Dach-2

Overview
NameDach-2
Smed IDSMED30009793
Length (bp)5875
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Dach-2 (SMED30009793) t-SNE clustered cells

Violin plots show distribution of expression levels for Dach-2 (SMED30009793) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Dach-2 (SMED30009793) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Dach-2 (SMED30009793) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30009793

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30009793SMESG000033540.1 SmedASXL_017316SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30009793SMESG000033540.1 dd_Smed_v4_11289_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30009793SMESG000033540.1 dd_Smed_v4_11289_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30009793SMESG000033540.1 dd_Smed_v4_11289_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
reproductive organSMED30009793SMESG000061896.1 SMESG000033540.1 Contig29713uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30009793SMESG000061896.1 SMESG000033540.1 Contig29713newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Dach-2 vs. Ensembl Human
Match: MYO5A (myosin VA [Source:HGNC Symbol;Acc:HGNC:7602])

HSP 1 Score: 1108.98 bits (2867), Expect = 0.000e+0
Identity = 717/1905 (37.64%), Postives = 1089/1905 (57.17%), Query Frame = 2
Query:   47 MALYEMYSKGVKIWIPDEESVWIGATVLQFHKEKN-VIKIITDNGISKELNLSSK-KCAPFLRNPDILIGQKDLTYLSYLNEPEVLYNLQIRFCERREIYTYCGIVLVAINPYQELSIYGKEIINAYHSQNSVDLDPHIFAVAENAFRRMSSFGENQSIIVSGESGAGKTVSAKYTMRYFALVGGSKTKQSFNLTETQIERKVLLSNPILEAFGNAKTIRNDNSSRFGKYLEILFNPRNQVIGANMCTYLLEKSRVVFQNLGERNYHIFYQIVTHCQSEDELLMNTGLVNNVEMYDYLRYGESLEIDGVDDSHEFLITKNSFLQLGIDLNKFKTICEILAAILHLGNIRFRFHDATDSSIIENPELLKLIAGLLGCSIDQLKIWLCFRTISTFQETLHKPLSKAEAQYFRDAFVKTLYSNLFDWIVKQANKVLSTDVSINIKKKLKKTIVVNQEDKKKFIAVLDIYGFETFAENSFEQFCINFANEKLQLQFNLHVFKLEQEEYMNEGLEWTFIDYYNNQPCIDLIESRXXXXXXXXXXXXXXXXSDENWCCKIYSHHLNKSANFNKPKLSNMVFIIEHFAGPVEYKCAGFIEKNRDSVLEEQINLLKASDVQLIAELFRDSEIEIFDTNNXXXXXXXXXXXXXXXXXXQEN--TRKMKKTVGSQFRNSLKSLMDALNKTNPHYVRCIKPNDLKLPFTFCPERAVQQLRACGVLETIRLSAAGFPSRWTYSDFYHRYYILMSNFNVKNHDFKAGSQKIVETLITVPDAFRFGNTKLFFRPGQVALLEKLRGHKIESSVTLIQSILRGSIERKKYLIIHKLTVQIQTYIRRKLAIEKATKLSQIRAVIIIQSFYRMYLARKLFVKMKCAVLAIEKWRRKIITTRLKQAYKKENCVIICQAIVRRFIQRRKFLKIQRGVILIQNHYRRRKAKETLKILKIEARSINHIKFVNKGLENKIIELTQKLDTKEKEM-CXXXXXX--------XXXXXXXXXXXXXXXAESAKIYQNTVQDLQTEIIQLKKELNREIVEKNKI--FADKELLEINYKKKINYL-ENLIEE---LKSSPSVIEPNIICNGDEAQQSICQD--EHQKFI-----NEQMDHQKLVREYEKLEMKYENLYKEFLFVKSSNQKPSINYDNQTSNDSETESTFSKDDADVESLSDKVDAKTTKEHXXXXXXXXXXLPNFISESISTAGDLAVVMQLQMNISSLSQENNRLKETVQQFEDELLKYEQCAEDSKGLVIHNEYDNELLSIIKDIKGMDEHGLKSRLIDEVANLKKKL-KQSNEDYQKLRLHIFDGSMSKLTGNLDHESINSEEEELKRA-FESQKEANRK------------MLKEIEGIKANNVDLKKALFQIRKDKEQLQVQLGKQHLMIRHGVEYL----QNLK---------------LTPKERLDKFVQNEISRILLENLKLQERNDQIISETIELKRGLKYFAFRLQKYEGSLVPNPNKEEDLLQLIQNVIYHSKMKTIGKRECYSEIGLIDLNMSELSIFIKSFIFDLSP-SICLQYEPYHLVPYIIFMVTRKFDFYKEEDQMTNFLSKLIVALKRTIRKRRNYIEYLVMLLSNVFCLVNLXXXXXXXXXXXXLNTAEDIQHYFVHYDLNEFIRLLKELCVTLFQMILKTIVDNLLPQSLCIDAILVHEAI--IDFLSKDGTKYKSNIETQPKNTSFNVLTKNLQSVLEILKNHKIPQLIINQIFVHIAYLINAYCLNTLLFRTDLCYFSKGLQIKYNLSSFETWIRYQKLIDSGALQCLRPMTEAVQLLQTLIDSDEDAKFVCDMCEYLNTRQVVKILNNFNPRDGYGCRLSSGLIAKIETQMKIKRGDEPSESKLETPTVIEIPIDIPFIHNGVSLCRTIIPKPLYLSCLT 5575
            MA  E+Y+K  ++WIPD E VW  A +L+ +K  + V+ +  + G   E +L  K K  P LRNPDIL+G+ DLT LSYL+EP VL+NL++RF + + IYTYCGIVLVAINPY++L IYG++IINAY  QN  D+DPHIFAVAE A+++M+    NQSIIVSGESGAGKTVSAKY MRYFA V GS        +E  +E KVL SNPI+E+ GNAKT RNDNSSRFGKY+EI F+ R ++IGANM TYLLEKSRVVFQ   ERNYHIFYQ+    +  +  ++  G   N + ++Y + G S  I+GVDD+ E   T+ +   LGI  +    I  ILA ILHLGN+ F   DA   +I    E L +   L+G   +++  WLC R ++T  ET  KP+SK +A   RDA  K +Y+ LF+WIV   N+ L + V                  +  FI VLDIYGFETF  NSFEQFCIN+ANEKLQ QFN+HVFKLEQEEYM E + WT ID+Y+NQPCI+LIES+LG+LDLLDEECK+ KG+D+ W  K+Y+ HLNK A F KP+LSN  FII+HFA  VEY+C GF+EKN+D+V EEQI +LK+S  +++ ELF+D E  I  T+ +    +  + T +  +  +     ++ KKTVG QFRNSL  LM+ LN T PHYVRCIKPND K PFTF  +RAVQQLRACGVLETIR+SAAGFPSRWTY +F+ RY +LM   +V + D K   + ++E LI   D ++FG TK+FFR GQVA LEKLR  K+ ++   IQ  +RG + RKKYL + K  + +Q Y+R   A   A  L + +A  IIQ ++RMY+ R+ +   + A + ++ + R  +     +   +E+  +I Q  VR ++ R  + +    +I +Q  +RR  AK  LK LKIEARS+   K ++ G+ENKI++L +K+D + K+  CL++             EK    L       E AK+    V  LQ EI +L+K+L +   EK  I   AD+      YK++   L  NL EE   LK     +   I+    E  +++ +   E  K +     +E++ +Q L+ E+ +LE +Y++L KE + +     KP     + T + +E+E  FS + A++E +  + +  + K+                        D+++ ++LQ  ++ L QE   +++ + + E+++L+  +  E+ +  +   E + E L      K  +      +L +E+  L+K L ++S  +        +   M +LT   +   +  EE  + R+   SQKEA +             +L++++ +K +  ++ +A   +++    L+ QL  Q     +  E L    Q+LK               L P+ R++  +Q+EI+R+  ENL L E+ ++      +LK+ LK FA ++ + E   + N +  + + + I+ V    K K           G+++    +    +K+ I +L P  + +   P  L  YI+FM  R  D+  ++ ++ + L+  I ++K+ ++KR +  E +   LSN    ++  +QYSG + F   NT+   +H   ++DL E+ ++L +L + ++Q +++ +++N+L Q + +  +L HE I  +  +   G + +++        + + + + L S   ++  H +   +I Q+   + Y+I A  LN LL R D+C +SKG+QI+YN+S  E W+R + L++SGA + L P+ +A QLLQ    +D+DA+ +C MC  L T Q+VK+LN + P + +  R+S   I  I+ +++  R D P   +L        P+  PF  + ++L    IP  L L  ++
Sbjct:    1 MAASELYTKFARVWIPDPEEVWKSAELLKDYKPGDKVLLLHLEEGKDLEYHLDPKTKELPHLRNPDILVGENDLTALSYLHEPAVLHNLRVRFIDSKLIYTYCGIVLVAINPYEQLPIYGEDIINAYSGQNMGDMDPHIFAVAEEAYKQMARDERNQSIIVSGESGAGKTVSAKYAMRYFATVSGSA-------SEANVEEKVLASNPIMESIGNAKTTRNDNSSRFGKYIEIGFDKRYRIIGANMRTYLLEKSRVVFQAEEERNYHIFYQLCASAKLPEFKMLRLG---NADNFNYTKQGGSPVIEGVDDAKEMAHTRQACTLLGISESHQMGIFRILAGILHLGNVGFTSRDADSCTIPPKHEPLCIFCELMGVDYEEMCHWLCHRKLATATETYIKPISKLQATNARDALAKHIYAKLFNWIVDNVNQALHSAVK-----------------QHSFIGVLDIYGFETFEINSFEQFCINYANEKLQQQFNMHVFKLEQEEYMKEQIPWTLIDFYDNQPCINLIESKLGILDLLDEECKMPKGTDDTWAQKLYNTHLNKCALFEKPRLSNKAFIIQHFADKVEYQCEGFLEKNKDTVFEEQIKVLKSSKFKMLPELFQDDEKAISPTSATSSGRTPLTRTPAKPTKGRPGQMAKEHKKTVGHQFRNSLHLLMETLNATTPHYVRCIKPNDFKFPFTFDEKRAVQQLRACGVLETIRISAAGFPSRWTYQEFFSRYRVLMKQKDVLS-DRKQTCKNVLEKLILDKDKYQFGKTKIFFRAGQVAYLEKLRADKLRAACIRIQKTIRGWLLRKKYLRMRKAAITMQRYVRGYQARCYAKFLRRTKAATIIQKYWRMYVVRRRYKIRRAATIVLQSYLRGFLARNRYRKILREHKAVIIQKRVRGWLARTHYKRSMHAIIYLQCCFRRMMAKRELKKLKIEARSVERYKKLHIGMENKIMQLQRKVDEQNKDYKCLVEKLTNLEGIYNSETEKLRSDLERLQLSEEEAKVATGRVLSLQEEIAKLRKDLEQTRSEKKCIEEHADR------YKQETEQLVSNLKEENTLLKQEKEALNHRIVQQAKEMTETMEKKLVEETKQLELDLNDERLRYQNLLNEFSRLEERYDDL-KEEMTLMVHVPKPGHKRTDSTHSSNESEYIFSSEIAEMEDIPSRTEEPSEKK---------------------VPLDMSLFLKLQKRVTELEQEKQVMQDELDRKEEQVLR-SKAKEEERPQIRGAELEYESL------KRQELESENKKLKNELNELRKALSEKSAPEVTAPGAPAYRVLMEQLTSVSEELDVRKEEVLILRSQLVSQKEAIQPKDDKNTMTDSTILLEDVQKMK-DKGEIAQAYIGLKETNRLLESQLQSQKRSHENEAEALRGEIQSLKEENNRQQQLLAQNLQLPPEARIEASLQHEITRLTNENLDLMEQLEKQDKTVRKLKKQLKVFAKKIGELEVGQMENISPGQIIDEPIRPVNIPRKEKDFQ--------GMLEYKKEDEQKLVKNLILELKPRGVAVNLIP-GLPAYILFMCVRHADYLNDDQKVRSLLTSTINSIKKVLKKRGDDFETVSFWLSNTCRFLHCLKQYSGEEGFMKHNTSRQNEHCLTNFDLAEYRQVLSDLAIQIYQQLVR-VLENIL-QPMIVSGMLEHETIQGVSGVKPTGLRKRTSSIADEGTYTLDSILRQLNSFHSVMCQHGMDPELIKQVVKQMFYIIGAITLNNLLLRKDMCSWSKGMQIRYNVSQLEEWLRDKNLMNSGAKETLEPLIQAAQLLQVKKKTDDDAEAICSMCNALTTAQIVKVLNLYTPVNEFEERVSVSFIRTIQMRLR-DRKDSP---QLLMDAKHIFPVTFPFNPSSLALETIQIPASLGLGFIS 1826          
BLAST of Dach-2 vs. Ensembl Human
Match: MYO5A (myosin VA [Source:HGNC Symbol;Acc:HGNC:7602])

HSP 1 Score: 1105.12 bits (2857), Expect = 0.000e+0
Identity = 716/1905 (37.59%), Postives = 1087/1905 (57.06%), Query Frame = 2
Query:   47 MALYEMYSKGVKIWIPDEESVWIGATVLQFHKEKN-VIKIITDNGISKELNLSSK-KCAPFLRNPDILIGQKDLTYLSYLNEPEVLYNLQIRFCERREIYTYCGIVLVAINPYQELSIYGKEIINAYHSQNSVDLDPHIFAVAENAFRRMSSFGENQSIIVSGESGAGKTVSAKYTMRYFALVGGSKTKQSFNLTETQIERKVLLSNPILEAFGNAKTIRNDNSSRFGKYLEILFNPRNQVIGANMCTYLLEKSRVVFQNLGERNYHIFYQIVTHCQSEDELLMNTGLVNNVEMYDYLRYGESLEIDGVDDSHEFLITKNSFLQLGIDLNKFKTICEILAAILHLGNIRFRFHDATDSSIIENPELLKLIAGLLGCSIDQLKIWLCFRTISTFQETLHKPLSKAEAQYFRDAFVKTLYSNLFDWIVKQANKVLSTDVSINIKKKLKKTIVVNQEDKKKFIAVLDIYGFETFAENSFEQFCINFANEKLQLQFNLHVFKLEQEEYMNEGLEWTFIDYYNNQPCIDLIESRXXXXXXXXXXXXXXXXSDENWCCKIYSHHLNKSANFNKPKLSNMVFIIEHFAGPVEYKCAGFIEKNRDSVLEEQINLLKASDVQLIAELFRDSEIEIFDTNNXXXXXXXXXXXXXXXXXXQEN--TRKMKKTVGSQFRNSLKSLMDALNKTNPHYVRCIKPNDLKLPFTFCPERAVQQLRACGVLETIRLSAAGFPSRWTYSDFYHRYYILMSNFNVKNHDFKAGSQKIVETLITVPDAFRFGNTKLFFRPGQVALLEKLRGHKIESSVTLIQSILRGSIERKKYLIIHKLTVQIQTYIRRKLAIEKATKLSQIRAVIIIQSFYRMYLARKLFVKMKCAVLAIEKWRRKIITTRLKQAYKKENCVIICQAIVRRFIQRRKFLKIQRGVILIQNHYRRRKAKETLKILKIEARSINHIKFVNKGLENKIIELTQKLDTKEKEM-CXXXXXX--------XXXXXXXXXXXXXXXAESAKIYQNTVQDLQTEIIQLKKELNREIVEKNKI--FADKELLEINYKKKINYL-ENLIEE---LKSSPSVIEPNIICNGDEAQQSICQD--EHQKFI-----NEQMDHQKLVREYEKLEMKYENLYKEFLFVKSSNQKPSINYDNQTSNDSETESTFSKDDADVESLSDKVDAKTTKEHXXXXXXXXXXLPNFISESISTAGDLAVVMQLQMNISSLSQENNRLKETVQQFEDELLKYEQCAEDSKGLVIHNEYDNELLSIIKDIKGMDEHGLKSRLIDEVANLKKKL-KQSNEDYQKLRLHIFDGSMSKLTGNLDHESINSEEEELKRA-FESQKEANRK------------MLKEIEGIKANNVDLKKALFQIRKDKEQLQVQLGKQHLMIRHGVEYL----QNLK---------------LTPKERLDKFVQNEISRILLENLKLQERNDQIISETIELKRGLKYFAFRLQKYEGSLVPNPNKEEDLLQLIQNVIYHSKMKTIGKRECYSEIGLIDLNMSELSIFIKSFIFDLSP-SICLQYEPYHLVPYIIFMVTRKFDFYKEEDQMTNFLSKLIVALKRTIRKRRNYIEYLVMLLSNVFCLVNLXXXXXXXXXXXXLNTAEDIQHYFVHYDLNEFIRLLKELCVTLFQMILKTIVDNLLPQSLCIDAILVHEAI--IDFLSKDGTKYKSNIETQPKNTSFNVLTKNLQSVLEILKNHKIPQLIINQIFVHIAYLINAYCLNTLLFRTDLCYFSKGLQIKYNLSSFETWIRYQKLIDSGALQCLRPMTEAVQLLQTLIDSDEDAKFVCDMCEYLNTRQVVKILNNFNPRDGYGCRLSSGLIAKIETQMKIKRGDEPSESKLETPTVIEIPIDIPFIHNGVSLCRTIIPKPLYLSCLT 5575
            MA  E+Y+K  ++WIPD E VW  A +L+ +K  + V+ +  + G   E +L  K K  P LRNPDIL+G+ DLT LSYL+EP VL+NL++RF + + IYTYCGIVLVAINPY++L IYG++IINAY  QN  D+DPHIFAVAE A+++M+    NQSIIVSGESGAGKTVSAKY MRYFA V GS        +E  +E KVL SNPI+E+ GNAKT RNDNSSRFGKY+EI F+ R ++IGANM TYLLEKSRVVFQ   ERNYHIFYQ+    +  +  ++  G   N + ++Y + G S  I+GVDD+ E   T+ +   LGI  +    I  ILA ILHLGN+ F   DA   +I    E L +   L+G   +++  WLC R ++T  ET  KP+SK +A   RDA  K +Y+ LF+WIV   N+ L + V                  +  FI VLDIYGFETF  NSFEQFCIN+ANEKLQ QFN+HVFKLEQEEYM E + WT ID+Y+NQPCI+LIES+LG+LDLLDEECK+ KG+D+ W  K+Y+ HLNK A F KP+LSN  FII+HFA  VEY+C GF+EKN+D+V EEQI +LK+S  +++ ELF+D E  I  T+ +    +  + T +  +  +     ++ KKTVG QFRNSL  LM+ LN T PHYVRCIKPND K PFTF  +RAVQQLRACGVLETIR+SAAGFPSRWTY +F+ RY +LM   +V + D K   + ++E LI   D ++FG TK+FFR GQVA LEKLR  K+ ++   IQ  +RG + RKKYL + K  + +Q Y+R   A   A  L + +A  IIQ ++RMY+ R+ +   + A + ++ + R  +     +   +E+  +I Q  VR ++ R  + +    +I +Q  +RR  AK  LK LKIEARS+   K ++ G+ENKI++L +K+D + K+  CL++             EK    L       E AK+    V  LQ EI +L+K+L +   EK  I   AD+      YK++   L  NL EE   LK     +   I+    E  +++ +   E  K +     +E++ +Q L+ E+ +LE +Y++L KE + +     KP     + T + +E+E  FS + A++E +  + +  + K+                        D+++ ++LQ  ++ L QE   +++ + + E+++L+  +  E+ +  +   E + E L      K  +      +L +E+  L+K L ++S  +        +   M +LT   +   +  EE  + R+   SQKEA +             +L++++ +K +  ++ +A   +++    L+ QL  Q     +  E L    Q+LK               L P+ R++  +Q+EI+R+  ENL L E+ ++      +LK+ LK FA ++ + E   + N +  + + + I+ V    K K           G+++    +    +K+ I    P  + +   P  L  YI+FM  R  D+  ++ ++ + L+  I ++K+ ++KR +  E +   LSN    ++  +QYSG + F   NT+   +H   ++DL E+ ++L +L + ++Q +++ +++N+L Q + +  +L HE I  +  +   G + +++        + + + + L S   ++  H +   +I Q+   + Y+I A  LN LL R D+C +SKG+QI+YN+S  E W+R + L++SGA + L P+ +A QLLQ    +D+DA+ +C MC  L T Q+VK+LN + P + +  R+S   I  I+ +++  R D P   +L        P+  PF  + ++L    IP  L L  ++
Sbjct:    1 MAASELYTKFARVWIPDPEEVWKSAELLKDYKPGDKVLLLHLEEGKDLEYHLDPKTKELPHLRNPDILVGENDLTALSYLHEPAVLHNLRVRFIDSKLIYTYCGIVLVAINPYEQLPIYGEDIINAYSGQNMGDMDPHIFAVAEEAYKQMARDERNQSIIVSGESGAGKTVSAKYAMRYFATVSGSA-------SEANVEEKVLASNPIMESIGNAKTTRNDNSSRFGKYIEIGFDKRYRIIGANMRTYLLEKSRVVFQAEEERNYHIFYQLCASAKLPEFKMLRLG---NADNFNYTKQGGSPVIEGVDDAKEMAHTRQACTLLGISESHQMGIFRILAGILHLGNVGFTSRDADSCTIPPKHEPLCIFCELMGVDYEEMCHWLCHRKLATATETYIKPISKLQATNARDALAKHIYAKLFNWIVDNVNQALHSAVK-----------------QHSFIGVLDIYGFETFEINSFEQFCINYANEKLQQQFNMHVFKLEQEEYMKEQIPWTLIDFYDNQPCINLIESKLGILDLLDEECKMPKGTDDTWAQKLYNTHLNKCALFEKPRLSNKAFIIQHFADKVEYQCEGFLEKNKDTVFEEQIKVLKSSKFKMLPELFQDDEKAISPTSATSSGRTPLTRTPAKPTKGRPGQMAKEHKKTVGHQFRNSLHLLMETLNATTPHYVRCIKPNDFKFPFTFDEKRAVQQLRACGVLETIRISAAGFPSRWTYQEFFSRYRVLMKQKDVLS-DRKQTCKNVLEKLILDKDKYQFGKTKIFFRAGQVAYLEKLRADKLRAACIRIQKTIRGWLLRKKYLRMRKAAITMQRYVRGYQARCYAKFLRRTKAATIIQKYWRMYVVRRRYKIRRAATIVLQSYLRGFLARNRYRKILREHKAVIIQKRVRGWLARTHYKRSMHAIIYLQCCFRRMMAKRELKKLKIEARSVERYKKLHIGMENKIMQLQRKVDEQNKDYKCLVEKLTNLEGIYNSETEKLRSDLERLQLSEEEAKVATGRVLSLQEEIAKLRKDLEQTRSEKKCIEEHADR------YKQETEQLVSNLKEENTLLKQEKEALNHRIVQQAKEMTETMEKKLVEETKQLELDLNDERLRYQNLLNEFSRLEERYDDL-KEEMTLMVHVPKPGHKRTDSTHSSNESEYIFSSEIAEMEDIPSRTEEPSEKK---------------------VPLDMSLFLKLQKRVTELEQEKQVMQDELDRKEEQVLR-SKAKEEERPQIRGAELEYESL------KRQELESENKKLKNELNELRKALSEKSAPEVTAPGAPAYRVLMEQLTSVSEELDVRKEEVLILRSQLVSQKEAIQPKDDKNTMTDSTILLEDVQKMK-DKGEIAQAYIGLKETNRLLESQLQSQKRSHENEAEALRGEIQSLKEENNRQQQLLAQNLQLPPEARIEASLQHEITRLTNENLDLMEQLEKQDKTVRKLKKQLKVFAKKIGELEVGQMENISPGQIIDEPIRPVNIPRKEKDFQ--------GMLEYKKEDEQKLVKNLILGNKPRGVAVNLIP-GLPAYILFMCVRHADYLNDDQKVRSLLTSTINSIKKVLKKRGDDFETVSFWLSNTCRFLHCLKQYSGEEGFMKHNTSRQNEHCLTNFDLAEYRQVLSDLAIQIYQQLVR-VLENIL-QPMIVSGMLEHETIQGVSGVKPTGLRKRTSSIADEGTYTLDSILRQLNSFHSVMCQHGMDPELIKQVVKQMFYIIGAITLNNLLLRKDMCSWSKGMQIRYNVSQLEEWLRDKNLMNSGAKETLEPLIQAAQLLQVKKKTDDDAEAICSMCNALTTAQIVKVLNLYTPVNEFEERVSVSFIRTIQMRLR-DRKDSP---QLLMDAKHIFPVTFPFNPSSLALETIQIPASLGLGFIS 1826          
BLAST of Dach-2 vs. Ensembl Human
Match: MYO5A (myosin VA [Source:HGNC Symbol;Acc:HGNC:7602])

HSP 1 Score: 1097.03 bits (2836), Expect = 0.000e+0
Identity = 717/1933 (37.09%), Postives = 1090/1933 (56.39%), Query Frame = 2
Query:   47 MALYEMYSKGVKIWIPDEESVWIGATVLQFHKEKN-VIKIITDNGISKELNLSSK-KCAPFLRNPDILIGQKDLTYLSYLNEPEVLYNLQIRFCERREIYTYCGIVLVAINPYQELSIYGKEIINAYHSQNSVDLDPHIFAVAENAFRRMSSFGENQSIIVSGESGAGKTVSAKYTMRYFALVGGSKTKQSFNLTETQIERKVLLSNPILEAFGNAKTIRNDNSSRFGKYLEILFNPRNQVIGANMCTYLLEKSRVVFQNLGERNYHIFYQIVTHCQSEDELLMNTGLVNNVEMYDYLRYGESLEIDGVDDSHEFLITKNSFLQLGIDLNKFKTICEILAAILHLGNIRFRFHDATDSSIIENPELLKLIAGLLGCSIDQLKIWLCFRTISTFQETLHKPLSKAEAQYFRDAFVKTLYSNLFDWIVKQANKVLSTDVSINIKKKLKKTIVVNQEDKKKFIAVLDIYGFETFAENSFEQFCINFANEKLQLQFNLHVFKLEQEEYMNEGLEWTFIDYYNNQPCIDLIESRXXXXXXXXXXXXXXXXSDENWCCKIYSHHLNKSANFNKPKLSNMVFIIEHFAGPVEYKCAGFIEKNRDSVLEEQINLLKASDVQLIAELFRDSEIEIFDTNNXXXXXXXXXXXXXXXXXXQEN--TRKMKKTVGSQFRNSLKSLMDALNKTNPHYVRCIKPNDLKLPFTFCPERAVQQLRACGVLETIRLSAAGFPSRWTYSDFYHRYYILMSNFNVKNHDFKAGSQKIVETLITVPDAFRFGNTKLFFRPGQVALLEKLRGHKIESSVTLIQSILRGSIERKKYLIIHKLTVQIQTYIRRKLAIEKATKLSQIRAVIIIQSFYRMYLARKLFVKMKCAVLAIEKWRRKIITTRLKQAYKKENCVIICQAIVRRFIQRRKFLKIQRGVILIQNHYRRRKAKETLKILKIEARSINHIKFVNKGLENKIIELTQKLDTKEKEM-CXXXXXX--------XXXXXXXXXXXXXXXAESAKIYQNTVQDLQTEIIQLKKELNREIVEKNKI--FADKELLEINYKKKINYL-ENLIEE---LKSSPSVIEPNIICNGDEAQQSICQD--EHQKFI-----NEQMDHQKLVREYEKLEMKYENLYKEFLFVKSSNQKPSINYDNQTSNDSETESTFSKDDADVESLSDKVDAKTTKEHXXXXXXXXXXLPNFISESISTAGDLAVVMQLQMNISSLSQENNRLKETVQQFEDELLKYEQCAEDSKGLVIHNEYDNELLSIIKDIKGMDEHGLKSRLIDEVANLKKKL-KQSNEDYQKLRLHIFDGSMSKLTGNLDHESINSEEEELKRA-FESQKEANRK------------MLKEIEGIKANNVDLKKALFQIRKDKEQLQVQLGKQHLMIRHGVEYL----QNLK---------------LTPKERLDKFVQNEISRILLENLKLQ----------------------------ERNDQIISETIELKRGLKYFAFRLQKYEGSLVPNPNKEEDLLQLIQNVIYHSKMKTIGKRECYSEIGLIDLNMSELSIFIKSFIFDLSP-SICLQYEPYHLVPYIIFMVTRKFDFYKEEDQMTNFLSKLIVALKRTIRKRRNYIEYLVMLLSNVFCLVNLXXXXXXXXXXXXLNTAEDIQHYFVHYDLNEFIRLLKELCVTLFQMILKTIVDNLLPQSLCIDAILVHEAI--IDFLSKDGTKYKSNIETQPKNTSFNVLTKNLQSVLEILKNHKIPQLIINQIFVHIAYLINAYCLNTLLFRTDLCYFSKGLQIKYNLSSFETWIRYQKLIDSGALQCLRPMTEAVQLLQTLIDSDEDAKFVCDMCEYLNTRQVVKILNNFNPRDGYGCRLSSGLIAKIETQMKIKRGDEPSESKLETPTVIEIPIDIPFIHNGVSLCRTIIPKPLYLSCLT 5575
            MA  E+Y+K  ++WIPD E VW  A +L+ +K  + V+ +  + G   E +L  K K  P LRNPDIL+G+ DLT LSYL+EP VL+NL++RF + + IYTYCGIVLVAINPY++L IYG++IINAY  QN  D+DPHIFAVAE A+++M+    NQSIIVSGESGAGKTVSAKY MRYFA V GS        +E  +E KVL SNPI+E+ GNAKT RNDNSSRFGKY+EI F+ R ++IGANM TYLLEKSRVVFQ   ERNYHIFYQ+    +  +  ++  G   N + ++Y + G S  I+GVDD+ E   T+ +   LGI  +    I  ILA ILHLGN+ F   DA   +I    E L +   L+G   +++  WLC R ++T  ET  KP+SK +A   RDA  K +Y+ LF+WIV   N+ L + V                  +  FI VLDIYGFETF  NSFEQFCIN+ANEKLQ QFN+HVFKLEQEEYM E + WT ID+Y+NQPCI+LIES+LG+LDLLDEECK+ KG+D+ W  K+Y+ HLNK A F KP+LSN  FII+HFA  VEY+C GF+EKN+D+V EEQI +LK+S  +++ ELF+D E  I  T+ +    +  + T +  +  +     ++ KKTVG QFRNSL  LM+ LN T PHYVRCIKPND K PFTF  +RAVQQLRACGVLETIR+SAAGFPSRWTY +F+ RY +LM   +V + D K   + ++E LI   D ++FG TK+FFR GQVA LEKLR  K+ ++   IQ  +RG + RKKYL + K  + +Q Y+R   A   A  L + +A  IIQ ++RMY+ R+ +   + A + ++ + R  +     +   +E+  +I Q  VR ++ R  + +    +I +Q  +RR  AK  LK LKIEARS+   K ++ G+ENKI++L +K+D + K+  CL++             EK    L       E AK+    V  LQ EI +L+K+L +   EK  I   AD+      YK++   L  NL EE   LK     +   I+    E  +++ +   E  K +     +E++ +Q L+ E+ +LE +Y++L KE + +     KP     + T + +E+E  FS + A++E +  + +  + K+                        D+++ ++LQ  ++ L QE   +++ + + E+++L+  +  E+ +  +   E + E L      K  +      +L +E+  L+K L ++S  +        +   M +LT   +   +  EE  + R+   SQKEA +             +L++++ +K +  ++ +A   +++    L+ QL  Q     +  E L    Q+LK               L P+ R++  +Q+EI+R+  ENL  +                            E+ D+ +    +LK+ LK FA ++ + E   + N +  + + + I+ V    K K           G+++    +    +K+ I +L P  + +   P  L  YI+FM  R  D+  ++ ++ + L+  I ++K+ ++KR +  E +   LSN    ++  +QYSG + F   NT+   +H   ++DL E+ ++L +L + ++Q +++ +++N+L Q + +  +L HE I  +  +   G + +++        + + + + L S   ++  H +   +I Q+   + Y+I A  LN LL R D+C +SKG+QI+YN+S  E W+R + L++SGA + L P+ +A QLLQ    +D+DA+ +C MC  L T Q+VK+LN + P + +  R+S   I  I+ +++  R D P   +L        P+  PF  + ++L    IP  L L  ++
Sbjct:    1 MAASELYTKFARVWIPDPEEVWKSAELLKDYKPGDKVLLLHLEEGKDLEYHLDPKTKELPHLRNPDILVGENDLTALSYLHEPAVLHNLRVRFIDSKLIYTYCGIVLVAINPYEQLPIYGEDIINAYSGQNMGDMDPHIFAVAEEAYKQMARDERNQSIIVSGESGAGKTVSAKYAMRYFATVSGSA-------SEANVEEKVLASNPIMESIGNAKTTRNDNSSRFGKYIEIGFDKRYRIIGANMRTYLLEKSRVVFQAEEERNYHIFYQLCASAKLPEFKMLRLG---NADNFNYTKQGGSPVIEGVDDAKEMAHTRQACTLLGISESHQMGIFRILAGILHLGNVGFTSRDADSCTIPPKHEPLCIFCELMGVDYEEMCHWLCHRKLATATETYIKPISKLQATNARDALAKHIYAKLFNWIVDNVNQALHSAVK-----------------QHSFIGVLDIYGFETFEINSFEQFCINYANEKLQQQFNMHVFKLEQEEYMKEQIPWTLIDFYDNQPCINLIESKLGILDLLDEECKMPKGTDDTWAQKLYNTHLNKCALFEKPRLSNKAFIIQHFADKVEYQCEGFLEKNKDTVFEEQIKVLKSSKFKMLPELFQDDEKAISPTSATSSGRTPLTRTPAKPTKGRPGQMAKEHKKTVGHQFRNSLHLLMETLNATTPHYVRCIKPNDFKFPFTFDEKRAVQQLRACGVLETIRISAAGFPSRWTYQEFFSRYRVLMKQKDVLS-DRKQTCKNVLEKLILDKDKYQFGKTKIFFRAGQVAYLEKLRADKLRAACIRIQKTIRGWLLRKKYLRMRKAAITMQRYVRGYQARCYAKFLRRTKAATIIQKYWRMYVVRRRYKIRRAATIVLQSYLRGFLARNRYRKILREHKAVIIQKRVRGWLARTHYKRSMHAIIYLQCCFRRMMAKRELKKLKIEARSVERYKKLHIGMENKIMQLQRKVDEQNKDYKCLVEKLTNLEGIYNSETEKLRSDLERLQLSEEEAKVATGRVLSLQEEIAKLRKDLEQTRSEKKCIEEHADR------YKQETEQLVSNLKEENTLLKQEKEALNHRIVQQAKEMTETMEKKLVEETKQLELDLNDERLRYQNLLNEFSRLEERYDDL-KEEMTLMVHVPKPGHKRTDSTHSSNESEYIFSSEIAEMEDIPSRTEEPSEKK---------------------VPLDMSLFLKLQKRVTELEQEKQVMQDELDRKEEQVLR-SKAKEEERPQIRGAELEYESL------KRQELESENKKLKNELNELRKALSEKSAPEVTAPGAPAYRVLMEQLTSVSEELDVRKEEVLILRSQLVSQKEAIQPKDDKNTMTDSTILLEDVQKMK-DKGEIAQAYIGLKETNRLLESQLQSQKRSHENEAEALRGEIQSLKEENNRQQQLLAQNLQLPPEARIEASLQHEITRLTNENLYFEELYADDPKKYQSYRISLYKRMIDLMEQLEKQDKTVR---KLKKQLKVFAKKIGELEVGQMENISPGQIIDEPIRPVNIPRKEKDFQ--------GMLEYKKEDEQKLVKNLILELKPRGVAVNLIP-GLPAYILFMCVRHADYLNDDQKVRSLLTSTINSIKKVLKKRGDDFETVSFWLSNTCRFLHCLKQYSGEEGFMKHNTSRQNEHCLTNFDLAEYRQVLSDLAIQIYQQLVR-VLENIL-QPMIVSGMLEHETIQGVSGVKPTGLRKRTSSIADEGTYTLDSILRQLNSFHSVMCQHGMDPELIKQVVKQMFYIIGAITLNNLLLRKDMCSWSKGMQIRYNVSQLEEWLRDKNLMNSGAKETLEPLIQAAQLLQVKKKTDDDAEAICSMCNALTTAQIVKVLNLYTPVNEFEERVSVSFIRTIQMRLR-DRKDSP---QLLMDAKHIFPVTFPFNPSSLALETIQIPASLGLGFIS 1851          
BLAST of Dach-2 vs. Ensembl Human
Match: MYO5A (myosin VA [Source:HGNC Symbol;Acc:HGNC:7602])

