY+N E C+ GL+Y NGLWNDI C+  N++ICSKDI N+     E     +K  +     T+ +A   C+    +++KI++   N  IY  +   +IGR+WI+ ND   EG +V + G K+ +  +A+ EPNNY
Sbjct:  674 ISNKEIVIFEEKVVFKHAQLLCKNNGYELLKIDSDEINSMIYDFAVKHNIGTYWIDANDIQTENTFVYSDSKKISYQKWYPGEPNNYEN-EDCVHGLYYKNGLWNDIKCDYKNSVICSKDILNS----NETIKQQQKYYVHEVLVTYEEAINFCNQHNCRIVKISNEETNKIIYEWSKNMKIGRFWINGNDIITEGKWVDSKGNKLVYLNWAKNEPNNY 887          

HSP 7 Score: 157.147 bits (396), Expect = 1.875e-43
Identity = 85/207 (41.06%), Postives = 128/207 (61.84%), Query Frame = 3
Query:  114 TFQQAKELCQKSGYNVVRIDNDQFNVMIYNMAVKYKLGRYWIDGNDIQQDRNFVNSDGKRLTFSKFYPGEPNNYQNSEHCLQGLFYPNGLWXXXXXXXXXXXXXSKDIQNTVSRFY-EVTVSNKKLLIIPEKRTFVQAQALCHSKGLQLIKITDNNFNTQIYNLAVQYRIGRYWIDANDRQNEGNFVYTDGQKITFNKFAQGEPNNY 731
            T+++A   CQ     +V I+N + +++I N+A K+K+  YW+DGNDI+++  +VN DG +L +  +  GEPNNY N E CL G ++ NG WND           S   +N+   +Y E  +S K+L I  E+ TF +AQ  C  KG  L++I +   N  IY+LAV+ +IG+YWIDAND+  EG FV ++   + ++KF +GEPNNY
Sbjct: 1068 TYEEALRFCQIHSCRLVTIENSELDILILNLARKHKISGYWLDGNDIKKEGEWVNIDGNKLKYLNWNQGEPNNYGN-EDCLLGNYFANGKWNDF----------SCSTKNSFIYYYIENIISTKELEIFKERVTFEEAQNTCIKKGWSLVRIDNEETNQNIYDLAVKNKIGQYWIDANDKAVEGKFVDSNNHALKYSKFPRGEPNNY 1263          

HSP 8 Score: 151.369 bits (381), Expect = 2.014e-41
Identity = 83/206 (40.29%), Postives = 125/206 (60.68%), Query Frame = 3
Query:  114 TFQQAKELCQKSGYNVVRIDNDQFNVMIYNMAVKYKLGRYWIDGNDIQQDRNFVNSDGKRLTFSKFYPGEPNNYQNSEHCLQGLFYPNGLWXXXXXXXXXXXXXSKDIQNTVSRFYEVTVSNKKLLIIPE-KRTFVQAQALCHSKGLQLIKITDNNFNTQIYNLAVQYRIGRYWIDANDRQNEGNFVYTDGQKITFNKFAQGEPNN 728
            T+++A   C +    +V+I N++ N +IY  +   K+GR+WI+GNDI  +  +V+S G +L +  +   EPNNY N+E CL+G FYPNG WNDI          S   +N +   YE T   +  + I E K  +++A  LC SKG  LI+I +   N  +Y++A + ++G+YWI+AND   EG F+Y+DGQ I++  FA GEPNN
Sbjct:  814 TYEEAINFCNQHNCRIVKISNEETNKIIYEWSKNMKIGRFWINGNDIITEGKWVDSKGNKLVYLNWAKNEPNNY-NNEDCLEGNFYPNGEWNDI----------SCKTKNYLIYEYESTAEKEITIEIMEGKVNYIKALELCKSKGYDLIRIENEEINKIVYDVATKNKVGQYWINANDINVEGQFIYSDGQNISYRNFAHGEPNN 1008          