HSP 1 Score: 1095.49 bits (2832), Expect = 0.000e+0
Identity = 722/1919 (37.62%), Postives = 1093/1919 (56.96%), Query Frame = 2
Query:   47 MALYEMYSKGVKIWIPDEESVWIGATVLQFHKEKN-VIKIITDNGISKELNLSSK-KCAPFLRNPDILIGQKDLTYLSYLNEPEVLYNLQIRFCERREIYTYCGIVLVAINPYQELSIYGKEIINAYHSQNSVDLDPHIFAVAENAFRRMSSFGENQSIIVSGESGAGKTVSAKYTMRYFALVGGSKTKQSFNLTETQIERKVLLSNPILEAFGNAKTIRNDNSSRFGKYLEILFNPRNQVIGANMCTYLLEKSRVVFQNLGERNYHIFYQIVTHCQSEDELLMNTGLVNNVEMYDYLRYGESLEIDGVDDSHEFLITKNSFLQLGIDLNKFKTICEILAAILHLGNIRFRFHDATDSSIIENPELLKLIAGLLGCSIDQLKIWLCFRTISTFQETLHKPLSKAEAQYFRDAFVKTLYSNLFDWIVKQANKVLSTDVSINIKKKLKKTIVVNQEDKKKFIAVLDIYGFETFAENSFEQFCINFANEKLQLQFNLHVFKLEQEEYMNEGLEWTFIDYYNNQPCIDLIESRXXXXXXXXXXXXXXXXSDENWCCKIYSHHLNKSANFNKPKLSNMVFIIEHFAGPVEYKCAGFIEKNRDSVLEEQINLLKASDVQLIAELFRDSEIEIFDTNNXXXXXXXXXXXXXXXXXXQEN--TRKMKKTVGSQFRNSLKSLMDALNKTNPHYVRCIKPNDLKLPFTFCPERAVQQLRACGVLETIRLSAAGFPSRWTYSDFYHRYYILMSNFNVKNHDFKAGSQKIVETLITVPDAFRFGNTKLFFRPGQVALLEKLRGHKIESSVTLIQSILRGSIERKKYLIIHKLTVQIQTYIRRKLAIEKATKLSQIRAVIIIQSFYRMYLARKLFVKMKCAVLAIEKWRRKIITTRLKQAYKKENCVIICQAIVRRFIQRRKFLKIQRGVILIQNHYRRRKAKETLKILKIEARSINHIKFVNKGLENKIIELTQKLDTKEKEM-CXXXXXX--------XXXXXXXXXXXXXXXAESAKIYQNTVQDLQTEIIQLKKELNREIVEKNKI--FADKELLEINYKKKINYL-ENLIEE---LKSSPSVIEPNIICNGDEAQQSICQD--EHQKFI-----NEQMDHQKLVREYEKLEMKYENLYKEFLFVKSSNQKPSINYDNQTSNDSETESTFSKDDADVESLSDKVDAKTTKEHXXXXXXXXXXLPNFISESISTAGDLAVVMQLQMN------ISSLSQENNRLKETVQQFEDELLKYEQCAEDSK------------------------GLVIHNEYDNELLSIIK--DIKGMDEHGLKSRLIDEVANLKKKLKQSN--------EDYQKLR-----LHIFDG-SMSKLTGNLDHESINSEEEELKRAFESQKEANRKMLKEIEGIKANNVDLKKAL-FQIRKDKEQLQVQLGKQHLMIRHGVEYLQNLKLTPKERLDKFVQNEISRILLENLKLQERNDQIISETIELKRGLKYFAFRLQKYEGSLVPNPNKEEDLLQLIQNVIYHSKMKTIGKRECYSEIGLIDLNMSELSIFIKSFIFDLSP-SICLQYEPYHLVPYIIFMVTRKFDFYKEEDQMTNFLSKLIVALKRTIRKRRNYIEYLVMLLSNVFCLVNLXXXXXXXXXXXXLNTAEDIQHYFVHYDLNEFIRLLKELCVTLFQMILKTIVDNLLPQSLCIDAILVHEAI--IDFLSKDGTKYKSNIETQPKNTSFNVLTKNLQSVLEILKNHKIPQLIINQIFVHIAYLINAYCLNTLLFRTDLCYFSKGLQIKYNLSSFETWIRYQKLIDSGALQCLRPMTEAVQLLQTLIDSDEDAKFVCDMCEYLNTRQVVKILNNFNPRDGYGCRLSSGLIAKIETQMKIKRGDEPSESKLETPTVIEIPIDIPFIHNGVSLCRTIIPKPLYLSCLT 5575
            MA  E+Y+K  ++WIPD E VW  A +L+ +K  + V+ +  + G   E +L  K K  P LRNPDIL+G+ DLT LSYL+EP VL+NL++RF + + IYTYCGIVLVAINPY++L IYG++IINAY  QN  D+DPHIFAVAE A+++M+    NQSIIVSGESGAGKTVSAKY MRYFA V GS +       E  +E KVL SNPI+E+ GNAKT RNDNSSRFGKY+EI F+ R ++IGANM TYLLEKSRVVFQ   ERNYHIFYQ+    +  +  ++  G   N + ++Y + G S  I+GVDD+ E   T+ +   LGI  +    I  ILA ILHLGN+ F   DA   +I    E L +   L+G   +++  WLC R ++T  ET  KP+SK +A   RDA  K +Y+ LF+WIV   N+ L + V                  +  FI VLDIYGFETF  NSFEQFCIN+ANEKLQ QFN+HVFKLEQEEYM E + WT ID+Y+NQPCI+LIES+LG+LDLLDEECK+ KG+D+ W  K+Y+ HLNK A F KP+LSN  FII+HFA  VEY+C GF+EKN+D+V EEQI +LK+S  +++ ELF+D E  I  T+ +    +  + T +  +  +     ++ KKTVG QFRNSL  LM+ LN T PHYVRCIKPND K PFTF  +RAVQQLRACGVLETIR+SAAGFPSRWTY +F+ RY +LM   +V + D K   + ++E LI   D ++FG TK+FFR GQVA LEKLR  K+ ++   IQ  +RG + RKKYL + K  + +Q Y+R   A   A  L + +A  IIQ ++RMY+ R+ +   + A + ++ + R  +     +   +E+  +I Q  VR ++ R  + +    +I +Q  +RR  AK  LK LKIEARS+   K ++ G+ENKI++L +K+D + K+  CL++             EK    L       E AK+    V  LQ EI +L+K+L +   EK  I   AD+      YK++   L  NL EE   LK     +   I+    E  +++ +   E  K +     +E++ +Q L+ E+ +LE +Y++L KE + +     KP     + T + +E+E  FS + A++E +  +     T+E   K   +   L   + + ++       VMQ +++      + S ++E  R +    + E E LK ++   ++K                        G   +     +L S+ +  D++  +   L+S+L+ +   ++ K  ++         ED QK++        + G   +  +  LD+  +N E+ EL   +E  K+ANR +  +++  K ++ +  +AL  +I+  KE+            R      QNL+L P+ R++  +Q+EI+R+  ENL L E+ ++      +LK+ LK FA ++ + E   + N +  + + + I+ V    K K           G+++    +    +K+ I    P  + +   P  L  YI+FM  R  D+  ++ ++ + L+  I ++K+ ++KR +  E +   LSN    ++  +QYSG + F   NT+   +H   ++DL E+ ++L +L + ++Q +++ +++N+L Q + +  +L HE I  +  +   G + +++        + + + + L S   ++  H +   +I Q+   + Y+I A  LN LL R D+C +SKG+QI+YN+S  E W+R + L++SGA + L P+ +A QLLQ    +D+DA+ +C MC  L T Q+VK+LN + P + +  R+S   I  I+ +++  R D P   +L        P+  PF  + ++L    IP  L L  ++
Sbjct:    1 MAASELYTKFARVWIPDPEEVWKSAELLKDYKPGDKVLLLHLEEGKDLEYHLDPKTKELPHLRNPDILVGENDLTALSYLHEPAVLHNLRVRFIDSKLIYTYCGIVLVAINPYEQLPIYGEDIINAYSGQNMGDMDPHIFAVAEEAYKQMARDERNQSIIVSGESGAGKTVSAKYAMRYFATVSGSAS-------EANVEEKVLASNPIMESIGNAKTTRNDNSSRFGKYIEIGFDKRYRIIGANMRTYLLEKSRVVFQAEEERNYHIFYQLCASAKLPEFKMLRLG---NADNFNYTKQGGSPVIEGVDDAKEMAHTRQACTLLGISESHQMGIFRILAGILHLGNVGFTSRDADSCTIPPKHEPLCIFCELMGVDYEEMCHWLCHRKLATATETYIKPISKLQATNARDALAKHIYAKLFNWIVDNVNQALHSAVK-----------------QHSFIGVLDIYGFETFEINSFEQFCINYANEKLQQQFNMHVFKLEQEEYMKEQIPWTLIDFYDNQPCINLIESKLGILDLLDEECKMPKGTDDTWAQKLYNTHLNKCALFEKPRLSNKAFIIQHFADKVEYQCEGFLEKNKDTVFEEQIKVLKSSKFKMLPELFQDDEKAISPTSATSSGRTPLTRTPAKPTKGRPGQMAKEHKKTVGHQFRNSLHLLMETLNATTPHYVRCIKPNDFKFPFTFDEKRAVQQLRACGVLETIRISAAGFPSRWTYQEFFSRYRVLMKQKDVLS-DRKQTCKNVLEKLILDKDKYQFGKTKIFFRAGQVAYLEKLRADKLRAACIRIQKTIRGWLLRKKYLRMRKAAITMQRYVRGYQARCYAKFLRRTKAATIIQKYWRMYVVRRRYKIRRAATIVLQSYLRGFLARNRYRKILREHKAVIIQKRVRGWLARTHYKRSMHAIIYLQCCFRRMMAKRELKKLKIEARSVERYKKLHIGMENKIMQLQRKVDEQNKDYKCLVEKLTNLEGIYNSETEKLRSDLERLQLSEEEAKVATGRVLSLQEEIAKLRKDLEQTRSEKKCIEEHADR------YKQETEQLVSNLKEENTLLKQEKEALNHRIVQQAKEMTETMEKKLVEETKQLELDLNDERLRYQNLLNEFSRLEERYDDL-KEEMTLMVHVPKPGHKRTDSTHSSNESEYIFSSEIAEMEDIPSR-----TEEPSEKKVPLDMSLFLKLQKRVTELEQEKQVMQDELDRKEEQVLRSKAKEEERPQIRGAELEYESLKRQELESENKKLKNELNELRKALSEKSAPEVTAPGAPAYRVLMEQLTSVSEELDVRKEEVLILRSQLVSQKEAIQPKDDKNTMTDSTILLEDVQKMKDKGEIAQAYIGLKETNRSSALDYHELN-EDGELWLVYEGLKQANRLLESQLQSQKRSHENEAEALRGEIQSLKEENN----------RQQQLLAQNLQLPPEARIEASLQHEITRLTNENLDLMEQLEKQDKTVRKLKKQLKVFAKKIGELEVGQMENISPGQIIDEPIRPVNIPRKEKDFQ--------GMLEYKKEDEQKLVKNLILGNKPRGVAVNLIP-GLPAYILFMCVRHADYLNDDQKVRSLLTSTINSIKKVLKKRGDDFETVSFWLSNTCRFLHCLKQYSGEEGFMKHNTSRQNEHCLTNFDLAEYRQVLSDLAIQIYQQLVR-VLENIL-QPMIVSGMLEHETIQGVSGVKPTGLRKRTSSIADEGTYTLDSILRQLNSFHSVMCQHGMDPELIKQVVKQMFYIIGAITLNNLLLRKDMCSWSKGMQIRYNVSQLEEWLRDKNLMNSGAKETLEPLIQAAQLLQVKKKTDDDAEAICSMCNALTTAQIVKVLNLYTPVNEFEERVSVSFIRTIQMRLR-DRKDSP---QLLMDAKHIFPVTFPFNPSSLALETIQIPASLGLGFIS 1853          
BLAST of Dach-2 vs. Ensembl Human
Match: MYO5B (myosin VB [Source:HGNC Symbol;Acc:HGNC:7603])

HSP 1 Score: 1091.26 bits (2821), Expect = 0.000e+0
Identity = 716/1915 (37.39%), Postives = 1064/1915 (55.56%), Query Frame = 2
Query:   47 MALYEMYSKGVKIWIPDEESVWIGATVLQFHKE--KNVIKIITDNGISKELNLSSKKCAPFLRNPDILIGQKDLTYLSYLNEPEVLYNLQIRFCERREIYTYCGIVLVAINPYQELSIYGKEIINAYHSQNSVDLDPHIFAVAENAFRRMSSFGENQSIIVSGESGAGKTVSAKYTMRYFALVGGSKTKQSFNLTETQIERKVLLSNPILEAFGNAKTIRNDNSSRFGKYLEILFNPRNQVIGANMCTYLLEKSRVVFQNLGERNYHIFYQIVTHCQSEDELLMNTGLVNNVEMYDYLRYGESLEIDGVDDSHEFLITKNSFLQLGIDLNKFKTICEILAAILHLGNIRFRFHDATDSSIIENPEL-LKLIAGLLGCSIDQLKIWLCFRTISTFQETLHKPLSKAEAQYFRDAFVKTLYSNLFDWIVKQANKVLSTDVSINIKKKLKKTIVVNQEDKKKFIAVLDIYGFETFAENSFEQFCINFANEKLQLQFNLHVFKLEQEEYMNEGLEWTFIDYYNNQPCIDLIESRXXXXXXXXXXXXXXXXSDENWCCKIYSHHLNKSANFNKPKLSNMVFIIEHFAGPVEYKCAGFIEKNRDSVLEEQINLLKASDVQLIAELFRDSEIEIFDTNNXXXXXXXXXXXXXXXXXXQENTRKMKKTVGSQFRNSLKSLMDALNKTNPHYVRCIKPNDLKLPFTFCPERAVQQLRACGVLETIRLSAAGFPSRWTYSDFYHRYYILMSNFNVKNHDFKAGSQKIVETLITVPDAFRFGNTKLFFRPGQVALLEKLRGHKIESSVTLIQSILRGSIERKKYLIIHKLTVQIQTYIRRKLAIEKATKLSQIRAVIIIQSFYRMYLARKLFVKMKCAVLAIEKWRRKIITTRLKQAYKKENCVIICQAIVRRFIQRRKFLKIQRGVILIQNHYRRRKAKETLKILKIEARSINHIKFVNKGLENKIIELTQKLDTKEKEMCXXXXXXXXXXXXXXXXXXXXXAESAKIYQNTVQD----LQTEIIQLKKELNREIVEKNKIFADKELLEIN-YKKKINYLENLIEELKSSPSVIEPNIICNGDE--AQQSICQDEHQKFINEQMD-HQKLVREYEKLEMKYENLYKEFLFVKSSNQKPSINYDNQTSNDSETESTFSKDDADVESLSDKVDAKTTKEHXXXXXXXXXXLPNFISESISTAGDLAVVMQLQMNISSLSQENNRLKETVQQFEDELLKYEQCAEDSKGLVIHNEYD----------------------NELLSIIKD--IKGMDEHGLK---SRLIDEVANLKKKLKQSNEDYQKLRLHIFDGSMSKLTGNLDHESINS-----------EEEELKRAFESQKEANRKMLKEIEGIKANNVDLKKALFQIRKDKEQLQVQLGKQHL-------------------MIRHGVEYLQNLKLTPKERLDKFVQNEISRILLENLKLQERNDQIISETIELKRGLKYFAFRLQKYEG--SLVPNPNKEEDLLQLIQNVIYHSKMKTIGKRECYSEIGLIDLNMSELSIFIKSFIFDLSPSICLQYEPYHLVPYIIFMVTRKFDFYKEEDQMTNFLSKLIVALKRTIRKRRNYIEYLVMLLSNVFCLVNLXXXXXXXXXXXXLNTAEDIQHYFVHYDLNEFIRLLKELCVTLFQMILKTIVDNLLPQSLCIDAILVHEAIIDFLSKDGTKYK---SNIETQPKNTSFNVLTKNLQSVLEILKNHKIPQLIINQIFVHIAYLINAYCLNTLLFRTDLCYFSKGLQIKYNLSSFETWIRYQKLIDSGALQCLRPMTEAVQLLQTLIDSDEDAKFVCDMCEYLNTRQVVKILNNFNPRDGYGCRLSSGLIAKIETQMKIKRGDEPSESKLETPTVIEIPIDIPFIHNGVSLCRTIIPKPLYLSCL 5572
            M++ E+YS+  ++WIPD + VW  A + + +KE  K++   + D  I +      +   PFLRNPDIL+G+ DLT LSYL+EP VL+NL++RF E   IYTYCGIVLVAINPY++L IYG+++I  Y  QN  D+DPHIFAVAE A+++M+   +NQSIIVSGESGAGKTVSAKY MRYFA VGGS +       ET IE KVL S+PI+EA GNAKT RNDNSSRFGKY++I F+ R  +IGANM TYLLEKSRVVFQ   ERNYHIFYQ+   C +          + + E + Y   G    I+GVDD+ +F  T+ +F  LG+  +   +I +I+A+ILHLG++  +     DS  I   ++ L     LLG    Q++ WLC R + T  ET  K +S  +    R+A  K +Y+ LF WIV+  NK L T +                  +  FI VLDIYGFETF  NSFEQFCIN+ANEKLQ QFN HVFKLEQEEYM E + WT ID+Y+NQPCIDLIE++LG+LDLLDEECK+ KG+D+NW  K+Y  H + S +F KP++SN  FII HFA  VEY   GF+EKNRD+V EEQIN+LKAS   L+A+LF D +  +  T   K   S  S   +   +K  N ++ KKTVG QFR SL  LM+ LN T PHYVRCIKPND KLPF F P+RAVQQLRACGVLETIR+SAAG+PSRW Y DF++RY +L+    + N D KA  + ++E LI  PD F+FG TK+FFR GQVA LEKLR  K  ++  +IQ  +RG +++ KY  +   T+ +Q Y R  LA   A  L +IRA +++Q  YRM  AR+ + +++ A + I+ + R +   R  +    E+     Q  VR ++ RR F +++   I+IQ  +R  KA+  LK L+IEARS  H+K +N G+ENK+++L +K+D + KE   +  QL        + ++  + E     Q+  +D    LQ E+  L+ EL R   E+ KI  D    E +  +K++  LE     LK     +   I+C   +  AQ S+ ++  +K + E+   +Q LV+EY +LE +Y+NL  E   +K   Q P   +    SN S  ES  +        + D  DA    E +                    A D+ V ++LQ  +  L QE  +L+  +++ E +  K  Q       + +    D                      NEL   + D   +    HG     S L++++    ++L+   E+   LR  I      +L G     +IN+           ++E+   A+    + N K   E  G    + +L  A   +++    L+ QL  Q L                   M +    + Q L L+P+ +++  VQ EISR+  ENL L+E  +++     +LK+ LK +  + Q  E   +L  +  K  +L          ++  T+ ++E   + G+++ +  + ++ I++ + DL P +     P  L  YI++M  R  D+  ++ ++ + L+  I  +K+ ++K  +  E     LSN   L++  +QYSG + F   NTA+  +H   ++DL E+ ++L +L + ++Q ++K I + +L Q + + A+L +E+I        T Y+   S++     +     + + + +   ++ +  +   II Q+F  + Y+INA  LN LL R D+C +S G+Q++YN+S  E W+R + L  SGA+Q + P+ +A QLLQ    + EDA+ +C +C  L+T+Q+VKILN + P + +  R++   I  I+ Q++ +R D P +  L+   +   P+  PF  + +++    IP  L L  L
Sbjct:    1 MSVGELYSQCTRVWIPDPDEVWRSAELTKDYKEGDKSLQLRLEDETILEYPIDVQRNQLPFLRNPDILVGENDLTALSYLHEPAVLHNLKVRFLESNHIYTYCGIVLVAINPYEQLPIYGQDVIYTYSGQNMGDMDPHIFAVAEEAYKQMARDEKNQSIIVSGESGAGKTVSAKYAMRYFATVGGSAS-------ETNIEEKVLASSPIMEAIGNAKTTRNDNSSRFGKYIQIGFDKRYHIIGANMRTYLLEKSRVVFQADDERNYHIFYQL---CAAAGLPEFKELALTSAEDFFYTSQGGDTSIEGVDDAEDFEKTRQAFTLLGVKESHQMSIFKIIASILHLGSVAIQAERDGDSCSISPQDVYLSNFCRLLGVEHSQMEHWLCHRKLVTTSETYVKTMSLQQVINARNALAKHIYAQLFGWIVEHINKALHTSLK-----------------QHSFIGVLDIYGFETFEVNSFEQFCINYANEKLQQQFNSHVFKLEQEEYMKEQIPWTLIDFYDNQPCIDLIEAKLGILDLLDEECKVPKGTDQNWAQKLYDRH-SSSQHFQKPRMSNTAFIIVHFADKVEYLSDGFLEKNRDTVYEEQINILKASKFPLVADLFHDDKDPVPATTPGKGSSSKISVRSARPPMKVSN-KEHKKTVGHQFRTSLHLLMETLNATTPHYVRCIKPNDEKLPFHFDPKRAVQQLRACGVLETIRISAAGYPSRWAYHDFFNRYRVLVKKRELANTDKKAICRSVLENLIKDPDKFQFGRTKIFFRAGQVAYLEKLRADKFRTATIMIQKTVRGWLQKVKYHRLKGATLTLQRYCRGHLARRLAEHLRRIRAAVVLQKHYRMQRARQAYQRVRRAAVVIQAFTRAMFVRRTYRQVLMEHKATTIQKHVRGWMARRHFQRLRDAAIVIQCAFRMLKARRELKALRIEARSAEHLKRLNVGMENKVVQLQRKIDEQNKEFKTLSEQLSVTTSTYTMEVERLKKELVHYQQSPGEDTSLRLQEEVESLRTELQRAHSER-KILEDAHSREKDELRKRVADLEQENALLKDEKEQLNNQILCQSKDEFAQNSVKENLMKKELEEERSRYQNLVKEYSQLEQRYDNLRDEMTIIK---QTPG--HRRNPSNQSSLESDSNYPSISTSEIGDTEDALQQVEEIGLE---------------KAAMDMTVFLKLQKRVRELEQERKKLQVQLEKREQQDSKKVQAEPPQTDIDLDPNADLAYNSLKRQELESENKKLKNDLNELRKAVADQATQNNSSHGSPDSYSLLLNQLKLAHEELEVRKEEVLILRTQIVSADQRRLAGRNAEPNINARSSWPNSEKHVDQEDAIEAYHGVCQTNSKT--EDWGYLNEDGELGLAYQGLKQVARLLEAQLQAQSLEHEEEVEHLKAQLEALKEEMDKQQQTFCQTLLLSPEAQVEFGVQQEISRLTNENLDLKELVEKLEKNERKLKKQLKIYMKKAQDLEAAQALAQSERKRHEL----------NRQVTVQRKEKDFQ-GMLEYHKEDEALLIRNLVTDLKPQMLSGTVPC-LPAYILYMCIRHADYTNDDLKVHSLLTSTINGIKKVLKKHNDDFEMTSFWLSNTCRLLHCLKQYSGDEGFMTQNTAKQNEHCLKNFDLTEYRQVLSDLSIQIYQQLIK-IAEGVL-QPMIVSAMLENESIQGLSGVKPTGYRKRSSSMADGDNSYCLEAIIRQMNAFHTVMCDQGLDPEIILQVFKQLFYMINAVTLNNLLLRKDVCSWSTGMQLRYNISQLEEWLRGRNLHQSGAVQTMEPLIQAAQLLQLKKKTQEDAEAICSLCTSLSTQQIVKILNLYTPLNEFEERVTVAFIRTIQAQLQ-ERND-PQQLLLDAKHM--FPVLFPFNPSSLTMDSIHIPACLNLEFL 1845          
BLAST of Dach-2 vs. Ensembl Celegans
Match: hum-2 (Heavy chain, Unconventional Myosin [Source:UniProtKB/TrEMBL;Acc:A0A168H5A5])

HSP 1 Score: 727.243 bits (1876), Expect = 0.000e+0
Identity = 465/1158 (40.16%), Postives = 671/1158 (57.94%), Query Frame = 2
Query:   65 YSKGVKIWIPDEESVWIGATV---LQFHKEKNVIKIITDNGISKELNLSSKKCAPFLRNPDILIGQKDLTYLSYLNEPEVLYNLQIRFCERREIYTYCGIVLVAINPYQELS-IYGKEIINAYHS--QNSVDLDPHIFAVAENAFRRMSSFGENQSIIVSGESGAGKTVSAKYTMRYFALVGGSKTKQSFNLTETQIERKVLLSNPILEAFGNAKTIRNDNSSRFGKYLEILFNPRNQ-VIGANMCTYLLEKSRVVFQNLGERNYHIFYQIVTHCQSEDELLMNTGLVNNVEMYDYLRYGESLEIDGVDDSHEFLITKNSFLQLGIDLNKFKTICEILAAILHLGNIRFRFHDATDS-SIIENPELLKLIAGLLGCSIDQLKIWLCFRTISTFQETLHKPLSKAEAQYFRDAFVKTLYSNLFDWIVKQANKVLSTDVSINIKKKLKKTIVVNQEDKK-KFIAVLDIYGFETFAENSFEQFCINFANEKLQLQFNLHVFKLEQEEYMNEGLEWTFIDYYNNQPCIDLIESRXXXXXXXXXXXXXXXXSDENWCCKIY-SHHLNKSANFNKPKLSNMVFIIEHFAGPVEYKCAGFIEKNRDSVLEEQINLLKASDVQLIAELFRDSEIEIFDTNNXXXXXXXXXXXXXXXXXXQENTRKMKKTVGSQFRNSLKSLMDALNKTNPHYVRCIKPNDLKLPFTFCPERAVQQLRACGVLETIRLSAAGFPSRWTYSDFYHRYYILMSNFNVKNHDFKAGSQKIVETLITVPDAFRFGNTKLFFRPGQVALLEKLRGHKIESSVTLIQSILRGSIERKKYLIIHKLTVQIQTYIRRKLAIEKATKLSQIRAVIIIQSFYRMYLARKLFVKMKCAVLAIEKWRRKIITTRLKQAYKKENCVIICQAIVRRFIQRRKFLKIQRGVILIQNHYRRRKAKETLKILKIEARSINHIKFVNKGLENKIIELTQKLD---TKEKEMCXXXXXXXXXXXXXXXXXXXXXAESAKIYQ--NTVQDLQTEIIQLKKELNREIVEKNKIFADKELLEINYKKKINYLENLIEELKSSPSVIEPNIICNGDEAQQSICQDEHQKFINEQMDHQKLVREYEKLE--------MKYENLYKEFLFVKSSNQKPSINYDN---QTSNDSETESTFSKD 3460
            + KGV+IW      VWIGAT+   + F      I++  D  +  E  + S    PFLRNP  L+G+ DLT LSYL+EP VL+NLQ+RF +   IYTYCGIVLVAINPY + S IYG+EII  Y    +++ ++DPHIFAVAE A   M +FG++QSIIVSGESGAGKTVSAK+ MRY A V  SKT+   N   T IE +VL SNPI+E+ GNAKTIRNDNSSRFGK+++I F  R + ++GA M TYLLEKSR+VFQ  GERNYHIFYQ+   C + +  ++    +   E Y YL  G    I GVDD  +F     +   LG D  +   +  +LA +L LGN+ F   + + + S     E+ +L       S   L+IWL  R I    E + KPL+K EA   RDA  K LYS+LF W+V + N+ L      N K KL  T   NQ+ +  +FI VLDIYGFETF  NSFEQF IN+ANEKLQ QFN HVFKLEQEEY+ E +EW  +D+++NQP IDLIE  +G+++LLDE+CK L GSD +W  ++  S  L ++     PK+ +  FI+ HFA  V Y   GF+EKNRD++ E+ ++++ AS    I  +                  +  +S  S  S      R +KKTV SQFR+SLK LM  L  T PHYVRCIKPND K+ F F P+RA+QQLRACGVLET+R+SAAGFPSR+ Y +F  RY ++ +       D      ++          +  G TK+F R GQVA+LE++R   + ++ T+IQ + +G + R+KY  + +  + +Q  ++  LA  +   L   RAVI++QS  R YL R+ + +++ +++ I+   +     R  +  + E   I  QA  R ++ RR+ +  ++ V+++Q   R+  AK  L+ LKIEARS+ H++ +N GLENKIIEL  +LD    + KE         K  +    +L + +AE   + +  N V+ LQ E+ +L+ E +  + E  +   + +++E+  +     L+    + +S  +++E        +A + +  +E Q+ +   ++ ++  R     E        MK  +L++   F K  +QK + + D+    TSN S+   +F+ +
Sbjct:   18 FKKGVRIWHRHPTLVWIGATLEEDITFQTRNVRIRLEDDTEV--EYAIKSLDQLPFLRNPAFLVGKDDLTLLSYLHEPAVLHNLQVRFVKGSSIYTYCGIVLVAINPYADCSHIYGEEIIQVYRGAGKSAREMDPHIFAVAEEAHFDMGAFGKSQSIIVSGESGAGKTVSAKFVMRYLASVAASKTR---NGGTTSIEARVLASNPIMESIGNAKTIRNDNSSRFGKFIQINFCERGRRIVGAEMKTYLLEKSRLVFQAPGERNYHIFYQL---CAARNHQVLKDLHLGPCESYSYLTQGGDSRIPGVDDKADFEALLKALQLLGFDEKQMSDVFRLLAGLLLLGNVHFENGEGSSAVSASSCQEISRLCREFWKISESDLRIWLTRREIRAVNEIVTKPLTKNEAVRSRDALTKMLYSHLFGWLVDKINEAL------NEKDKLDGT---NQKKRPDRFIGVLDIYGFETFDVNSFEQFSINYANEKLQQQFNQHVFKLEQEEYIREEIEWVRVDFHDNQPAIDLIEGPVGMINLLDEQCKRLNGSDADWLSQLQNSTELKRNPQLAFPKVRSNDFIVRHFAADVTYSTDGFVEKNRDAIGEQLLDVVVASKFPFIRTVI---------------GSTAPTSVSSSSSSSTPGKRTIKKTVASQFRDSLKELMSVLCSTRPHYVRCIKPNDSKISFDFEPKRAIQQLRACGVLETVRISAAGFPSRYPYEEFARRYRVIYTKEAALWRDKPKQFAELACQQCLEEGKYAVGKTKIFLRTGQVAVLERVRLDTLAAAATVIQKMWKGFLARRKYETMRRSLLIVQASLKAFLAFRRIKYLQMHRAVIVMQSAVRGYLERRKYEQIRDSIIGIQAMFKANRVRRYVEKLRYEKSAITIQAAWRGYLARREQIANRKKVVMVQCAVRKWLAKRRLRELKIEARSVGHLQKLNTGLENKIIELQMRLDIANARTKEEAEKFATASKNLQKTKADLAMMEAERLTLLEARNRVEVLQEEVERLETECD--LKEAQRGGMETKMVELQSR-----LDQFQMQSESGQTIVELTEQLEKAKADRVLWDEERQR-MEAALNTERSARNALDAEMAAMREQLMKNVDLFESSTFQKRPSQKKNRDDDSCSRTTSNLSQLTGSFTAE 1135          

HSP 2 Score: 100.523 bits (249), Expect = 1.101e-20
Identity = 112/460 (24.35%), Postives = 205/460 (44.57%), Query Frame = 2
Query: 4235 NDQIISETIELKRGLKYFAFRLQKYEGSLVPNPNKEEDLLQLIQNVIYHSKMKTIGKRECYSEIGLIDLNMSELSIFIKSFIFDLSPSICLQYEPYHLVPYIIFMVTRKFDFYKEEDQMTNFLSKLIVALKRTIRKRRNYIEYLVMLLSNVFCLVNLXXXXXXXXXXXXL---NTAEDIQHYFVHYDLNEFIRLLKELCVTLFQMILKTIVDNLLPQSLCIDAILVHEAIIDFLSKDGTKYKSN---IETQPKNTSFNVLTKNLQSVLEILKNHKIPQLIINQIFVHIAYLINAYCLNTLLFRTDLCYFSKGLQIKYNLSSFETWIRYQKLIDSGALQCLRPMTEAVQLLQTLIDSDEDAKFVCDMCEYLNTRQVVKILNNFNPRDGYGCRLSSGLIAKIETQM--KIKRGDEPSE--SKLETPTVIEIPIDI-PFIHNGVSLCRTIIPKPLYLSCLTVL 5581
            ND++  ++ EL         +L+ Y G L      +E++++L         +K  G  E Y        N+ E   F +  + +L P++  +    +L  Y++    R  D  ++E  +T   S + + LK TI  R + ++ L + L N++ L NL +QYSG          NT     + F  YD+      LK      +  ++K  ++++L   + +  IL HE+  D ++    +   N   +E+Q K  S + L + ++ V   L  +    +++ Q+   +A  + A  LN ++FR +LC F K +QIK+N++  + W+  + L D        P+ +A  LLQ+  D         +M   L  RQVV IL +++P D     LS   + +I+ ++  +    ++P E   KL        P D  PF ++   L    +P  L++  +  L
Sbjct: 1375 NDKLTRQSEELAEARA----QLRGYSGPLGLENASDEEIIRL--EAFEKGSIKHSGFLEVY--------NVPE---FARIIVCELKPTLA-RLLTKNLPAYLLVAAFRNHDEKRDETALTGLFSSVHLVLKDTI-SRSHDLDLLSLWLVNLWRLFNLLRQYSGEDSQPEWHVANTETQNSYRFKAYDVAPIRDQLKLRIEECYTSLMKKAIEHVLSPKI-VPGILQHESSSDLMTAGQERRDRNSGSVESQRK--SLDDLLQFMEIVHTKLTTYGGDDIVVKQVIGQMARWMCALALNYMMFRRELCNFEKAIQIKHNVTQIQNWLNAKGLSD--CRDHFEPLVQACHLLQSRKDPSNLDTLCGEMTSRLKPRQVVAILQHYDPSDEMEDGLSPEFLVQIQKKLNERAIANNDPIEDKDKLIMLGTYLPPFDTQPFSYSDFPLETLSLPSCLHMQSVCRL 1810          
BLAST of Dach-2 vs. Ensembl Celegans
Match: hum-2 (Heavy chain, Unconventional Myosin [Source:UniProtKB/TrEMBL;Acc:A0A168H5A5])

HSP 1 Score: 725.702 bits (1872), Expect = 0.000e+0
Identity = 464/1158 (40.07%), Postives = 674/1158 (58.20%), Query Frame = 2
Query:   65 YSKGVKIWIPDEESVWIGATV---LQFHKEKNVIKIITDNGISKELNLSSKKCAPFLRNPDILIGQKDLTYLSYLNEPEVLYNLQIRFCERREIYTYCGIVLVAINPYQELS-IYGKEIINAYHS--QNSVDLDPHIFAVAENAFRRMSSFGENQSIIVSGESGAGKTVSAKYTMRYFALVGGSKTKQSFNLTETQIERKVLLSNPILEAFGNAKTIRNDNSSRFGKYLEILFNPRNQ-VIGANMCTYLLEKSRVVFQNLGERNYHIFYQIVTHCQSEDELLMNTGLVNNVEMYDYLRYGESLEIDGVDDSHEFLITKNSFLQLGIDLNKFKTICEILAAILHLGNIRFRFHDATDS-SIIENPELLKLIAGLLGCSIDQLKIWLCFRTISTFQETLHKPLSKAEAQYFRDAFVKTLYSNLFDWIVKQANKVLSTDVSINIKKKLKKTIVVNQEDKK-KFIAVLDIYGFETFAENSFEQFCINFANEKLQLQFNLHVFKLEQEEYMNEGLEWTFIDYYNNQPCIDLIESRXXXXXXXXXXXXXXXXSDENWCCKIY-SHHLNKSANFNKPKLSNMVFIIEHFAGPVEYKCAGFIEKNRDSVLEEQINLLKASDVQLIAELFRDSEIEIFDTNNXXXXXXXXXXXXXXXXXXQENTRKMKKTVGSQFRNSLKSLMDALNKTNPHYVRCIKPNDLKLPFTFCPERAVQQLRACGVLETIRLSAAGFPSRWTYSDFYHRYYILMSNFNVKNHDFKAGSQKIVETLITVPDAFRFGNTKLFFRPGQVALLEKLRGHKIESSVTLIQSILRGSIERKKYLIIHKLTVQIQTYIRRKLAIEKATKLSQIRAVIIIQSFYRMYLARKLFVKMKCAVLAIEKWRRKIITTRLKQAYKKENCVIICQAIVRRFIQRRKFLKIQRGVILIQNHYRRRKAKETLKILKIEARSINHIKFVNKGLENKIIELTQKLD---TKEKEMCXXXXXXXXXXXXXXXXXXXXXAESAKIYQ--NTVQDLQTEIIQLKKELNREIVEKNKIFADKELLEINYKKKINYLENLIEELKSSPSVIEPNIICNGDEAQQSICQDEHQKFINEQMDHQKLVREYEKLE--------MKYENLYKEFLFVKSSNQKPSINYDN---QTSNDSETESTFSKD 3460
            + KGV+IW      VWIGAT+   + F      I++  D  +  E  + S    PFLRNP  L+G+ DLT LSYL+EP VL+NLQ+RF +   IYTYCGIVLVAINPY + S IYG+EII  Y    +++ ++DPHIFAVAE A   M +FG++QSIIVSGESGAGKTVSAK+ MRY A V  SKT+   N   T IE +VL SNPI+E+ GNAKTIRNDNSSRFGK+++I F  R + ++GA M TYLLEKSR+VFQ  GERNYHIFYQ+   C + +  ++    +   E Y YL  G    I GVDD  +F     +   LG D  +   +  +LA +L LGN+ F   + + + S     E+ +L       S   L+IWL  R I    E + KPL+K EA   RDA  K LYS+LF W+V + N+ L      N K KL  T   NQ+ +  +FI VLDIYGFETF  NSFEQF IN+ANEKLQ QFN HVFKLEQEEY+ E +EW  +D+++NQP IDLIE  +G+++LLDE+CK L GSD +W  ++  S  L ++     PK+ +  FI+ HFA  V Y   GF+EKNRD++ E+ ++++ AS    I  +                  +  +S  S  S      R +KKTV SQFR+SLK LM  L  T PHYVRCIKPND K+ F F P+RA+QQLRACGVLET+R+SAAGFPSR+ Y +F  RY ++ +       D      ++          +  G TK+F R GQVA+LE++R   + ++ T+IQ + +G + R+KY  + +  + +Q  ++  LA  +   L   RAVI++QS  R YL R+ + +++ +++ I+   +     R  +  + E   I  QA  R ++ RR+ +  ++ V+++Q   R+  AK  L+ LKIEARS+ H++ +N GLENKIIEL  +LD    + KE         K  +    +L + +AE   + +  N V+ LQ E+ +L+ E +  + E  +   + +++E+  + +++ +++     +S  +++E        +A + +  +E Q+ +   ++ ++  R     E        MK  +L++   F K  +QK + + D+    TSN S+   +F+ +
Sbjct:   18 FKKGVRIWHRHPTLVWIGATLEEDITFQTRNVRIRLEDDTEV--EYAIKSLDQLPFLRNPAFLVGKDDLTLLSYLHEPAVLHNLQVRFVKGSSIYTYCGIVLVAINPYADCSHIYGEEIIQVYRGAGKSAREMDPHIFAVAEEAHFDMGAFGKSQSIIVSGESGAGKTVSAKFVMRYLASVAASKTR---NGGTTSIEARVLASNPIMESIGNAKTIRNDNSSRFGKFIQINFCERGRRIVGAEMKTYLLEKSRLVFQAPGERNYHIFYQL---CAARNHQVLKDLHLGPCESYSYLTQGGDSRIPGVDDKADFEALLKALQLLGFDEKQMSDVFRLLAGLLLLGNVHFENGEGSSAVSASSCQEISRLCREFWKISESDLRIWLTRREIRAVNEIVTKPLTKNEAVRSRDALTKMLYSHLFGWLVDKINEAL------NEKDKLDGT---NQKKRPDRFIGVLDIYGFETFDVNSFEQFSINYANEKLQQQFNQHVFKLEQEEYIREEIEWVRVDFHDNQPAIDLIEGPVGMINLLDEQCKRLNGSDADWLSQLQNSTELKRNPQLAFPKVRSNDFIVRHFAADVTYSTDGFVEKNRDAIGEQLLDVVVASKFPFIRTVI---------------GSTAPTSVSSSSSSSTPGKRTIKKTVASQFRDSLKELMSVLCSTRPHYVRCIKPNDSKISFDFEPKRAIQQLRACGVLETVRISAAGFPSRYPYEEFARRYRVIYTKEAALWRDKPKQFAELACQQCLEEGKYAVGKTKIFLRTGQVAVLERVRLDTLAAAATVIQKMWKGFLARRKYETMRRSLLIVQASLKAFLAFRRIKYLQMHRAVIVMQSAVRGYLERRKYEQIRDSIIGIQAMFKANRVRRYVEKLRYEKSAITIQAAWRGYLARREQIANRKKVVMVQCAVRKWLAKRRLRELKIEARSVGHLQKLNTGLENKIIELQMRLDIANARTKEEAEKFATASKNLQKTKADLAMMEAERLTLLEARNRVEVLQEEVERLETECD--LKEAQRGGMETKMVEL--QSRLDQMQS-----ESGQTIVELTEQLEKAKADRVLWDEERQR-MEAALNTERSARNALDAEMAAMREQLMKNVDLFESSTFQKRPSQKKNRDDDSCSRTTSNLSQLTGSFTAE 1133          