HSP 9 Score: 144.821 bits (364), Expect = 3.109e-39
Identity = 83/209 (39.71%), Postives = 131/209 (62.68%), Query Frame = 3
Query:  108 KGTFQQAKELCQKSGYNVVRIDNDQFNVMIYNMAVKYKLGRYWIDGNDIQQDRNFVNSDGKRLTFSKFYPGEPNNYQNSEHCLQGLFYPNGLWXXXXXXXXXXXXXSKDIQNTVSRFYEV-TVSNKKLLIIPEKRTFVQAQALCHSKGLQLIKITDNNFNTQIYNLAVQYRIGRYWIDANDRQNEGNFVYTDGQKITFNKFAQGEPNNY 731
            K  + +A ELC+  GY+++RI+N++ N ++Y++A K K+G+YWI+ NDI  +  F+ SDG+ +++  F  GEPNN QN+E C+ GLFY NGLWNDI+CN IN+++C K  +       E   +   K  +   + T+ +A   C     +L+ I ++  +  I NLA +++I  YW+D ND + EG +V  DG K+ +  + QGEPNNY
Sbjct:  934 KVNYIKALELCKSKGYDLIRIENEEINKIVYDVATKNKVGQYWINANDINVEGQFIYSDGQNISYRNFAHGEPNN-QNNEDCVHGLFYTNGLWNDISCNSINSVLCYKPFKEDKDEKKEEGKIDTSKYFVHTGRVTYEEALRFCQIHSCRLVTIENSELDILILNLARKHKISGYWLDGNDIKKEGEWVNIDGNKLKYLNWNQGEPNNY 1141          

HSP 10 Score: 143.28 bits (360), Expect = 1.217e-38
Identity = 86/208 (41.35%), Postives = 134/208 (64.42%), Query Frame = 3
Query:   75 ILGKDVVFSGQKGTFQQAKELCQKSGYNVVRIDNDQFNVMIYNMAVKYKLGRYWIDGNDIQQDRNFVNSDGKRLTFSKFYPGEPNNYQNSEHCLQGLFYPNGLWXXXXXXXXXXXXXSKDIQNTVSRFYEVTVSNKKLLIIPEKRTFVQAQALCHSKGLQLIKITDNNFNTQIYNLAVQYRIGRYWIDANDRQNEGNFVYTDGQKITF 698
            I  K++    ++ TF++A+  C K G+++VRIDN++ N  IY++AVK K+G+YWID ND   +  FV+S+   L +SKF  GEPNNY N E C+ GL+Y NG WNDI CN  N+ ICSK     +  F +  +S K   I   K T+ +A   C S+G  LIK+ +++ +  ++ L+++Y++  YWID  D +N+G + ++DGQ++TF
Sbjct: 1177 ISTKELEIFKERVTFEEAQNTCIKKGWSLVRIDNEETNQNIYDLAVKNKIGQYWIDANDKAVEGKFVDSNNHALKYSKFPRGEPNNYGN-EDCVHGLYYSNGFWNDIACNSKNSFICSKYSPPII--FIDEHMSYK---IFINKVTYREAVDKCQSEGYSLIKVENSDISFIVHTLSLRYKLVNYWIDGTDSKNDGKWTFSDGQQLTF 1378          

HSP 11 Score: 96.2857 bits (238), Expect = 1.856e-22
Identity = 60/206 (29.13%), Postives = 114/206 (55.34%), Query Frame = 3
Query:  108 KGTFQQAKELCQKSGYNVVRIDNDQFNVMIYNMAVKYKLGRYWIDGNDIQQDRNFVNSDGKRLTFSKFYPGEPNNYQNSEHCLQGLFYPNGLWXXXXXXXXXXXXXSKDIQNTVSRFYEVTVSNKKLLIIPEKRTFVQAQALCHSKGLQLIKITDNNFNTQIYNLAVQYRIGRYWIDANDRQNEGNFVYTDGQKITFNKFAQGEPN 725
            K T+++A + CQ  GY++++++N   + +++ ++++YKL  YWIDG D + D  +  SDG++LTF  +      + + + +CL      +G W   +C   N++IC K    T+    EV  +  K  I     TF +A   C  +  +LI + + + N  ++ L+ +  I +YW++ ND+ NEG ++ +D +K+TF  +  G+ N
Sbjct: 1314 KVTYREAVDKCQSEGYSLIKVENSDISFIVHTLSLRYKLVNYWIDGTDSKNDGKWTFSDGQQLTFKNWQTAPLPSDKENNNCLYSSETLSGKWLGTSCVSKNSVICYKP-SKTIDTGKEVKKT--KYYIHRIGVTFQEALDFCKERRCKLIVVDNIDTNIYLWELSKKLSIEKYWLNGNDKDNEGAWIDSDKKKLTFFNWTNGKVN 1516          
BLAST of Macrophage mannose receptor 1 vs. Planmine SMEST
Match: SMESG000031111.1 (SMESG000031111.1)

HSP 1 Score: 163.31 bits (412), Expect = 6.677e-50
Identity = 89/198 (44.95%), Postives = 127/198 (64.14%), Query Frame = 3
Query:  156 NVVRIDNDQFNVMIYNMAVKYKLGRYWIDGNDIQQDRNFVNSDGKRLTFSKFYPGEPNNYQNSEHCLQGLFYPNGLWXXXXXXXXXXXXXSKDIQNTVSRFYE------VTVSNKKLLIIPEKRTFVQAQALCHSKGLQLIKITDNNFNTQIYNLAVQYRIGRYWIDANDRQNEGNFVYTDGQKITFNKFAQGEPNNY 731
            N++RI ++Q N ++YN AV+  LG+YWID ND  Q+R FV  DG R+T+SK++ GEPNNY N+E C+ GLFY NG WNDI C          DI N V  + E      V +   +L+++P K     A  +C + GLQL+K+ +   N  +Y+ AV+  +G+YW+DAND Q E  +VY +GQ+IT++K+  GEPNNY
Sbjct:    2 NLIRIQDEQTNQIVYNFAVRRGLGQYWIDANDRVQERQFVYEDGNRITYSKWHRGEPNNY-NNEDCVHGLFYQNGFWNDIKC----------DINNAVICYRERSQNSIVNIQENQLVVLPGKVNQQTAINMCKANGLQLVKVQNEQINQLVYDFAVRNNVGQYWMDANDNQQETVWVYDNGQRITYSKWHSGEPNNY 188          

HSP 2 Score: 93.9745 bits (232), Expect = 3.803e-23
Identity = 45/99 (45.45%), Postives = 68/99 (68.69%), Query Frame = 3
Query:   90 VVFSGQKGTFQQAKELCQKSGYNVVRIDNDQFNVMIYNMAVKYKLGRYWIDGNDIQQDRNFVNSDGKRLTFSKFYPGEPNNYQNSEHCLQGLFYPNGLW 386
            VV  G K   Q A  +C+ +G  +V++ N+Q N ++Y+ AV+  +G+YW+D ND QQ+  +V  +G+R+T+SK++ GEPNNY   E+CL GLFY NG W
Sbjct:  108 VVLPG-KVNQQTAINMCKANGLQLVKVQNEQINQLVYDFAVRNNVGQYWMDANDNQQETVWVYDNGQRITYSKWHSGEPNNY-GGENCLHGLFYQNGFW 204          

HSP 3 Score: 71.2478 bits (173), Expect = 9.378e-15
Identity = 33/61 (54.10%), Postives = 44/61 (72.13%), Query Frame = 3
Query:  549 LQLIKITDNNFNTQIYNLAVQYRIGRYWIDANDRQNEGNFVYTDGQKITFNKFAQGEPNNY 731
            + LI+I D   N  +YN AV+  +G+YWIDANDR  E  FVY DG +IT++K+ +GEPNNY
Sbjct:    1 MNLIRIQDEQTNQIVYNFAVRRGLGQYWIDANDRVQERQFVYEDGNRITYSKWHRGEPNNY 61          
BLAST of Macrophage mannose receptor 1 vs. Planmine SMEST
Match: SMESG000046618.1 (SMESG000046618.1)