HSP 2 Score: 100.523 bits (249), Expect = 1.119e-20
Identity = 112/460 (24.35%), Postives = 205/460 (44.57%), Query Frame = 2
Query: 4235 NDQIISETIELKRGLKYFAFRLQKYEGSLVPNPNKEEDLLQLIQNVIYHSKMKTIGKRECYSEIGLIDLNMSELSIFIKSFIFDLSPSICLQYEPYHLVPYIIFMVTRKFDFYKEEDQMTNFLSKLIVALKRTIRKRRNYIEYLVMLLSNVFCLVNLXXXXXXXXXXXXL---NTAEDIQHYFVHYDLNEFIRLLKELCVTLFQMILKTIVDNLLPQSLCIDAILVHEAIIDFLSKDGTKYKSN---IETQPKNTSFNVLTKNLQSVLEILKNHKIPQLIINQIFVHIAYLINAYCLNTLLFRTDLCYFSKGLQIKYNLSSFETWIRYQKLIDSGALQCLRPMTEAVQLLQTLIDSDEDAKFVCDMCEYLNTRQVVKILNNFNPRDGYGCRLSSGLIAKIETQM--KIKRGDEPSE--SKLETPTVIEIPIDI-PFIHNGVSLCRTIIPKPLYLSCLTVL 5581
            ND++  ++ EL         +L+ Y G L      +E++++L         +K  G  E Y        N+ E   F +  + +L P++  +    +L  Y++    R  D  ++E  +T   S + + LK TI  R + ++ L + L N++ L NL +QYSG          NT     + F  YD+      LK      +  ++K  ++++L   + +  IL HE+  D ++    +   N   +E+Q K  S + L + ++ V   L  +    +++ Q+   +A  + A  LN ++FR +LC F K +QIK+N++  + W+  + L D        P+ +A  LLQ+  D         +M   L  RQVV IL +++P D     LS   + +I+ ++  +    ++P E   KL        P D  PF ++   L    +P  L++  +  L
Sbjct: 1373 NDKLTRQSEELAEARA----QLRGYSGPLGLENASDEEIIRL--EAFEKGSIKHSGFLEVY--------NVPE---FARIIVCELKPTLA-RLLTKNLPAYLLVAAFRNHDEKRDETALTGLFSSVHLVLKDTI-SRSHDLDLLSLWLVNLWRLFNLLRQYSGEDSQPEWHVANTETQNSYRFKAYDVAPIRDQLKLRIEECYTSLMKKAIEHVLSPKI-VPGILQHESSSDLMTAGQERRDRNSGSVESQRK--SLDDLLQFMEIVHTKLTTYGGDDIVVKQVIGQMARWMCALALNYMMFRRELCNFEKAIQIKHNVTQIQNWLNAKGLSD--CRDHFEPLVQACHLLQSRKDPSNLDTLCGEMTSRLKPRQVVAILQHYDPSDEMEDGLSPEFLVQIQKKLNERAIANNDPIEDKDKLIMLGTYLPPFDTQPFSYSDFPLETLSLPSCLHMQSVCRL 1808          
BLAST of Dach-2 vs. Ensembl Celegans
Match: myo-6 (MYOsin heavy chain structural genes [Source:UniProtKB/TrEMBL;Acc:Q5FC20])

HSP 1 Score: 449.899 bits (1156), Expect = 5.810e-133
Identity = 301/890 (33.82%), Postives = 478/890 (53.71%), Query Frame = 2
Query:   86 WIPDEESVWIGATVLQFHKEKNVIKIITDNGISKELNLSSKKCAPFLRNPDILIGQKDLTYLSYLNEPEVLYNLQIRFCERREIYTYCGIVLVAINPYQELSIYGKEIINAYHSQNSVDLDPHIFAVAENAFRRMSSFGENQSIIVSGESGAGKTVSAKYTMRYFALVGGSKTKQSFNLTETQIERKVLLSNPILEAFGNAKTIRNDNSSRFGKYLEILFNPRNQVIGANMCTYLLEKSRVVFQNLGERNYHIFYQIVTHCQSEDELLMNTGLVNNVEMYDYLRYGESLEIDGVDDSHEFLITKNSFLQLGIDLNKFKTICEILAAILHLGNIRFRFHDATDSSIIENPELLKLIAGLLGCSIDQLKIWLCFRTISTFQETLHKPLSKAEAQYFRDAFVKTLYSNLFDWIVKQANKVLSTDVSINIKKKLKKTIVVNQEDKKKFIAVLDIYGFETFAENSFEQFCINFANEKLQLQFNLHVFKLEQEEYMNEGLEWTFIDY-YNNQPCIDLIESRXXXXXXXXXXXXXXXXSDENWCCKIYSHHLNKSANFNKPKL-----SNMVFIIEHFAGPVEYKCAGFIEKNRDSVLEEQINLLKASDVQ-LIAELFRDSEIEIFDTNNXXXXXXXXXXXXXXXXXXQENTRKMKKTVGSQFRNSLKSLMDALNKTNPHYVRCIKPNDLKLPFTFCPERAVQQLRACGVLETIRLSAAGFPSRWTYSDFYHRYYILMSNFNVKNHDFKAGSQKIVETL-----ITVPDAFRFGNTKLFFRPGQVALLEKLRGHKIESSVTLIQSILRGSIERKKYLIIHKLTVQIQTYIRRKLAIEKATKLSQ--IRAVIIIQS--FYRMYLARKLFVKMKCAVLAIEKWRRKIITTRLKQAYKKE 2707
            W+PD    ++ A V    +E + +     +G  K+L  +  +      NP      +D++ L++LNE  VL+NL+ R+     IYTY G+  V INPY+ L IY   + + Y ++   ++ PH+FAV++ AFR M S  ENQS++++GESGAGKT + K  + YFA++G     Q    +E+ +E +V+ +NP +EAFGN  T RN NSSR+GK++ I F+ + +++G ++  YLLEKSRV+ Q  GER+YHIFYQI+T    +  L    GL +N+  Y ++   E + + G++D+ E+ IT  +F  +G    +   + ++ +AI+H+GN  F+     + + +++         L G + DQ    L    I    E ++K  +  +  +   A  K +Y+ +F+W++K+ NK                T+  N ++   +I VLDI GFE F  NSFEQ  INF NEKLQ  FN H+F LEQEEY  EG+EWTFID+  + Q CI+LIE  LG++ +LDEEC + K SD  +  K+ + HL K  NF K K      +   F I H+AG V Y    +++KN+D + +  + +LK SD + ++ +L+ + + ++    + K   +         S           TV + +R SL SLM  L+ T+PH++RCI PN+ K          + QL   GVLE IR+   GFP+R  ++DF  RY IL ++    + D    S+ ++  L     + V D F+ G TK+FFR G +A LE+LR   + + +   Q  LR  + + +Y              +R+L  E A  + Q  IRA I ++S  +YR++   K  +K   +   IE   +K     L++ +K+E
Sbjct:   38 WVPDAAEGFVTAAVAV--QEGDNLTFTMPDGTPKKLTRAEVQEI----NPAKFEKTEDMSNLTFLNEASVLHNLRQRYYSMM-IYTYSGLFCVFINPYKMLPIYTDSVASMYVNKRRAEMPPHLFAVSDEAFRNMMSDKENQSMLITGESGAGKTENTKKVIAYFAMIGSGNKDQK---SESSLENQVVQANPAIEAFGNGATTRNYNSSRYGKFIRIHFDRKGKLVGGDIEHYLLEKSRVIKQAPGERSYHIFYQIMT----QKALRERYGLSDNIRDYKFVSQAE-ITVPGMNDTEEWQITDGAFNVMGFSEREKDDLYKLCSAIMHIGNSTFKQKPRDEQAEVDDMTSPTAACKLFGINTDQFLNALTRPRIKVGMEWVNKGQNVQQVDWAVGALSKAIYARMFNWLIKRVNK----------------TLQANSDEMVYYIGVLDIAGFEIFDRNSFEQLWINFVNEKLQQFFNHHMFVLEQEEYQREGIEWTFIDFGLDLQSCIELIEKPLGIVSMLDEECIVPKASDMTYVDKLLTQHLGKHPNFQKAKPPKGKQAEAHFSIMHYAGTVRYNAEQWLDKNKDPLNDSAVAILKTSDKEGVLYQLWEEYQTDVDREESEKRGKAQAKKKGKSASFL---------TVSTMYRESLTSLMTMLHTTHPHFIRCIIPNEKKTSGLIDAPLVLNQLTCNGVLEGIRICRKGFPNRMMFADFRFRYAILAAD-EASDKDAAKASKAMLRKLSKNNQLNV-DTFKVGTTKVFFRAGMLARLEELRDEALSAVILKFQCSLRHYLAQLEY--------------KRRLDREDAYPIIQENIRAWIKLRSWPWYRLFSRLKPMLKGMKSNAEIEALEKKC--KELEENHKRE 869          
BLAST of Dach-2 vs. Ensembl Celegans
Match: myo-1 (Myosin-1 [Source:UniProtKB/Swiss-Prot;Acc:P02567])

HSP 1 Score: 456.062 bits (1172), Expect = 5.494e-131
Identity = 307/877 (35.01%), Postives = 454/877 (51.77%), Query Frame = 2
Query:   65 YSKGVKIWIPDEESVWIGATVLQFHKEKNVIKIITDNGISKELNLSSKKCAPFLRNPDILIGQKDLTYLSYLNEPEVLYNLQIRFCERREIYTYCGIVLVAINPYQELSIYGKEIINAYHSQNSVDLDPHIFAVAENAFRRMSSFGENQSIIVSGESGAGKTVSAKYTMRYFALVGGS-KTKQSFNLTETQIERKVLLSNPILEAFGNAKTIRNDNSSRFGKYLEILFNPRNQVIGANMCTYLLEKSRVVFQNLGERNYHIFYQIVTH--CQSEDELLMNTGLVNNVEMYDYLRYGESLEIDGVDDSHEFLITKNSFLQLGIDLNKFKTICEILAAILHLGNIRFRFHDATDSSIIENPELLKLIAGLLGCSIDQLKIWLCFRTISTFQETLHKPLSKAEAQYFRDAFVKTLYSNLFDWIVKQANKVLSTDVSINIKKKLKKTIVVNQEDKKKFIAVLDIYGFETFAENSFEQFCINFANEKLQLQFNLHVFKLEQEEYMNEGLEWTFIDY-YNNQPCIDLIESRXXXXXXXXXXXXXXXXSDENWCCKIYSHHLNKSANFNKPK-----LSNMVFIIEHFAGPVEYKCAGFIEKNRDSVLEEQINLLKASDV-QLIAELFRDSEIEIFDTNNXXXXXXXXXXXXXXXXXXQENTRKMKKTVGSQFRNSLKSLMDALNKTNPHYVRCIKPNDLKLPFTFCPERAVQQLRACGVLETIRLSAAGFPSRWTYSDFYHRYYILMSNFNVKNHDFKAGSQKIVETLITV----PDAFRFGNTKLFFRPGQVALLEKLRGHKIESSVTLIQSILRGSIERKKYLIIHKLTVQIQTYIRRKLAIEKATKLSQIRAVIIIQSFYRMYLARKLFVKMKCAVLAIE 2653
            Y     +WIPD E  +I   +     + + + I+T  G  K++ L  KK      NP      +D++ L++LN+  VL+NL+ R+     IYTY G+  V INPY+ L IY   +   +  +   ++ PH+FAV++ A+R M    ENQS++++GESGAGKT + K  + YFA VG S K        E  +E +++ +NP+LEAFGNAKT+RN+NSSRFGK++ I FN    +   ++  YLLEKSRV+ Q  GER YHIFYQI +    Q  DELL+N  + N    Y ++   E L IDG+DD+ EF +T  +F  L     +      +++A +H+GN++F+     + +  +  +  +    + G  +DQ    L    +    E + K  +  +  +   A  K LY+ +F W+VK+ N  L            +K I     D+  FI VLDI GFE F  NSFEQ  INF NEKLQ  FN H+F LEQEEY  EG++WTFID+  + Q CI+LIE  LG++ +LDEEC + K +D     K+   HL K  NF KPK          F + H+AG V Y    ++EKN+D + +  ++++KAS    L+ E+++D     + T       +     +               TV   +R SL  LM  L+KT+PH++RCI PN+ K          + QL   GVLE IR+   GFP+R  + DF  RY IL +     + D K  +  I++ LI       + FR G+TK+FF+ G VA +E LR  K+   +T  QS +R              T       RRK           IR+  +++++    L  KL  ++KC  +A E
Sbjct:   29 YDSKKNVWIPDAEEGYIEGVIKGPGPKADTV-IVTAGG--KDVTL--KKDIVQEVNPPKFEKTEDMSNLTFLNDASVLWNLRSRYAAML-IYTYSGLFCVVINPYKRLPIYTDSVARMFMGKRRTEMPPHLFAVSDQAYRYMLQDHENQSMLITGESGAGKTENTKKVICYFATVGASQKAALKEGEKEVTLEDQIVQTNPVLEAFGNAKTVRNNNSSRFGKFIRIHFNKHGTLASCDIEHYLLEKSRVIRQAPGERCYHIFYQIYSDFKPQLRDELLLNHPISN----YWFVAQAELL-IDGIDDTEEFQLTDEAFDVLKFSPTEKMDCYRLMSAHMHMGNMKFKQRPREEQAEPDGQDEAERACNMYGIDVDQFLKALVSPRVKVGTEWVSKGQNVDQVHWAIGAMAKGLYARVFHWLVKKCNLTLD-----------QKGI-----DRDYFIGVLDIAGFEIFDFNSFEQLWINFVNEKLQQFFNHHMFVLEQEEYAREGIQWTFIDFGLDLQACIELIEKPLGIISMLDEECIVPKATDMTLAQKLTDQHLGKHPNFEKPKPPKGKQGEAHFAMRHYAGTVRYNVLNWLEKNKDPLNDTVVSVMKASKKNDLLVEIWQD-----YTTQEEAAAAAKAGGGRKGG------KSGSFMTVSMMYRESLNKLMTMLHKTHPHFIRCIIPNEKKQSGMIDAALVLNQLTCNGVLEGIRICRKGFPNRTQHPDFVQRYAILAAKEAKSSDDMKTCAGAILQALINQKQLNDEQFRIGHTKVFFKAGVVAHIEDLRDDKLNQIITGFQSAIRW------------YTATADAGARRKQLNSYIILQRNIRSWCVLRTWDWFLLFGKLRPQLKCGKMAEE 855          
BLAST of Dach-2 vs. Ensembl Celegans
Match: myo-1 (Myosin-1 [Source:UniProtKB/Swiss-Prot;Acc:P02567])

HSP 1 Score: 456.062 bits (1172), Expect = 5.494e-131
Identity = 307/877 (35.01%), Postives = 454/877 (51.77%), Query Frame = 2
Query:   65 YSKGVKIWIPDEESVWIGATVLQFHKEKNVIKIITDNGISKELNLSSKKCAPFLRNPDILIGQKDLTYLSYLNEPEVLYNLQIRFCERREIYTYCGIVLVAINPYQELSIYGKEIINAYHSQNSVDLDPHIFAVAENAFRRMSSFGENQSIIVSGESGAGKTVSAKYTMRYFALVGGS-KTKQSFNLTETQIERKVLLSNPILEAFGNAKTIRNDNSSRFGKYLEILFNPRNQVIGANMCTYLLEKSRVVFQNLGERNYHIFYQIVTH--CQSEDELLMNTGLVNNVEMYDYLRYGESLEIDGVDDSHEFLITKNSFLQLGIDLNKFKTICEILAAILHLGNIRFRFHDATDSSIIENPELLKLIAGLLGCSIDQLKIWLCFRTISTFQETLHKPLSKAEAQYFRDAFVKTLYSNLFDWIVKQANKVLSTDVSINIKKKLKKTIVVNQEDKKKFIAVLDIYGFETFAENSFEQFCINFANEKLQLQFNLHVFKLEQEEYMNEGLEWTFIDY-YNNQPCIDLIESRXXXXXXXXXXXXXXXXSDENWCCKIYSHHLNKSANFNKPK-----LSNMVFIIEHFAGPVEYKCAGFIEKNRDSVLEEQINLLKASDV-QLIAELFRDSEIEIFDTNNXXXXXXXXXXXXXXXXXXQENTRKMKKTVGSQFRNSLKSLMDALNKTNPHYVRCIKPNDLKLPFTFCPERAVQQLRACGVLETIRLSAAGFPSRWTYSDFYHRYYILMSNFNVKNHDFKAGSQKIVETLITV----PDAFRFGNTKLFFRPGQVALLEKLRGHKIESSVTLIQSILRGSIERKKYLIIHKLTVQIQTYIRRKLAIEKATKLSQIRAVIIIQSFYRMYLARKLFVKMKCAVLAIE 2653
            Y     +WIPD E  +I   +     + + + I+T  G  K++ L  KK      NP      +D++ L++LN+  VL+NL+ R+     IYTY G+  V INPY+ L IY   +   +  +   ++ PH+FAV++ A+R M    ENQS++++GESGAGKT + K  + YFA VG S K        E  +E +++ +NP+LEAFGNAKT+RN+NSSRFGK++ I FN    +   ++  YLLEKSRV+ Q  GER YHIFYQI +    Q  DELL+N  + N    Y ++   E L IDG+DD+ EF +T  +F  L     +      +++A +H+GN++F+     + +  +  +  +    + G  +DQ    L    +    E + K  +  +  +   A  K LY+ +F W+VK+ N  L            +K I     D+  FI VLDI GFE F  NSFEQ  INF NEKLQ  FN H+F LEQEEY  EG++WTFID+  + Q CI+LIE  LG++ +LDEEC + K +D     K+   HL K  NF KPK          F + H+AG V Y    ++EKN+D + +  ++++KAS    L+ E+++D     + T       +     +               TV   +R SL  LM  L+KT+PH++RCI PN+ K          + QL   GVLE IR+   GFP+R  + DF  RY IL +     + D K  +  I++ LI       + FR G+TK+FF+ G VA +E LR  K+   +T  QS +R              T       RRK           IR+  +++++    L  KL  ++KC  +A E
Sbjct:   29 YDSKKNVWIPDAEEGYIEGVIKGPGPKADTV-IVTAGG--KDVTL--KKDIVQEVNPPKFEKTEDMSNLTFLNDASVLWNLRSRYAAML-IYTYSGLFCVVINPYKRLPIYTDSVARMFMGKRRTEMPPHLFAVSDQAYRYMLQDHENQSMLITGESGAGKTENTKKVICYFATVGASQKAALKEGEKEVTLEDQIVQTNPVLEAFGNAKTVRNNNSSRFGKFIRIHFNKHGTLASCDIEHYLLEKSRVIRQAPGERCYHIFYQIYSDFKPQLRDELLLNHPISN----YWFVAQAELL-IDGIDDTEEFQLTDEAFDVLKFSPTEKMDCYRLMSAHMHMGNMKFKQRPREEQAEPDGQDEAERACNMYGIDVDQFLKALVSPRVKVGTEWVSKGQNVDQVHWAIGAMAKGLYARVFHWLVKKCNLTLD-----------QKGI-----DRDYFIGVLDIAGFEIFDFNSFEQLWINFVNEKLQQFFNHHMFVLEQEEYAREGIQWTFIDFGLDLQACIELIEKPLGIISMLDEECIVPKATDMTLAQKLTDQHLGKHPNFEKPKPPKGKQGEAHFAMRHYAGTVRYNVLNWLEKNKDPLNDTVVSVMKASKKNDLLVEIWQD-----YTTQEEAAAAAKAGGGRKGG------KSGSFMTVSMMYRESLNKLMTMLHKTHPHFIRCIIPNEKKQSGMIDAALVLNQLTCNGVLEGIRICRKGFPNRTQHPDFVQRYAILAAKEAKSSDDMKTCAGAILQALINQKQLNDEQFRIGHTKVFFKAGVVAHIEDLRDDKLNQIITGFQSAIRW------------YTATADAGARRKQLNSYIILQRNIRSWCVLRTWDWFLLFGKLRPQLKCGKMAEE 855          
BLAST of Dach-2 vs. Ensembl Fly
Match: didum (gene:FBgn0261397 transcript:FBtr0089744)

HSP 1 Score: 780.015 bits (2013), Expect = 0.000e+0
Identity = 446/969 (46.03%), Postives = 612/969 (63.16%), Query Frame = 2
Query:   62 MYSKGVKIWIPDEESVWIGATVLQ-FHKEKNVIKIITDNGISKELNLSSKKC-APFLRNPDILIGQKDLTYLSYLNEPEVLYNLQIRFCERREIYTYCGIVLVAINPYQELSIYGKEIINAYHSQNSVDLDPHIFAVAENAFRRMSSFGENQSIIVSGESGAGKTVSAKYTMRYFALVGGSKTKQSFNLTETQIERKVLLSNPILEAFGNAKTIRNDNSSRFGKYLEILFNPRNQVI---GANMCTYLLEKSRVVFQNLGERNYHIFYQIVTHCQSEDELLMNTGLVNNVEMYDYLRYGESLEIDGVDDSHEFLITKNSFLQLGIDLNKFKTICEILAAILHLGNIRF--RFH------DATDSSIIENPELLKLIAGLLGCSIDQLKIWLCFRTISTFQETLHKPLSKAEAQYFRDAFVKTLYSNLFDWIVKQANKVLSTDVSINIKKKLKKTIVVNQEDKKKFIAVLDIYGFETFAENSFEQFCINFANEKLQLQFNLHVFKLEQEEYMNEGLEWTFIDYYNNQPCIDLIESRXXXXXXXXXXXXXXXXSDENWCCKIYSHHLNKSANFNKPKLSNMVFIIEHFAGPVEYKCAGFIEKNRDSVLEEQINLLKASDVQLIAELFRDSEIEIFDTNNXXXXXXXXXXXXXXXXXXQENTRKMKKTVGSQFRNSLKSLMDALNKTNPHYVRCIKPNDLKLPFTFCPERAVQQLRACGVLETIRLSAAGFPSRWTYSDFYHRYYILMSNFNVKNHDFKAGSQKIVETLITVPDAFRFGNTKLFFRPGQVALLEKLRGHKIESSVTLIQSILRGSIERKKYLIIHKLTVQIQTYIRRKLAIEKATKLSQIRAVIIIQSFYRMYLARKLFVKMKCAVLAIEKWRRKIITTRLKQAYKKENCVIICQAIVRRFIQRRKFLKIQRGVILIQNHYRRRKAKETLKILKIEARSINHIKFVNKGLENKIIELTQKLD 2929
            +Y++G KIW+P  + VW  AT+ + + K    +KI TD+G  KE+ L +     P LRNP IL+GQ DLT LSYL+EP VL+NL++RFCER+ IYTYCGI+LVAINPY E+ +YG  II AY      DL+PHIFA+AE A+ ++     N SIIVSGESGAGKTVSAKY MRYFA VGGS++       ETQ+ERKVL S+PI+EAFGNAKT RNDNSSRFGK+ ++LF  +  V+   GA M TYLLEKSRVV+Q  GERNYHIFYQ+        EL+++     + + + +L  G + EI+ V D+ +F  T  +   LG  + +   I +ILA ILHLGNI+   +F+      D+    I  N   L++ A LL  S D L+ WL  R I +  E +  P S   AQ  RDA  K +Y+ LF +IV   NK L+                 N   +  FI VLDIYGFETF  NSFEQFCIN+ANEKLQ QFN HVFKLEQEEY+ EG+ WT ID+Y+NQPCIDLIESRLG+LDLLDEEC++ KGSDE+W  K+     NK  +F KP+     F I+HF+  VEY   GF+EKNRD+V +E   +L  S++ L  ++    EI+    +++K          S    +   +++ +KTVGSQF+ SL SL+  L+ T PHYVRCIKPND K+ F +   + +QQLRACGVLET+R+SAAGFPSRW Y DFY RY +L+    +  +D K   + IV   I   D +RFGNT++FFR GQVA LE++R +  +  +T++QS++R  + R+++L I K+   IQ + R  LA E+  K+ + RA +I+  + R +L R+ +++++ ++  I+ + R ++      A +     +  Q  VR  + RR + K +R +I+ Q   RR  A+   K +K EA++I+H++    GLENKII + Q++D
Sbjct:    7 LYAQGAKIWVPHADLVWESATLEESYRKGAGFLKICTDSGKLKEVKLKADGSDLPPLRNPAILVGQNDLTTLSYLHEPGVLHNLRVRFCERQIIYTYCGIILVAINPYAEMPLYGPSIIRAYRGHAMGDLEPHIFALAEEAYTKLERENCNLSIIVSGESGAGKTVSAKYAMRYFAAVGGSES-------ETQVERKVLASSPIMEAFGNAKTTRNDNSSRFGKFTKLLFRNQMGVMFLQGATMHTYLLEKSRVVYQAQGERNYHIFYQLCAARSKYPELVLD-----HQDKFQFLNMGGAPEIERVSDAEQFNETVQAMTVLGFSIQQIADIVKILAGILHLGNIQVSKKFNEGSEEEDSDSCDIFHNDIHLQITADLLRVSADDLRRWLLMRKIESVNEYVLIPNSIEAAQAARDALAKHIYAKLFQYIVGVLNKSLN-----------------NGSKQCSFIGVLDIYGFETFEVNSFEQFCINYANEKLQQQFNQHVFKLEQEEYLKEGITWTMIDFYDNQPCIDLIESRLGVLDLLDEECRMPKGSDESWAGKLIGK-CNKFPHFEKPRFGTTSFFIKHFSDTVEYDVNGFLEKNRDTVSKELTQVLSESNMSLAKQVMTLEEIDTLCVDSAKSSTLGGRVVISAGRKQVVPSKQHRKTVGSQFQESLASLISTLHATTPHYVRCIKPNDDKVAFKWETAKIIQQLRACGVLETVRISAAGFPSRWLYPDFYMRYQLLVYRSKLDKNDMKLSCRNIVMKWIQDEDKYRFGNTQIFFRAGQVAFLEQVRANLRKKYITIVQSVVRRFVYRRQFLRIQKVINGIQKHARGYLARERTQKMREARAGLILSKYARGWLCRRRYLRLRHSISGIQTYARGMLARNKFHAMRDHYRAVQIQRFVRGALARRAYQKRRRNIIICQAAIRRFLARRKFKRMKAEAKTISHMENKYMGLENKIISMQQRID 945          
BLAST of Dach-2 vs. Ensembl Fly
Match: didum (gene:FBgn0261397 transcript:FBtr0089745)

HSP 1 Score: 779.245 bits (2011), Expect = 0.000e+0
Identity = 446/969 (46.03%), Postives = 612/969 (63.16%), Query Frame = 2
Query:   62 MYSKGVKIWIPDEESVWIGATVLQ-FHKEKNVIKIITDNGISKELNLSSKKCA-PFLRNPDILIGQKDLTYLSYLNEPEVLYNLQIRFCERREIYTYCGIVLVAINPYQELSIYGKEIINAYHSQNSVDLDPHIFAVAENAFRRMSSFGENQSIIVSGESGAGKTVSAKYTMRYFALVGGSKTKQSFNLTETQIERKVLLSNPILEAFGNAKTIRNDNSSRFGKYLEILFNPRNQVI---GANMCTYLLEKSRVVFQNLGERNYHIFYQIVTHCQSEDELLMNTGLVNNVEMYDYLRYGESLEIDGVDDSHEFLITKNSFLQLGIDLNKFKTICEILAAILHLGNIRF--RFH------DATDSSIIENPELLKLIAGLLGCSIDQLKIWLCFRTISTFQETLHKPLSKAEAQYFRDAFVKTLYSNLFDWIVKQANKVLSTDVSINIKKKLKKTIVVNQEDKKKFIAVLDIYGFETFAENSFEQFCINFANEKLQLQFNLHVFKLEQEEYMNEGLEWTFIDYYNNQPCIDLIESRXXXXXXXXXXXXXXXXSDENWCCKIYSHHLNKSANFNKPKLSNMVFIIEHFAGPVEYKCAGFIEKNRDSVLEEQINLLKASDVQLIAELFRDSEIEIFDTNNXXXXXXXXXXXXXXXXXXQENTRKMKKTVGSQFRNSLKSLMDALNKTNPHYVRCIKPNDLKLPFTFCPERAVQQLRACGVLETIRLSAAGFPSRWTYSDFYHRYYILMSNFNVKNHDFKAGSQKIVETLITVPDAFRFGNTKLFFRPGQVALLEKLRGHKIESSVTLIQSILRGSIERKKYLIIHKLTVQIQTYIRRKLAIEKATKLSQIRAVIIIQSFYRMYLARKLFVKMKCAVLAIEKWRRKIITTRLKQAYKKENCVIICQAIVRRFIQRRKFLKIQRGVILIQNHYRRRKAKETLKILKIEARSINHIKFVNKGLENKIIELTQKLD 2929
            +Y++G KIW+P  + VW  AT+ + + K    +KI TD+G  KE+ L +     P LRNP IL+GQ DLT LSYL+EP VL+NL++RFCER+ IYTYCGI+LVAINPY E+ +YG  II AY      DL+PHIFA+AE A+ ++     N SIIVSGESGAGKTVSAKY MRYFA VGGS++       ETQ+ERKVL S+PI+EAFGNAKT RNDNSSRFGK+ ++LF  +  V+   GA M TYLLEKSRVV+Q  GERNYHIFYQ+        EL+++     + + + +L  G + EI+ V D+ +F  T  +   LG  + +   I +ILA ILHLGNI+   +F+      D+    I  N   L++ A LL  S D L+ WL  R I +  E +  P S   AQ  RDA  K +Y+ LF +IV   NK L+                 N   +  FI VLDIYGFETF  NSFEQFCIN+ANEKLQ QFN HVFKLEQEEY+ EG+ WT ID+Y+NQPCIDLIESRLG+LDLLDEEC++ KGSDE+W  K+     NK  +F KP+     F I+HF+  VEY   GF+EKNRD+V +E   +L  S++ L  ++    EI+    +++K          S    +   +++ +KTVGSQF+ SL SL+  L+ T PHYVRCIKPND K+ F +   + +QQLRACGVLET+R+SAAGFPSRW Y DFY RY +L+    +  +D K   + IV   I   D +RFGNT++FFR GQVA LE++R +  +  +T++QS++R  + R+++L I K+   IQ + R  LA E+  K+ + RA +I+  + R +L R+ +++++ ++  I+ + R ++      A +     +  Q  VR  + RR + K +R +I+ Q   RR  A+   K +K EA++I+H++    GLENKII + Q++D
Sbjct:    7 LYAQGAKIWVPHADLVWESATLEESYRKGAGFLKICTDSGKLKEVKLKADGSDLPPLRNPAILVGQNDLTTLSYLHEPGVLHNLRVRFCERQIIYTYCGIILVAINPYAEMPLYGPSIIRAYRGHAMGDLEPHIFALAEEAYTKLERENCNLSIIVSGESGAGKTVSAKYAMRYFAAVGGSES-------ETQVERKVLASSPIMEAFGNAKTTRNDNSSRFGKFTKLLFRNQMGVMFLQGATMHTYLLEKSRVVYQAQGERNYHIFYQLCAARSKYPELVLD-----HQDKFQFLNMGGAPEIERVSDAEQFNETVQAMTVLGFSIQQIADIVKILAGILHLGNIQVSKKFNEGSEEEDSDSCDIFHNDIHLQITADLLRVSADDLRRWLLMRKIESVNEYVLIPNSIEAAQAARDALAKHIYAKLFQYIVGVLNKSLN-----------------NGSKQCSFIGVLDIYGFETFEVNSFEQFCINYANEKLQQQFNQHVFKLEQEEYLKEGITWTMIDFYDNQPCIDLIESRLGVLDLLDEECRMPKGSDESWAGKLIGK-CNKFPHFEKPRFGTTSFFIKHFSDTVEYDVNGFLEKNRDTVSKELTQVLSESNMSLAKQVMTLEEIDTLCVDSAKSSTLGGRVVISAGRKQVVPSKQHRKTVGSQFQESLASLISTLHATTPHYVRCIKPNDDKVAFKWETAKIIQQLRACGVLETVRISAAGFPSRWLYPDFYMRYQLLVYRSKLDKNDMKLSCRNIVMKWIQDEDKYRFGNTQIFFRAGQVAFLEQVRANLRKKYITIVQSVVRRFVYRRQFLRIQKVINGIQKHARGYLARERTQKMREARAGLILSKYARGWLCRRRYLRLRHSISGIQTYARGMLARNKFHAMRDHYRAVQIQRFVRGALARRAYQKRRRNIIICQAAIRRFLARRKFKRMKAEAKTISHMENKYMGLENKIISMQQRID 945          
BLAST of Dach-2 vs. Ensembl Fly
Match: didum (gene:FBgn0261397 transcript:FBtr0089743)

HSP 1 Score: 778.089 bits (2008), Expect = 0.000e+0
Identity = 448/977 (45.85%), Postives = 614/977 (62.85%), Query Frame = 2
Query:   62 MYSKGVKIWIPDEESVWIGATVLQ-FHKEKNVIKIITDNGISKELNLSSKKCA-PFLRNPDILIGQKDLTYLSYLNEPEVLYNLQIRFCERREIYTYCGIVLVAINPYQELSIYGKEIINAYHSQNSVDLDPHIFAVAENAFRRMSSFGENQSIIVSGESGAGKTVSAKYTMRYFALVGGSKTKQSFNLTETQIERKVLLSNPILEAFGNAKTIRNDNSSRFGKYLEILFNPRNQVI---GANMCTYLLEKSRVVFQNLGERNYHIFYQIVTHCQSEDELLMNTGLVNNVEMYDYLRYGESLEIDGVDDSHEFLITKNSFLQLGIDLNKFKTICEILAAILHLGNIRF--RFH------DATDSSIIENPELLKLIAGLLGCSIDQLKIWLCFRTISTFQETLHKPLSKAEAQYFRDAFVKTLYSNLFDWIVKQANKVLSTDVSINIKKKLKKTIVVNQEDKKKFIAVLDIYGFETFAENSFEQFCINFANEKLQLQFNLHVFKLEQEEYMNEGLEWTFIDYYNNQPCIDLIESRXXXXXXXXXXXXXXXXSDENWCCKIYSHHLNKSANFNKPKLSNMVFIIEHFAGPVEYKCAGFIEKNRDSVLEEQINLLKASDVQLIAELFRDSEIEIFDTNNXXXXXXXXXXXXXXXXXXQEN--------TRKMKKTVGSQFRNSLKSLMDALNKTNPHYVRCIKPNDLKLPFTFCPERAVQQLRACGVLETIRLSAAGFPSRWTYSDFYHRYYILMSNFNVKNHDFKAGSQKIVETLITVPDAFRFGNTKLFFRPGQVALLEKLRGHKIESSVTLIQSILRGSIERKKYLIIHKLTVQIQTYIRRKLAIEKATKLSQIRAVIIIQSFYRMYLARKLFVKMKCAVLAIEKWRRKIITTRLKQAYKKENCVIICQAIVRRFIQRRKFLKIQRGVILIQNHYRRRKAKETLKILKIEARSINHIKFVNKGLENKIIELTQKLD 2929
            +Y++G KIW+P  + VW  AT+ + + K    +KI TD+G  KE+ L +     P LRNP IL+GQ DLT LSYL+EP VL+NL++RFCER+ IYTYCGI+LVAINPY E+ +YG  II AY      DL+PHIFA+AE A+ ++     N SIIVSGESGAGKTVSAKY MRYFA VGGS++       ETQ+ERKVL S+PI+EAFGNAKT RNDNSSRFGK+ ++LF  +  V+   GA M TYLLEKSRVV+Q  GERNYHIFYQ+        EL+++     + + + +L  G + EI+ V D+ +F  T  +   LG  + +   I +ILA ILHLGNI+   +F+      D+    I  N   L++ A LL  S D L+ WL  R I +  E +  P S   AQ  RDA  K +Y+ LF +IV   NK L+                 N   +  FI VLDIYGFETF  NSFEQFCIN+ANEKLQ QFN HVFKLEQEEY+ EG+ WT ID+Y+NQPCIDLIESRLG+LDLLDEEC++ KGSDE+W  K+     NK  +F KP+     F I+HF+  VEY   GF+EKNRD+V +E   +L  S++ L  ++    EI+    +++K          S    +Q N        +++ +KTVGSQF+ SL SL+  L+ T PHYVRCIKPND K+ F +   + +QQLRACGVLET+R+SAAGFPSRW Y DFY RY +L+    +  +D K   + IV   I   D +RFGNT++FFR GQVA LE++R +  +  +T++QS++R  + R+++L I K+   IQ + R  LA E+  K+ + RA +I+  + R +L R+ +++++ ++  I+ + R ++      A +     +  Q  VR  + RR + K +R +I+ Q   RR  A+   K +K EA++I+H++    GLENKII + Q++D
Sbjct:    7 LYAQGAKIWVPHADLVWESATLEESYRKGAGFLKICTDSGKLKEVKLKADGSDLPPLRNPAILVGQNDLTTLSYLHEPGVLHNLRVRFCERQIIYTYCGIILVAINPYAEMPLYGPSIIRAYRGHAMGDLEPHIFALAEEAYTKLERENCNLSIIVSGESGAGKTVSAKYAMRYFAAVGGSES-------ETQVERKVLASSPIMEAFGNAKTTRNDNSSRFGKFTKLLFRNQMGVMFLQGATMHTYLLEKSRVVYQAQGERNYHIFYQLCAARSKYPELVLD-----HQDKFQFLNMGGAPEIERVSDAEQFNETVQAMTVLGFSIQQIADIVKILAGILHLGNIQVSKKFNEGSEEEDSDSCDIFHNDIHLQITADLLRVSADDLRRWLLMRKIESVNEYVLIPNSIEAAQAARDALAKHIYAKLFQYIVGVLNKSLN-----------------NGSKQCSFIGVLDIYGFETFEVNSFEQFCINYANEKLQQQFNQHVFKLEQEEYLKEGITWTMIDFYDNQPCIDLIESRLGVLDLLDEECRMPKGSDESWAGKLIGK-CNKFPHFEKPRFGTTSFFIKHFSDTVEYDVNGFLEKNRDTVSKELTQVLSESNMSLAKQVMTLEEIDTLCVDSAKSSTLGGRVVISAGRKQQGNDTRRRVVPSKQHRKTVGSQFQESLASLISTLHATTPHYVRCIKPNDDKVAFKWETAKIIQQLRACGVLETVRISAAGFPSRWLYPDFYMRYQLLVYRSKLDKNDMKLSCRNIVMKWIQDEDKYRFGNTQIFFRAGQVAFLEQVRANLRKKYITIVQSVVRRFVYRRQFLRIQKVINGIQKHARGYLARERTQKMREARAGLILSKYARGWLCRRRYLRLRHSISGIQTYARGMLARNKFHAMRDHYRAVQIQRFVRGALARRAYQKRRRNIIICQAAIRRFLARRKFKRMKAEAKTISHMENKYMGLENKIISMQQRID 953          
BLAST of Dach-2 vs. Ensembl Fly
Match: Myo28B1 (gene:FBgn0040299 transcript:FBtr0079476)

HSP 1 Score: 456.447 bits (1173), Expect = 3.573e-137
Identity = 296/816 (36.27%), Postives = 434/816 (53.19%), Query Frame = 2
Query:  254 KDLTYLSYLNEPEVLYNLQIRFCERREIYTYCGIVLVAINPYQELSIYGKEIINAYHSQNSVDLDPHIFAVAENAFRRMSSFGENQSIIVSGESGAGKTVSAKYTMRYFALVGGSKTKQSFNLTETQIERKVLLSNPILEAFGNAKTIRNDNSSRFGKYLEILFNPRNQVIGANMCTYLLEKSRVVFQNLGERNYHIFYQIVTHCQSEDELLMNTGLVNNVEMYDYLRYGESLEIDGVDDSHEFLITKNSFLQLGIDLNKFKTICEILAAILHLGNIRFRFHDATD--SSIIENPELLKLIAGLLGCSIDQLKIWLCFRTISTFQETLHKPLSKAEAQYFRDAFVKTLYSNLFDWIVKQANKVLSTDVSINIKKKLKKTIVVNQEDKKKFIAVLDIYGFETFAENSFEQFCINFANEKLQLQFNLHVFKLEQEEYMNEGLEWTFIDYYNNQPCIDLIESRXXXXXXXXXXXXX-XXXSDENWCCKIYSHHLNKSANFNKPKLSNMVFIIEHFAGPVEYKCAGFIEKNRDSVLEEQINLLKASDVQLIAELFRDSEIEIFDTNNXXXXXXXXXXXXXXXXXXQENTRKMKKTVGSQFRNSLKSLMDALNKTNPHYVRCIKPNDLKLPFTFCPERAVQQLRACGVLETIRLSAAGFPSRWTYSDFYHRYYILMSNFN-VKNHDFKAGSQKIVETLITVPDAFRFGNTKLFFRPGQVALLEKLRGHKIESSVTLIQSILRGSIERKKYLIIHKLTVQIQTYIRRKL--------------------AIEKATKLSQIRA-VIIIQSFYRMYLARKLFVK 2626
            +D+  L  L E  +L NLQ R+  ++ IYTY G +LVAINPYQ L IY    I  Y +++  +L PHIFA+++NAF+R+    ENQ +++SGESGAGKT S K  ++Y A + G   K S+      IE++++ +NPI+EAFGNAKT+RNDNSSRFGKY+EI F P+  + GA +  YLLEKSR+VFQ+  ERNYHIFY ++    + +   +      +   Y YL  G    + G  D+ +F   + +   L     +  +I  +LAAILHLGN+RF   +  +  ++ I++   L+ +A LLG  I  L   L  RTI    E +   LSK  A   RDAFVK+LY  +F  IV++ N+ ++  V   +                  I VLDI+GFE F  NSFEQ CIN+ANE LQ  F  H+FK+EQ+EY NE + W  I++ +NQ  +DLI  +   L  L +E     KG+D+    K++  H N+S           +F I H+AG V Y   GF+EKNRDS   +   L++ S  + + ++F   E+ +                         +T K + T+  +FRNSL  LM  L++ +P+++RCIKPN+ K P  F  E  V+QLR  G++ET R+  AG+P R  Y  F  RY +L+     ++  D +  +++I E  +      ++G TKLF R    A LE  R   +  S+  IQ  +R  + R+      +  + +Q Y R +L                    A +  TK + +R   I +Q+  R YL RK F K
Sbjct:   69 EDMITLGDLQEYTILRNLQNRYA-KQLIYTYTGSMLVAINPYQILPIYTNREIQLYRNKSLAELPPHIFAISDNAFQRLQRLKENQCVVISGESGAGKTESTKLILQYLAAISG---KHSW------IEQQIIEANPIMEAFGNAKTVRNDNSSRFGKYIEIRFTPQGAIQGARIQQYLLEKSRIVFQSRDERNYHIFYCMLAGLSTAERERLKLQ-EQSPSQYHYLAQGGCFTLPGRGDAKDFADIRAAMKVLSFKPEEVWSILSLLAAILHLGNLRFTATEVANLATAEIDDTPNLQRVAQLLGIPISALNAALTQRTIFVHGEHVTTSLSKEAAIEGRDAFVKSLYDGIFVRIVRRINETINKQVDQPMNS----------------IGVLDIFGFENFDNNSFEQLCINYANENLQQFFVGHIFKMEQDEYQNEHINWQHIEFQDNQQILDLIGMKPMNLMSLIDEESKFPKGTDQTLLEKLHVQHGNRSIYVKGKTTQTSLFGIRHYAGVVMYNPLGFLEKNRDSFSGDLRTLVQRSTNKYLVDIF-PHEMPM-------------------------DTAKKQPTLCVKFRNSLDMLMRTLSQAHPYFIRCIKPNEYKEPKNFDKELCVRQLRYSGMMETARIRRAGYPIRHAYRAFVERYRLLVPPVGPLEQCDCRKLARQICEVALPADSDRQYGKTKLFLRDEDDASLELQRSQLMLKSIVTIQRGIRRVLFRRYMKRYREAIITVQRYWRGRLQRRKYQVMRQGFHRLGACIAAQQLTTKFTMVRCRTIKLQALSRGYLVRKDFQK 831          
BLAST of Dach-2 vs. Ensembl Fly
Match: Myo28B1 (gene:FBgn0040299 transcript:FBtr0079474)

HSP 1 Score: 456.447 bits (1173), Expect = 4.197e-137
Identity = 296/816 (36.27%), Postives = 434/816 (53.19%), Query Frame = 2
Query:  254 KDLTYLSYLNEPEVLYNLQIRFCERREIYTYCGIVLVAINPYQELSIYGKEIINAYHSQNSVDLDPHIFAVAENAFRRMSSFGENQSIIVSGESGAGKTVSAKYTMRYFALVGGSKTKQSFNLTETQIERKVLLSNPILEAFGNAKTIRNDNSSRFGKYLEILFNPRNQVIGANMCTYLLEKSRVVFQNLGERNYHIFYQIVTHCQSEDELLMNTGLVNNVEMYDYLRYGESLEIDGVDDSHEFLITKNSFLQLGIDLNKFKTICEILAAILHLGNIRFRFHDATD--SSIIENPELLKLIAGLLGCSIDQLKIWLCFRTISTFQETLHKPLSKAEAQYFRDAFVKTLYSNLFDWIVKQANKVLSTDVSINIKKKLKKTIVVNQEDKKKFIAVLDIYGFETFAENSFEQFCINFANEKLQLQFNLHVFKLEQEEYMNEGLEWTFIDYYNNQPCIDLIESRXXXXXXXXXXXXX-XXXSDENWCCKIYSHHLNKSANFNKPKLSNMVFIIEHFAGPVEYKCAGFIEKNRDSVLEEQINLLKASDVQLIAELFRDSEIEIFDTNNXXXXXXXXXXXXXXXXXXQENTRKMKKTVGSQFRNSLKSLMDALNKTNPHYVRCIKPNDLKLPFTFCPERAVQQLRACGVLETIRLSAAGFPSRWTYSDFYHRYYILMSNFN-VKNHDFKAGSQKIVETLITVPDAFRFGNTKLFFRPGQVALLEKLRGHKIESSVTLIQSILRGSIERKKYLIIHKLTVQIQTYIRRKL--------------------AIEKATKLSQIRA-VIIIQSFYRMYLARKLFVK 2626
            +D+  L  L E  +L NLQ R+  ++ IYTY G +LVAINPYQ L IY    I  Y +++  +L PHIFA+++NAF+R+    ENQ +++SGESGAGKT S K  ++Y A + G   K S+      IE++++ +NPI+EAFGNAKT+RNDNSSRFGKY+EI F P+  + GA +  YLLEKSR+VFQ+  ERNYHIFY ++    + +   +      +   Y YL  G    + G  D+ +F   + +   L     +  +I  +LAAILHLGN+RF   +  +  ++ I++   L+ +A LLG  I  L   L  RTI    E +   LSK  A   RDAFVK+LY  +F  IV++ N+ ++  V   +                  I VLDI+GFE F  NSFEQ CIN+ANE LQ  F  H+FK+EQ+EY NE + W  I++ +NQ  +DLI  +   L  L +E     KG+D+    K++  H N+S           +F I H+AG V Y   GF+EKNRDS   +   L++ S  + + ++F   E+ +                         +T K + T+  +FRNSL  LM  L++ +P+++RCIKPN+ K P  F  E  V+QLR  G++ET R+  AG+P R  Y  F  RY +L+     ++  D +  +++I E  +      ++G TKLF R    A LE  R   +  S+  IQ  +R  + R+      +  + +Q Y R +L                    A +  TK + +R   I +Q+  R YL RK F K
Sbjct:   70 EDMITLGDLQEYTILRNLQNRYA-KQLIYTYTGSMLVAINPYQILPIYTNREIQLYRNKSLAELPPHIFAISDNAFQRLQRLKENQCVVISGESGAGKTESTKLILQYLAAISG---KHSW------IEQQIIEANPIMEAFGNAKTVRNDNSSRFGKYIEIRFTPQGAIQGARIQQYLLEKSRIVFQSRDERNYHIFYCMLAGLSTAERERLKLQ-EQSPSQYHYLAQGGCFTLPGRGDAKDFADIRAAMKVLSFKPEEVWSILSLLAAILHLGNLRFTATEVANLATAEIDDTPNLQRVAQLLGIPISALNAALTQRTIFVHGEHVTTSLSKEAAIEGRDAFVKSLYDGIFVRIVRRINETINKQVDQPMNS----------------IGVLDIFGFENFDNNSFEQLCINYANENLQQFFVGHIFKMEQDEYQNEHINWQHIEFQDNQQILDLIGMKPMNLMSLIDEESKFPKGTDQTLLEKLHVQHGNRSIYVKGKTTQTSLFGIRHYAGVVMYNPLGFLEKNRDSFSGDLRTLVQRSTNKYLVDIF-PHEMPM-------------------------DTAKKQPTLCVKFRNSLDMLMRTLSQAHPYFIRCIKPNEYKEPKNFDKELCVRQLRYSGMMETARIRRAGYPIRHAYRAFVERYRLLVPPVGPLEQCDCRKLARQICEVALPADSDRQYGKTKLFLRDEDDASLELQRSQLMLKSIVTIQRGIRRVLFRRYMKRYREAIITVQRYWRGRLQRRKYQVMRQGFHRLGACIAAQQLTTKFTMVRCRTIKLQALSRGYLVRKDFQK 832          
BLAST of Dach-2 vs. Ensembl Zebrafish
Match: myo5b (myosin VB [Source:ZFIN;Acc:ZDB-GENE-031219-7])

HSP 1 Score: 1098.96 bits (2841), Expect = 0.000e+0
Identity = 717/1902 (37.70%), Postives = 1065/1902 (55.99%), Query Frame = 2
Query:   47 MALYEMYSKGVKIWIPDEESVWIGATVLQFHKEKN-VIKIITDNGISKELNLSSKKCA-PFLRNPDILIGQKDLTYLSYLNEPEVLYNLQIRFCERREIYTYCGIVLVAINPYQELSIYGKEIINAYHSQNSVDLDPHIFAVAENAFRRMSSFGENQSIIVSGESGAGKTVSAKYTMRYFALVGGSKTKQSFNLTETQIERKVLLSNPILEAFGNAKTIRNDNSSRFGKYLEILFNPRNQVIGANMCTYLLEKSRVVFQNLGERNYHIFYQIVTHCQSEDELLMNTGLVNNVEMYDYLRYGESLEIDGVDDSHEFLITKNSFLQLGIDLNKFKTICEILAAILHLGNIRF-RFHDATDSSIIENPELLKLIAGLLGCSIDQLKIWLCFRTISTFQETLHKPLSKAEAQYFRDAFVKTLYSNLFDWIVKQANKVLSTDVSINIKKKLKKTIVVNQEDKKKFIAVLDIYGFETFAENSFEQFCINFANEKLQLQFNLHVFKLEQEEYMNEGLEWTFIDYYNNQPCIDLIESRXXXXXXXXXXXXXXXXSDENWCCKIYSHHLNKSANFNKPKLSNMVFIIEHFAGPVEYKCAGFIEKNRDSVLEEQINLLKASDVQLIAELFRDSEIEIFDTNNXXXXXXXXXXXXXXXXXXQENTRKMKKTVGSQFRNSLKSLMDALNKTNPHYVRCIKPNDLKLPFTFCPERAVQQLRACGVLETIRLSAAGFPSRWTYSDFYHRYYILMSNFNVKNHDFKAGSQKIVETLITVPDAFRFGNTKLFFRPGQVALLEKLRGHKIESSVTLIQSILRGSIERKKYLIIHKLTVQIQTYIRRKLAIEKATKLSQIRAVIIIQSFYRMYLARKLFVKMKCAVLAIEKWRRKIITTRLKQAYKKENCVIICQAIVRRFIQRRKFLKIQRGVILIQNHYRRRKAKETLKILKIEARSINHIKFVNKGLENKIIELTQKLDTKEKEMCXXXXXXXXXXXXXXXXXXXXXAESAKIYQNTVQDLQTEIIQLKKELNREIVEKNKIFADKELLEINYKKKINYLENLIEELKSSPSV-----------IEPNIICNGDEAQQSICQDEHQKFINEQMDHQKLVREYEKLEMKYENLYKEFLFVKSSNQKPSINYDNQTSNDSETESTFSKDDADVESLSDKVDAKTTKEHXXXXXXXXXXLPNFISESISTAGDLAVVMQLQMNISSLSQENNRLKETVQQFED------ELLKYEQCAEDSKGLVIHNEYD---------------NELLSIIKDIKGMDEHGLKSRLIDEVANLKKKLKQSNE--DYQK-----LRLHIFDGSMSKLTGNLDHESIN--SEEEELKRAFESQKE----ANRKMLKEIEGIKANNVDLKKALFQIRKDKEQLQVQLGKQHLMIRHGVEYLQNL-----KLTPKERLDKFVQNEISRILLENLKLQERNDQIISETIELKRGLKYFAFRLQKYEGSLVPNPNKEEDLLQLIQNVIYHSKMKTIGKRECYSEIGLIDLNMSELSIFIKSFIFDLSPSICLQYEPYHLVPYIIFMVTRKFDFYKEEDQMTNFLSKLIVALKRTIRKRRNYIEYLVMLLSNVFCLVNLXXXXXXXXXXXXLNTAEDIQHYFVHYDLNEFIRLLKELCVTLFQMILKTIVDNLLPQSLCIDAILVHEAIIDFLSKDGTKYK---SNIETQ---PKNTSFNVLTKNLQSVLEILKNHKIPQLIINQIFVHIAYLINAYCLNTLLFRTDLCYFSKGLQIKYNLSSFETWIRYQKLIDSGALQCLRPMTEAVQLLQTLIDSDEDAKFVCDMCEYLNTRQVVKILNNFNPRDGYGCRLSSGLIAKIETQMKIKRGDEPSESKLETPTVIEIPIDIPFIHNGVSLCRTIIPKPLYLSCLT 5575
            M++ E+YSK  ++WIPD + VW  A +++ +KE + V+ +  ++  + E  + SK    PFLRNPDIL+G+ DLT LSYL+EP VL+NL++RF E   IYTYCGIVLVAINPY++L IYG+E+INAY  QN  D+DPHIFAVAE AF++M+   +NQSIIVSGESGAGKTVSAKY MR+FA VGGS         +T +E KVL S+PI+EA GNAKT RNDNSSRFGKY++I F+ R  +IGANM TYLLEKSRVVFQ   ERNYHIFYQ+   C   +        + + E + Y   GE++ I+GV+D+ + + T+ +   LG+  N   +I +I+A+ILHLGN+   +  D     I  N   L     LLG   +Q++ WLC R + T  ET  K +  ++A   RDA  K +Y++LFDWIV+  NK L T                    +  FI VLDIYGFETF  NSFEQFCIN+ANEKLQ QFN HVFKLEQEEYM E + WT ID+Y+NQPCIDLIE++LG+LDLLDEECK+ KG+D+NW  K+YS H + S +F KP++SN  FI+ HFA  VEY+C GF+EKNRD+V EEQIN+LKAS  QL+A+LF D++    D        + + + +      + + R+ +KTVG+QFRNSL  LM+ LN T PHYVRCIKPND K  F F   RAVQQLRACGVLETIR+SAAG+PSRWTY DF+ RY +LM+  ++   D K   + ++E LI  PD F+FG TK+FFR GQVA LEKLR  K   +   IQ  +RG ++R +Y  I K  + +Q Y R  LA   A  L   RA +I Q  YRM   R+ +++++ AV+ I+ + R +   RL Q +   +  +I Q  VR ++ R+K+ + +   I+IQ  YRR +AK  LK LKIEARS  H K +N G+ENKI++L +K+D + KE+      L   K +    +     E   +   T Q   T++  L++EL +   E  +  A K+LLE  +  +   LE  +EEL+   +V           I+ +    G +  Q   + +H+   +E+  +Q LV+EY +LE +YENL ++   +K         +     N S   S  S  +    SLS+  D   T + V +  +               A DL+V M+LQ  +  L QE  RL+  + + E+         K     +D    + +N                  NEL   + D     E+   + L D    L  +LK +NE  D +K     L+  I +   ++ T NL+H + N  SE  + K    ++      A++K+L+           L+    Q R + E L  Q+     +++  +E  Q++      L+P   ++  VQ EI+R+  ENL L+E  +++     +LK+ L+ +  ++Q+ E            + Q  ++    ++  T+ +RE   E G+++    + ++ +K+ + D+ P+      P  L  YI+FM  R  D+  ++ ++ + L+  I A+K+ ++K  +  E     L+N   L++  +QYSG + F   N+A+  +H   ++DL E+ ++L +L + ++Q ++K    N+ P  + + A+L  E+I          Y+   S+++ +   P   +   L K L      + +H +   I  Q+   + Y INA  LN LL R D+C +S G+Q++YN+S  E W+R + L   GA+  + P+ +A QLLQ    + +DA+ +C +C  L+ +Q+VKILN + P + +  R++   I  I+ +++    D    ++L   T    P+  P+  + +SL    IP  L L  LT
Sbjct:    1 MSVTELYSKYTRVWIPDPDEVWRSAEIIKDYKEGDTVLHLKLEDESTLEYPIGSKDNPLPFLRNPDILVGENDLTALSYLHEPAVLHNLKVRFLESNHIYTYCGIVLVAINPYEQLHIYGEEVINAYSGQNMGDMDPHIFAVAEEAFKQMARDEKNQSIIVSGESGAGKTVSAKYAMRFFATVGGSAN-------DTNVEEKVLASSPIMEAIGNAKTTRNDNSSRFGKYIQIGFDRRYHIIGANMRTYLLEKSRVVFQAEEERNYHIFYQLCASCSLPE---FKDLTLTSAEDFTYTSLGENIFIEGVNDAEDLVKTREALTMLGVKENHQMSIFKIIASILHLGNVEIVQERDGESCHINRNDTHLHHFCRLLGIEQEQMENWLCRRKLVTTSETYVKNMPHSQAVNARDALAKHIYAHLFDWIVEHINKSLHTSTK-----------------QHSFIGVLDIYGFETFEINSFEQFCINYANEKLQQQFNSHVFKLEQEEYMKEQIPWTLIDFYDNQPCIDLIEAKLGILDLLDEECKVPKGTDQNWAQKLYSKH-SGSGHFEKPRMSNKSFIVVHFADKVEYQCDGFLEKNRDTVYEEQINILKASKFQLVADLFDDAK----DAAPHPGSKTSRINVRPAKPAPKGHNREHRKTVGTQFRNSLHLLMETLNATTPHYVRCIKPNDYKESFVFDSRRAVQQLRACGVLETIRISAAGYPSRWTYPDFFSRYRVLMTKKDLSVGDKKQVCKNLLEILIKDPDKFQFGKTKIFFRAGQVAYLEKLRADKFRFACIKIQKTVRGWLQRIRYRKIRKSAITLQRYGRGYLARRYAEMLRLTRAAVICQKQYRMVQVRREYLRVRRAVITIQAFTRGMFIRRLYQEFLLHHKAMIIQKTVRGWLVRKKYQRSRYAAIVIQCFYRRVRAKRQLKQLKIEARSAEHFKKLNVGMENKIVQLQKKMDNQSKELKSQNENLAVAKTVLETEVSKLSKELETL--RTRQVAGTQMTSLQEELEKLRAELQEAHAHKKLLEEEFSNEKQGLEQRVEELEKENTVLKKEKEEMNRRIQTSTQDQGGDVSQKESRLQHE-LDDERQRYQNLVKEYSRLEQRYENLQEDMSSMKF--------HPGHRRNPSNQSSLGSDSNYPSISLSEVGDTDDTIQQVEEMGIE------------KAAMDLSVFMKLQKRVRELEQERKRLQTNLDKVEELSKRKGSEAKNSTSEDDINADLAYNSLKRQELETENKKLKNDLNELRKAVAD--RASENNSSNELQDGYNLLLSQLKAANEELDVRKEEVLMLKTQIVNS--TRQTENLNHINSNDVSEWTDNKSPVNTEDRVDAPASKKLLE---------TQLQTQTRQHRDELEALHTQIE----LLKDNLEKKQDMLDHFSTLSPDALVEFSVQQEITRLTNENLDLKELVEKLEKNEKKLKKQLRIYMKKVQELE------------VTQATKSRPELTRQFTVQRREKDFE-GMLEYYKEDEALLVKTLVTDMKPNAVSATVPC-LPAYILFMCIRHADYINDDQKVHSLLTATINAIKKVLKKNNDDFEMTSFWLANASRLLHCLKQYSGDEAFMTQNSAKQNEHCLKNFDLAEYRQVLSDLSIQIYQQLVKVAEANMQP--MIVSAMLESESIPSLAGVKPMGYRNRSSSVDCESGGPAGYTLQALIKQLAQFYSTMADHGLDPEISQQVLRQLFYSINAVTLNNLLLRKDVCSWSTGMQLRYNISQLEEWLRGKNLHQCGAVATMEPVIQAAQLLQVKKKTSQDAEAICSLCTALSLQQIVKILNLYTPLNEFEERVTVSFIRDIQNRLQ----DRIENNQLLADTKYTFPVLFPYTPSNLSLETIHIPASLSLDFLT 1810          
BLAST of Dach-2 vs. Ensembl Zebrafish
Match: myo5aa (myosin VAa [Source:ZFIN;Acc:ZDB-GENE-041027-2])

HSP 1 Score: 1092.8 bits (2825), Expect = 0.000e+0
Identity = 711/1891 (37.60%), Postives = 1082/1891 (57.22%), Query Frame = 2
Query:   62 MYSKGVKIWIPDEESVWIGATVLQFHKEKN-VIKIITDNGISKELNLSSK-KCAPFLRNPDILIGQKDLTYLSYLNEPEVLYNLQIRFCERREIYTYCGIVLVAINPYQELSIYGKEIINAYHSQNSVDLDPHIFAVAENAFRRMSSFGENQSIIVSGESGAGKTVSAKYTMRYFALVGGSKTKQSFNLTETQIERKVLLSNPILEAFGNAKTIRNDNSSRFGKYLEILFNPRNQVIGANMCTYLLEKSRVVFQNLGERNYHIFYQIVTHCQSEDELLMNTGLVNNVEMYDYLRYGESLEIDGVDDSHEFLITKNSFLQLGIDLNKFKTICEILAAILHLGNIRFRFHDATDSSIIENPELLKLIAGLLGCSIDQLKIWLCFRTISTFQETLHKPLSKAEAQYFRDAFVKTLYSNLFDWIVKQANKVLSTDVSINIKKKLKKTIVVNQEDKKKFIAVLDIYGFETFAENSFEQFCINFANEKLQLQFNLHVFKLEQEEYMNEGLEWTFIDYYNNQPCIDLIESRXXXXXXXXXXXXXXXXSDENWCCKIYSHHLNKSANFNKPKLSNMVFIIEHFAGPVEYKCAGFIEKNRDSVLEEQINLLKASDVQLIAELFRDSEIEIFDTNNXXXXXXXXX-XXXXXXXXXQENTRKMKKTVGSQFRNSLKSLMDALNKTNPHYVRCIKPNDLKLPFTFCPERAVQQLRACGVLETIRLSAAGFPSRWTYSDFYHRYYILMSNFNVKNHDFKAGSQKIVETLITVPDAFRFGNTKLFFRPGQVALLEKLRGHKIESSVTLIQSILRGSIERKKYLIIHKLTVQIQTYIRRKLAIEKATKLSQIRAVIIIQSFYRMYLARKLFVKMKCAVLAIEKWRRKIITTRLKQAYKKENCVIICQAIVRRFIQRRKFLKIQRGVILIQNHYRRRKAKETLKILKIEARSINHIKFVNKGLENKIIELTQKLDTKEKEMCXXXXXXXXXXXXXXXXXXXXXA---------ESAKIYQNTVQDLQTEIIQLKKELNREIVEKNKIFADKELLEINYKKKINYLENLIEELKSSPS----VIEPNIICNGDEAQQSICQDEHQKFIN----EQMDHQKLVREYEKLEMKYENLYKEFLFVKSSNQKPSINYDNQTSNDSETESTFSKDDADVESLSDKVDAKTTKEHXXXXXXXXXXLPNFISESISTA-GDLAVVMQLQMNISSLSQE----NNRLKETVQQFEDELLKYEQCAEDSKGLVIHNE-------------YDNELLSIIKDIKGMDEHGLKSRLIDEVANLKKKLKQSNEDYQ--KLRLHIFDGSMSKLTGNLDHESINSEE----EELKRAFESQKEANRKMLKEIEGIKANNVDLKKAL-FQIRKDKEQLQVQLGKQHLMI----RHGVEYLQNLKLTPKERLDKFVQNEISRILLENLKLQERNDQIISETIELKRGLKYFAFRLQKYEGSLVP-NPNKEEDLLQLIQNVIYHSKMKTIGKRECYSEIGLIDLNMSELSIFIKSFIFDLSP-SICLQYEPYHLVPYIIFMVTRKFDFYKEEDQMTNFLSKLIVALKRTIRKRRNYIEYLVMLLSNVFCLVNLXXXXXXXXXXXXLNTAEDIQHYFVHYDLNEFIRLLKELCVTLFQMILKTIVDNLLPQSLCIDAILVHEAI--IDFLSKDGTKYKSNIETQPKNTSFNVLTKNLQSVLEILKNHKIPQLIINQIFVHIAYLINAYCLNTLLFRTDLCYFSKGLQIKYNLSSFETWIRYQKLIDSGALQCLRPMTEAVQLLQTLIDSDEDAKFVCDMCEYLNTRQVVKILNNFNPRDGYGCRLSSGLIAKIETQMKIKRGDEPSESKLETPTVIEIPIDIPFIHNGVSLCRTIIPKPLYLSCLT 5575
            M+ K  ++WIPD+E VW  A + + +++ + V+++  ++G   E  L  K    P LRNPDIL+G+ DLT LSYL+EP VL+NL++RF + + IYTYCGIVLVAINPY+ L IYG +IINAY  QN  D+DPHIFAVAE A+++M+    NQSIIVSGESGAGKTVSAKY MRYFA V GS        +E  +E KVL SNPI+E+ GNAKT RNDNSSRFGKY+EI F+ +  +IGANM TYLLEKSRVVFQ   ERNYHIFYQ+       +   +  G  N+   + Y + G +  IDGVDD+ E   T+N+F+ LGI+ +    + +ILA+ILHLGN+  +  D+  S I  N   L +   L+G +   +  WLC + + T  ET  KP+ K +A   RDA  K +Y+ LF+WIV   NK L + V                  +  FI VLDIYGFETF  NSFEQFCIN+ANEKLQ QFN+HVFKLEQEEYM E + WT ID+Y+NQPCI+LIE+++G+LDLLDEECK+ KGSD++W  K+Y+ HL   A F KP++SN  FII+HFA  VEY+C GF+EKN+D+V EEQIN+LKAS   L+ ELF D E     T  +         S K       + +++ KKTVG QFRNSL+ LM+ LN T PHYVRCIKPND K  FTF P+RAVQQLRACGVLETIR+SAAGFPSRWTY +F+ RY +LM   +V   D K   + ++E L+  PD ++FG TK+FFR GQVA LEKLR  K+ ++   IQ  +R  + RKKYL +      IQ ++R   A   A  L + RA IIIQ + RMY+ +  + + + A LA++   R  +  +L +A  +E+  +I Q +VR ++ R+ F +  + ++ +Q   RR +AK  LK LKIEARS+ H K +N G+ENKI++L +++D + KE   +  +L   +    +  +  +A         E AK   N V  L  E+ +L+K+L     EK  I    +  +   +K I+ L+   + LK+  +    +I+       D+ Q+++ ++E Q+  N    E+  +Q L+ E+ +LE KY++L KE + +  +  KP     + T + +E+E T++ + A+ E  S                         + E +S +  D+++ ++LQ  +S L QE     N L    +QF+    + ++  + ++G  +  E               ++L  + + ++G  E G  +        L  +L  SNE+ +  K  + I    +      + H++  +E     E++++  ++++ +   M     G+K  N  L+  L  Q R    +++V  G+ H +     R      QNL+L P+ R++  +Q+EI+R+  ENL L E+ ++      +LK+ LK FA ++   EG  +  +P +  D  + +  V        I +RE   + G+++    +    +K+ I +L P  + +   P  L  YI+FM  R  D+  ++ ++ + L+ +I ++K+ ++KR +  E +   L+N    ++  +QYSG +QF   N+ +  +H   ++DL E+ ++L +L + ++Q ++K + +N+L Q + +  +L HE I  +  +   G + +++        + + + + L +   I+ +H     +I Q+     Y+I A  LN LL R D+C +SKG+QI+YN+S  E W+R + L+  GA + L P+ +A QLLQ    +DEDA+ +C MC  L+T Q+VK+LN + P + +  R+S   I  I+T+++    D     +L   T +  P+  PF  + ++L    IP  L L+ LT
Sbjct:    8 MFIKYARVWIPDDEEVWRSAELTKDYRQGDGVLQLQLEDGKDLEFKLDPKTNNLPHLRNPDILVGENDLTALSYLHEPAVLHNLKVRFIDSKLIYTYCGIVLVAINPYETLPIYGADIINAYSGQNMGDMDPHIFAVAEEAYKQMARDERNQSIIVSGESGAGKTVSAKYAMRYFATVSGSA-------SEANVEEKVLASNPIMESIGNAKTTRNDNSSRFGKYIEIGFDKKYHIIGANMRTYLLEKSRVVFQADEERNYHIFYQLCASAHLPEFKALKLGKAND---FHYTKQGRNPVIDGVDDAKEMSTTRNAFILLGINESYQMGLFQILASILHLGNVDVKDRDSDSSIIPPNNGHLSVFCELMGVTYQDMSHWLCHKKLKTATETYIKPIPKLQAINARDALAKHIYAKLFNWIVDHVNKALHSTVK-----------------QHSFIGVLDIYGFETFEINSFEQFCINYANEKLQQQFNMHVFKLEQEEYMKEQIPWTLIDFYDNQPCINLIEAKMGILDLLDEECKMPKGSDDSWAQKLYNTHLKTCALFEKPRMSNKAFIIQHFADKVEYQCDGFLEKNKDTVNEEQINVLKASKFDLLVELFHDEEKATSPTGAAPGPGGRTRLSVKPDKGKSSQASKEHKKTVGLQFRNSLQLLMETLNATTPHYVRCIKPNDYKHAFTFDPKRAVQQLRACGVLETIRISAAGFPSRWTYQEFFSRYRVLMKQKDVLT-DKKMTCKNVLEKLVQDPDKYQFGKTKIFFRAGQVAYLEKLRADKLRAACIRIQKTIRCWLARKKYLRMKHAATTIQRFVRGYQARCLAKFLRRTRAAIIIQKYQRMYIQKTCYKRKQAAALAMQCILRAYMARQLYKALLREHKAVIIQKMVRGWLARQWFKRSLKAIVYLQCCIRRMRAKRELKKLKIEARSVEHFKKLNIGMENKIMQLQRRIDDQNKENRSMSERLNTLETSHAVESERMRAEVTRLRGAEEDAKNNANKVTSLLEELERLRKDLQNTQKEKKAIEDWAQTYQDEMEKMISELKEQNQLLKTEKNNLNQLIQEQSQQWTDKMQRAL-KEETQQLENDLNEERSRYQNLLTEHLRLEEKYDDL-KEEITLAVNVPKPGHRRTDSTHSSNESECTYNSEFAESEEGSR------------------------VGEDVSKSILDMSLFLKLQKRVSELEQEKQSLQNELDRREEQFQRARARDDEEHKKARGAELEYESLKRQELESENKKLKHDLNQMRQSLRGSVEAGSGAPGSPAYTVLLDQLNASNEELEVRKEEVLILRSQLVSQKEAMQHKTTMTEPLPYIEDVQKLTDAKEISQAYM-----GLKDTNRLLESQLQAQRRSHDNEVEVLRGELHSLKEENNRQQQLLAQNLQLPPEARIEASLQHEITRLTNENLDLMEQLEKQDKTVRKLKKQLKVFAKKINDLEGGQMDVSPGQTAD--EPVHPV-------NIPRREKDFQ-GMLEYKKEDELKLVKNIILELKPRGVAVNLIP-GLPAYILFMCLRHADYINDDQKVRSLLTSVINSIKKILKKRGDDFETVSFWLANTCRFLHCLKQYSGDEQFMKHNSPKQNEHCLSNFDLAEYRQVLSDLAIQIYQQLIKCM-ENIL-QPMIVSGMLEHETIQGVSGVKPTGLRKRTSSIADEGTYTLDSIIRQLNTFHSIMCHHGTDPELIKQVVKQQFYIIGAVTLNNLLLRKDMCSWSKGMQIRYNVSQLEEWLRDKNLMTCGAKETLEPLIQAAQLLQVKKKTDEDAEAICSMCNALSTAQIVKVLNLYTPVNAFEERVSVLFIRTIQTRLR----DRKESPQLLMDTKLIYPVTFPFNPSSLALETIQIPSSLNLAFLT 1822          
BLAST of Dach-2 vs. Ensembl Zebrafish
Match: myo5aa (myosin VAa [Source:ZFIN;Acc:ZDB-GENE-041027-2])

HSP 1 Score: 1090.1 bits (2818), Expect = 0.000e+0
Identity = 715/1921 (37.22%), Postives = 1088/1921 (56.64%), Query Frame = 2
Query:   47 MALYEMYSKGVKIWIPDEESVWIGATVLQFHKEKN-VIKIITDNGISKELNLSSK-KCAPFLRNPDILIGQKDLTYLSYLNEPEVLYNLQIRFCERREIYTYCGIVLVAINPYQELSIYGKEIINAYHSQNSVDLDPHIFAVAENAFRRMSSFGENQSIIVSGESGAGKTVSAKYTMRYFALVGGSKTKQSFNLTETQIERKVLLSNPILEAFGNAKTIRNDNSSRFGKYLEILFNPRNQVIGANMCTYLLEKSRVVFQNLGERNYHIFYQIVTHCQSEDELLMNTGLVNNVEMYDYLRYGESLEIDGVDDSHEFLITKNSFLQLGIDLNKFKTICEILAAILHLGNIRFRFHDATDSSIIENPELLKLIAGLLGCSIDQLKIWLCFRTISTFQETLHKPLSKAEAQYFRDAFVKTLYSNLFDWIVKQANKVLSTDVSINIKKKLKKTIVVNQEDKKKFIAVLDIYGFETFAENSFEQFCINFANEKLQLQFNLHVFKLEQEEYMNEGLEWTFIDYYNNQPCIDLIESRXXXXXXXXXXXXXXXXSDENWCCKIYSHHLNKSANFNKPKLSNMVFIIEHFAGPVEYKCAGFIEKNRDSVLEEQINLLKASDVQLIAELFRDSEIEIFDTNNXXXXXXXXX-XXXXXXXXXQENTRKMKKTVGSQFRNSLKSLMDALNKTNPHYVRCIKPNDLKLPFTFCPERAVQQLRACGVLETIRLSAAGFPSRWTYSDFYHRYYILMSNFNVKNHDFKAGSQKIVETLITVPDAFRFGNTKLFFRPGQVALLEKLRGHKIESSVTLIQSILRGSIERKKYLIIHKLTVQIQTYIRRKLAIEKATKLSQIRAVIIIQSFYRMYLARKLFVKMKCAVLAIEKWRRKIITTRLKQAYKKENCVIICQAIVRRFIQRRKFLKIQRGVILIQNHYRRRKAKETLKILKIEARSINHIKFVNKGLENKIIELTQKLDTKEKEMCXXXXXXXXXXXXXXXXXXXXXA---------ESAKIYQNTVQDLQTEIIQLKKELNREIVEKNKIFADKELLEINYKKKINYLENLIEELKSSPS----VIEPNIICNGDEAQQSICQDEHQKFIN----EQMDHQKLVREYEKLEMKYENLYKEFLFVKSSNQKPSINYDNQTSNDSETESTFSKDDADVESLSDKVDAKTTKEHXXXXXXXXXXLPNFISESISTA-GDLAVVMQLQMNISSLSQE----NNRLKETVQQFEDELLKYEQCAEDSKGLVIHNE-------------YDNELLSIIKDIKGMDEHGLKSRLIDEVANLKKKLKQSNEDYQ--KLRLHIFDGSMSKLTGNLDHESINSEE----EELKRAFESQKEANRKMLKEIEGIKANNVDLKKAL-FQIRKDKEQLQVQLGKQHLMI----RHGVEYLQNLKLTPKERLDKFVQNEISRILLENLKLQ-------------------------ERNDQIISETIELKRGLKYFAFRLQKYEGSLVP-NPNKEEDLLQLIQNVIYHSKMKTIGKRECYSEIGLIDLNMSELSIFIKSFIFDLSP-SICLQYEPYHLVPYIIFMVTRKFDFYKEEDQMTNFLSKLIVALKRTIRKRRNYIEYLVMLLSNVFCLVNLXXXXXXXXXXXXLNTAEDIQHYFVHYDLNEFIRLLKELCVTLFQMILKTIVDNLLPQSLCIDAILVHEAI--IDFLSKDGTKYKSNIETQPKNTSFNVLTKNLQSVLEILKNHKIPQLIINQIFVHIAYLINAYCLNTLLFRTDLCYFSKGLQIKYNLSSFETWIRYQKLIDSGALQCLRPMTEAVQLLQTLIDSDEDAKFVCDMCEYLNTRQVVKILNNFNPRDGYGCRLSSGLIAKIETQMKIKRGDEPSESKLETPTVIEIPIDIPFIHNGVSLCRTIIPKPLYLSCLT 5575
            MA  E+Y+K  ++WIPD+E VW  A + + +++ + V+++  ++G   E  L  K    P LRNPDIL+G+ DLT LSYL+EP VL+NL++RF + + IYTYCGIVLVAINPY+ L IYG +IINAY  QN  D+DPHIFAVAE A+++M+    NQSIIVSGESGAGKTVSAKY MRYFA V GS        +E  +E KVL SNPI+E+ GNAKT RNDNSSRFGKY+EI F+ +  +IGANM TYLLEKSRVVFQ   ERNYHIFYQ+       +   +  G  N+   + Y + G +  IDGVDD+ E   T+N+F+ LGI+ +    + +ILA+ILHLGN+  +  D+  S I  N   L +   L+G +   +  WLC + + T  ET  KP+ K +A   RDA  K +Y+ LF+WIV   NK L + V                  +  FI VLDIYGFETF  NSFEQFCIN+ANEKLQ QFN+HVFKLEQEEYM E + WT ID+Y+NQPCI+LIE+++G+LDLLDEECK+ KGSD++W  K+Y+ HL   A F KP++SN  FII+HFA  VEY+C GF+EKN+D+V EEQIN+LKAS   L+ ELF D E     T  +         S K       + +++ KKTVG QFRNSL+ LM+ LN T PHYVRCIKPND K  FTF P+RAVQQLRACGVLETIR+SAAGFPSRWTY +F+ RY +LM   +V   D K   + ++E L+  PD ++FG TK+FFR GQVA LEKLR  K+ ++   IQ  +R  + RKKYL +      IQ ++R   A   A  L + RA IIIQ + RMY+ +  + + + A LA++   R  +  +L +A  +E+  +I Q +VR ++ R+ F +  + ++ +Q   RR +AK  LK LKIEARS+ H K +N G+ENKI++L +++D + KE   +  +L   +    +  +  +A         E AK   N V  L  E+ +L+K+L     EK  I    +  +   +K I+ L+   + LK+  +    +I+       D+ Q+++ ++E Q+  N    E+  +Q L+ E+ +LE KY++L KE + +  +  KP     + T + +E+E T++ + A+ E  S                         + E +S +  D+++ ++LQ  +S L QE     N L    +QF+    + ++  + ++G  +  E               ++L  + + ++G  E G  +        L  +L  SNE+ +  K  + I    +      + H++  +E     E++++  ++++ +   M     G+K  N  L+  L  Q R    +++V  G+ H +     R      QNL+L P+ R++  +Q+EI+R+  ENL+L                          E+ D+ +    +LK+ LK FA ++   EG  +  +P +  D  + +  V        I +RE   + G+++    +    +K+ I +L P  + +   P  L  YI+FM  R  D+  ++ ++ + L+ +I ++K+ ++KR +  E +   L+N    ++  +QYSG +QF   N+ +  +H   ++DL E+ ++L +L + ++Q ++K + +N+L Q + +  +L HE I  +  +   G + +++        + + + + L +   I+ +H     +I Q+     Y+I A  LN LL R D+C +SKG+QI+YN+S  E W+R + L+  GA + L P+ +A QLLQ    +DEDA+ +C MC  L+T Q+VK+LN + P + +  R+S   I  I+T+++    D     +L   T +  P+  PF  + ++L    IP  L L+ LT
Sbjct:    1 MAASELYTKYARVWIPDDEEVWRSAELTKDYRQGDGVLQLQLEDGKDLEFKLDPKTNNLPHLRNPDILVGENDLTALSYLHEPAVLHNLKVRFIDSKLIYTYCGIVLVAINPYETLPIYGADIINAYSGQNMGDMDPHIFAVAEEAYKQMARDERNQSIIVSGESGAGKTVSAKYAMRYFATVSGSA-------SEANVEEKVLASNPIMESIGNAKTTRNDNSSRFGKYIEIGFDKKYHIIGANMRTYLLEKSRVVFQADEERNYHIFYQLCASAHLPEFKALKLGKAND---FHYTKQGRNPVIDGVDDAKEMSTTRNAFILLGINESYQMGLFQILASILHLGNVDVKDRDSDSSIIPPNNGHLSVFCELMGVTYQDMSHWLCHKKLKTATETYIKPIPKLQAINARDALAKHIYAKLFNWIVDHVNKALHSTVK-----------------QHSFIGVLDIYGFETFEINSFEQFCINYANEKLQQQFNMHVFKLEQEEYMKEQIPWTLIDFYDNQPCINLIEAKMGILDLLDEECKMPKGSDDSWAQKLYNTHLKTCALFEKPRMSNKAFIIQHFADKVEYQCDGFLEKNKDTVNEEQINVLKASKFDLLVELFHDEEKATSPTGAAPGPGGRTRLSVKPDKGKSSQASKEHKKTVGLQFRNSLQLLMETLNATTPHYVRCIKPNDYKHAFTFDPKRAVQQLRACGVLETIRISAAGFPSRWTYQEFFSRYRVLMKQKDVLT-DKKMTCKNVLEKLVQDPDKYQFGKTKIFFRAGQVAYLEKLRADKLRAACIRIQKTIRCWLARKKYLRMKHAATTIQRFVRGYQARCLAKFLRRTRAAIIIQKYQRMYIQKTCYKRKQAAALAMQCILRAYMARQLYKALLREHKAVIIQKMVRGWLARQWFKRSLKAIVYLQCCIRRMRAKRELKKLKIEARSVEHFKKLNIGMENKIMQLQRRIDDQNKENRSMSERLNTLETSHAVESERMRAEVTRLRGAEEDAKNNANKVTSLLEELERLRKDLQNTQKEKKAIEDWAQTYQDEMEKMISELKEQNQLLKTEKNNLNQLIQEQSQQWTDKMQRAL-KEETQQLENDLNEERSRYQNLLTEHLRLEEKYDDL-KEEITLAVNVPKPGHRRTDSTHSSNESECTYNSEFAESEEGSR------------------------VGEDVSKSILDMSLFLKLQKRVSELEQEKQSLQNELDRREEQFQRARARDDEEHKKARGAELEYESLKRQELESENKKLKHDLNQMRQSLRGSVEAGSGAPGSPAYTVLLDQLNASNEELEVRKEEVLILRSQLVSQKEAMQHKTTMTEPLPYIEDVQKLTDAKEISQAYM-----GLKDTNRLLESQLQAQRRSHDNEVEVLRGELHSLKEENNRQQQLLAQNLQLPPEARIEASLQHEITRLTNENLELHSDDPKEYKAYRISMLRRMVDLMEQLEKQDKTVR---KLKKQLKVFAKKINDLEGGQMDVSPGQTAD--EPVHPV-------NIPRREKDFQ-GMLEYKKEDELKLVKNIILELKPRGVAVNLIP-GLPAYILFMCLRHADYINDDQKVRSLLTSVINSIKKILKKRGDDFETVSFWLANTCRFLHCLKQYSGDEQFMKHNSPKQNEHCLSNFDLAEYRQVLSDLAIQIYQQLIKCM-ENIL-QPMIVSGMLEHETIQGVSGVKPTGLRKRTSSIADEGTYTLDSIIRQLNTFHSIMCHHGTDPELIKQVVKQQFYIIGAVTLNNLLLRKDMCSWSKGMQIRYNVSQLEEWLRDKNLMTCGAKETLEPLIQAAQLLQVKKKTDEDAEAICSMCNALSTAQIVKVLNLYTPVNAFEERVSVLFIRTIQTRLR----DRKESPQLLMDTKLIYPVTFPFNPSSLALETIQIPSSLNLAFLT 1842          
BLAST of Dach-2 vs. Ensembl Zebrafish
Match: myo5b (myosin VB [Source:ZFIN;Acc:ZDB-GENE-031219-7])