HSP 1 Score: 162.155 bits (409), Expect = 6.813e-49
Identity = 90/220 (40.91%), Postives = 139/220 (63.18%), Query Frame = 3
Query:   72 TILGKDVVFSGQKGTFQQAKELCQKSGYNVVRIDNDQFNVMIYNMAVKYKLGRYWIDGNDIQQDRNFVNSDGKRLTFSKFYPGEPNNYQNSEHCLQGLFYPNGLWXXXXXXXXXXXXXSKDIQNTVSRFYEVTVSNKKLLIIPEKRTFVQAQALCHSKGLQLIKITDNNFNTQIYNLAVQYRIGRYWIDANDRQNEGNFVYTDGQKITFNKFAQGEPNNY 731
            +I    ++    K   QQA +LCQ +G N+V++ +DQ N +++  A    LG+YW+DGND   +  ++  DG RL+++K+ PGEPNNY N E C+ G ++PNG WND++CN   A+IC K      S F  V +   +L+++P K     A  +C + GLQL+K+ +   N  +Y+ AV+  +G+YW+DAND Q E  +VY +GQ+IT++K+  GEPNNY
Sbjct:   10 SITEDQLIALPNKANQQQAVQLCQNNGMNLVKVQDDQSNQLVFRFATNRGLGQYWLDGNDRVNEGYWMYEDGNRLSYTKWQPGEPNNYGN-EDCIHGNYHPNGFWNDVSCNANCAVICYK----RKSDFKIVNIQENQLVVLPGKVNQQTAINMCKANGLQLVKVQNEQINQLVYDFAVRNNVGQYWMDANDNQQETVWVYDNGQRITYSKWHSGEPNNY 224          

HSP 2 Score: 93.5893 bits (231), Expect = 1.256e-22
Identity = 45/99 (45.45%), Postives = 68/99 (68.69%), Query Frame = 3
Query:   90 VVFSGQKGTFQQAKELCQKSGYNVVRIDNDQFNVMIYNMAVKYKLGRYWIDGNDIQQDRNFVNSDGKRLTFSKFYPGEPNNYQNSEHCLQGLFYPNGLW 386
            VV  G K   Q A  +C+ +G  +V++ N+Q N ++Y+ AV+  +G+YW+D ND QQ+  +V  +G+R+T+SK++ GEPNNY   E+CL GLFY NG W
Sbjct:  144 VVLPG-KVNQQTAINMCKANGLQLVKVQNEQINQLVYDFAVRNNVGQYWMDANDNQQETVWVYDNGQRITYSKWHSGEPNNY-GGENCLHGLFYQNGFW 240          

HSP 3 Score: 81.2629 bits (199), Expect = 3.574e-18
Identity = 33/93 (35.48%), Postives = 59/93 (63.44%), Query Frame = 3
Query:  453 RFYEVTVSNKKLLIIPEKRTFVQAQALCHSKGLQLIKITDNNFNTQIYNLAVQYRIGRYWIDANDRQNEGNFVYTDGQKITFNKFAQGEPNNY 731
            +++  +++  +L+ +P K    QA  LC + G+ L+K+ D+  N  ++  A    +G+YW+D NDR NEG ++Y DG ++++ K+  GEPNNY
Sbjct:    5 KYFPDSITEDQLIALPNKANQQQAVQLCQNNGMNLVKVQDDQSNQLVFRFATNRGLGQYWLDGNDRVNEGYWMYEDGNRLSYTKWQPGEPNNY 97          
BLAST of Macrophage mannose receptor 1 vs. Planmine SMEST
Match: SMESG000046618.1 (SMESG000046618.1)

HSP 1 Score: 162.155 bits (409), Expect = 3.912e-48
Identity = 90/220 (40.91%), Postives = 139/220 (63.18%), Query Frame = 3
Query:   72 TILGKDVVFSGQKGTFQQAKELCQKSGYNVVRIDNDQFNVMIYNMAVKYKLGRYWIDGNDIQQDRNFVNSDGKRLTFSKFYPGEPNNYQNSEHCLQGLFYPNGLWXXXXXXXXXXXXXSKDIQNTVSRFYEVTVSNKKLLIIPEKRTFVQAQALCHSKGLQLIKITDNNFNTQIYNLAVQYRIGRYWIDANDRQNEGNFVYTDGQKITFNKFAQGEPNNY 731
            +I    ++    K   QQA +LCQ +G N+V++ +DQ N +++  A    LG+YW+DGND   +  ++  DG RL+++K+ PGEPNNY N E C+ G ++PNG WND++CN   A+IC K      S F  V +   +L+++P K     A  +C + GLQL+K+ +   N  +Y+ AV+  +G+YW+DAND Q E  +VY +GQ+IT++K+  GEPNNY
Sbjct:   77 SITEDQLIALPNKANQQQAVQLCQNNGMNLVKVQDDQSNQLVFRFATNRGLGQYWLDGNDRVNEGYWMYEDGNRLSYTKWQPGEPNNYGN-EDCIHGNYHPNGFWNDVSCNANCAVICYK----RKSDFKIVNIQENQLVVLPGKVNQQTAINMCKANGLQLVKVQNEQINQLVYDFAVRNNVGQYWMDANDNQQETVWVYDNGQRITYSKWHSGEPNNY 291          