HSP 1 Score: 1089.33 bits (2816), Expect = 0.000e+0
Identity = 719/1918 (37.49%), Postives = 1066/1918 (55.58%), Query Frame = 2
Query:   47 MALYEMYSKGVKIWIPDEESVWIGATVLQFHKEKN-VIKIITDNGISKELNLSSKKCA-PFLRNPDILIGQKDLTYLSYLNEPEVLYNLQIRFCERREIYTYCGIVLVAINPYQELSIYGKEIINAYHSQNSVDLDPHIFAVAENAFRRMSSFGENQSIIVSGESGAGKTVSAKYTMRYFALVGGSKTKQSFNLTETQIERKVLLSNPILEAFGNAKTIRNDNSSRFGKYLEILFNPRNQVIGANMCTYLLEKSRVVFQNLGERNYHIFYQIVTHCQSEDELLMNTGLVNNVEMYDYLRYGESLEIDGVDDSHEFLITKNSFLQLGIDLNKFKTICEILAAILHLGNIRF-RFHDATDSSIIENPELLKLIAGLLGCSIDQLKIWLCFRTISTFQETLHKPLSKAEAQYFRDAFVKTLYSNLFDWIVKQANKVLSTDVSINIKKKLKKTIVVNQEDKKKFIAVLDIYGFETFAENSFEQFCINFANEKLQLQFNLHVFKLEQEEYMNEGLEWTFIDYYNNQPCIDLIESRXXXXXXXXXXXXXXXXSDENWCCKIYSHHLNKSANFNKPKLSNMVFIIEHFAGPVEYKCAGFIEKNRDSVLEEQINLLKASDVQLIAELFRDSEIEIFDTNNXXXXXXXXXXXXXXXXXXQENTRKMKKTVGSQFRNSLKSLMDALNKTNPHYVRCIKPNDLKLPFTFCPERAVQQLRACGVLETIRLSAAGFPSRWTYSDFYHRYYILMSNFNVKNHDFKAGSQKIVETLITVPDAFRFGNTKLFFRPGQVALLEKLRGHKIESSVTLIQSILRGSIERKKYLIIHKLTVQIQTYIRRKLAIEKATKLSQIRAVIIIQSFYRMYLARKLFVKMKCAVLAIEKWRRKIITTRLKQAYKKENCVIICQAIVRRFIQRRKFLKIQRGVILIQNHYRRRKAKETLKILKIEARSINHIKFVNKGLENKIIELTQKLDTKEKEMCXXXXXXXXXXXXXXXXXXXXXAESAKIYQNTVQDLQTEIIQLKKELNREIVEKNKIFADKELLEINYKKKINYLENLIEELKSSPSV-----------IEPNIICNGDEAQQSICQDEHQKFINEQMDHQKLVREYEKLEMKYENLYKEFLFVKSSNQKPSINYDNQTSNDSETESTFSKDDADVESLSDKVDAKTTKEHXXXXXXXXXXLPNFISESISTAGDLAVVMQLQMNISSLSQENNRLKETVQQFED------ELLKYEQCAEDSKGLVIHNEYD---------------NELLSIIKDIKGMDEHGLKSRLIDEVANLKKKLKQSNE--DYQK-----LRLHIFDGSMSKLTGNLDHESINSE--------------EEELKRAFESQKEANRKMLKE-------IEGIKANNVDLKKAL-FQIRKDKEQLQVQLGKQHLMIRHGVEYLQNL-----KLTPKERLDKFVQNEISRILLENLKLQERNDQIISETIELKRGLKYFAFRLQKYEGSLVPNPNKEEDLLQLIQNVIYHSKMKTIGKRECYSEIGLIDLNMSELSIFIKSFIFDLSPSICLQYEPYHLVPYIIFMVTRKFDFYKEEDQMTNFLSKLIVALKRTIRKRRNYIEYLVMLLSNVFCLVNLXXXXXXXXXXXXLNTAEDIQHYFVHYDLNEFIRLLKELCVTLFQMILKTIVDNLLPQSLCIDAILVHEAIIDFLSKDGTKYK---SNIETQ---PKNTSFNVLTKNLQSVLEILKNHKIPQLIINQIFVHIAYLINAYCLNTLLFRTDLCYFSKGLQIKYNLSSFETWIRYQKLIDSGALQCLRPMTEAVQLLQTLIDSDEDAKFVCDMCEYLNTRQVVKILNNFNPRDGYGCRLSSGLIAKIETQMKIKRGDEPSESKLETPTVIEIPIDIPFIHNGVSLCRTIIPKPLYLSCLT 5575
            M  +E+Y K  ++WIPD + VW  A +++ +KE + V+ +  ++  + E  + SK    PFLRNPDIL+G+ DLT LSYL+EP VL+NL++RF E   IYTYCGIVLVAINPY++L IYG+E+INAY  QN  D+DPHIFAVAE AF++M+   +NQSIIVSGESGAGKTVSAKY MR+FA VGGS         +T +E KVL S+PI+EA GNAKT RNDNSSRFGKY++I F+ R  +IGANM TYLLEKSRVVFQ   ERNYHIFYQ+   C   +        + + E + Y   GE++ I+GV+D+ + + T+ +   LG+  N   +I +I+A+ILHLGN+   +  D     I  N   L     LLG   +Q++ WLC R + T  ET  K +  ++A   RDA  K +Y++LFDWIV+  NK L T                    +  FI VLDIYGFETF  NSFEQFCIN+ANEKLQ QFN HVFKLEQEEYM E + WT ID+Y+NQPCIDLIE++LG+LDLLDEECK+ KG+D+NW  K+YS H + S +F KP++SN  FI+ HFA  VEY+C GF+EKNRD+V EEQIN+LKAS  QL+A+LF D++    D        + + + +      + + R+ +KTVG+QFRNSL  LM+ LN T PHYVRCIKPND K  F F   RAVQQLRACGVLETIR+SAAG+PSRWTY DF+ RY +LM+  ++   D K   + ++E LI  PD F+FG TK+FFR GQVA LEKLR  K   +   IQ  +RG ++R +Y  I K  + +Q Y R  LA   A  L   RA +I Q  YRM   R+ +++++ AV+ I+ + R +   RL Q +   +  +I Q  VR ++ R+K+ + +   I+IQ  YRR +AK  LK LKIEARS  H K +N G+ENKI++L +K+D + KE+      L   K +    +     E   +   T Q   T++  L++EL +   E  +  A K+LLE  +  +   LE  +EEL+   +V           I+ +    G +  Q   + +H+   +E+  +Q LV+EY +LE +YENL ++   +K         +     N S   S  S  +    SLS+  D   T + V +  +               A DL+V M+LQ  +  L QE  RL+  + + E+         K     +D    + +N                  NEL   + D     E+   + L D    L  +LK +NE  D +K     L+  I +   ++ T NL+H  INS               E+ +       K  +   L E        +G+K     L+  L  Q R+ +++L+  L  Q  +++  +E  Q++      L+P   ++  VQ EI+R+  ENL L+E  +++     +LK+ L+ +  ++Q+ E            + Q  ++    ++  T+ +RE   E G+++    + ++ +K+ + D+ P+      P  L  YI+FM  R  D+  ++ ++ + L+  I A+K+ ++K  +  E     L+N   L++  +QYSG + F   N+A+  +H   ++DL E+ ++L +L + ++Q ++K    N+ P  + + A+L  E+I          Y+   S+++ +   P   +   L K L      + +H +   I  Q+   + Y INA  LN LL R D+C +S G+Q++YN+S  E W+R + L   GA+  + P+ +A QLLQ    + +DA+ +C +C  L+ +Q+VKILN + P + +  R++   I  I+ +++    D    ++L   T    P+  P+  + +SL    IP  L L  LT
Sbjct:    1 MREHELYVKYTRVWIPDPDEVWRSAEIIKDYKEGDTVLHLKLEDESTLEYPIGSKDNPLPFLRNPDILVGENDLTALSYLHEPAVLHNLKVRFLESNHIYTYCGIVLVAINPYEQLHIYGEEVINAYSGQNMGDMDPHIFAVAEEAFKQMARDEKNQSIIVSGESGAGKTVSAKYAMRFFATVGGSAN-------DTNVEEKVLASSPIMEAIGNAKTTRNDNSSRFGKYIQIGFDRRYHIIGANMRTYLLEKSRVVFQAEEERNYHIFYQLCASCSLPE---FKDLTLTSAEDFTYTSLGENIFIEGVNDAEDLVKTREALTMLGVKENHQMSIFKIIASILHLGNVEIVQERDGESCHINRNDTHLHHFCRLLGIEQEQMENWLCRRKLVTTSETYVKNMPHSQAVNARDALAKHIYAHLFDWIVEHINKSLHTSTK-----------------QHSFIGVLDIYGFETFEINSFEQFCINYANEKLQQQFNSHVFKLEQEEYMKEQIPWTLIDFYDNQPCIDLIEAKLGILDLLDEECKVPKGTDQNWAQKLYSKH-SGSGHFEKPRMSNKSFIVVHFADKVEYQCDGFLEKNRDTVYEEQINILKASKFQLVADLFDDAK----DAAPHPGSKTSRINVRPAKPAPKGHNREHRKTVGTQFRNSLHLLMETLNATTPHYVRCIKPNDYKESFVFDSRRAVQQLRACGVLETIRISAAGYPSRWTYPDFFSRYRVLMTKKDLSVGDKKQVCKNLLEILIKDPDKFQFGKTKIFFRAGQVAYLEKLRADKFRFACIKIQKTVRGWLQRIRYRKIRKSAITLQRYGRGYLARRYAEMLRLTRAAVICQKQYRMVQVRREYLRVRRAVITIQAFTRGMFIRRLYQEFLLHHKAMIIQKTVRGWLVRKKYQRSRYAAIVIQCFYRRVRAKRQLKQLKIEARSAEHFKKLNVGMENKIVQLQKKMDNQSKELKSQNENLAVAKTVLETEVSKLSKELETL--RTRQVAGTQMTSLQEELEKLRAELQEAHAHKKLLEEEFSNEKQGLEQRVEELEKENTVLKKEKEEMNRRIQTSTQDQGGDVSQKESRLQHE-LDDERQRYQNLVKEYSRLEQRYENLQEDMSSMKF--------HPGHRRNPSNQSSLGSDSNYPSISLSEVGDTDDTIQQVEEMGIE------------KAAMDLSVFMKLQKRVRELEQERKRLQTNLDKVEELSKRKGSEAKNSTSEDDINADLAYNSLKRQELETENKKLKNDLNELRKAVAD--RASENNSSNELQDGYNLLLSQLKAANEELDVRKEEVLMLKTQIVNS--TRQTENLNH--INSNDVSEWTDNKSPVNTEDRVDAPASKNKAQDWGYLNEDGELGLAYQGLKQVARLLETQLQTQTRQHRDELEA-LHTQIELLKDNLEKKQDMLDHFSTLSPDALVEFSVQQEITRLTNENLDLKELVEKLEKNEKKLKKQLRIYMKKVQELE------------VTQATKSRPELTRQFTVQRREKDFE-GMLEYYKEDEALLVKTLVTDMKPNAVSATVPC-LPAYILFMCIRHADYINDDQKVHSLLTATINAIKKVLKKNNDDFEMTSFWLANASRLLHCLKQYSGDEAFMTQNSAKQNEHCLKNFDLAEYRQVLSDLSIQIYQQLVKVAEANMQP--MIVSAMLESESIPSLAGVKPMGYRNRSSSVDCESGGPAGYTLQALIKQLAQFYSTMADHGLDPEISQQVLRQLFYSINAVTLNNLLLRKDVCSWSTGMQLRYNISQLEEWLRGKNLHQCGAVATMEPVIQAAQLLQVKKKTSQDAEAICSLCTALSLQQIVKILNLYTPLNEFEERVTVSFIRDIQNRLQ----DRIENNQLLADTKYTFPVLFPYTPSNLSLETIHIPASLSLDFLT 1836          
BLAST of Dach-2 vs. Ensembl Zebrafish
Match: myo5b (myosin VB [Source:ZFIN;Acc:ZDB-GENE-031219-7])

HSP 1 Score: 1089.33 bits (2816), Expect = 0.000e+0
Identity = 717/1929 (37.17%), Postives = 1064/1929 (55.16%), Query Frame = 2
Query:   47 MALYEMYSKGVKIWIPDEESVWIGATVLQFHKEKN-VIKIITDNGISKELNLSSKKCA-PFLRNPDILIGQKDLTYLSYLNEPEVLYNLQIRFCERREIYTYCGIVLVAINPYQELSIYGKEIINAYHSQNSVDLDPHIFAVAENAFRRMSSFGENQSIIVSGESGAGKTVSAKYTMRYFALVGGSKTKQSFNLTETQIERKVLLSNPILEAFGNAKTIRNDNSSRFGKYLEILFNPRNQVIGANMCTYLLEKSRVVFQNLGERNYHIFYQIVTHCQSEDELLMNTGLVNNVEMYDYLRYGESLEIDGVDDSHEFLITKNSFLQLGIDLNKFKTICEILAAILHLGNIRF-RFHDATDSSIIENPELLKLIAGLLGCSIDQLKIWLCFRTISTFQETLHKPLSKAEAQYFRDAFVKTLYSNLFDWIVKQANKVLSTDVSINIKKKLKKTIVVNQEDKKKFIAVLDIYGFETFAENSFEQFCINFANEKLQLQFNLHVFKLEQEEYMNEGLEWTFIDYYNNQPCIDLIESRXXXXXXXXXXXXXXXXSDENWCCKIYSHHLNKSANFNKPKLSNMVFIIEHFAGPVEYKCAGFIEKNRDSVLEEQINLLKASDVQLIAELFRDSEIEIFDTNNXXXXXXXXXXXXXXXXXXQENTRKMKKTVGSQFRNSLKSLMDALNKTNPHYVRCIKPNDLKLPFTFCPERAVQQLRACGVLETIRLSAAGFPSRWTYSDFYHRYYILMSNFNVKNHDFKAGSQKIVETLITVPDAFRFGNTKLFFRPGQVALLEKLRGHKIESSVTLIQSILRGSIERKKYLIIHKLTVQIQTYIRRKLAIEKATKLSQIRAVIIIQSFYRMYLARKLFVKMKCAVLAIEKWRRKIITTRLKQAYKKENCVIICQAIVRRFIQRRKFLKIQRGVILIQNHYRRRKAKETLKILKIEARSINHIKFVNKGLENKIIELTQKLDTKEKEMCXXXXXXXXXXXXXXXXXXXXXAESAKIYQNTVQDLQTEIIQLKKELNREIVEKNKIFADKELLEINYKKKINYLENLIEELKSSPSV-----------IEPNIICNGDEAQQSICQDEHQKFINEQMDHQKLVREYEKLEMKYENLYKEFLFVKSSNQKPSINYDNQTSNDSETESTFSKDDADVESLSDKVDAKTTKEHXXXXXXXXXXLPNFISESISTAGDLAVVMQLQMNISSLSQENNRLKETVQQFED------ELLKYEQCAEDSKGLVIHNEYD---------------NELLSIIKDIKGMDEHGLKSRLIDEVANLKKKLKQSNE--DYQK-----LRLHIFDGSMSKLTGNLDH-------------ESINSEEE--------------------ELKRAFESQKEANRKMLKEIEGIKANNVDLKKALFQIRKDKEQLQVQLGKQHLMIRHGVEYLQNL-----KLTPKERLDKFVQNEISRILLENLKLQERNDQIISETIELKRGLKYFAFRLQKYEGSLVPNPNKEEDLLQLIQNVIYHSKMKTIGKRECYSEIGLIDLNMSELSIFIKSFIFDLSPSICLQYEPYHLVPYIIFMVTRKFDFYKEEDQMTNFLSKLIVALKRTIRKRRNYIEYLVMLLSNVFCLVNLXXXXXXXXXXXXLNTAEDIQHYFVHYDLNEFIRLLKELCVTLFQMILKTIVDNLLPQSLCIDAILVHEAIIDFLSKDGTKYK---SNIETQ---PKNTSFNVLTKNLQSVLEILKNHKIPQLIINQIFVHIAYLINAYCLNTLLFRTDLCYFSKGLQIKYNLSSFETWIRYQKLIDSGALQCLRPMTEAVQLLQTLIDSDEDAKFVCDMCEYLNTRQVVKILNNFNPRDGYGCRLSSGLIAKIETQMKIKRGDEPSESKLETPTVIEIPIDIPFIHNGVSLCRTIIPKPLYLSCLT 5575
            M  +E+Y K  ++WIPD + VW  A +++ +KE + V+ +  ++  + E  + SK    PFLRNPDIL+G+ DLT LSYL+EP VL+NL++RF E   IYTYCGIVLVAINPY++L IYG+E+INAY  QN  D+DPHIFAVAE AF++M+   +NQSIIVSGESGAGKTVSAKY MR+FA VGGS         +T +E KVL S+PI+EA GNAKT RNDNSSRFGKY++I F+ R  +IGANM TYLLEKSRVVFQ   ERNYHIFYQ+   C   +        + + E + Y   GE++ I+GV+D+ + + T+ +   LG+  N   +I +I+A+ILHLGN+   +  D     I  N   L     LLG   +Q++ WLC R + T  ET  K +  ++A   RDA  K +Y++LFDWIV+  NK L T                    +  FI VLDIYGFETF  NSFEQFCIN+ANEKLQ QFN HVFKLEQEEYM E + WT ID+Y+NQPCIDLIE++LG+LDLLDEECK+ KG+D+NW  K+YS H + S +F KP++SN  FI+ HFA  VEY+C GF+EKNRD+V EEQIN+LKAS  QL+A+LF D++    D        + + + +      + + R+ +KTVG+QFRNSL  LM+ LN T PHYVRCIKPND K  F F   RAVQQLRACGVLETIR+SAAG+PSRWTY DF+ RY +LM+  ++   D K   + ++E LI  PD F+FG TK+FFR GQVA LEKLR  K   +   IQ  +RG ++R +Y  I K  + +Q Y R  LA   A  L   RA +I Q  YRM   R+ +++++ AV+ I+ + R +   RL Q +   +  +I Q  VR ++ R+K+ + +   I+IQ  YRR +AK  LK LKIEARS  H K +N G+ENKI++L +K+D + KE+      L   K +    +     E   +   T Q   T++  L++EL +   E  +  A K+LLE  +  +   LE  +EEL+   +V           I+ +    G +  Q   + +H+   +E+  +Q LV+EY +LE +YENL ++   +K         +     N S   S  S  +    SLS+  D   T + V +  +               A DL+V M+LQ  +  L QE  RL+  + + E+         K     +D    + +N                  NEL   + D     E+   + L D    L  +LK +NE  D +K     L+  I +   ++ T NL+H               +N+E+                     EL  A++  K+  R +L+           L+    Q R + E L  Q+     +++  +E  Q++      L+P   ++  VQ EI+R+  ENL L+E  +++     +LK+ L+ +  ++Q+ E            + Q  ++    ++  T+ +RE   E G+++    + ++ +K+ + D+ P+      P  L  YI+FM  R  D+  ++ ++ + L+  I A+K+ ++K  +  E     L+N   L++  +QYSG + F   N+A+  +H   ++DL E+ ++L +L + ++Q ++K    N+ P  + + A+L  E+I          Y+   S+++ +   P   +   L K L      + +H +   I  Q+   + Y INA  LN LL R D+C +S G+Q++YN+S  E W+R + L   GA+  + P+ +A QLLQ    + +DA+ +C +C  L+ +Q+VKILN + P + +  R++   I  I+ +++    D    ++L   T    P+  P+  + +SL    IP  L L  LT
Sbjct:    1 MREHELYVKYTRVWIPDPDEVWRSAEIIKDYKEGDTVLHLKLEDESTLEYPIGSKDNPLPFLRNPDILVGENDLTALSYLHEPAVLHNLKVRFLESNHIYTYCGIVLVAINPYEQLHIYGEEVINAYSGQNMGDMDPHIFAVAEEAFKQMARDEKNQSIIVSGESGAGKTVSAKYAMRFFATVGGSAN-------DTNVEEKVLASSPIMEAIGNAKTTRNDNSSRFGKYIQIGFDRRYHIIGANMRTYLLEKSRVVFQAEEERNYHIFYQLCASCSLPE---FKDLTLTSAEDFTYTSLGENIFIEGVNDAEDLVKTREALTMLGVKENHQMSIFKIIASILHLGNVEIVQERDGESCHINRNDTHLHHFCRLLGIEQEQMENWLCRRKLVTTSETYVKNMPHSQAVNARDALAKHIYAHLFDWIVEHINKSLHTSTK-----------------QHSFIGVLDIYGFETFEINSFEQFCINYANEKLQQQFNSHVFKLEQEEYMKEQIPWTLIDFYDNQPCIDLIEAKLGILDLLDEECKVPKGTDQNWAQKLYSKH-SGSGHFEKPRMSNKSFIVVHFADKVEYQCDGFLEKNRDTVYEEQINILKASKFQLVADLFDDAK----DAAPHPGSKTSRINVRPAKPAPKGHNREHRKTVGTQFRNSLHLLMETLNATTPHYVRCIKPNDYKESFVFDSRRAVQQLRACGVLETIRISAAGYPSRWTYPDFFSRYRVLMTKKDLSVGDKKQVCKNLLEILIKDPDKFQFGKTKIFFRAGQVAYLEKLRADKFRFACIKIQKTVRGWLQRIRYRKIRKSAITLQRYGRGYLARRYAEMLRLTRAAVICQKQYRMVQVRREYLRVRRAVITIQAFTRGMFIRRLYQEFLLHHKAMIIQKTVRGWLVRKKYQRSRYAAIVIQCFYRRVRAKRQLKQLKIEARSAEHFKKLNVGMENKIVQLQKKMDNQSKELKSQNENLAVAKTVLETEVSKLSKELETL--RTRQVAGTQMTSLQEELEKLRAELQEAHAHKKLLEEEFSNEKQGLEQRVEELEKENTVLKKEKEEMNRRIQTSTQDQGGDVSQKESRLQHE-LDDERQRYQNLVKEYSRLEQRYENLQEDMSSMKF--------HPGHRRNPSNQSSLGSDSNYPSISLSEVGDTDDTIQQVEEMGIE------------KAAMDLSVFMKLQKRVRELEQERKRLQTNLDKVEELSKRKGSEAKNSTSEDDINADLAYNSLKRQELETENKKLKNDLNELRKAVAD--RASENNSSNELQDGYNLLLSQLKAANEELDVRKEEVLMLKTQIVNS--TRQTENLNHINSNDVSEWTDNKSPVNTEDRVDAPASKNKAQDWGYLNEDGELGLAYQGLKQVARLLLE---------TQLQTQTRQHRDELEALHTQIE----LLKDNLEKKQDMLDHFSTLSPDALVEFSVQQEITRLTNENLDLKELVEKLEKNEKKLKKQLRIYMKKVQELE------------VTQATKSRPELTRQFTVQRREKDFE-GMLEYYKEDEALLVKTLVTDMKPNAVSATVPC-LPAYILFMCIRHADYINDDQKVHSLLTATINAIKKVLKKNNDDFEMTSFWLANASRLLHCLKQYSGDEAFMTQNSAKQNEHCLKNFDLAEYRQVLSDLSIQIYQQLVKVAEANMQP--MIVSAMLESESIPSLAGVKPMGYRNRSSSVDCESGGPAGYTLQALIKQLAQFYSTMADHGLDPEISQQVLRQLFYSINAVTLNNLLLRKDVCSWSTGMQLRYNISQLEEWLRGKNLHQCGAVATMEPVIQAAQLLQVKKKTSQDAEAICSLCTALSLQQIVKILNLYTPLNEFEERVTVSFIRDIQNRLQ----DRIENNQLLADTKYTFPVLFPYTPSNLSLETIHIPASLSLDFLT 1837          
BLAST of Dach-2 vs. Ensembl Xenopus
Match: MYO5A (myosin VA [Source:NCBI gene;Acc:100495365])

HSP 1 Score: 1109.75 bits (2869), Expect = 0.000e+0
Identity = 716/1913 (37.43%), Postives = 1075/1913 (56.19%), Query Frame = 2
Query:   47 MALYEMYSKGVKIWIPDEESVWIGATVLQFHKEKN-VIKIITDNGISKELNLSSK-KCAPFLRNPDILIGQKDLTYLSYLNEPEVLYNLQIRFCERREIYTYCGIVLVAINPYQELSIYGKEIINAYHSQNSVDLDPHIFAVAENAFRRMSSFGENQSIIVSGESGAGKTVSAKYTMRYFALVGGSKTKQSFNLTETQIERKVLLSNPILEAFGNAKTIRNDNSSRFGKYLEILFNPRNQVIGANMCTYLLEKSRVVFQNLGERNYHIFYQIVTHCQSEDELLMNTGLVNNVEMYDYLRYGESLEIDGVDDSHEFLITKNSFLQLGIDLNKFKTICEILAAILHLGNIRFRFHDATDSSIIENPELLKLIAGLLGCSIDQLKIWLCFRTISTFQETLHKPLSKAEAQYFRDAFVKTLYSNLFDWIVKQANKVLSTDVSINIKKKLKKTIVVNQEDKKKFIAVLDIYGFETFAENSFEQFCINFANEKLQLQFNLHVFKLEQEEYMNEGLEWTFIDYYNNQPCIDLIESRXXXXXXXXXXXXXXXXSDENWCCKIYSHHLNKSANFNKPKLSNMVFIIEHFAGPVEYKCAGFIEKNRDSVLEEQINLLKASDVQLIAELFRDSEIEIFDTNNXXXXXXXXXXXX---XXXXXXQENTRKMKKTVGSQFRNSLKSLMDALNKTNPHYVRCIKPNDLKLPFTFCPERAVQQLRACGVLETIRLSAAGFPSRWTYSDFYHRYYILMSNFNVKNHDFKAGSQKIVETLITVPDAFRFGNTKLFFRPGQVALLEKLRGHKIESSVTLIQSILRGSIERKKYLIIHKLTVQIQTYIRRKLAIEKATKLSQIRAVIIIQSFYRMYLARKLFVKMKCAVLAIEKWRRKIITTRLKQAYKKENCVIICQAIVRRFIQRRKFLKIQRGVILIQNHYRRRKAKETLKILKIEARSINHIKFVNKGLENKIIELTQKLDTKEKEMCXXXXXXXXXXXXXXXXXXXXXA---------ESAKIYQNTVQDLQTEIIQLKKELNREIVEKNKIFADKELLEINYKKKINYLENLIEELKSSPSVI-----EPNIICNGDEAQQSICQDEHQKFI-----------NEQMDHQKLVREYEKLEMKYENLYKEFLFVKSSNQKPSINYDNQTSNDSETESTFSKDDADVESLSDKVDAKTTKEHXXXXXXXXXXLPNFISESISTAGDLAVVMQLQMNISSLSQENNRLKETVQQFEDELLK---YEQCAEDSKGLVIHNEYD------------------NELLSIIKDIKGMDEHGLKSR----LIDEVANLKKKLKQSNEDYQKLRLHIF---------DGSMSKLTGNLDHESINSEEEELKRAFESQKEANRKMLKEIEGIKA---NNVDLKKALFQIRKDKEQLQVQLGKQHLMIRHGVEYLQNLKLTPKERLDKFVQNEISRILLENLKLQERNDQIISETIELKRGLKYFAFRLQKYEGSLVPNPNKEEDLLQLIQNVIYHSKMKTIGKRECYSEIGLIDLNMSELSIFIKSFIFDLSP-SICLQYEPYHLVPYIIFMVTRKFDFYKEEDQMTNFLSKLIVALKRTIRKRRNYIEYLVMLLSNVFCLVNLXXXXXXXXXXXXLNTAEDIQHYFVHYDLNEFIRLLKELCVTLFQMILKTIVDNLLPQSLCIDAILVHEAI--IDFLSKDGTKYKSNIETQPKNTSFNVLTKNLQSVLEILKNHKIPQLIINQIFVHIAYLINAYCLNTLLFRTDLCYFSKGLQIKYNLSSFETWIRYQKLIDSGALQCLRPMTEAVQLLQTLIDSDEDAKFVCDMCEYLNTRQVVKILNNFNPRDGYGCRLSSGLIAKIETQMKIKRGDEPSESKLETPTVIEIPIDIPFIHNGVSLCRTIIPKPLYLSCLT 5575
            MA  E+Y+K  ++WIPD E VW  A +L+ +K  + V+++  + G   E  L +K K  P LRNPDIL+G+ DLT LSYL+EP VL+NL++RF + + IYTYCGIVLVAINPY++L IYG +IINAY  QN  D+DPHIFAVAE A+++M+    NQSIIVSGESGAGKTVSAKY MRYFA V GS        +ET +E +VL SNPI+E+ GNAKT RNDNSSRFGKY+EI F+ R +++GA+M TYLLEKSRVVFQ   ERNYHIFYQ+       +  ++  G  N+   + Y + G S  I+GVDD  E   T+ +   LGI  +    I  ILAAILHLGN+ F+  D+    +      L +   L+G   +++  WLC R + T  ET  KP+S+ +A   RDA  K +Y+ LF+WIV   NK L +    N                  FI VLDIYGFETF  NSFEQFCIN+ANEKLQ QFNLHVFKLEQEEYM E + WT ID+Y+NQPCI+LIE+++G+LDLLDEECK+ KGSD  W  K+Y+ HL KSA F KP+LSN+ FII+HFA  VEY+C GF+EKN+D+V EEQI +LKAS   L+ ELF++ E  +  T+++ P      S     S+    ++ +++ KKTVG QFRNSL  LM+ LN T PHYVRCIKPND K PFTF  +RAVQQLRACGVLETIR+SAAGFPSRWTY +F+ RY +LM   +V + D K   + ++E LI   D ++FG TK+FFR GQVA LEK+R  K+  +   IQ  +RG + RKKYL + K  + IQ Y+R   A   A  L + RA IIIQ F RMY+ R+ +  M+   LA++ + R     +  Q   + +   I Q  VR ++ R  + +    ++ +Q  YRR  AK  LK LKIEARS+ H K +N G+ENKI++L +K+D + K+   +  +L   +          ++         E AK   N +  LQ E+ +L+KEL +   EKNKI       E   +K     E L+ EL+   +++     E N++    E  + + +D  +K I           +E++ +Q L+ EY +LE +Y++L  E   +  S  KP     + T + +E+E TFS +  + E    + +    ++                     T  D+++ ++LQ  +  L QE   +++ + + E+++++    E+    ++G  +  EY+                  NEL   I +    D  G        L++++ ++ ++L+   E+   LR  +          D     +  + D + +  ++ E+ +A+   KE NR +  +++  K    N V+  +   Q  K++              R      QNL+L P+ R++  +Q+EI+R+  ENL L E+ ++      +LK+ LK FA ++ + E   + N +  + + + I+ V    K K           G+++    +    +K+ I +L P  + +   P  L  YI+FM  R  D+  ++ ++ + L+  I  +K+ ++KR +  E +   LSN    ++  +QYSG + F   NT    +H   ++DL E+ ++L +L + ++Q +++ +++N+L Q + +  +L HE I  +  +   G + +++        + + + + L +   I+  H +   +I Q+   + Y+I A  LN LL R D+C +SKG+QI+YN+S  E W+R + L++S A + L P+ +A QLLQ    +DEDA+ +C MC  L T Q+VK+LN + P + +  R+    I  I+ +++  R D P   +L        P+  PF  + ++L    IP  L L+ LT
Sbjct:    1 MAASELYTKHARVWIPDPEEVWKSAEILKDYKPGDTVLRLRLEEGTDLEYRLDAKTKELPPLRNPDILVGENDLTALSYLHEPAVLHNLKVRFIDSKLIYTYCGIVLVAINPYEQLPIYGSDIINAYSGQNMGDMDPHIFAVAEEAYKQMARDERNQSIIVSGESGAGKTVSAKYAMRYFATVSGSA-------SETNVEERVLASNPIMESIGNAKTTRNDNSSRFGKYIEIGFDKRYRILGAHMRTYLLEKSRVVFQAEEERNYHIFYQLCASASLPEFKMLRLGTAND---FHYTKQGGSPVIEGVDDQREMKNTRQACTLLGIGDSYQMGIFRILAAILHLGNVEFKSRDSDSCLVPPKHAPLNIFCDLMGVEYEEMSHWLCHRKLVTAAETYIKPISRLQATNARDALAKHIYAFLFNWIVCHVNKALHSSTKQN-----------------SFIGVLDIYGFETFEINSFEQFCINYANEKLQQQFNLHVFKLEQEEYMKEQIPWTLIDFYDNQPCINLIEAKMGILDLLDEECKMPKGSDSTWAQKLYNTHLKKSALFEKPRLSNVAFIIKHFADKVEYQCEGFLEKNKDTVFEEQIKVLKASKFTLLTELFQEEEQILSPTSSAPPSGRTLLSRTGLRSLKPKPEQTSKEHKKTVGHQFRNSLHLLMETLNATTPHYVRCIKPNDFKYPFTFDSKRAVQQLRACGVLETIRISAAGFPSRWTYQEFFSRYRVLMKQKDVLS-DRKQTCKNVLEKLILDKDKYQFGKTKIFFRAGQVAYLEKIRADKLRMACIRIQKTIRGWLLRKKYLRMRKAAITIQRYVRGYQARCYAQFLRRTRAAIIIQKFQRMYVVRQKYRHMQSITLALQSYMRGYAARKRFQGMLRAHKATIIQKHVRGWLARVTYKRNLSAIVYLQCCYRRMMAKRELKKLKIEARSVEHYKKLNNGMENKIMQLQRKVDEQNKDNKSLLERLTHLEVTYNTEKDKLRSDVDRLRHFEEEAKNAANRMVSLQDELARLRKELQQTQTEKNKI-------EERAEKYQTETEKLVAELREQNALLKAEKEELNLLIQ--EQAKKMTEDMEKKIIEETKQLELELNDERLRYQNLLNEYSRLEERYDDLKDEINTM--SPPKPGHKRTDSTHSSNESEYTFSSEITESEDYPYRNEEPADRK---------------------TPLDMSLFLKLQKRVKELEQEKQVMQDDLDKKEEQIIRAKIMEEAKTPTRGTEL--EYESLKRQELESENKKLKNELNELRRAITEKASPDATGPGGTVYKVLLEQMTSVSEELEVRKEEVLILRSQLVSQMEAIPHKDTMTDSMVLSEDVQKMK-DKREIAQAYTGMKETNRVLESQLQSQKKAFENEVEALRGEIQALKEENN------------RQQQLLAQNLQLPPEARIEASLQHEITRLTNENLDLMEQLEKQDKTVRKLKKQLKVFAKKIGELEVGQMENVSPGQIVDEPIRPVNIPRKEKDFQ--------GMLEYKKEDELKLVKNLILELKPRGVAVNLIP-GLPAYILFMCLRHADYLNDDQKVRSLLTSTINGIKKILKKRGDDFETVSFWLSNSCRFLHCLKQYSGEEGFMKHNTTRQNEHCLTNFDLAEYRQVLSDLAIQIYQQLVR-VLENIL-QPMIVSGMLEHETIQGVSGVKPTGLRKRTSSIADEGTYTLDSIVRQLNTFHSIMCQHGMDPELIKQVVKQMFYIIGAVTLNNLLLRKDMCSWSKGMQIRYNVSQLEEWLRDKNLMNSSAKETLEPLIQAAQLLQVKKKTDEDAEAICSMCNALTTAQIVKVLNLYTPVNEFEERVLVSFIRNIQMRLR-DRKDSP---QLLMDAKHIFPVTFPFNPSSLALETIQIPGSLGLAFLT 1823          
BLAST of Dach-2 vs. Ensembl Xenopus
Match: MYO5A (myosin VA [Source:NCBI gene;Acc:100495365])

HSP 1 Score: 1102.81 bits (2851), Expect = 0.000e+0
Identity = 717/1901 (37.72%), Postives = 1075/1901 (56.55%), Query Frame = 2
Query:   47 MALYEMYSKGVKIWIPDEESVWIGATVLQFHKEKN-VIKIITDNGISKELNLSSK-KCAPFLRNPDILIGQKDLTYLSYLNEPEVLYNLQIRFCERREIYTYCGIVLVAINPYQELSIYGKEIINAYHSQNSVDLDPHIFAVAENAFRRMSSFGENQSIIVSGESGAGKTVSAKYTMRYFALVGGSKTKQSFNLTETQIERKVLLSNPILEAFGNAKTIRNDNSSRFGKYLEILFNPRNQVIGANMCTYLLEKSRVVFQNLGERNYHIFYQIVTHCQSEDELLMNTGLVNNVEMYDYLRYGESLEIDGVDDSHEFLITKNSFLQLGIDLNKFKTICEILAAILHLGNIRFRFHDATDSSIIENPELLKLIAGLLGCSIDQLKIWLCFRTISTFQETLHKPLSKAEAQYFRDAFVKTLYSNLFDWIVKQANKVLSTDVSINIKKKLKKTIVVNQEDKKKFIAVLDIYGFETFAENSFEQFCINFANEKLQLQFNLHVFKLEQEEYMNEGLEWTFIDYYNNQPCIDLIESRXXXXXXXXXXXXXXXXSDENWCCKIYSHHLNKSANFNKPKLSNMVFIIEHFAGPVEYKCAGFIEKNRDSVLEEQINLLKASDVQLIAELFRDSEIEIFDTNNXXXXXXXXXXXX---XXXXXXQENTRKMKKTVGSQFRNSLKSLMDALNKTNPHYVRCIKPNDLKLPFTFCPERAVQQLRACGVLETIRLSAAGFPSRWTYSDFYHRYYILMSNFNVKNHDFKAGSQKIVETLITVPDAFRFGNTKLFFRPGQVALLEKLRGHKIESSVTLIQSILRGSIERKKYLIIHKLTVQIQTYIRRKLAIEKATKLSQIRAVIIIQSFYRMYLARKLFVKMKCAVLAIEKWRRKIITTRLKQAYKKENCVIICQAIVRRFIQRRKFLKIQRGVILIQNHYRRRKAKETLKILKIEARSINHIKFVNKGLENKIIELTQKLDTKEKEMCXXXXXXXXXXXXXXXXXXXXXA---------ESAKIYQNTVQDLQTEIIQLKKELNREIVEKNKIFADKELLEINYKKKINYLENLIEELKSSPSVIEPNIICNGDEAQQSICQDEHQ---KFINEQMDHQKLVREYEKLEMKYENLYKEFLFVKSSNQKPSINYDNQTSNDSETESTFSKDDADVESLSDKVDAKTTKEHXXXXXXXXXXLPNFISESISTAGDLAVVMQLQMNISSLSQENNRLKETVQQFEDELLK---YEQCAEDSKGLVIHNEYD------------------NELLSIIKDIKGMDEHGLKSR----LIDEVANLKKKLKQSNEDYQKLRLHIFDG--------SMSKLTGNL--DHESINSEEEELKRAFESQKEANRKMLKEIEGIKA---NNVDLKKALFQIRKDKEQLQVQLGKQHLMIRHGVEYLQNLKLTPKERLDKFVQNEISRILLENLKLQERNDQIISETIELKRGLKYFAFRLQKYEGSLVPNPNKEEDLLQLIQNVIYHSKMKTIGKRECYSEIGLIDLNMSELSIFIKSFIFDLSP-SICLQYEPYHLVPYIIFMVTRKFDFYKEEDQMTNFLSKLIVALKRTIRKRRNYIEYLVMLLSNVFCLVNLXXXXXXXXXXXXLNTAEDIQHYFVHYDLNEFIRLLKELCVTLFQMILKTIVDNLLPQSLCIDAILVHEAI--IDFLSKDGTKYKSNIETQPKNTSFNVLTKNLQSVLEILKNHKIPQLIINQIFVHIAYLINAYCLNTLLFRTDLCYFSKGLQIKYNLSSFETWIRYQKLIDSGALQCLRPMTEAVQLLQTLIDSDEDAKFVCDMCEYLNTRQVVKILNNFNPRDGYGCRLSSGLIAKIETQMKIKRGDEPSESKLETPTVIEIPIDIPFIHNGVSLCRTIIPKPLYLSCLT 5575
            MA  E+Y+K  ++WIPD E VW  A +L+ +K  + V+++  + G   E  L +K K  P LRNPDIL+G+ DLT LSYL+EP VL+NL++RF + + IYTYCGIVLVAINPY++L IYG +IINAY  QN  D+DPHIFAVAE A+++M+    NQSIIVSGESGAGKTVSAKY MRYFA V GS        +ET +E +VL SNPI+E+ GNAKT RNDNSSRFGKY+EI F+ R +++GA+M TYLLEKSRVVFQ   ERNYHIFYQ+       +  ++  G  N+   + Y + G S  I+GVDD  E   T+ +   LGI  +    I  ILAAILHLGN+ F+  D +DS + ++   L +   L+G   +++  WLC R + T  ET  KP+S+ +A   RDA  K +Y+ LF+WIV   NK L +    N                  FI VLDIYGFETF  NSFEQFCIN+ANEKLQ QFNLHVFKLEQEEYM E + WT ID+Y+NQPCI+LIE+++G+LDLLDEECK+ KGSD  W  K+Y+ HL KSA F KP+LSN+ FII+HFA  VEY+C GF+EKN+D+V EEQI +LKAS   L+ ELF++ E  +  T+++ P      S     S+    ++ +++ KKTVG QFRNSL  LM+ LN T PHYVRCIKPND K PFTF  +RAVQQLRACGVLETIR+SAAGFPSRWTY +F+ RY +LM   +V + D K   + ++E LI   D ++FG TK+FFR GQVA LEK+R  K+  +   IQ  +RG + RKKYL + K  + IQ Y+R   A   A  L + RA IIIQ F RMY+ R+ +  M+   LA++ + R     R  +A        I Q  VR ++ R  + +    ++ +Q  YRR  AK  LK LKIEARS+ H K +N G+ENKI++L +K+D + K+   +  +L   +          ++         E AK   N +  LQ E+ +L+KEL +   EKNKI    E  +   +K        +   K   SV +  +    ++ ++ I ++  Q   +  +E++ +Q L+ EY +LE +Y++L  E       N  P     + T + +E+E TFS +  + E    + +    ++                     T  D+++ ++LQ  +  L QE   +++ + + E+++++    E+    ++G  +  EY+                  NEL   I +    D  G        L++++ ++ ++L+   E+   LR  +           S+  +  NL  D++ +N E+ EL   ++  K+ANR +  +++  K    N V+  +   Q  K++              R      QNL+L P+ R++  +Q+EI+R+  ENL L E+ ++      +LK+ LK FA ++ + E   + N +  + + + I+ V    K K           G+++    +    +K+ I +L P  + +   P  L  YI+FM  R  D+  ++ ++ + L+  I  +K+ ++KR +  E +   LSN    ++  +QYSG + F   NT    +H   ++DL E+ ++L +L + ++Q +++ +++N+L Q + +  +L HE I  +  +   G + +++        + + + + L +   I+  H +   +I Q+   + Y+I A  LN LL R D+C +SKG+QI+YN+S  E W+R + L++S A + L P+ +A QLLQ    +DEDA+ +C MC  L T Q+VK+LN + P + +  R+    I  I+ +++  R D P   +L        P+  PF  + ++L    IP  L L+ LT
Sbjct:    1 MAASELYTKHARVWIPDPEEVWKSAEILKDYKPGDTVLRLRLEEGTDLEYRLDAKTKELPPLRNPDILVGENDLTALSYLHEPAVLHNLKVRFIDSKLIYTYCGIVLVAINPYEQLPIYGSDIINAYSGQNMGDMDPHIFAVAEEAYKQMARDERNQSIIVSGESGAGKTVSAKYAMRYFATVSGSA-------SETNVEERVLASNPIMESIGNAKTTRNDNSSRFGKYIEIGFDKRYRILGAHMRTYLLEKSRVVFQAEEERNYHIFYQLCASASLPEFKMLRLGTAND---FHYTKQGGSPVIEGVDDQREMKNTRQACTLLGIGDSYQMGIFRILAAILHLGNVEFKSRD-SDSCLPKHAP-LNIFCDLMGVEYEEMSHWLCHRKLVTAAETYIKPISRLQATNARDALAKHIYAFLFNWIVCHVNKALHSSTKQN-----------------SFIGVLDIYGFETFEINSFEQFCINYANEKLQQQFNLHVFKLEQEEYMKEQIPWTLIDFYDNQPCINLIEAKMGILDLLDEECKMPKGSDSTWAQKLYNTHLKKSALFEKPRLSNVAFIIKHFADKVEYQCEGFLEKNKDTVFEEQIKVLKASKFTLLTELFQEEEQILSPTSSAPPSGRTLLSRTGLRSLKPKPEQTSKEHKKTVGHQFRNSLHLLMETLNATTPHYVRCIKPNDFKYPFTFDSKRAVQQLRACGVLETIRISAAGFPSRWTYQEFFSRYRVLMKQKDVLS-DRKQTCKNVLEKLILDKDKYQFGKTKIFFRAGQVAYLEKIRADKLRMACIRIQKTIRGWLLRKKYLRMRKAAITIQRYVRGYQARCYAQFLRRTRAAIIIQKFQRMYVVRQKYRHMQSITLALQSYMRGYAMLRAHKA-------TIIQKHVRGWLARVTYKRNLSAIVYLQCCYRRMMAKRELKKLKIEARSVEHYKKLNNGMENKIMQLQRKVDEQNKDNKSLLERLTHLEVTYNTEKDKLRSDVDRLRHFEEEAKNAANRMVSLQDELARLRKELQQTQTEKNKIEERAEKYQTETEK--------VGTDKILSSVFKHCVCLIIEDMEKKIIEETKQLELELNDERLRYQNLLNEYSRLEERYDDLKDEI------NTMPGHKRTDSTHSSNESEYTFSSEITESEDYPYRNEEPADRK---------------------TPLDMSLFLKLQKRVKELEQEKQVMQDDLDKKEEQIIRAKIMEEAKTPTRGTEL--EYESLKRQELESENKKLKNELNELRRAITEKASPDATGPGGTVYKVLLEQMTSVSEELEVRKEEVLILRSQLVSQMEAIPHKVSLETIERNLPPDYQDLN-EDGELWLVYDGLKQANRVLESQLQSQKKAFENEVEALRGEIQALKEENN------------RQQQLLAQNLQLPPEARIEASLQHEITRLTNENLDLMEQLEKQDKTVRKLKKQLKVFAKKIGELEVGQMENVSPGQIVDEPIRPVNIPRKEKDFQ--------GMLEYKKEDELKLVKNLILELKPRGVAVNLIP-GLPAYILFMCLRHADYLNDDQKVRSLLTSTINGIKKILKKRGDDFETVSFWLSNSCRFLHCLKQYSGEEGFMKHNTTRQNEHCLTNFDLAEYRQVLSDLAIQIYQQLVR-VLENIL-QPMIVSGMLEHETIQGVSGVKPTGLRKRTSSIADEGTYTLDSIVRQLNTFHSIMCQHGMDPELIKQVVKQMFYIIGAVTLNNLLLRKDMCSWSKGMQIRYNVSQLEEWLRDKNLMNSSAKETLEPLIQAAQLLQVKKKTDEDAEAICSMCNALTTAQIVKVLNLYTPVNEFEERVLVSFIRNIQMRLR-DRKDSP---QLLMDAKHIFPVTFPFNPSSLALETIQIPGSLGLAFLT 1799          
BLAST of Dach-2 vs. Ensembl Xenopus
Match: MYO5A (myosin VA [Source:NCBI gene;Acc:100495365])

HSP 1 Score: 1100.5 bits (2845), Expect = 0.000e+0
Identity = 711/1899 (37.44%), Postives = 1070/1899 (56.35%), Query Frame = 2
Query:   80 KIWIPDEESVWIGATVLQFHKEKN-VIKIITDNGISKELNLSSK-KCAPFLRNPDILIGQKDLTYLSYLNEPEVLYNLQIRFCERREIYTYCGIVLVAINPYQELSIYGKEIINAYHSQNSVDLDPHIFAVAENAFRRMSSFGENQSIIVSGESGAGKTVSAKYTMRYFALVGGSKTKQSFNLTETQIERKVLLSNPILEAFGNAKTIRNDNSSRFGKYLEILFNPRNQVIGANMCTYLLEKSRVVFQNLGERNYHIFYQIVTHCQSEDELLMNTGLVNNVEMYDYLRYGESLEIDGVDDSHEFLITKNSFLQLGIDLNKFKTICEILAAILHLGNIRFRFHDATDSSIIENPELLKLIAGLLGCSIDQLKIWLCFRTISTFQETLHKPLSKAEAQYFRDAFVKTLYSNLFDWIVKQANKVLSTDVSINIKKKLKKTIVVNQEDKKKFIAVLDIYGFETFAENSFEQFCINFANEKLQLQFNLHVFKLEQEEYMNEGLEWTFIDYYNNQPCIDLIESRXXXXXXXXXXXXXXXXSDENWCCKIYSHHLNKSANFNKPKLSNMVFIIEHFAGPVEYKCAGFIEKNRDSVLEEQINLLKASDVQLIAELFRDSEIEIFDTNNXXXXXXXXXXXX---XXXXXXQENTRKMKKTVGSQFRNSLKSLMDALNKTNPHYVRCIKPNDLKLPFTFCPERAVQQLRACGVLETIRLSAAGFPSRWTYSDFYHRYYILMSNFNVKNHDFKAGSQKIVETLITVPDAFRFGNTKLFFRPGQVALLEKLRGHKIESSVTLIQSILRGSIERKKYLIIHKLTVQIQTYIRRKLAIEKATKLSQIRAVIIIQSFYRMYLARKLFVKMKCAVLAIEKWRRKIITTRLKQAYKKENCVIICQAIVRRFIQRRKFLKIQRGVILIQNHYRRRKAKETLKILKIEARSINHIKFVNKGLENKIIELTQKLDTKEKEMCXXXXXXXXXXXXXXXXXXXXXA---------ESAKIYQNTVQDLQTEIIQLKKELNREIVEKNKIFADKELLEINYKKKINYLENLIEELKSSPSVI-----EPNIICNGDEAQQSICQDEHQKFI-----------NEQMDHQKLVREYEKLEMKYENLYKEFLFVKSSNQKPSINYDNQTSNDSETESTFSKDDADVESLSDKVDAKTTKEHXXXXXXXXXXLPNFISESISTAGDLAVVMQLQMNISSLSQENNRLKETVQQFEDELLKYEQCAE--DSKGLVIHNEYDNELLSIIKDIKGMDEHGLKSR----LIDEVANLKKKLKQSNEDYQKLRLHIF---------DGSMSKLTGNLDHESINSEEEELKRAFESQKEANRKMLKEIEGIKANNVDLKKALFQIRKDKEQLQVQLGKQHLMIRHGVEYL----QNLK---------------LTPKERLDKFVQNEISRILLENLKLQERNDQIISETIELKRGLKYFAFRLQKYEGSLVPNPNKEEDLLQLIQNVIYHSKMKTIGKRECYSEIGLIDLNMSELSIFIKSFIFDLSP-SICLQYEPYHLVPYIIFMVTRKFDFYKEEDQMTNFLSKLIVALKRTIRKRRNYIEYLVMLLSNVFCLVNLXXXXXXXXXXXXLNTAEDIQHYFVHYDLNEFIRLLKELCVTLFQMILKTIVDNLLPQSLCIDAILVHEAI--IDFLSKDGTKYKSNIETQPKNTSFNVLTKNLQSVLEILKNHKIPQLIINQIFVHIAYLINAYCLNTLLFRTDLCYFSKGLQIKYNLSSFETWIRYQKLIDSGALQCLRPMTEAVQLLQTLIDSDEDAKFVCDMCEYLNTRQVVKILNNFNPRDGYGCRLSSGLIAKIETQMKIKRGDEPSESKLETPTVIEIPIDIPFIHNGVSLCRTIIPKPLYLSCLT 5575
            ++WIPD E VW  A +L+ +K  + V+++  + G   E  L +K K  P LRNPDIL+G+ DLT LSYL+EP VL+NL++RF + + IYTYCGIVLVAINPY++L IYG +IINAY  QN  D+DPHIFAVAE A+++M+    NQSIIVSGESGAGKTVSAKY MRYFA V GS        +ET +E +VL SNPI+E+ GNAKT RNDNSSRFGKY+EI F+ R +++GA+M TYLLEKSRVVFQ   ERNYHIFYQ+       +  ++  G  N+   + Y + G S  I+GVDD  E   T+ +   LGI  +    I  ILAAILHLGN+ F+  D+    +      L +   L+G   +++  WLC R + T  ET  KP+S+ +A   RDA  K +Y+ LF+WIV   NK L +    N                  FI VLDIYGFETF  NSFEQFCIN+ANEKLQ QFNLHVFKLEQEEYM E + WT ID+Y+NQPCI+LIE+++G+LDLLDEECK+ KGSD  W  K+Y+ HL KSA F KP+LSN+ FII+HFA  VEY+C GF+EKN+D+V EEQI +LKAS   L+ ELF++ E  +  T+++ P      S     S+    ++ +++ KKTVG QFRNSL  LM+ LN T PHYVRCIKPND K PFTF  +RAVQQLRACGVLETIR+SAAGFPSRWTY +F+ RY +LM   +V + D K   + ++E LI   D ++FG TK+FFR GQVA LEK+R  K+  +   IQ  +RG + RKKYL + K  + IQ Y+R   A   A  L + RA IIIQ F RMY+ R+ +  M+   LA++ + R     +  Q   + +   I Q  VR ++ R  + +    ++ +Q  YRR  AK  LK LKIEARS+ H K +N G+ENKI++L +K+D + K+   +  +L   +          ++         E AK   N +  LQ E+ +L+KEL +   EKNKI       E   +K     E L+ EL+   +++     E N++    E  + + +D  +K I           +E++ +Q L+ EY +LE +Y++L  E   +     KP     + T + +E+E TFS +  + E    + +    ++                     T  D+++ ++LQ  +  L QE   +++ + + E+++++ +   +  +S+   + NE  NEL   I +    D  G        L++++ ++ ++L+   E+   LR  +          D     +  + D + +  ++ E+ +A+   KE NR +  + + +  +  +L      +++    L+ QL  Q     + VE L    Q LK               L P+ R++  +Q+EI+R+  ENL L E+ ++      +LK+ LK FA ++ + E   + N +  + + + I+ V    K K           G+++    +    +K+ I +L P  + +   P  L  YI+FM  R  D+  ++ ++ + L+  I  +K+ ++KR +  E +   LSN    ++  +QYSG + F   NT    +H   ++DL E+ ++L +L + ++Q +++ +++N+L Q + +  +L HE I  +  +   G + +++        + + + + L +   I+  H +   +I Q+   + Y+I A  LN LL R D+C +SKG+QI+YN+S  E W+R + L++S A + L P+ +A QLLQ    +DEDA+ +C MC  L T Q+VK+LN + P + +  R+    I  I+ +++  R D P   +L        P+  PF  + ++L    IP  L L+ LT
Sbjct:    8 QVWIPDPEEVWKSAEILKDYKPGDTVLRLRLEEGTDLEYRLDAKTKELPPLRNPDILVGENDLTALSYLHEPAVLHNLKVRFIDSKLIYTYCGIVLVAINPYEQLPIYGSDIINAYSGQNMGDMDPHIFAVAEEAYKQMARDERNQSIIVSGESGAGKTVSAKYAMRYFATVSGSA-------SETNVEERVLASNPIMESIGNAKTTRNDNSSRFGKYIEIGFDKRYRILGAHMRTYLLEKSRVVFQAEEERNYHIFYQLCASASLPEFKMLRLGTAND---FHYTKQGGSPVIEGVDDQREMKNTRQACTLLGIGDSYQMGIFRILAAILHLGNVEFKSRDSDSCLVPPKHAPLNIFCDLMGVEYEEMSHWLCHRKLVTAAETYIKPISRLQATNARDALAKHIYAFLFNWIVCHVNKALHSSTKQN-----------------SFIGVLDIYGFETFEINSFEQFCINYANEKLQQQFNLHVFKLEQEEYMKEQIPWTLIDFYDNQPCINLIEAKMGILDLLDEECKMPKGSDSTWAQKLYNTHLKKSALFEKPRLSNVAFIIKHFADKVEYQCEGFLEKNKDTVFEEQIKVLKASKFTLLTELFQEEEQILSPTSSAPPSGRTLLSRTGLRSLKPKPEQTSKEHKKTVGHQFRNSLHLLMETLNATTPHYVRCIKPNDFKYPFTFDSKRAVQQLRACGVLETIRISAAGFPSRWTYQEFFSRYRVLMKQKDVLS-DRKQTCKNVLEKLILDKDKYQFGKTKIFFRAGQVAYLEKIRADKLRMACIRIQKTIRGWLLRKKYLRMRKAAITIQRYVRGYQARCYAQFLRRTRAAIIIQKFQRMYVVRQKYRHMQSITLALQSYMRGYAARKRFQGMLRAHKATIIQKHVRGWLARVTYKRNLSAIVYLQCCYRRMMAKRELKKLKIEARSVEHYKKLNNGMENKIMQLQRKVDEQNKDNKSLLERLTHLEVTYNTEKDKLRSDVDRLRHFEEEAKNAANRMVSLQDELARLRKELQQTQTEKNKI-------EERAEKYQTETEKLVAELREQNALLKAEKEELNLLIQ--EQAKKMTEDMEKKIIEETKQLELELNDERLRYQNLLNEYSRLEERYDDLKDEINTMVPP--KPGHKRTDSTHSSNESEYTFSSEITESEDYPYRNEEPADRK---------------------TPLDMSLFLKLQKRVKELEQEKQVMQDDLDKKEEQIIRAKIMRQELESENKKLKNEL-NELRRAITEKASPDATGPGGTVYKVLLEQMTSVSEELEVRKEEVLILRSQLVSQMEAIPHKDTMTDSMVLSEDVQKM-KDKREIAQAYTGMKETNRNLPPDYQDLNEDG-ELWLVYDGLKQANRVLESQLQSQKKAFENEVEALRGEIQALKEENNRQQQLLAQNLQLPPEARIEASLQHEITRLTNENLDLMEQLEKQDKTVRKLKKQLKVFAKKIGELEVGQMENVSPGQIVDEPIRPVNIPRKEKDFQ--------GMLEYKKEDELKLVKNLILELKPRGVAVNLIP-GLPAYILFMCLRHADYLNDDQKVRSLLTSTINGIKKILKKRGDDFETVSFWLSNSCRFLHCLKQYSGEEGFMKHNTTRQNEHCLTNFDLAEYRQVLSDLAIQIYQQLVR-VLENIL-QPMIVSGMLEHETIQGVSGVKPTGLRKRTSSIADEGTYTLDSIVRQLNTFHSIMCQHGMDPELIKQVVKQMFYIIGAVTLNNLLLRKDMCSWSKGMQIRYNVSQLEEWLRDKNLMNSSAKETLEPLIQAAQLLQVKKKTDEDAEAICSMCNALTTAQIVKVLNLYTPVNEFEERVLVSFIRNIQMRLR-DRKDSP---QLLMDAKHIFPVTFPFNPSSLALETIQIPGSLGLAFLT 1828          
BLAST of Dach-2 vs. Ensembl Xenopus
Match: MYO5A (myosin VA [Source:NCBI gene;Acc:100495365])

HSP 1 Score: 1097.8 bits (2838), Expect = 0.000e+0
Identity = 710/1903 (37.31%), Postives = 1067/1903 (56.07%), Query Frame = 2
Query:   77 VKIWIPDEESVWIGATVLQFHKEKN-VIKIITDNGISKELNLSSK-KCAPFLRNPDILIGQKDLTYLSYLNEPEVLYNLQIRFCERREIYTYCGIVLVAINPYQELSIYGKEIINAYHSQNSVDLDPHIFAVAENAFRRMSSFGENQSIIVSGESGAGKTVSAKYTMRYFALVGGSKTKQSFNLTETQIERKVLLSNPILEAFGNAKTIRNDNSSRFGKYLEILFNPRNQVIGANMCTYLLEKSRVVFQNLGERNYHIFYQIVTHCQSEDELLMNTGLVNNVEMYDYLRYGESLEIDGVDDSHEFLITKNSFLQLGIDLNKFKTICEILAAILHLGNIRFRFHDATDSSIIENPELLKLIAGLLGCSIDQLKIWLCFRTISTFQETLHKPLSKAEAQYFRDAFVKTLYSNLFDWIVKQANKVLSTDVSINIKKKLKKTIVVNQEDKKKFIAVLDIYGFETFAENSFEQFCINFANEKLQLQFNLHVFKLEQEEYMNEGLEWTFIDYYNNQPCIDLIESRXXXXXXXXXXXXXXXXSDENWCCKIYSHHLNKSANFNKPKLSNMVFIIEHFAGPVEYKCAGFIEKNRDSVLEEQINLLKASDVQLIAELFRDSEIEIFDTNNXXXXXXXXXXXX---XXXXXXQENTRKMKKTVGSQFRNSLKSLMDALNKTNPHYVRCIKPNDLKLPFTFCPERAVQQLRACGVLETIRLSAAGFPSRWTYSDFYHRYYILMSNFNVKNHDFKAGSQKIVETLITVPDAFRFGNTKLFFRPGQVALLEKLRGHKIESSVTLIQSILRGSIERKKYLIIHKLTVQIQTYIRRKLAIEKATKLSQIRAVIIIQSFYRMYLARKLFVKMKCAVLAIEKWRRKIITTRLKQAYKKENCVIICQAIVRRFIQRRKFLKIQRGVILIQNHYRRRKAKETLKILKIEARSINHIKFVNKGLENKIIELTQKLDTKEKEMCXXXXXXXXXXXXXXXXXXXXXA---------ESAKIYQNTVQDLQTEIIQLKKELNREIVEKNKIFADKELLEINYKKKINYLENLIEELKSSPSVI-----EPNIICNGDEAQQSICQDEHQKFI-----------NEQMDHQKLVREYEKLEMKYENLYKEFLFVKSSNQKPSINYDNQTSNDSETESTFSKDDADVESLSDKVDAKTTKEHXXXXXXXXXXLPNFISESISTAGDLAVVMQLQMNISSLSQENNRLKETVQQFEDELLK---YEQCAEDSKGLVIHNEYD------------------NELLSIIKDIKGMDEHGLKSR----LIDEVANLKKKLKQSNEDYQKLRLHIF---------DGSMSKLTGNLDHESINSEEEELKRAFESQKEANRKMLKEIEGIKA---NNVDLKKALFQIRKDKEQLQVQLGKQHLMIRHGVEYLQNLKLTPKERLDKFVQNEISRILLENLKLQERNDQIISETIELKRGLKYFAFRLQKYEGSLVPNPNKEEDLLQLIQNVIYHSKMKTIGKRECYSEIGLIDLNMSELSIFIKSFIFDLSP-SICLQYEPYHLVPYIIFMVTRKFDFYKEEDQMTNFLSKLIVALKRTIRKRRNYIEYLVMLLSNVFCLVNLXXXXXXXXXXXXLNTAEDIQHYFVHYDLNEFIRLLKELCVTLFQMILKTIVDNLLPQSLCIDAILVHEAI--IDFLSKDGTKYKSNIETQPKNTSFNVLTKNLQSVLEILKNHKIPQLIINQIFVHIAYLINAYCLNTLLFRTDLCYFSKGLQIKYNLSSFETWIRYQKLIDSGALQCLRPMTEAVQLLQTLIDSDEDAKFVCDMCEYLNTRQVVKILNNFNPRDGYGCRLSSGLIAKIETQMKIKRGDEPSESKLETPTVIEIPIDIPFIHNGVSLCRTIIPKPLYLSCLT 5575
             ++WIPD E VW  A +L+ +K  + V+++  + G   E  L +K K  P LRNPDIL+G+ DLT LSYL+EP VL+NL++RF + + IYTYCGIVLVAINPY++L IYG +IINAY  QN  D+DPHIFAVAE A+++M+    NQSIIVSGESGAGKTVSAKY MRYFA V GS        +ET +E +VL SNPI+E+ GNAKT RNDNSSRFGKY+EI F+ R +++GA+M TYLLEKSRVVFQ   ERNYHIFYQ+       +  ++  G  N+   + Y + G S  I+GVDD  E   T+ +   LGI  +    I  ILAAILHLGN+ F+  D+    +      L +   L+G   +++  WLC R + T  ET  KP+S+ +A   RDA  K +Y+ LF+WIV   NK L +    N                  FI VLDIYGFETF  NSFEQFCIN+ANEKLQ QFNLHVFKLEQEEYM E + WT ID+Y+NQPCI+LIE+++G+LDLLDEECK+ KGSD  W  K+Y+ HL KSA F KP+LSN+ FII+HFA  VEY+C GF+EKN+D+V EEQI +LKAS   L+ ELF++ E  +  T+++ P      S     S+    ++ +++ KKTVG QFRNSL  LM+ LN T PHYVRCIKPND K PFTF  +RAVQQLRACGVLETIR+SAAGFPSRWTY +F+ RY +LM   +V + D K   + ++E LI   D ++FG TK+FFR GQVA LEK+R  K+  +   IQ  +RG + RKKYL + K  + IQ Y+R   A   A  L + RA IIIQ F RMY+ R+ +  M+   LA++ + R     +  Q   + +   I Q  VR ++ R  + +    ++ +Q  YRR  AK  LK LKIEARS+ H K +N G+ENKI++L +K+D + K+   +  +L   +          ++         E AK   N +  LQ E+ +L+KEL +   EKNKI       E   +K     E L+ EL+   +++     E N++    E  + + +D  +K I           +E++ +Q L+ EY +LE +Y++L  E   +     KP     + T + +E+E TFS +  + E    + +    ++                     T  D+++ ++LQ  +  L QE   +++ + + E+++++    E+    ++G  +  EY+                  NEL   I +    D  G        L++++ ++ ++L+   E+   LR  +          D     +  + D + +  ++ E+ +A+   KE NR +  +++  K    N V+  +   Q  K++              R      QNL+L P+ R++  +Q+EI+R+  ENL L E+ ++      +LK+ LK FA ++ + E   + N +  + + + I+ V    K K           G+++    +    +K+ I +L P  + +   P  L  YI+FM  R  D+  ++ ++ + L+  I  +K+ ++KR +  E +   LSN    ++  +QYSG + F   NT    +H   ++DL E+ ++L +L + ++Q +++ +++N+L Q + +  +L HE I  +  +   G + +++        + + + + L +   I+  H +   +I Q+   + Y+I A  LN LL R D+C +SKG+QI+YN+S  E W+R + L++S A + L P+ +A QLLQ    +DEDA+ +C MC  L T Q+VK+LN + P + +  R+    I  I+ +++  R D P   +L        P+  PF  + ++L    IP  L L+ LT
Sbjct:   17 ARVWIPDPEEVWKSAEILKDYKPGDTVLRLRLEEGTDLEYRLDAKTKELPPLRNPDILVGENDLTALSYLHEPAVLHNLKVRFIDSKLIYTYCGIVLVAINPYEQLPIYGSDIINAYSGQNMGDMDPHIFAVAEEAYKQMARDERNQSIIVSGESGAGKTVSAKYAMRYFATVSGSA-------SETNVEERVLASNPIMESIGNAKTTRNDNSSRFGKYIEIGFDKRYRILGAHMRTYLLEKSRVVFQAEEERNYHIFYQLCASASLPEFKMLRLGTAND---FHYTKQGGSPVIEGVDDQREMKNTRQACTLLGIGDSYQMGIFRILAAILHLGNVEFKSRDSDSCLVPPKHAPLNIFCDLMGVEYEEMSHWLCHRKLVTAAETYIKPISRLQATNARDALAKHIYAFLFNWIVCHVNKALHSSTKQN-----------------SFIGVLDIYGFETFEINSFEQFCINYANEKLQQQFNLHVFKLEQEEYMKEQIPWTLIDFYDNQPCINLIEAKMGILDLLDEECKMPKGSDSTWAQKLYNTHLKKSALFEKPRLSNVAFIIKHFADKVEYQCEGFLEKNKDTVFEEQIKVLKASKFTLLTELFQEEEQILSPTSSAPPSGRTLLSRTGLRSLKPKPEQTSKEHKKTVGHQFRNSLHLLMETLNATTPHYVRCIKPNDFKYPFTFDSKRAVQQLRACGVLETIRISAAGFPSRWTYQEFFSRYRVLMKQKDVLS-DRKQTCKNVLEKLILDKDKYQFGKTKIFFRAGQVAYLEKIRADKLRMACIRIQKTIRGWLLRKKYLRMRKAAITIQRYVRGYQARCYAQFLRRTRAAIIIQKFQRMYVVRQKYRHMQSITLALQSYMRGYAARKRFQGMLRAHKATIIQKHVRGWLARVTYKRNLSAIVYLQCCYRRMMAKRELKKLKIEARSVEHYKKLNNGMENKIMQLQRKVDEQNKDNKSLLERLTHLEVTYNTEKDKLRSDVDRLRHFEEEAKNAANRMVSLQDELARLRKELQQTQTEKNKI-------EERAEKYQTETEKLVAELREQNALLKAEKEELNLLIQ--EQAKKMTEDMEKKIIEETKQLELELNDERLRYQNLLNEYSRLEERYDDLKDEINTMVPP--KPGHKRTDSTHSSNESEYTFSSEITESEDYPYRNEEPADRK---------------------TPLDMSLFLKLQKRVKELEQEKQVMQDDLDKKEEQIIRAKIMEEAKTPTRGTEL--EYESLKRQELESENKKLKNELNELRRAITEKASPDATGPGGTVYKVLLEQMTSVSEELEVRKEEVLILRSQLVSQMEAIPHKDTMTDSMVLSEDVQKMK-DKREIAQAYTGMKETNRVLESQLQSQKKAFENEVEALRGEIQALKEENN------------RQQQLLAQNLQLPPEARIEASLQHEITRLTNENLDLMEQLEKQDKTVRKLKKQLKVFAKKIGELEVGQMENVSPGQIVDEPIRPVNIPRKEKDFQ--------GMLEYKKEDELKLVKNLILELKPRGVAVNLIP-GLPAYILFMCLRHADYLNDDQKVRSLLTSTINGIKKILKKRGDDFETVSFWLSNSCRFLHCLKQYSGEEGFMKHNTTRQNEHCLTNFDLAEYRQVLSDLAIQIYQQLVR-VLENIL-QPMIVSGMLEHETIQGVSGVKPTGLRKRTSSIADEGTYTLDSIVRQLNTFHSIMCQHGMDPELIKQVVKQMFYIIGAVTLNNLLLRKDMCSWSKGMQIRYNVSQLEEWLRDKNLMNSSAKETLEPLIQAAQLLQVKKKTDEDAEAICSMCNALTTAQIVKVLNLYTPVNEFEERVLVSFIRNIQMRLR-DRKDSP---QLLMDAKHIFPVTFPFNPSSLALETIQIPGSLGLAFLT 1829          
BLAST of Dach-2 vs. Ensembl Xenopus
Match: MYO5A (myosin VA [Source:NCBI gene;Acc:100495365])