HSP 2 Score: 93.5893 bits (231), Expect = 3.047e-22
Identity = 45/99 (45.45%), Postives = 68/99 (68.69%), Query Frame = 3
Query:   90 VVFSGQKGTFQQAKELCQKSGYNVVRIDNDQFNVMIYNMAVKYKLGRYWIDGNDIQQDRNFVNSDGKRLTFSKFYPGEPNNYQNSEHCLQGLFYPNGLW 386
            VV  G K   Q A  +C+ +G  +V++ N+Q N ++Y+ AV+  +G+YW+D ND QQ+  +V  +G+R+T+SK++ GEPNNY   E+CL GLFY NG W
Sbjct:  211 VVLPG-KVNQQTAINMCKANGLQLVKVQNEQINQLVYDFAVRNNVGQYWMDANDNQQETVWVYDNGQRITYSKWHSGEPNNY-GGENCLHGLFYQNGFW 307          

HSP 3 Score: 80.1073 bits (196), Expect = 2.483e-17
Identity = 37/103 (35.92%), Postives = 62/103 (60.19%), Query Frame = 3
Query:  438 QNTVSRFYEV-----TVSNKKLLIIPEKRTFVQAQALCHSKGLQLIKITDNNFNTQIYNLAVQYRIGRYWIDANDRQNEGNFVYTDGQKITFNKFAQGEPNNY 731
            QN +S+  E      +++  +L+ +P K    QA  LC + G+ L+K+ D+  N  ++  A    +G+YW+D NDR NEG ++Y DG ++++ K+  GEPNNY
Sbjct:   62 QNKISKDMEPEYPCDSITEDQLIALPNKANQQQAVQLCQNNGMNLVKVQDDQSNQLVFRFATNRGLGQYWLDGNDRVNEGYWMYEDGNRLSYTKWQPGEPNNY 164          
BLAST of Macrophage mannose receptor 1 vs. Planmine SMEST
Match: SMESG000031111.1 (SMESG000031111.1)

HSP 1 Score: 157.532 bits (397), Expect = 8.350e-47
Identity = 86/197 (43.65%), Postives = 125/197 (63.45%), Query Frame = 3
Query:  126 AKELCQKSGYNVVRIDNDQFNVMIYNMAVKYKLGRYWIDGNDIQQDRNFVNSDGKRLTFSKFYPGEPNNYQNSEHCLQGLFYPNGLWXXXXXXXXXXXXXSKDIQNTVSRFYE------VTVSNKKLLIIPEKRTFVQAQALCHSKGLQLIKITDNNFNTQIYNLAVQYRIGRYWIDANDRQNEGNFVYTDGQKITF 698
            A +LC++ G N++RI ++Q N ++YN AV+  LG+YWID ND  Q+R FV  DG R+T+SK++ GEPNNY N+E C+ GLFY NG WNDI C          DI N V  + E      V +   +L+++P K     A  +C + GLQL+K+ +   N  +Y+ AV+  +G+YW+DAND Q E  +VY +GQ+IT+
Sbjct:  104 AVQLCRQQGMNLIRIQDEQTNQIVYNFAVRRGLGQYWIDANDRVQERQFVYEDGNRITYSKWHRGEPNNY-NNEDCVHGLFYQNGFWNDIKC----------DINNAVICYRERSQNSIVNIQENQLVVLPGKVNQQTAINMCKANGLQLVKVQNEQINQLVYDFAVRNNVGQYWMDANDNQQETVWVYDNGQRITY 289          

HSP 2 Score: 87.0409 bits (214), Expect = 5.009e-20
Identity = 44/103 (42.72%), Postives = 63/103 (61.17%), Query Frame = 3
Query:  438 QNTVSRFYE-----VTVSNKKLLIIPEKRTFVQAQALCHSKGLQLIKITDNNFNTQIYNLAVQYRIGRYWIDANDRQNEGNFVYTDGQKITFNKFAQGEPNNY 731
            QN +S+  E      ++   +L+ +P K     A  LC  +G+ LI+I D   N  +YN AV+  +G+YWIDANDR  E  FVY DG +IT++K+ +GEPNNY
Sbjct:   71 QNKISKDMEPEYPCASIGEDQLIALPNKVNQPTAVQLCRQQGMNLIRIQDEQTNQIVYNFAVRRGLGQYWIDANDRVQERQFVYEDGNRITYSKWHRGEPNNY 173          

HSP 3 Score: 57.3806 bits (137), Expect = 1.406e-9
Identity = 27/74 (36.49%), Postives = 48/74 (64.86%), Query Frame = 3
Query:   90 VVFSGQKGTFQQAKELCQKSGYNVVRIDNDQFNVMIYNMAVKYKLGRYWIDGNDIQQDRNFVNSDGKRLTFSKF 311
            VV  G K   Q A  +C+ +G  +V++ N+Q N ++Y+ AV+  +G+YW+D ND QQ+  +V  +G+R+T+  +
Sbjct:  220 VVLPG-KVNQQTAINMCKANGLQLVKVQNEQINQLVYDFAVRNNVGQYWMDANDNQQETVWVYDNGQRITYRYY 292          
The following BLAST results are available for this feature:
BLAST of Macrophage mannose receptor 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MRC22.563e-1226.91mannose receptor C type 2 [Source:HGNC Symbol;Acc:... [more]
COLEC111.294e-934.34collectin subfamily member 11 [Source:HGNC Symbol;... [more]
COLEC111.387e-934.34collectin subfamily member 11 [Source:HGNC Symbol;... [more]
COLEC111.400e-934.34collectin subfamily member 11 [Source:HGNC Symbol;... [more]
COLEC111.751e-934.65collectin subfamily member 11 [Source:HGNC Symbol;... [more]
back to top
BLAST of Macrophage mannose receptor 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Macrophage mannose receptor 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 4
Match NameE-valueIdentityDescription
CG153581.309e-637.50gene:FBgn0031373 transcript:FBtr0473589[more]
CG153581.309e-637.50gene:FBgn0031373 transcript:FBtr0473590[more]
tfc8.766e-630.00gene:FBgn0035199 transcript:FBtr0072661[more]
tfc8.766e-630.00gene:FBgn0035199 transcript:FBtr0072660[more]
back to top
BLAST of Macrophage mannose receptor 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
colec116.458e-930.30collectin sub-family member 11 [Source:NCBI gene;A... [more]
colec117.490e-930.30collectin sub-family member 11 [Source:NCBI gene;A... [more]
zmp:00000007295.421e-830.85zmp:0000000729 [Source:ZFIN;Acc:ZDB-GENE-130530-73... [more]
hbl25.686e-830.85hexose-binding lectin 2 [Source:ZFIN;Acc:ZDB-GENE-... [more]
mrc25.523e-725.57mannose receptor, C type 2 [Source:ZFIN;Acc:ZDB-GE... [more]
back to top
BLAST of Macrophage mannose receptor 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ptpn11b2.078e-1035.35protein tyrosine phosphatase, non-receptor type 11... [more]
ptpn11b7.177e-1037.65protein tyrosine phosphatase, non-receptor type 11... [more]
ptpn11b7.654e-1038.27protein tyrosine phosphatase, non-receptor type 11... [more]
mrc22.030e-923.96mannose receptor C type 2 [Source:NCBI gene;Acc:10... [more]
mrc22.453e-923.96mannose receptor C type 2 [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of Macrophage mannose receptor 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Mrc23.415e-1025.56mannose receptor, C type 2 [Source:MGI Symbol;Acc:... [more]
Mrc24.338e-1025.56mannose receptor, C type 2 [Source:MGI Symbol;Acc:... [more]
Colec115.842e-1034.34collectin sub-family member 11 [Source:MGI Symbol;... [more]
Colec113.638e-932.32collectin sub-family member 11 [Source:MGI Symbol;... [more]
back to top
BLAST of Macrophage mannose receptor 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9UBG0|MRC2_HUMAN1.231e-1126.91C-type mannose receptor 2 OS=Homo sapiens OX=9606 ... [more]
sp|Q2LK94|COL11_CHICK1.742e-1139.39Collectin-11 OS=Gallus gallus OX=9031 GN=COLEC11 P... [more]
sp|Q4TU93|MRC2_RAT1.408e-924.56C-type mannose receptor 2 OS=Rattus norvegicus OX=... [more]
sp|Q64449|MRC2_MOUSE2.389e-925.56C-type mannose receptor 2 OS=Mus musculus OX=10090... [more]