HSP 1 Score: 1097.03 bits (2836), Expect = 0.000e+0
Identity = 719/1934 (37.18%), Postives = 1075/1934 (55.58%), Query Frame = 2
Query:   80 KIWIPDEESVWIGATVLQFHKEKN-VIKIITDNGISKELNLSSK-KCAPFLRNPDILIGQKDLTYLSYLNEPEVLYNLQIRFCERREIYTYCGIVLVAINPYQELSIYGKEIINAYHSQNSVDLDPHIFAVAENAFRRMSSFGENQSIIVSGESGAGKTVSAKYTMRYFALVGGSKTKQSFNLTETQIERKVLLSNPILEAFGNAKTIRNDNSSRFGKYLEILFNPRNQVIGANMCTYLLEKSRVVFQNLGERNYHIFYQIVTHCQSEDELLMNTGLVNNVEMYDYLRYGESLEIDGVDDSHEFLITKNSFLQLGIDLNKFKTICEILAAILHLGNIRFRFHDATDSSIIENPELLKLIAGLLGCSIDQLKIWLCFRTISTFQETLHKPLSKAEAQYFRDAFVKTLYSNLFDWIVKQANKVLSTDVSINIKKKLKKTIVVNQEDKKKFIAVLDIYGFETFAENSFEQFCINFANEKLQLQFNLHVFKLEQEEYMNEGLEWTFIDYYNNQPCIDLIESRXXXXXXXXXXXXXXXXSDENWCCKIYSHHLNKSANFNKPKLSNMVFIIEHFAGPVEYKCAGFIEKNRDSVLEEQINLLKASDVQLIAELFRDSEIEIFDTNNXXXXXXXXXXXX---XXXXXXQENTRKMKKTVGSQFRNSLKSLMDALNKTNPHYVRCIKPNDLKLPFTFCPERAVQQLRACGVLETIRLSAAGFPSRWTYSDFYHRYYILMSNFNVKNHDFKAGSQKIVETLITVPDAFRFGNTKLFFRPGQVALLEKLRGHKIESSVTLIQSILRGSIERKKYLIIHKLTVQIQTYIRRKLAIEKATKLSQIRAVIIIQSFYRMYLARKLFVKMKCAVLAIEKWRRKIITTRLKQAYKKENCVIICQAIVRRFIQRRKFLKIQRGVILIQNHYRRRKAKETLKILKIEARSINHIKFVNKGLENKIIELTQKLDTKEKEMCXXXXXXXXXXXXXXXXXXXXXA---------ESAKIYQNTVQDLQTEIIQLKKELNREIVEKNKIFADKELLEINYKKKINYLENLIEELKSSPSVI-----EPNIICNGDEAQQSICQDEHQKFI-----------NEQMDHQKLVREYEKLEMKYENLYKEFLFVKSSNQKPSINYDNQTSNDSETESTFSKDDADVESLSDKVDAKTTKEHXXXXXXXXXXLPNFISESISTAGDLAVVMQLQMNISSLSQENNRLKETVQQFEDELLK---YEQCAEDSKGLVIHNEYD------------------NELLSIIKDIKGMDEHG-----------------------------LKSRLIDEVANLKKKLKQSN---------EDYQKLR-----LHIFDGSMSKLTGNL--DHESINSEEEELKRAFESQKEANRKMLKEIEGIKA---NNVDLKKALFQIRKDKEQLQVQLGKQHLMIRHGVEYLQNLKLTPKERLDKFVQNEISRILLENLKLQERNDQIISETIELKRGLKYFAFRLQKYEGSLVPNPNKEEDLLQLIQNVIYHSKMKTIGKRECYSEIGLIDLNMSELSIFIKSFIFDLSP-SICLQYEPYHLVPYIIFMVTRKFDFYKEEDQMTNFLSKLIVALKRTIRKRRNYIEYLVMLLSNVFCLVNLXXXXXXXXXXXXLNTAEDIQHYFVHYDLNEFIRLLKELCVTLFQMILKTIVDNLLPQSLCIDAILVHEAI--IDFLSKDGTKYKSNIETQPKNTSFNVLTKNLQSVLEILKNHKIPQLIINQIFVHIAYLINAYCLNTLLFRTDLCYFSKGLQIKYNLSSFETWIRYQKLIDSGALQCLRPMTEAVQLLQTLIDSDEDAKFVCDMCEYLNTRQVVKILNNFNPRDGYGCRLSSGLIAKIETQMKIKRGDEPSESKLETPTVIEIPIDIPFIHNGVSLCRTIIPKPLYLSCLT 5575
            ++WIPD E VW  A +L+ +K  + V+++  + G   E  L +K K  P LRNPDIL+G+ DLT LSYL+EP VL+NL++RF + + IYTYCGIVLVAINPY++L IYG +IINAY  QN  D+DPHIFAVAE A+++M+    NQSIIVSGESGAGKTVSAKY MRYFA V GS        +ET +E +VL SNPI+E+ GNAKT RNDNSSRFGKY+EI F+ R +++GA+M TYLLEKSRVVFQ   ERNYHIFYQ+       +  ++  G  N+   + Y + G S  I+GVDD  E   T+ +   LGI  +    I  ILAAILHLGN+ F+  D+    +      L +   L+G   +++  WLC R + T  ET  KP+S+ +A   RDA  K +Y+ LF+WIV   NK L +    N                  FI VLDIYGFETF  NSFEQFCIN+ANEKLQ QFNLHVFKLEQEEYM E + WT ID+Y+NQPCI+LIE+++G+LDLLDEECK+ KGSD  W  K+Y+ HL KSA F KP+LSN+ FII+HFA  VEY+C GF+EKN+D+V EEQI +LKAS   L+ ELF++ E  +  T+++ P      S     S+    ++ +++ KKTVG QFRNSL  LM+ LN T PHYVRCIKPND K PFTF  +RAVQQLRACGVLETIR+SAAGFPSRWTY +F+ RY +LM   +V + D K   + ++E LI   D ++FG TK+FFR GQVA LEK+R  K+  +   IQ  +RG + RKKYL + K  + IQ Y+R   A   A  L + RA IIIQ F RMY+ R+ +  M+   LA++ + R     +  Q   + +   I Q  VR ++ R  + +    ++ +Q  YRR  AK  LK LKIEARS+ H K +N G+ENKI++L +K+D + K+   +  +L   +          ++         E AK   N +  LQ E+ +L+KEL +   EKNKI       E   +K     E L+ EL+   +++     E N++    E  + + +D  +K I           +E++ +Q L+ EY +LE +Y++L  E   +     KP     + T + +E+E TFS +  + E    + +    ++                     T  D+++ ++LQ  +  L QE   +++ + + E+++++    E+    ++G  +  EY+                  NEL   I +    D  G                             L+S+L+ ++  +  K + S+         ED QK++        + G M +   NL  D++ +N E+ EL   ++  K+ANR +  +++  K    N V+  +   Q  K++              R      QNL+L P+ R++  +Q+EI+R+  ENL L E+ ++      +LK+ LK FA ++ + E   + N +  + + + I+ V    K K           G+++    +    +K+ I +L P  + +   P  L  YI+FM  R  D+  ++ ++ + L+  I  +K+ ++KR +  E +   LSN    ++  +QYSG + F   NT    +H   ++DL E+ ++L +L + ++Q +++ +++N+L Q + +  +L HE I  +  +   G + +++        + + + + L +   I+  H +   +I Q+   + Y+I A  LN LL R D+C +SKG+QI+YN+S  E W+R + L++S A + L P+ +A QLLQ    +DEDA+ +C MC  L T Q+VK+LN + P + +  R+    I  I+ +++  R D P   +L        P+  PF  + ++L    IP  L L+ LT
Sbjct:    8 QVWIPDPEEVWKSAEILKDYKPGDTVLRLRLEEGTDLEYRLDAKTKELPPLRNPDILVGENDLTALSYLHEPAVLHNLKVRFIDSKLIYTYCGIVLVAINPYEQLPIYGSDIINAYSGQNMGDMDPHIFAVAEEAYKQMARDERNQSIIVSGESGAGKTVSAKYAMRYFATVSGSA-------SETNVEERVLASNPIMESIGNAKTTRNDNSSRFGKYIEIGFDKRYRILGAHMRTYLLEKSRVVFQAEEERNYHIFYQLCASASLPEFKMLRLGTAND---FHYTKQGGSPVIEGVDDQREMKNTRQACTLLGIGDSYQMGIFRILAAILHLGNVEFKSRDSDSCLVPPKHAPLNIFCDLMGVEYEEMSHWLCHRKLVTAAETYIKPISRLQATNARDALAKHIYAFLFNWIVCHVNKALHSSTKQN-----------------SFIGVLDIYGFETFEINSFEQFCINYANEKLQQQFNLHVFKLEQEEYMKEQIPWTLIDFYDNQPCINLIEAKMGILDLLDEECKMPKGSDSTWAQKLYNTHLKKSALFEKPRLSNVAFIIKHFADKVEYQCEGFLEKNKDTVFEEQIKVLKASKFTLLTELFQEEEQILSPTSSAPPSGRTLLSRTGLRSLKPKPEQTSKEHKKTVGHQFRNSLHLLMETLNATTPHYVRCIKPNDFKYPFTFDSKRAVQQLRACGVLETIRISAAGFPSRWTYQEFFSRYRVLMKQKDVLS-DRKQTCKNVLEKLILDKDKYQFGKTKIFFRAGQVAYLEKIRADKLRMACIRIQKTIRGWLLRKKYLRMRKAAITIQRYVRGYQARCYAQFLRRTRAAIIIQKFQRMYVVRQKYRHMQSITLALQSYMRGYAARKRFQGMLRAHKATIIQKHVRGWLARVTYKRNLSAIVYLQCCYRRMMAKRELKKLKIEARSVEHYKKLNNGMENKIMQLQRKVDEQNKDNKSLLERLTHLEVTYNTEKDKLRSDVDRLRHFEEEAKNAANRMVSLQDELARLRKELQQTQTEKNKI-------EERAEKYQTETEKLVAELREQNALLKAEKEELNLLIQ--EQAKKMTEDMEKKIIEETKQLELELNDERLRYQNLLNEYSRLEERYDDLKDEINTMVPP--KPGHKRTDSTHSSNESEYTFSSEITESEDYPYRNEEPADRK---------------------TPLDMSLFLKLQKRVKELEQEKQVMQDDLDKKEEQIIRAKIMEEAKTPTRGTEL--EYESLKRQELESENKKLKNELNELRRAITEKASPDATGPGGTVYKVLLEQMTSVSEELEVRKEEVLILRSQLVSQMEAIPHKPRPSDTMTDSMVLSEDVQKMKDKREIAQAYTG-MKETNRNLPPDYQDLN-EDGELWLVYDGLKQANRVLESQLQSQKKAFENEVEALRGEIQALKEENN------------RQQQLLAQNLQLPPEARIEASLQHEITRLTNENLDLMEQLEKQDKTVRKLKKQLKVFAKKIGELEVGQMENVSPGQIVDEPIRPVNIPRKEKDFQ--------GMLEYKKEDELKLVKNLILELKPRGVAVNLIP-GLPAYILFMCLRHADYLNDDQKVRSLLTSTINGIKKILKKRGDDFETVSFWLSNSCRFLHCLKQYSGEEGFMKHNTTRQNEHCLTNFDLAEYRQVLSDLAIQIYQQLVR-VLENIL-QPMIVSGMLEHETIQGVSGVKPTGLRKRTSSIADEGTYTLDSIVRQLNTFHSIMCQHGMDPELIKQVVKQMFYIIGAVTLNNLLLRKDMCSWSKGMQIRYNVSQLEEWLRDKNLMNSSAKETLEPLIQAAQLLQVKKKTDEDAEAICSMCNALTTAQIVKVLNLYTPVNEFEERVLVSFIRNIQMRLR-DRKDSP---QLLMDAKHIFPVTFPFNPSSLALETIQIPGSLGLAFLT 1850          
BLAST of Dach-2 vs. Ensembl Mouse
Match: Myo5a (myosin VA [Source:MGI Symbol;Acc:MGI:105976])

HSP 1 Score: 1109.36 bits (2868), Expect = 0.000e+0
Identity = 710/1902 (37.33%), Postives = 1083/1902 (56.94%), Query Frame = 2
Query:   47 MALYEMYSKGVKIWIPDEESVWIGATVLQFHKEKN-VIKIITDNGISKELNLSSKKCA-PFLRNPDILIGQKDLTYLSYLNEPEVLYNLQIRFCERREIYTYCGIVLVAINPYQELSIYGKEIINAYHSQNSVDLDPHIFAVAENAFRRMSSFGENQSIIVSGESGAGKTVSAKYTMRYFALVGGSKTKQSFNLTETQIERKVLLSNPILEAFGNAKTIRNDNSSRFGKYLEILFNPRNQVIGANMCTYLLEKSRVVFQNLGERNYHIFYQIVTHCQSEDELLMNTGLVNNVEMYDYLRYGESLEIDGVDDSHEFLITKNSFLQLGIDLNKFKTICEILAAILHLGNIRFRFHDATDSSIIENPELLKLIAGLLGCSIDQLKIWLCFRTISTFQETLHKPLSKAEAQYFRDAFVKTLYSNLFDWIVKQANKVLSTDVSINIKKKLKKTIVVNQEDKKKFIAVLDIYGFETFAENSFEQFCINFANEKLQLQFNLHVFKLEQEEYMNEGLEWTFIDYYNNQPCIDLIESRXXXXXXXXXXXXXXXXSDENWCCKIYSHHLNKSANFNKPKLSNMVFIIEHFAGPVEYKCAGFIEKNRDSVLEEQINLLKASDVQLIAELFRDSEIEIFDTNNXXXXXXXXXXXXXXXXXXQ--ENTRKMKKTVGSQFRNSLKSLMDALNKTNPHYVRCIKPNDLKLPFTFCPERAVQQLRACGVLETIRLSAAGFPSRWTYSDFYHRYYILMSNFNVKNHDFKAGSQKIVETLITVPDAFRFGNTKLFFRPGQVALLEKLRGHKIESSVTLIQSILRGSIERKKYLIIHKLTVQIQTYIRRKLAIEKATKLSQIRAVIIIQSFYRMYLARKLFVKMKCAVLAIEKWRRKIITTRLKQAYKKENCVIICQAIVRRFIQRRKFLKIQRGVILIQNHYRRRKAKETLKILKIEARSINHIKFVNKGLENKIIELTQKLDTKEKEM-CXXXXXX--------XXXXXXXXXXXXXXXAESAKIYQNTVQDLQTEIIQLKKELNREIVEKNKI--FADKELLEINYKKKINYL-ENLIEE---LKSSPSVIEPNIICNGDEAQQSICQD--EHQKFI-----NEQMDHQKLVREYEKLEMKYENLYKEFLFVKSSNQKPSINYDNQTSNDSETESTFSKDDADVESLSDKVDAKTTKEHXXXXXXXXXXLPNFISESISTAGDLAVVMQLQMNISSLSQENNRLKETVQQFEDELLKYEQCAEDSKGLVIHNEYDNELLSIIKDIKGMDEHGLKSRLIDEVANLKKKL-KQSNEDYQKLRLHIFDGSMSKLTGNLDHESINSEEEELKRA-FESQKEANRK------------MLKEIEGIKANNVDLKKALFQIRKDKEQLQVQLGKQHLMIRHGVEYL----QNLK---------------LTPKERLDKFVQNEISRILLENLKLQERNDQIISETIELKRGLKYFAFRLQKYEGSLVPNPNKEEDLLQLIQNVIYHSKMKTIGKRECYSEIGLIDLNMSELSIFIKSFIFDLSP-SICLQYEPYHLVPYIIFMVTRKFDFYKEEDQMTNFLSKLIVALKRTIRKRRNYIEYLVMLLSNVFCLVNLXXXXXXXXXXXXLNTAEDIQHYFVHYDLNEFIRLLKELCVTLFQMILKTIVDNLLPQSLCIDAILVHEAI--IDFLSKDGTKYKSNIETQPKNTSFNVLTKNLQSVLEILKNHKIPQLIINQIFVHIAYLINAYCLNTLLFRTDLCYFSKGLQIKYNLSSFETWIRYQKLIDSGALQCLRPMTEAVQLLQTLIDSDEDAKFVCDMCEYLNTRQVVKILNNFNPRDGYGCRLSSGLIAKIETQMKIKRGDEPSESKLETPTVIEIPIDIPFIHNGVSLCRTIIPKPLYLS 5566
            MA  E+Y+K  ++WIPD E VW  A +L+ +K  + V+ +  + G   E  L  K    P LRNPDIL+G+ DLT LSYL+EP VL+NL++RF + + IYTYCGIVLVAINPY++L IYG++IINAY  QN  D+DPHIFAVAE A+++M+    NQSIIVSGESGAGKTVSAKY MRYFA V GS        +E  +E KVL SNPI+E+ GNAKT RNDNSSRFGKY+EI F+ R ++IGANM TYLLEKSRVVFQ   ERNYHIFYQ+    +  +  ++  G   N + + Y + G S  I+GVDD+ E   T+ +   LGI  +    I  ILA ILHLGN+ F   D+   +I    E L +   L+G   +++  WLC R ++T  ET  KP+SK +A   RDA  K +Y+ LF+WIV   N+ L + V                  +  FI VLDIYGFETF  NSFEQFCIN+ANEKLQ QFN+HVFKLEQEEYM E + WT ID+Y+NQPCI+LIES+LG+LDLLDEECK+ KG+D+ W  K+Y+ HLNK A F KP++SN  FII+HFA  VEY+C GF+EKN+D+V EEQI +LK+S  +++ ELF+D E  I  T+ +    +  +      +  +  +  ++ KKTVG QFRNSL  LM+ LN T PHYVRCIKPND K PFTF  +RAVQQLRACGVLETIR+SAAGFPSRWTY +F+ RY +LM   +V   D K   + ++E LI   D ++FG TK+FFR GQVA LEKLR  K+ ++   IQ  +RG + RK+YL + +  + +Q Y+R   A   A  L + +A   IQ ++RMY+ R+ +   + A + I+ + R  +T    +   +E   +I Q  VR ++ R  + +  + ++ +Q  +RR  AK  LK LKIEARS+   K ++ G+ENKI++L +K+D + K+  CL++             EK    +       E AK+    V  LQ EI +L+K+L +   EK  I   ADK      YK++ + L  NL EE   LK     +   I+    E  +++ +   E  K +     +E++ +Q L+ E+ +LE +Y++L KE + +  +  KP     + T + +E+E TFS + A+ E ++ + +    K+                        D+++ ++LQ  ++ L QE   +++ + + E+++ +  +  E+ +  +   E + E L      K  +      +L +E+  L+K L ++S  +        +   M +LT   +   +  EE  + R+   SQKEA +             +L++++ +K +  ++ +A   +++    L+ QL  Q     +  E L    Q+LK               L P+ R++  +Q+EI+R+  ENL L E+ ++      +LK+ LK FA ++ + E   + N +  + + + I+ V    K K           G+++    +    +K+ I +L P  + +   P  L  YI+FM  R  D+  ++ ++ + L+  I ++K+ ++KR +  E +   LSN    ++  +QYSG + F   NT+   +H   ++DL E+ ++L +L + ++Q +++ +++N+L Q + +  +L HE I  +  +   G + +++        + + + + L S   ++  H +   +I Q+   + Y++ A  LN LL R D+C +SKG+QI+YN+S  E W+R + L++SGA + L P+ +A QLLQ    +D+DA+ +C MC  L T Q+VK+LN + P + +  R+S   I  I+ +++  R D P   +L        P+  PF  + ++L    IP  L L 
Sbjct:    1 MAASELYTKFARVWIPDPEEVWKSAELLKDYKPGDKVLLLHLEEGKDLEYRLDPKTGELPHLRNPDILVGENDLTALSYLHEPAVLHNLRVRFIDSKLIYTYCGIVLVAINPYEQLPIYGEDIINAYSGQNMGDMDPHIFAVAEEAYKQMARDERNQSIIVSGESGAGKTVSAKYAMRYFATVSGSA-------SEANVEEKVLASNPIMESIGNAKTTRNDNSSRFGKYIEIGFDKRYRIIGANMRTYLLEKSRVVFQAEEERNYHIFYQLCASAKLPEFKMLRLG---NADSFHYTKQGGSPMIEGVDDAKEMAHTRQACTLLGISESYQMGIFRILAGILHLGNVGFASRDSDSCTIPPKHEPLTIFCDLMGVDYEEMCHWLCHRKLATATETYIKPISKLQATNARDALAKHIYAKLFNWIVDHVNQALHSAVK-----------------QHSFIGVLDIYGFETFEINSFEQFCINYANEKLQQQFNMHVFKLEQEEYMKEQIPWTLIDFYDNQPCINLIESKLGILDLLDEECKMPKGTDDTWAQKLYNTHLNKCALFEKPRMSNKAFIIKHFADKVEYQCEGFLEKNKDTVFEEQIKVLKSSKFKMLPELFQDDEKAISPTSATSSGRTPLTRVPVKPTKGRPGQTAKEHKKTVGHQFRNSLHLLMETLNATTPHYVRCIKPNDFKFPFTFDEKRAVQQLRACGVLETIRISAAGFPSRWTYQEFFSRYRVLMKQKDVLG-DRKQTCKNVLEKLILDKDKYQFGKTKIFFRAGQVAYLEKLRADKLRAACIRIQKTIRGWLLRKRYLCMQRAAITVQRYVRGYQARCYAKFLRRTKAATTIQKYWRMYVVRRRYKIRRAATIVIQSYLRGYLTRNRYRKILREYKAVIIQKRVRGWLARTHYKRTMKAIVYLQCCFRRMMAKRELKKLKIEARSVERYKKLHIGMENKIMQLQRKVDEQNKDYKCLMEKLTNLEGVYNSETEKLRNDVERLQLSEEEAKVATGRVLSLQEEIAKLRKDLEQTRSEKKSIEERADK------YKQETDQLVSNLKEENTLLKQEKETLNHRIVEQAKEMTETMERKLVEETKQLELDLNDERLRYQNLLNEFSRLEERYDDL-KEEMTLMLNVPKPGHKRTDSTHSSNESEYTFSSEFAETEDIAPRTEEPIEKK---------------------VPLDMSLFLKLQKRVTELEQEKQLMQDELDRKEEQVFR-SKAKEEERPQIRGAELEYESL------KRQELESENKKLKNELNELRKALSEKSAPEVTAPGAPAYRVLMEQLTSVSEELDVRKEEVLILRSQLVSQKEAIQPKDDKNTMTDSTILLEDVQKMK-DKGEIAQAYIGLKETNRLLESQLQSQKRSHENEAEALRGEIQSLKEENNRQQQLLAQNLQLPPEARIEASLQHEITRLTNENLDLMEQLEKQDKTVRKLKKQLKVFAKKIGELEVGQMENISPGQIIDEPIRPVNIPRKEKDFQ--------GMLEYKREDEQKLVKNLILELKPRGVAVNLIP-GLPAYILFMCVRHADYLNDDQKVRSLLTSTINSIKKVLKKRGDDFETVSFWLSNTCRFLHCLKQYSGEEGFMKHNTSRQNEHCLTNFDLAEYRQVLSDLAIQIYQQLVR-VLENIL-QPMIVSGMLEHETIQGVSGVKPTGLRKRTSSIADEGTYTLDSILRQLNSFHSVMCQHGMDPELIKQVVKQMFYIVGAITLNNLLLRKDMCSWSKGMQIRYNVSQLEEWLRDKNLMNSGAKETLEPLIQAAQLLQVKKKTDDDAEAICSMCNALTTAQIVKVLNLYTPVNEFEERVSVSFIRTIQMRLR-DRKDSP---QLLMDAKHIFPVTFPFNPSSLALETIQIPASLGLG 1823          
BLAST of Dach-2 vs. Ensembl Mouse
Match: Myo5a (myosin VA [Source:MGI Symbol;Acc:MGI:105976])

HSP 1 Score: 1095.49 bits (2832), Expect = 0.000e+0
Identity = 710/1930 (36.79%), Postives = 1084/1930 (56.17%), Query Frame = 2
Query:   47 MALYEMYSKGVKIWIPDEESVWIGATVLQFHKEKN-VIKIITDNGISKELNLSSKKCA-PFLRNPDILIGQKDLTYLSYLNEPEVLYNLQIRFCERREIYTYCGIVLVAINPYQELSIYGKEIINAYHSQNSVDLDPHIFAVAENAFRRMSSFGENQSIIVSGESGAGKTVSAKYTMRYFALVGGSKTKQSFNLTETQIERKVLLSNPILEAFGNAKTIRNDNSSRFGKYLEILFNPRNQVIGANMCTYLLEKSRVVFQNLGERNYHIFYQIVTHCQSEDELLMNTGLVNNVEMYDYLRYGESLEIDGVDDSHEFLITKNSFLQLGIDLNKFKTICEILAAILHLGNIRFRFHDATDSSIIENPELLKLIAGLLGCSIDQLKIWLCFRTISTFQETLHKPLSKAEAQYFRDAFVKTLYSNLFDWIVKQANKVLSTDVSINIKKKLKKTIVVNQEDKKKFIAVLDIYGFETFAENSFEQFCINFANEKLQLQFNLHVFKLEQEEYMNEGLEWTFIDYYNNQPCIDLIESRXXXXXXXXXXXXXXXXSDENWCCKIYSHHLNKSANFNKPKLSNMVFIIEHFAGPVEYKCAGFIEKNRDSVLEEQINLLKASDVQLIAELFRDSEIEIFDTNNXXXXXXXXXXXXXXXXXXQ--ENTRKMKKTVGSQFRNSLKSLMDALNKTNPHYVRCIKPNDLKLPFTFCPERAVQQLRACGVLETIRLSAAGFPSRWTYSDFYHRYYILMSNFNVKNHDFKAGSQKIVETLITVPDAFRFGNTKLFFRPGQVALLEKLRGHKIESSVTLIQSILRGSIERKKYLIIHKLTVQIQTYIRRKLAIEKATKLSQIRAVIIIQSFYRMYLARKLFVKMKCAVLAIEKWRRKIITTRLKQAYKKENCVIICQAIVRRFIQRRKFLKIQRGVILIQNHYRRRKAKETLKILKIEARSINHIKFVNKGLENKIIELTQKLDTKEKEM-CXXXXXX--------XXXXXXXXXXXXXXXAESAKIYQNTVQDLQTEIIQLKKELNREIVEKNKI--FADKELLEINYKKKINYL-ENLIEE---LKSSPSVIEPNIICNGDEAQQSICQD--EHQKFI-----NEQMDHQKLVREYEKLEMKYENLYKEFLFVKSSNQKPSINYDNQTSNDSETESTFSKDDADVESLSDKVDAKTTKEHXXXXXXXXXXLPNFISESISTAGDLAVVMQLQMNISSLSQENNRLKETVQQFEDELLKYEQCAEDSKGLVIHNEYDNELLSIIKDIKGMDEHGLKSRLIDEVANLKKKL-KQSNEDYQKLRLHIFDGSMSKLTGNLDHESINSEEEELKRA-FESQKEANRK------------MLKEIEGIKANNVDLKKALFQIRKDKEQLQVQLGKQHLMIRHGVEYL----QNLK---------------LTPKERLDKFVQNEISRILLENLKLQ----------------------------ERNDQIISETIELKRGLKYFAFRLQKYEGSLVPNPNKEEDLLQLIQNVIYHSKMKTIGKRECYSEIGLIDLNMSELSIFIKSFIFDLSP-SICLQYEPYHLVPYIIFMVTRKFDFYKEEDQMTNFLSKLIVALKRTIRKRRNYIEYLVMLLSNVFCLVNLXXXXXXXXXXXXLNTAEDIQHYFVHYDLNEFIRLLKELCVTLFQMILKTIVDNLLPQSLCIDAILVHEAI--IDFLSKDGTKYKSNIETQPKNTSFNVLTKNLQSVLEILKNHKIPQLIINQIFVHIAYLINAYCLNTLLFRTDLCYFSKGLQIKYNLSSFETWIRYQKLIDSGALQCLRPMTEAVQLLQTLIDSDEDAKFVCDMCEYLNTRQVVKILNNFNPRDGYGCRLSSGLIAKIETQMKIKRGDEPSESKLETPTVIEIPIDIPFIHNGVSLCRTIIPKPLYLS 5566
            MA  E+Y+K  ++WIPD E VW  A +L+ +K  + V+ +  + G   E  L  K    P LRNPDIL+G+ DLT LSYL+EP VL+NL++RF + + IYTYCGIVLVAINPY++L IYG++IINAY  QN  D+DPHIFAVAE A+++M+    NQSIIVSGESGAGKTVSAKY MRYFA V GS        +E  +E KVL SNPI+E+ GNAKT RNDNSSRFGKY+EI F+ R ++IGANM TYLLEKSRVVFQ   ERNYHIFYQ+    +  +  ++  G   N + + Y + G S  I+GVDD+ E   T+ +   LGI  +    I  ILA ILHLGN+ F   D+   +I    E L +   L+G   +++  WLC R ++T  ET  KP+SK +A   RDA  K +Y+ LF+WIV   N+ L + V                  +  FI VLDIYGFETF  NSFEQFCIN+ANEKLQ QFN+HVFKLEQEEYM E + WT ID+Y+NQPCI+LIES+LG+LDLLDEECK+ KG+D+ W  K+Y+ HLNK A F KP++SN  FII+HFA  VEY+C GF+EKN+D+V EEQI +LK+S  +++ ELF+D E  I  T+ +    +  +      +  +  +  ++ KKTVG QFRNSL  LM+ LN T PHYVRCIKPND K PFTF  +RAVQQLRACGVLETIR+SAAGFPSRWTY +F+ RY +LM   +V   D K   + ++E LI   D ++FG TK+FFR GQVA LEKLR  K+ ++   IQ  +RG + RK+YL + +  + +Q Y+R   A   A  L + +A   IQ ++RMY+ R+ +   + A + I+ + R  +T    +   +E   +I Q  VR ++ R  + +  + ++ +Q  +RR  AK  LK LKIEARS+   K ++ G+ENKI++L +K+D + K+  CL++             EK    +       E AK+    V  LQ EI +L+K+L +   EK  I   ADK      YK++ + L  NL EE   LK     +   I+    E  +++ +   E  K +     +E++ +Q L+ E+ +LE +Y++L KE + +  +  KP     + T + +E+E TFS + A+ E ++ + +    K+                        D+++ ++LQ  ++ L QE   +++ + + E+++ +  +  E+ +  +   E + E L      K  +      +L +E+  L+K L ++S  +        +   M +LT   +   +  EE  + R+   SQKEA +             +L++++ +K +  ++ +A   +++    L+ QL  Q     +  E L    Q+LK               L P+ R++  +Q+EI+R+  ENL  +                            E+ D+ +    +LK+ LK FA ++ + E   + N +  + + + I+ V    K K           G+++    +    +K+ I +L P  + +   P  L  YI+FM  R  D+  ++ ++ + L+  I ++K+ ++KR +  E +   LSN    ++  +QYSG + F   NT+   +H   ++DL E+ ++L +L + ++Q +++ +++N+L Q + +  +L HE I  +  +   G + +++        + + + + L S   ++  H +   +I Q+   + Y++ A  LN LL R D+C +SKG+QI+YN+S  E W+R + L++SGA + L P+ +A QLLQ    +D+DA+ +C MC  L T Q+VK+LN + P + +  R+S   I  I+ +++  R D P   +L        P+  PF  + ++L    IP  L L 
Sbjct:    1 MAASELYTKFARVWIPDPEEVWKSAELLKDYKPGDKVLLLHLEEGKDLEYRLDPKTGELPHLRNPDILVGENDLTALSYLHEPAVLHNLRVRFIDSKLIYTYCGIVLVAINPYEQLPIYGEDIINAYSGQNMGDMDPHIFAVAEEAYKQMARDERNQSIIVSGESGAGKTVSAKYAMRYFATVSGSA-------SEANVEEKVLASNPIMESIGNAKTTRNDNSSRFGKYIEIGFDKRYRIIGANMRTYLLEKSRVVFQAEEERNYHIFYQLCASAKLPEFKMLRLG---NADSFHYTKQGGSPMIEGVDDAKEMAHTRQACTLLGISESYQMGIFRILAGILHLGNVGFASRDSDSCTIPPKHEPLTIFCDLMGVDYEEMCHWLCHRKLATATETYIKPISKLQATNARDALAKHIYAKLFNWIVDHVNQALHSAVK-----------------QHSFIGVLDIYGFETFEINSFEQFCINYANEKLQQQFNMHVFKLEQEEYMKEQIPWTLIDFYDNQPCINLIESKLGILDLLDEECKMPKGTDDTWAQKLYNTHLNKCALFEKPRMSNKAFIIKHFADKVEYQCEGFLEKNKDTVFEEQIKVLKSSKFKMLPELFQDDEKAISPTSATSSGRTPLTRVPVKPTKGRPGQTAKEHKKTVGHQFRNSLHLLMETLNATTPHYVRCIKPNDFKFPFTFDEKRAVQQLRACGVLETIRISAAGFPSRWTYQEFFSRYRVLMKQKDVLG-DRKQTCKNVLEKLILDKDKYQFGKTKIFFRAGQVAYLEKLRADKLRAACIRIQKTIRGWLLRKRYLCMQRAAITVQRYVRGYQARCYAKFLRRTKAATTIQKYWRMYVVRRRYKIRRAATIVIQSYLRGYLTRNRYRKILREYKAVIIQKRVRGWLARTHYKRTMKAIVYLQCCFRRMMAKRELKKLKIEARSVERYKKLHIGMENKIMQLQRKVDEQNKDYKCLMEKLTNLEGVYNSETEKLRNDVERLQLSEEEAKVATGRVLSLQEEIAKLRKDLEQTRSEKKSIEERADK------YKQETDQLVSNLKEENTLLKQEKETLNHRIVEQAKEMTETMERKLVEETKQLELDLNDERLRYQNLLNEFSRLEERYDDL-KEEMTLMLNVPKPGHKRTDSTHSSNESEYTFSSEFAETEDIAPRTEEPIEKK---------------------VPLDMSLFLKLQKRVTELEQEKQLMQDELDRKEEQVFR-SKAKEEERPQIRGAELEYESL------KRQELESENKKLKNELNELRKALSEKSAPEVTAPGAPAYRVLMEQLTSVSEELDVRKEEVLILRSQLVSQKEAIQPKDDKNTMTDSTILLEDVQKMK-DKGEIAQAYIGLKETNRLLESQLQSQKRSHENEAEALRGEIQSLKEENNRQQQLLAQNLQLPPEARIEASLQHEITRLTNENLYFEELYADDPKKYQSYRISLYKRMIDLMEQLEKQDKTVR---KLKKQLKVFAKKIGELEVGQMENISPGQIIDEPIRPVNIPRKEKDFQ--------GMLEYKREDEQKLVKNLILELKPRGVAVNLIP-GLPAYILFMCVRHADYLNDDQKVRSLLTSTINSIKKVLKKRGDDFETVSFWLSNTCRFLHCLKQYSGEEGFMKHNTSRQNEHCLTNFDLAEYRQVLSDLAIQIYQQLVR-VLENIL-QPMIVSGMLEHETIQGVSGVKPTGLRKRTSSIADEGTYTLDSILRQLNSFHSVMCQHGMDPELIKQVVKQMFYIVGAITLNNLLLRKDMCSWSKGMQIRYNVSQLEEWLRDKNLMNSGAKETLEPLIQAAQLLQVKKKTDDDAEAICSMCNALTTAQIVKVLNLYTPVNEFEERVSVSFIRTIQMRLR-DRKDSP---QLLMDAKHIFPVTFPFNPSSLALETIQIPASLGLG 1848          
BLAST of Dach-2 vs. Ensembl Mouse
Match: Myo5b (myosin VB [Source:MGI Symbol;Acc:MGI:106598])

HSP 1 Score: 1094.34 bits (2829), Expect = 0.000e+0
Identity = 713/1902 (37.49%), Postives = 1081/1902 (56.83%), Query Frame = 2
Query:   47 MALYEMYSKGVKIWIPDEESVWIGATVLQFHKEKN---VIKIITDNGISKELNLSSKKCAPFLRNPDILIGQKDLTYLSYLNEPEVLYNLQIRFCERREIYTYCGIVLVAINPYQELSIYGKEIINAYHSQNSVDLDPHIFAVAENAFRRMSSFGENQSIIVSGESGAGKTVSAKYTMRYFALVGGSKTKQSFNLTETQIERKVLLSNPILEAFGNAKTIRNDNSSRFGKYLEILFNPRNQVIGANMCTYLLEKSRVVFQNLGERNYHIFYQIVTHCQSEDELLMNTGLVNNVEMYDYLRYGESLEIDGVDDSHEFLITKNSFLQLGIDLNKFKTICEILAAILHLGNIRFRFHDATDS-SIIENPELLKLIAGLLGCSIDQLKIWLCFRTISTFQETLHKPLSKAEAQYFRDAFVKTLYSNLFDWIVKQANKVLSTDVSINIKKKLKKTIVVNQEDKKKFIAVLDIYGFETFAENSFEQFCINFANEKLQLQFNLHVFKLEQEEYMNEGLEWTFIDYYNNQPCIDLIESRXXXXXXXXXXXXXXXXSDENWCCKIYSHHLNKSANFNKPKLSNMVFIIEHFAGPVEYKCAGFIEKNRDSVLEEQINLLKASDVQLIAELFRDSEIEIFDTNNXXXXXXXXXXXXXXXXXXQENTRKMKKTVGSQFRNSLKSLMDALNKTNPHYVRCIKPNDLKLPFTFCPERAVQQLRACGVLETIRLSAAGFPSRWTYSDFYHRYYILMSNFNVKNHDFKAGSQKIVETLITVPDAFRFGNTKLFFRPGQVALLEKLRGHKIESSVTLIQSILRGSIERKKYLIIHKLTVQIQTYIRRKLAIEKATKLSQIRAVIIIQSFYRMYLARKLFVKMKCAVLAIEKWRRKIITTRLKQAYKKENCVIICQAIVRRFIQRRKFLKIQRGVILIQNHYRRRKAKETLKILKIEARSINHIKFVNKGLENKIIELTQKLDTKEKEMCXXXXXXXXXXXXXXXXXXXXXAESAKIYQNTVQD----LQTEIIQLKKELNREIVEKNKIFAD---KELLEINYKKKINYLENLIEELKSSPSVIEPNIICNGD-EAQQSICQDE---HQKFINEQMDHQKLVREYEKLEMKYENLYKEFLFVKSSNQKPSINYDNQTSNDSETESTFSKDDADVESLSDKVDAKTTKEHXXXXXXXXXXLPNFISESISTAGDLAVVMQLQMNISSLSQENNRLKETVQQFEDELLKYEQCAEDSKGLVIHNEYD----------------------NELLSIIKDIKGMDEHGLKSRLIDEVANLKKKLKQSNEDYQK-------LRLHIFDGSMSKLTGNLDHESINS-----------EEEELKRAFESQKEANRKMLKEIEGIKANNVDLKKALFQIRKDKEQLQVQLGKQHLMIRHGVEYLQNLKLTPKERLDKFVQNEISRILLENLKLQERNDQIISETIELKRGLKYFAFRLQKYEG--SLVPNPNKEEDLLQLIQNVIYHSKMKTIGKRECYSEIGLIDLNMSELSIFIKSFIFDLSPSICLQYEPYHLVPYIIFMVTRKFDFYKEEDQMTNFLSKLIVALKRTIRKRRNYIEYLVMLLSNVFCLVNLXXXXXXXXXXXXLNTAEDIQHYFVHYDLNEFIRLLKELCVTLFQMILKTIVDNLLPQSLCIDAILVHEAI--IDFLSKDGTKYKSNIETQPKNT-SFNVLTKNLQSVLEILKNHKIPQLIINQIFVHIAYLINAYCLNTLLFRTDLCYFSKGLQIKYNLSSFETWIRYQKLIDSGALQCLRPMTEAVQLLQTLIDSDEDAKFVCDMCEYLNTRQVVKILNNFNPRDGYGCRLSSGLIAKIETQMKIKRGDEPSESKLETPTVIEIPIDIPFIHNGVSLCRTIIPKPLYLSCL 5572
            M+  E+Y++  ++WIPD + VW  A + + +KE +    +++  D  +   +++ + +  PFLRNPDIL+G+ DLT LS+L+EP VL+NL++RF E   IYTYCGIVLVAINPY++L IYG+++I AY  QN  D+DPHIFAVAE A+++M+   +NQSIIVSGESGAGKTVSAKY MRYFA VGGS +       +T IE KVL S+PI+EA GNAKT RNDNSSRFGK++EI F+ +  +IGANM TYLLEKSRVVFQ   ERNYHIFYQ+   C +          +   E + Y  +G +  I+GV+D+ +F  T+ +   LG+  +   +I +I+A+ILHLG++  +     DS SI    E L     LLG    Q++ WLC R + T  ET  K +S  +    RDA  K +Y+ LF WIV+  NK L T +                  +  FI VLDIYGFETF  NSFEQFCIN+ANEKLQ QFN HVFKLEQEEYM E + WT ID+Y+NQPCIDLIE++LG+LDLLDEECK+ KG+D+NW  K+Y  H N S +F KP++SN  FI+ HFA  VEY   GF+EKNRD+V EEQIN+LKAS   L+A+LF D +     TN +K + S K + +S   + +   ++ KK+VG QFR SL  LM+ LN T PHYVRCIKPND KLPF F P+RAVQQLRACGVLETIR+SAAG+PSRWTY DF++RY +LM    + N D K   + ++E+LI  PD F+FG TK+FFR GQVA LEKLR  K   +  +IQ  +RG ++R KY  +   T+ +Q + R  LA   A  L + RA I+ Q  YRM  AR+ + ++  A + I+ + R +   R  +    E+   I Q   R ++ R++FL+ +   I+IQ  +RR KA++ LK LKIEARS  H+K +N G+ENK+++L +K+D + KE   +  QL        + ++  + E A   QN   D    LQ E+  L+ EL +   E+ ++  D   KE  E+  +K++  LE+    LK     +   I+C    E+ QS  ++     ++   E+  +Q LV+EY +LE +YENL  E        Q P   +    SN S  ES  +        + D  DA    E +                    A D+ V ++LQ  +  L QE  +L+  +++ + +  K  Q  + + GL +  + D                      NEL   + D + M ++   S   D  + L  +LK +NE+ +        LR  I +    +L+G     +IN+           ++E+   A+    + NR +  +++   A +++ ++ +  ++   E L+ ++ KQ         + Q L L+P+ +++  VQ EISR+  ENL  +E  +++     +LK+ LK +  ++Q  E   +L  +  +  +L + +          T+ ++E   + G+++ +  + ++ I++ + DL P +     P  L  YI++M  R  D+  ++ ++ + LS  I  +K+ ++K  +  E     LSN    ++  +QYSG + F   NTA+  +H   ++DL E+ ++L +L + ++Q ++K I + LL Q + + A+L +E+I  +  +   G + +S+     +N+     + + + S   +L +  +   II Q+F  + Y+INA  LN LL R D C +S G+Q++YN+S  E W+R + L  SGA+Q + P+ +A QLLQ    + EDA+ +C +C  L+T+Q+VKILN + P + +  R++   I  I+ Q++ +R D P +  L++  V   P+  P+  + +++    IP  L L  L
Sbjct:    1 MSYSELYTRYTRVWIPDPDEVWRSAELTKDYKEGDKSLQLRLEDDTILEYPVDVQNNQ-VPFLRNPDILVGENDLTALSHLHEPAVLHNLKVRFLESNHIYTYCGIVLVAINPYEQLPIYGQDVIYAYSGQNMGDMDPHIFAVAEEAYKQMARDEKNQSIIVSGESGAGKTVSAKYAMRYFATVGGSAS-------DTNIEEKVLASSPIMEAIGNAKTTRNDNSSRFGKFIEIGFDKKYHIIGANMRTYLLEKSRVVFQADDERNYHIFYQL---CAAASLPEFKELALTCAEDFFYTAHGGNTTIEGVNDADDFEKTRQALTLLGVRDSHQISIFKIIASILHLGSVEIQSERDGDSCSISPQDEHLSNFCSLLGIEHSQMEHWLCHRKLVTTSETYVKTMSLQQVVNARDALAKHIYAQLFSWIVEHINKALHTSLK-----------------QHSFIGVLDIYGFETFEINSFEQFCINYANEKLQQQFNSHVFKLEQEEYMKEQIPWTLIDFYDNQPCIDLIEAKLGILDLLDEECKVPKGTDQNWAQKLYERHSN-SQHFQKPRMSNTAFIVNHFADKVEYLSDGFLEKNRDTVYEEQINILKASKFPLVADLFHDDKDSAPATNTAKNRSSSKINVRSSRPLIKVPNKEHKKSVGYQFRTSLNLLMETLNATTPHYVRCIKPNDEKLPFHFDPKRAVQQLRACGVLETIRISAAGYPSRWTYHDFFNRYRVLMKKRELTNTDKKNICKSVLESLIKDPDKFQFGRTKIFFRAGQVAYLEKLRADKFREATIMIQKSVRGWLQRVKYRRLRAATLSLQRFCRGYLARRLAEHLRRTRAAIVFQKQYRMLKARRAYRRVCRATVIIQSFTRAMFVRRNYRQVLMEHKATIIQKYARGWMARKRFLRERDAAIVIQCAFRRLKARQELKALKIEARSAEHLKRLNVGMENKVVQLQRKIDDQNKEFKTLSEQLSAVTSSHAVEVEKLKKELAHYQQNQEADTSLQLQEEVQSLRTELQKAHSER-RVLEDAHNKENGEL--RKRVADLEHENALLKDEKEYLNNQILCQSKAESSQSSVEENLLMKKELEEERSRYQNLVKEYSQLEQRYENLRDE--------QTPG--HRKNPSNQSSLESDSNYPSISTSEIGDTEDALQQVEEIGIE---------------KAAMDMTVFLKLQKRVRELEQERKKLQAQLEKGQQD-SKKGQVEQQNNGLDVDQDADIAYNSLKRQELESENKKLKNDLNELRKAVAD-QAMQDNSTHSS-PDSYSLLLNQLKLANEELEVRKEEVLILRTQIMNADQRRLSGKNMEPNINARTSWPNSEKHVDQEDAIEAYHGVCQTNRLLEAQLQ---AQSLEHEEEVEHLKAQVEALKEEMDKQQQT------FCQTLLLSPEAQVEFGVQQEISRLTNENLDFKELVEKLEKNERKLKKQLKIYMKKVQDLEAAQALAQSDRRHHELTRQV----------TVQRKEKDFQ-GMLEYHKEDEALLIRNLVTDLKPQMLSGTVPC-LPAYILYMCIRHADYTNDDLKVHSLLSSTINGIKKVLKKHNDDFEMTSFWLSNTCRFLHCLKQYSGDEGFMTQNTAKQNEHCLKNFDLTEYRQVLSDLSIQIYQQLIK-IAEGLL-QPMIVSAMLENESIQGLSGVRPTGYRKRSSSMVDGENSYCLEAIVRQMNSFHTVLCDQGLDPEIILQVFKQLFYMINAVTLNNLLLRKDACSWSTGMQLRYNISQLEEWLRGKNLHQSGAVQTMEPLIQAAQLLQLKKKTHEDAEAICSLCTSLSTQQIVKILNLYTPLNEFEERVTVSFIRTIQAQLQ-ERND-PQQLLLDSKHV--FPVLFPYNPSALTMDSIHIPACLNLEFL 1815          
BLAST of Dach-2 vs. Ensembl Mouse
Match: Myo5b (myosin VB [Source:MGI Symbol;Acc:MGI:106598])