sp|Q3SXB8|COL11_MOUSE2.437e-934.34Collectin-11 OS=Mus musculus OX=10090 GN=Colec11 P... [more]
back to top
BLAST of Macrophage mannose receptor 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
Q8WSX22.634e-4137.38Lectin 1 (Fragment) OS=Girardia tigrina OX=6162 GN... [more]
Q8WSW73.808e-3130.33Scarf3b OS=Girardia tigrina OX=6162 GN=scarf3b PE=... [more]
Q8WSW81.118e-2931.46Scarf3a OS=Girardia tigrina OX=6162 GN=scarf3a PE=... [more]
Q8WTP37.155e-2830.05Scarf2 OS=Girardia tigrina OX=6162 GN=scarf2 PE=4 ... [more]
Q246967.951e-2729.58C-type lectin-like protein OS=Girardia tigrina OX=... [more]
back to top
BLAST of Macrophage mannose receptor 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mrc1b5.997e-925.00mannose receptor, C type 1b [Source:ZFIN;Acc:ZDB-G... [more]
ENSAMXT00000053854.11.249e-823.56pep primary_assembly:Astyanax_mexicanus-2.0:16:249... [more]
acana2.455e-830.53aggrecan core protein-like [Source:NCBI gene;Acc:1... [more]
acana2.461e-830.53aggrecan core protein-like [Source:NCBI gene;Acc:1... [more]
colec111.230e-731.76collectin subfamily member 11 [Source:NCBI gene;Ac... [more]
back to top
BLAST of Macrophage mannose receptor 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSPMAT00000005222.11.683e-748.15pep scaffold:Pmarinus_7.0:GL492592:1201:2726:-1 ge... [more]
ENSPMAT00000003237.11.699e-729.11pep scaffold:Pmarinus_7.0:GL486820:4307:11265:1 ge... [more]
back to top
BLAST of Macrophage mannose receptor 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Macrophage mannose receptor 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO495094.148e-1225.11Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO495122.023e-1125.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO367785.964e-934.25Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO312683.309e-625.74Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO446386.941e-627.47Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Macrophage mannose receptor 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000003250.25.676e-1030.56ladderlectin [Source:NCBI gene;Acc:101164187][more]
ENSORLT00000003252.27.839e-1033.00ladderlectin-like [Source:NCBI gene;Acc:110013319][more]
ENSORLT00000003236.21.210e-729.29ladderlectin-like [Source:NCBI gene;Acc:110013319][more]
colec111.544e-729.29collectin subfamily member 11 [Source:NCBI gene;Ac... [more]
mrc1a2.936e-724.43mannose receptor C-type 1 [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of Macrophage mannose receptor 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000078340.13.281e-142100.00SMESG000078340.1[more]
SMESG000031111.16.677e-5044.95SMESG000031111.1[more]
SMESG000046618.16.813e-4940.91SMESG000046618.1[more]
SMESG000046618.13.912e-4840.91SMESG000046618.1[more]
SMESG000031111.18.350e-4743.65SMESG000031111.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30009805 ID=SMED30009805|Name=Macrophage mannose receptor 1|organism=Schmidtea mediterranea sexual|type=transcript|length=740bp
TTCCGATCTCTTTTTTAGAAATATTATTTATAATATTTTCTATTTTTTCT
GCCAATTTTTTAAATGGAGCAACAATCTTAGGTAAGGATGTGGTGTTTTC
TGGTCAAAAGGGTACATTTCAACAAGCCAAGGAACTTTGTCAAAAATCTG
GATATAATGTTGTAAGGATCGACAATGATCAATTTAATGTTATGATTTAT
AATATGGCGGTAAAGTACAAACTTGGACGATATTGGATAGATGGGAATGA
TATTCAACAAGATAGAAACTTTGTAAATTCAGATGGAAAACGACTAACCT
TCAGTAAATTCTATCCAGGAGAGCCAAATAATTACCAGAATAGTGAACAT
TGTTTACAAGGTTTGTTCTATCCAAATGGGTTATGGAATGATATCAACTG
CAATGACATAAATGCAATAATATGTTCCAAGGATATTCAAAATACTGTCT
CAAGATTTTACGAAGTCACTGTATCAAACAAAAAACTATTAATAATTCCC
GAAAAACGGACGTTTGTGCAAGCTCAGGCTCTTTGTCATAGTAAAGGATT
ACAACTGATCAAAATTACTGACAACAACTTCAATACCCAAATATATAATC
TCGCAGTTCAATACAGAATTGGACGATATTGGATTGATGCCAATGACAGA
CAAAACGAAGGAAATTTTGTTTATACCGATGGACAAAAAATTACATTCAA
CAAATTCGCACAAGGGGAACCAAATAATTATCAAAAGAAT
back to top

protein sequence of SMED30009805-orf-1

>SMED30009805-orf-1 ID=SMED30009805-orf-1|Name=SMED30009805-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=246bp
PISFLEILFIIFSIFSANFLNGATILGKDVVFSGQKGTFQQAKELCQKSG
YNVVRIDNDQFNVMIYNMAVKYKLGRYWIDGNDIQQDRNFVNSDGKRLTF
SKFYPGEPNNYQNSEHCLQGLFYPNGLWNDINCNDINAIICSKDIQNTVS
RFYEVTVSNKKLLIIPEKRTFVQAQALCHSKGLQLIKITDNNFNTQIYNL
AVQYRIGRYWIDANDRQNEGNFVYTDGQKITFNKFAQGEPNNYQKN
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000420parapharyngeal region
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR001304C-type_lectin-like
IPR016186C-type_lectin-like/link_sf
IPR018378C-type_lectin_CS
IPR016187CTDL_fold
Vocabulary: molecular function
TermDefinition
GO:0030246carbohydrate binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001304C-type lectin-likeSMARTSM00034CLECT_2coord: 16..139
e-value: 1.9E-12
score: 57.3
IPR001304C-type lectin-likePFAMPF00059Lectin_Ccoord: 165..241
e-value: 2.9E-7
score: 31.2
coord: 33..140
e-value: 4.6E-12
score: 46.6
IPR001304C-type lectin-likePROSITEPS50041C_TYPE_LECTIN_2coord: 154..243
score: 9.05
IPR001304C-type lectin-likePROSITEPS50041C_TYPE_LECTIN_2coord: 29..139
score: 13.85
IPR016186C-type lectin-like/link domain superfamilyGENE3DG3DSA:3.10.100.10coord: 12..142
e-value: 4.8E-28
score: 99.5
IPR016186C-type lectin-like/link domain superfamilyGENE3DG3DSA:3.10.100.10coord: 143..243
e-value: 5.1E-18
score: 67.1
NoneNo IPR availablePANTHERPTHR24024:SF15PULMONARY SURFACTANT-ASSOCIATED PROTEIN Dcoord: 165..242
NoneNo IPR availablePANTHERPTHR24024:SF15PULMONARY SURFACTANT-ASSOCIATED PROTEIN Dcoord: 16..138
NoneNo IPR availablePANTHERPTHR24024FAMILY NOT NAMEDcoord: 165..242
NoneNo IPR availablePANTHERPTHR24024FAMILY NOT NAMEDcoord: 16..138
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..19
score: 0.632
IPR018378C-type lectin, conserved sitePROSITEPS00615C_TYPE_LECTIN_1coord: 114..138
IPR016187C-type lectin foldSUPERFAMILYSSF56436C-type lectin-likecoord: 156..241
IPR016187C-type lectin foldSUPERFAMILYSSF56436C-type lectin-likecoord: 28..140