HSP 1 Score: 1087.4 bits (2811), Expect = 0.000e+0
Identity = 717/1921 (37.32%), Postives = 1078/1921 (56.12%), Query Frame = 2
Query:   47 MALYEMYSKGVKIWIPDEESVWIGATVLQFHKEKN---VIKIITDNGISKELNLSSKKCAPFLRNPDILIGQKDLTYLSYLNEPEVLYNLQIRFCERREIYTYCGIVLVAINPYQELSIYGKEIINAYHSQNSVDLDPHIFAVAENAFRRMSSFGENQSIIVSGESGAGKTVSAKYTMRYFALVGGSKTKQSFNLTETQIERKVLLSNPILEAFGNAKTIRNDNSSRFGKYLEILFNPRNQVIGANMCTYLLEKSRVVFQNLGERNYHIFYQIVTHCQSEDELLMNTGLVNNVEMYDYLRYGESLEIDGVDDSHEFLITKNSFLQLGIDLNKFKTICEILAAILHLGNIRFRFHDATDS-SIIENPELLKLIAGLLGCSIDQLKIWLCFRTISTFQETLHKPLSKAEAQYFRDAFVKTLYSNLFDWIVKQANKVLSTDVSINIKKKLKKTIVVNQEDKKKFIAVLDIYGFETFAENSFEQFCINFANEKLQLQFNLHVFKLEQEEYMNEGLEWTFIDYYNNQPCIDLIESRXXXXXXXXXXXXXXXXSDENWCCKIYSHHLNKSANFNKPKLSNMVFIIEHFAGPVEYKCAGFIEKNRDSVLEEQINLLKASDVQLIAELFRDSEIEIFDTNNXXXXXXXXXXXXXXXXXXQENTRKMKKTVGSQFRNSLKSLMDALNKTNPHYVRCIKPNDLKLPFTFCPERAVQQLRACGVLETIRLSAAGFPSRWTYSDFYHRYYILMSNFNVKNHDFKAGSQKIVETLITVPDAFRFGNTKLFFRPGQVALLEKLRGHKIESSVTLIQSILRGSIERKKYLIIHKLTVQIQTYIRRKLAIEKATKLSQIRAVIIIQSFYRMYLARKLFVKMKCAVLAIEKWRRKIITTRLKQAYKKENCVIICQAIVRRFIQRRKFLKIQRGVILIQNHYRRRKAKETLKILKIEARSINHIKFVNKGLENKIIELTQKLDTKEKEMCXXXXXXXXXXXXXXXXXXXXXAESAKIYQNTVQD----LQTEIIQLKKELNREIVEKNKIFAD---KELLEINYKKKINYLENLIEELKSSPSVIEPNIICNGD-EAQQSICQDE---HQKFINEQMDHQKLVREYEKLEMKYENLYKEFLFVKSSNQKPSINYDNQTSNDSETESTFSKDDADVESLSDKVDAKTTKEHXXXXXXXXXXLPNFISESISTAGDLAVVMQLQMNISSLSQENNRLKETVQQFEDELLKYEQCAEDSKGLVIHNEYD----------------------NELLSIIKDIKGMDEHGLKSRLIDEVANLKKKLKQSNEDYQK-------LRLHIFDGSMSKLTGNLDHESINS-----------EEEELKRAFESQKEANRKMLKEIEGIKANNVDLKKALFQIRKDKEQLQVQLGKQHL-------------------MIRHGVEYLQNLKLTPKERLDKFVQNEISRILLENLKLQERNDQIISETIELKRGLKYFAFRLQKYEG--SLVPNPNKEEDLLQLIQNVIYHSKMKTIGKRECYSEIGLIDLNMSELSIFIKSFIFDLSPSICLQYEPYHLVPYIIFMVTRKFDFYKEEDQMTNFLSKLIVALKRTIRKRRNYIEYLVMLLSNVFCLVNLXXXXXXXXXXXXLNTAEDIQHYFVHYDLNEFIRLLKELCVTLFQMILKTIVDNLLPQSLCIDAILVHEAI--IDFLSKDGTKYKSNIETQPKNT-SFNVLTKNLQSVLEILKNHKIPQLIINQIFVHIAYLINAYCLNTLLFRTDLCYFSKGLQIKYNLSSFETWIRYQKLIDSGALQCLRPMTEAVQLLQTLIDSDEDAKFVCDMCEYLNTRQVVKILNNFNPRDGYGCRLSSGLIAKIETQMKIKRGDEPSESKLETPTVIEIPIDIPFIHNGVSLCRTIIPKPLYLSCL 5572
            M+  E+Y++  ++WIPD + VW  A + + +KE +    +++  D  +   +++ + +  PFLRNPDIL+G+ DLT LS+L+EP VL+NL++RF E   IYTYCGIVLVAINPY++L IYG+++I AY  QN  D+DPHIFAVAE A+++M+   +NQSIIVSGESGAGKTVSAKY MRYFA VGGS +       +T IE KVL S+PI+EA GNAKT RNDNSSRFGK++EI F+ +  +IGANM TYLLEKSRVVFQ   ERNYHIFYQ+   C +          +   E + Y  +G +  I+GV+D+ +F  T+ +   LG+  +   +I +I+A+ILHLG++  +     DS SI    E L     LLG    Q++ WLC R + T  ET  K +S  +    RDA  K +Y+ LF WIV+  NK L T +                  +  FI VLDIYGFETF  NSFEQFCIN+ANEKLQ QFN HVFKLEQEEYM E + WT ID+Y+NQPCIDLIE++LG+LDLLDEECK+ KG+D+NW  K+Y  H N S +F KP++SN  FI+ HFA  VEY   GF+EKNRD+V EEQIN+LKAS   L+A+LF D +     TN +K + S K + +S   + +   ++ KK+VG QFR SL  LM+ LN T PHYVRCIKPND KLPF F P+RAVQQLRACGVLETIR+SAAG+PSRWTY DF++RY +LM    + N D K   + ++E+LI  PD F+FG TK+FFR GQVA LEKLR  K   +  +IQ  +RG ++R KY  +   T+ +Q + R  LA   A  L + RA I+ Q  YRM  AR+ + ++  A + I+ + R +   R  +    E+   I Q   R ++ R++FL+ +   I+IQ  +RR KA++ LK LKIEARS  H+K +N G+ENK+++L +K+D + KE   +  QL        + ++  + E A   QN   D    LQ E+  L+ EL +   E+ ++  D   KE  E+  +K++  LE+    LK     +   I+C    E+ QS  ++     ++   E+  +Q LV+EY +LE +YENL  E        Q P   +    SN S  ES  +        + D  DA    E +                    A D+ V ++LQ  +  L QE  +L+  +++ + +  K  Q  + + GL +  + D                      NEL   + D + M ++   S   D  + L  +LK +NE+ +        LR  I +    +L+G     +IN+           ++E+   A+    + N +   E  G    + +L  A   +++    L+ QL  Q L                   M +    + Q L L+P+ +++  VQ EISR+  ENL  +E  +++     +LK+ LK +  ++Q  E   +L  +  +  +L + +          T+ ++E   + G+++ +  + ++ I++ + DL P +     P  L  YI++M  R  D+  ++ ++ + LS  I  +K+ ++K  +  E     LSN    ++  +QYSG + F   NTA+  +H   ++DL E+ ++L +L + ++Q ++K I + LL Q + + A+L +E+I  +  +   G + +S+     +N+     + + + S   +L +  +   II Q+F  + Y+INA  LN LL R D C +S G+Q++YN+S  E W+R + L  SGA+Q + P+ +A QLLQ    + EDA+ +C +C  L+T+Q+VKILN + P + +  R++   I  I+ Q++ +R D P +  L++  V   P+  P+  + +++    IP  L L  L
Sbjct:    1 MSYSELYTRYTRVWIPDPDEVWRSAELTKDYKEGDKSLQLRLEDDTILEYPVDVQNNQV-PFLRNPDILVGENDLTALSHLHEPAVLHNLKVRFLESNHIYTYCGIVLVAINPYEQLPIYGQDVIYAYSGQNMGDMDPHIFAVAEEAYKQMARDEKNQSIIVSGESGAGKTVSAKYAMRYFATVGGSAS-------DTNIEEKVLASSPIMEAIGNAKTTRNDNSSRFGKFIEIGFDKKYHIIGANMRTYLLEKSRVVFQADDERNYHIFYQL---CAAASLPEFKELALTCAEDFFYTAHGGNTTIEGVNDADDFEKTRQALTLLGVRDSHQISIFKIIASILHLGSVEIQSERDGDSCSISPQDEHLSNFCSLLGIEHSQMEHWLCHRKLVTTSETYVKTMSLQQVVNARDALAKHIYAQLFSWIVEHINKALHTSLK-----------------QHSFIGVLDIYGFETFEINSFEQFCINYANEKLQQQFNSHVFKLEQEEYMKEQIPWTLIDFYDNQPCIDLIEAKLGILDLLDEECKVPKGTDQNWAQKLYERHSN-SQHFQKPRMSNTAFIVNHFADKVEYLSDGFLEKNRDTVYEEQINILKASKFPLVADLFHDDKDSAPATNTAKNRSSSKINVRSSRPLIKVPNKEHKKSVGYQFRTSLNLLMETLNATTPHYVRCIKPNDEKLPFHFDPKRAVQQLRACGVLETIRISAAGYPSRWTYHDFFNRYRVLMKKRELTNTDKKNICKSVLESLIKDPDKFQFGRTKIFFRAGQVAYLEKLRADKFREATIMIQKSVRGWLQRVKYRRLRAATLSLQRFCRGYLARRLAEHLRRTRAAIVFQKQYRMLKARRAYRRVCRATVIIQSFTRAMFVRRNYRQVLMEHKATIIQKYARGWMARKRFLRERDAAIVIQCAFRRLKARQELKALKIEARSAEHLKRLNVGMENKVVQLQRKIDDQNKEFKTLSEQLSAVTSSHAVEVEKLKKELAHYQQNQEADTSLQLQEEVQSLRTELQKAHSER-RVLEDAHNKENGEL--RKRVADLEHENALLKDEKEYLNNQILCQSKAESSQSSVEENLLMKKELEEERSRYQNLVKEYSQLEQRYENLRDE--------QTPG--HRKNPSNQSSLESDSNYPSISTSEIGDTEDALQQVEEIGIE---------------KAAMDMTVFLKLQKRVRELEQERKKLQAQLEKGQQD-SKKGQVEQQNNGLDVDQDADIAYNSLKRQELESENKKLKNDLNELRKAVAD-QAMQDNSTHSS-PDSYSLLLNQLKLANEELEVRKEEVLILRTQIMNADQRRLSGKNMEPNINARTSWPNSEKHVDQEDAIEAYHGVCQTNSQT--EDWGYLNEDGELGLAYQGLKQVARLLEAQLQAQSLEHEEEVEHLKAQVEALKEEMDKQQQTFCQTLLLSPEAQVEFGVQQEISRLTNENLDFKELVEKLEKNERKLKKQLKIYMKKVQDLEAAQALAQSDRRHHELTRQV----------TVQRKEKDFQ-GMLEYHKEDEALLIRNLVTDLKPQMLSGTVPC-LPAYILYMCIRHADYTNDDLKVHSLLSSTINGIKKVLKKHNDDFEMTSFWLSNTCRFLHCLKQYSGDEGFMTQNTAKQNEHCLKNFDLTEYRQVLSDLSIQIYQQLIK-IAEGLL-QPMIVSAMLENESIQGLSGVRPTGYRKRSSSMVDGENSYCLEAIVRQMNSFHTVLCDQGLDPEIILQVFKQLFYMINAVTLNNLLLRKDACSWSTGMQLRYNISQLEEWLRGKNLHQSGAVQTMEPLIQAAQLLQLKKKTHEDAEAICSLCTSLSTQQIVKILNLYTPLNEFEERVTVSFIRTIQAQLQ-ERND-PQQLLLDSKHV--FPVLFPYNPSALTMDSIHIPACLNLEFL 1841          
BLAST of Dach-2 vs. Ensembl Mouse
Match: Myo5a (myosin VA [Source:MGI Symbol;Acc:MGI:105976])

HSP 1 Score: 932.939 bits (2410), Expect = 0.000e+0
Identity = 542/1241 (43.67%), Postives = 760/1241 (61.24%), Query Frame = 2
Query:   47 MALYEMYSKGVKIWIPDEESVWIGATVLQFHKEKN-VIKIITDNGISKELNLSSKKCA-PFLRNPDILIGQKDLTYLSYLNEPEVLYNLQIRFCERREIYTYCGIVLVAINPYQELSIYGKEIINAYHSQNSVDLDPHIFAVAENAFRRMSSFGENQSIIVSGESGAGKTVSAKYTMRYFALVGGSKTKQSFNLTETQIERKVLLSNPILEAFGNAKTIRNDNSSRFGKYLEILFNPRNQVIGANMCTYLLEKSRVVFQNLGERNYHIFYQIVTHCQSEDELLMNTGLVNNVEMYDYLRYGESLEIDGVDDSHEFLITKNSFLQLGIDLNKFKTICEILAAILHLGNIRFRFHDATDSSIIENPELLKLIAGLLGCSIDQLKIWLCFRTISTFQETLHKPLSKAEAQYFRDAFVKTLYSNLFDWIVKQANKVLSTDVSINIKKKLKKTIVVNQEDKKKFIAVLDIYGFETFAENSFEQFCINFANEKLQLQFNLHVFKLEQEEYMNEGLEWTFIDYYNNQPCIDLIESRXXXXXXXXXXXXXXXXSDENWCCKIYSHHLNKSANFNKPKLSNMVFIIEHFAGPVEYKCAGFIEKNRDSVLEEQINLLKASDVQLIAELFRDSEIEIFDTNNXXXXXXXXXXXXXXXXXXQ--ENTRKMKKTVGSQFRNSLKSLMDALNKTNPHYVRCIKPNDLKLPFTFCPERAVQQLRACGVLETIRLSAAGFPSRWTYSDFYHRYYILMSNFNVKNHDFKAGSQKIVETLITVPDAFRFGNTKLFFRPGQVALLEKLRGHKIESSVTLIQSILRGSIERKKYLIIHKLTVQIQTYIRRKLAIEKATKLSQIRAVIIIQSFYRMYLARKLFVKMKCAVLAIEKWRRKIITTRLKQAYKKENCVIICQAIVRRFIQRRKFLKIQRGVILIQNHYRRRKAKETLKILKIEARSINHIKFVNKGLENKIIELTQKLDTKEKEM-CXXXXXX--------XXXXXXXXXXXXXXXAESAKIYQNTVQDLQTEIIQLKKELNREIVEKNKI--FADKELLEINYKKKINYL-ENLIEE---LKSSPSVIEPNIICNGDEAQQSICQD--EHQKFI-----NEQMDHQKLVREYEKLEMKYENLYKEFLFVKSSNQKPSINYDNQTSNDSETESTFSKDDADVESLSDKVDAKTTKEHXXXXXXXXXXLPNFISESISTAGDLAVVMQLQMNISSLSQENNRLKETVQQFEDELLK 3691
            MA  E+Y+K  ++WIPD E VW  A +L+ +K  + V+ +  + G   E  L  K    P LRNPDIL+G+ DLT LSYL+EP VL+NL++RF + + IYTYCGIVLVAINPY++L IYG++IINAY  QN  D+DPHIFAVAE A+++M+    NQSIIVSGESGAGKTVSAKY MRYFA V GS        +E  +E KVL SNPI+E+ GNAKT RNDNSSRFGKY+EI F+ R ++IGANM TYLLEKSRVVFQ   ERNYHIFYQ+    +  +  ++  G   N + + Y + G S  I+GVDD+ E   T+ +   LGI  +    I  ILA ILHLGN+ F   D+   +I    E L +   L+G   +++  WLC R ++T  ET  KP+SK +A   RDA  K +Y+ LF+WIV   N+ L + V                  +  FI VLDIYGFETF  NSFEQFCIN+ANEKLQ QFN+HVFKLEQEEYM E + WT ID+Y+NQPCI+LIES+LG+LDLLDEECK+ KG+D+ W  K+Y+ HLNK A F KP++SN  FII+HFA  VEY+C GF+EKN+D+V EEQI +LK+S  +++ ELF+D E  I  T+ +    +  +      +  +  +  ++ KKTVG QFRNSL  LM+ LN T PHYVRCIKPND K PFTF  +RAVQQLRACGVLETIR+SAAGFPSRWTY +F+ RY +LM   +V   D K   + ++E LI   D ++FG TK+FFR GQVA LEKLR  K+ ++   IQ  +RG + RK+YL + +  + +Q Y+R   A   A  L + +A   IQ ++RMY+ R+ +   + A + I+ + R  +T    +   +E   +I Q  VR ++ R  + +  + ++ +Q  +RR  AK  LK LKIEARS+   K ++ G+ENKI++L +K+D + K+  CL++             EK    +       E AK+    V  LQ EI +L+K+L +   EK  I   ADK      YK++ + L  NL EE   LK     +   I+    E  +++ +   E  K +     +E++ +Q L+ E+ +LE +Y++L KE + +  +  KP     + T + +E+E TFS + A+ E ++ + +    K+                        D+++ ++LQ  ++ L QE   +++ + + E+++ +
Sbjct:    1 MAASELYTKFARVWIPDPEEVWKSAELLKDYKPGDKVLLLHLEEGKDLEYRLDPKTGELPHLRNPDILVGENDLTALSYLHEPAVLHNLRVRFIDSKLIYTYCGIVLVAINPYEQLPIYGEDIINAYSGQNMGDMDPHIFAVAEEAYKQMARDERNQSIIVSGESGAGKTVSAKYAMRYFATVSGSA-------SEANVEEKVLASNPIMESIGNAKTTRNDNSSRFGKYIEIGFDKRYRIIGANMRTYLLEKSRVVFQAEEERNYHIFYQLCASAKLPEFKMLRLG---NADSFHYTKQGGSPMIEGVDDAKEMAHTRQACTLLGISESYQMGIFRILAGILHLGNVGFASRDSDSCTIPPKHEPLTIFCDLMGVDYEEMCHWLCHRKLATATETYIKPISKLQATNARDALAKHIYAKLFNWIVDHVNQALHSAVK-----------------QHSFIGVLDIYGFETFEINSFEQFCINYANEKLQQQFNMHVFKLEQEEYMKEQIPWTLIDFYDNQPCINLIESKLGILDLLDEECKMPKGTDDTWAQKLYNTHLNKCALFEKPRMSNKAFIIKHFADKVEYQCEGFLEKNKDTVFEEQIKVLKSSKFKMLPELFQDDEKAISPTSATSSGRTPLTRVPVKPTKGRPGQTAKEHKKTVGHQFRNSLHLLMETLNATTPHYVRCIKPNDFKFPFTFDEKRAVQQLRACGVLETIRISAAGFPSRWTYQEFFSRYRVLMKQKDVLG-DRKQTCKNVLEKLILDKDKYQFGKTKIFFRAGQVAYLEKLRADKLRAACIRIQKTIRGWLLRKRYLCMQRAAITVQRYVRGYQARCYAKFLRRTKAATTIQKYWRMYVVRRRYKIRRAATIVIQSYLRGYLTRNRYRKILREYKAVIIQKRVRGWLARTHYKRTMKAIVYLQCCFRRMMAKRELKKLKIEARSVERYKKLHIGMENKIMQLQRKVDEQNKDYKCLMEKLTNLEGVYNSETEKLRNDVERLQLSEEEAKVATGRVLSLQEEIAKLRKDLEQTRSEKKSIEERADK------YKQETDQLVSNLKEENTLLKQEKETLNHRIVEQAKEMTETMERKLVEETKQLELDLNDERLRYQNLLNEFSRLEERYDDL-KEEMTLMLNVPKPGHKRTDSTHSSNESEYTFSSEFAETEDIAPRTEEPIEKK---------------------VPLDMSLFLKLQKRVTELEQEKQLMQDELDRKEEQVFR 1185          
BLAST of Dach-2 vs. UniProt/SwissProt
Match: sp|Q02440|MYO5A_CHICK (Unconventional myosin-Va OS=Gallus gallus OX=9031 GN=MYO5A PE=1 SV=1)

HSP 1 Score: 1118.22 bits (2891), Expect = 0.000e+0
Identity = 730/1911 (38.20%), Postives = 1089/1911 (56.99%), Query Frame = 2
Query:   47 MALYEMYSKGVKIWIPDEESVWIGATVLQFHKEKN-VIKIITDNGISKELNLSSK-KCAPFLRNPDILIGQKDLTYLSYLNEPEVLYNLQIRFCERREIYTYCGIVLVAINPYQELSIYGKEIINAYHSQNSVDLDPHIFAVAENAFRRMSSFGENQSIIVSGESGAGKTVSAKYTMRYFALVGGSKTKQSFNLTETQIERKVLLSNPILEAFGNAKTIRNDNSSRFGKYLEILFNPRNQVIGANMCTYLLEKSRVVFQNLGERNYHIFYQIVTHCQSEDELLMNTGLVNNVEMYDYLRYGESLEIDGVDDSHEFLITKNSFLQLGIDLNKFKTICEILAAILHLGNIRFRFHDATDSSIIENPELLKLIAGLLGCSIDQLKIWLCFRTISTFQETLHKPLSKAEAQYFRDAFVKTLYSNLFDWIVKQANKVLSTDVSINIKKKLKKTIVVNQEDKKKFIAVLDIYGFETFAENSFEQFCINFANEKLQLQFNLHVFKLEQEEYMNEGLEWTFIDYYNNQPCIDLIESRXXXXXXXXXXXXXXXXSDENWCCKIYSHHLNKSANFNKPKLSNMVFIIEHFAGPVEYKCAGFIEKNRDSVLEEQINLLKAS-DVQLIAELFRDSEIEIFDTNNXXXXXXXXXXXXXXXXXXQ--ENTRKMKKTVGSQFRNSLKSLMDALNKTNPHYVRCIKPNDLKLPFTFCPERAVQQLRACGVLETIRLSAAGFPSRWTYSDFYHRYYILMSNFNVKNHDFKAGSQKIVETLITVPDAFRFGNTKLFFRPGQVALLEKLRGHKIESSVTLIQSILRGSIERKKYLIIHKLTVQIQTYIRRKLAIEKATKLSQIRAVIIIQSFYRMYLARKLFVKMKCAVLAIEKWRRKIITTRLKQAYKKENCVIICQAIVRRFIQRRKFLKIQRGVILIQNHYRRRKAKETLKILKIEARSINHIKFVNKGLENKIIELTQKLDTKEKEM---------CXXXXXXXXXXXXXXXXXXXXXAESAKIYQNTVQDLQTEIIQLKKELNREIVEKNKI--FADKELLEINYKKKINYLENLIEELKSSPSVI-----EPNIICNGDEAQQSICQDEHQKFI-----------NEQMDHQKLVREYEKLEMKYENLYKEFLFVKSSNQKPSINYDNQTSNDSETESTFSKDDADVESLSDKVDAKTTKEHXXXXXXXXXXLPNFISESISTAGDLAVVMQLQMNISSLSQENNRLKETVQQFEDELLKYEQCAEDSKGLVIHNEYDNELLSIIKDIKGMDEHGLKSRLIDEVANLKKKLKQSN-EDYQKLRLHIFDGSMSKLTGNLDHESINSEEEELKRA-FESQKEANRK------------MLKEIEGIKANNVDLKKALFQIRKDKEQLQVQLGKQHLMIRHGVEYL----QNLK---------------LTPKERLDKFVQNEISRILLENLKLQERNDQIISETIELKRGLKYFAFRLQKYEGSLVPNPNKEEDLLQLIQNVIYHSKMKTIGKRECYSEIGLIDLNMSELSIFIKSFIFDLSP-SICLQYEPYHLVPYIIFMVTRKFDFYKEEDQMTNFLSKLIVALKRTIRKRRNYIEYLVMLLSNVFCLVNLXXXXXXXXXXXXLNTAEDIQHYFVHYDLNEFIRLLKELCVTLFQMILKTIVDNLLPQSLCIDAILVHEAI--IDFLSKDGTKYKSNIETQPKNTSFNVLTKNLQSVLEILKNHKIPQLIINQIFVHIAYLINAYCLNTLLFRTDLCYFSKGLQIKYNLSSFETWIRYQKLIDSGALQCLRPMTEAVQLLQTLIDSDEDAKFVCDMCEYLNTRQVVKILNNFNPRDGYGCRLSSGLIAKIETQMKIKRGDEPSESKLETPTVIEIPIDIPFIHNGVSLCRTIIPKPLYLSCLT 5575
            MA  E+Y+K  ++WIPD E VW  A +L+ +K  + V+++  + G   E  L  K K  P LRNPDIL+G+ DLT LSYL+EP VL+NL++RF + + IYTYCGIVLVAINPY++L IYG++IINAY  QN  D+DPHIFAVAE A+++M+    NQSIIVSGESGAGKTVSAKY MRYFA V GS        +E  +E KVL SNPI+E+ GNAKT RNDNSSRFGKY+EI F+ R ++IGANM TYLLEKSRVVFQ   ERNYHIFYQ+   C S       T  + N   + Y + G S  IDG+DD+ E + T+ +   LGI  +    I  ILA ILHLGN+ F   D+   +I    + L +   L+G   +++  WLC R ++T  ET  KP+SK  A   RDA  K +Y+NLF+WIV   NK L + V                  +  FI VLDIYGFETF  NSFEQFCIN+ANEKLQ QFN+HVFKLEQEEYM E + WT ID+Y+NQPCI+LIE+++G+LDLLDEECK+ KGSD+ W  K+Y+ HLNK A F KP+LSN  FII+HFA  VEY+C GF+EKN+D+V EEQI +LK+S   +L+ ELF+D E  I  T+ +       S T    +  +  + +++ KKTVG QFRNSL  LM+ LN T PHYVRCIKPND K PFTF  +RAVQQLRACGVLETIR+SAAGFPSRWTY +F+ RY +LM   +V + D K   + ++E LI   D ++FG TK+FFR GQVA LEK+R  K+ ++   IQ  +RG + RKKY+ + +  + IQ Y+R   A   AT L + RA IIIQ F RMY+ RK +  M+ A +A++   R  +     Q   +E+  II Q  VR ++ R  + +  + ++ +Q  YRR  AK  LK LKIEARS+   K ++ GLENKI++L +K+D + KE            I      EK    +       E AK   N V  LQ EI +L+KEL++   EK  I  +ADK      YK +    E L+ ELK   +++     E N   + D+A++ I +   +K +           +E++ +Q L+ E+ +LE +Y++L K+ + +  S  KP     + T + +E+E TFS +  + E L  +++  + K+                        D+++ ++LQ  ++ L QE   L++ + + E++ L+  +  E+ +  +   E + E L      K  +      +L +E+  L+K L ++   +        +   + +LT   +   +  EE  + R+   SQKEA +             +L++++ +K +  ++ +A   +++    L+ QL  Q     + +E L    Q+LK               L P+ R++  +Q+EI+R+  ENL L E+ ++      +LK+ LK FA ++ + E   + N +  + + + I+ V    K K           G+++    +    +K+ I +L P  + +   P  L  YI+FM  R  D+  ++ ++ + L+  I  +K+ ++KR +  E +   LSN    ++  +QYSG + F   NT    +H   ++DL E+ ++L +L + ++Q +++ +++N+L Q + +  +L HE I  +  +   G + +++        + + + + L S   ++  H +   +I Q+   + Y+I A  LN LL R D+C +SKG+QI+YN+S  E W+R + L++SGA + L P+ +A QLLQ    +DEDA+ +C MC  L T Q+VK+LN + P + +  R+    I  I+ +++  R D P   +L        P+  PF  + ++L    IP  L L  ++
Sbjct:    1 MAASELYTKYARVWIPDPEEVWKSAELLKDYKPGDKVLQLRLEEGKDLEYCLDPKTKELPPLRNPDILVGENDLTALSYLHEPAVLHNLKVRFIDSKLIYTYCGIVLVAINPYEQLPIYGEDIINAYSGQNMGDMDPHIFAVAEEAYKQMARDERNQSIIVSGESGAGKTVSAKYAMRYFATVSGSA-------SEANVEEKVLASNPIMESIGNAKTTRNDNSSRFGKYIEIGFDKRYRIIGANMRTYLLEKSRVVFQAEEERNYHIFYQL---CASAALPEFKTLRLGNANYFHYTKQGGSPVIDGIDDAKEMVNTRQACTLLGISDSYQMGIFRILAGILHLGNVEFASRDSDSCAIPPKHDPLTIFCDLMGVDYEEMAHWLCHRKLATATETYIKPISKLHAINARDALAKHIYANLFNWIVDHVNKALHSTVK-----------------QHSFIGVLDIYGFETFEINSFEQFCINYANEKLQQQFNMHVFKLEQEEYMKEQIPWTLIDFYDNQPCINLIEAKMGVLDLLDEECKMPKGSDDTWAQKLYNTHLNKCALFEKPRLSNKAFIIKHFADKVEYQCEGFLEKNKDTVYEEQIKVLKSSKKFKLLPELFQDEEKAISPTSATPSGRVPLSRTPVKPAKARPGQTSKEHKKTVGHQFRNSLHLLMETLNATTPHYVRCIKPNDFKFPFTFDEKRAVQQLRACGVLETIRISAAGFPSRWTYQEFFSRYRVLMKQKDVLS-DRKQTCKNVLEKLILDKDKYQFGKTKIFFRAGQVAYLEKIRADKLRAACIRIQKTIRGWLMRKKYMRMRRAAITIQRYVRGHQARCYATFLRRTRAAIIIQKFQRMYVVRKRYQCMRDATIALQALLRGYLVRNKYQMMLREHKSIIIQKHVRGWLARVHYHRTLKAIVYLQCCYRRMMAKRELKKLKIEARSVERYKKLHIGLENKIMQLQRKIDEQNKEYKSLLEKMNNLEITYSTETEKLRSDVERLRMSEEEAKNATNRVLSLQEEIAKLRKELHQTQTEKKTIEEWADK------YKHET---EQLVSELKEQNTLLKTEKEELNRRIH-DQAKE-ITETMEKKLVEETKQLELDLNDERLRYQNLLNEFSRLEERYDDL-KDEMNLMVSIPKPGHKRTDSTHSSNESEYTFSSEITEAEDLPLRMEEPSEKK---------------------APLDMSLFLKLQKRVTELEQEKQSLQDELDRKEEQALR-AKAKEEERPPIRGAELEYESL------KRQELESENKKLKNELNELQKALTETRAPEVTAPGAPAYRVLLDQLTSVSEELEVRKEEVLILRSQLVSQKEAIQPKEDKNTMTDSTILLEDVQKMK-DKGEIAQAYIGLKETNRLLESQLQSQKKSHENELESLRGEIQSLKEENNRQQQLLAQNLQLPPEARIEASLQHEITRLTNENLDLMEQLEKQDKTVRKLKKQLKVFAKKIGELEVGQMENISPGQIIDEPIRPVNIPRKEKDFQ--------GMLEYKKEDEQKLVKNLILELKPRGVAVNLIP-GLPAYILFMCVRHADYLNDDQKVRSLLTSTINGIKKVLKKRGDDFETVSFWLSNTCRFLHCLKQYSGEEGFMKHNTPRQNEHCLTNFDLAEYRQVLSDLAIQIYQQLVR-VLENIL-QPMIVSGMLEHETIQGVSGVKPTGLRKRTSSIADEGTYTLDSIIRQLNSFHSVMCQHGMDPELIKQVVKQMFYIIGAVTLNNLLLRKDMCSWSKGMQIRYNVSQLEEWLRDKNLMNSGAKETLEPLIQAAQLLQVKKKTDEDAEAICSMCNALTTAQIVKVLNLYTPVNEFEERVLVSFIRTIQLRLR-DRKDSP---QLLMDAKHIFPVTFPFNPSSLALETIQIPASLGLGFIS 1827          
BLAST of Dach-2 vs. UniProt/SwissProt
Match: sp|Q9QYF3|MYO5A_RAT (Unconventional myosin-Va OS=Rattus norvegicus OX=10116 GN=Myo5a PE=1 SV=1)

HSP 1 Score: 1104.35 bits (2855), Expect = 0.000e+0
Identity = 710/1901 (37.35%), Postives = 1080/1901 (56.81%), Query Frame = 2
Query:   47 MALYEMYSKGVKIWIPDEESVWIGATVLQFHKEKN-VIKIITDNGISKELNLSSKKCA-PFLRNPDILIGQKDLTYLSYLNEPEVLYNLQIRFCERREIYTYCGIVLVAINPYQELSIYGKEIINAYHSQNSVDLDPHIFAVAENAFRRMSSFGENQSIIVSGESGAGKTVSAKYTMRYFALVGGSKTKQSFNLTETQIERKVLLSNPILEAFGNAKTIRNDNSSRFGKYLEILFNPRNQVIGANMCTYLLEKSRVVFQNLGERNYHIFYQIVTHCQSEDELLMNTGLVNNVEMYDYLRYGESLEIDGVDDSHEFLITKNSFLQLGIDLNKFKTICEILAAILHLGNIRFRFHDATDSSIIENPELLKLIAGLLGCSIDQLKIWLCFRTISTFQETLHKPLSKAEAQYFRDAFVKTLYSNLFDWIVKQANKVLSTDVSINIKKKLKKTIVVNQEDKKKFIAVLDIYGFETFAENSFEQFCINFANEKLQLQFNLHVFKLEQEEYMNEGLEWTFIDYYNNQPCIDLIESRXXXXXXXXXXXXXXXXSDENWCCKIYSHHLNKSANFNKPKLSNMVFIIEHFAGPVEYKCAGFIEKNRDSVLEEQINLLKASDVQLIAELFRDSEIEIFDTNNXXXXXXXXXXXXXXXXXXQ--ENTRKMKKTVGSQFRNSLKSLMDALNKTNPHYVRCIKPNDLKLPFTFCPERAVQQLRACGVLETIRLSAAGFPSRWTYSDFYHRYYILMSNFNVKNHDFKAGSQKIVETLITVPDAFRFGNTKLFFRPGQVALLEKLRGHKIESSVTLIQSILRGSIERKKYLIIHKLTVQIQTYIRRKLAIEKATKLSQIRAVIIIQSFYRMYLARKLFVKMKCAVLAIEKWRRKIITTRLKQAYKKENCVIICQAIVRRFIQRRKFLKIQRGVILIQNHYRRRKAKETLKILKIEARSINHIKFVNKGLENKIIELTQKLDTKEKEM-CXXXXXX--------XXXXXXXXXXXXXXXAESAKIYQNTVQDLQTEIIQLKKELNREIVEKNKI--FADKELLEINYKKKINYL-ENLIEE---LKSSPSVIEPNIICNGDEAQQSICQD--EHQKFI-----NEQMDHQKLVREYEKLEMKYENLYKEFLFVKSSNQKPSINYDNQTSNDSETESTFSKDDADVESLSDKVDAKTTKEHXXXXXXXXXXLPNFISESISTAGDLAVVMQLQMNISSLSQENNRLKETVQQFEDELLKYEQCAEDSKGLVIHNEYDNELLSIIKDIKGMDEHGLKSRLIDEVANLKKKL-KQSNEDYQKLRLHIFDGSMSKLTGNLDHESINSEEEELKRA-FESQKEANRK------------MLKEIEGIKANNVDLKKALFQIRKDKEQLQVQLGKQHLMIRHGVEYL----QNLK---------------LTPKERLDKFVQNEISRILLENLKLQERNDQIISETIELKRGLKYFAFRLQKYEGSLVPNPNKEEDLLQLIQNVIYHSKMKTIGKRECYSEIGLIDLNMSELSIFIKSFIFDLSPSICLQYEPYHLVPYIIFMVTRKFDFYKEEDQMTNFLSKLIVALKRTIRKRRNYIEYLVMLLSNVFCLVNLXXXXXXXXXXXXLNTAEDIQHYFVHYDLNEFIRLLKELCVTLFQMILKTIVDNLLPQSLCIDAILVHEAI--IDFLSKDGTKYKSNIETQPKNTSFNVLTKNLQSVLEILKNHKIPQLIINQIFVHIAYLINAYCLNTLLFRTDLCYFSKGLQIKYNLSSFETWIRYQKLIDSGALQCLRPMTEAVQLLQTLIDSDEDAKFVCDMCEYLNTRQVVKILNNFNPRDGYGCRLSSGLIAKIETQMKIKRGDEPSESKLETPTVIEIPIDIPFIHNGVSLCRTIIPKPLYLS 5566
            MA  E+Y+K  ++WIPD E VW  A +L+ +K  + V+ +  + G   E  L  K    P LRNPDIL+G+ DLT LSYL+EP VL+NL++RF + + IYTYCGIVLVAINPY++L IYG++IINAY  QN  D+DPHIFAVAE A+++M+    NQSIIVSGESGAGKTVSAKY MRYFA V GS        +E  +E KVL SNPI+E+ GNAKT RNDNSSRFGKY+EI F+ R ++IGANM TYLLEKSRVVFQ   ERNYHIFYQ+    +  +  ++  G   N + + Y + G S  I+GVDD+ E   T+ +   LGI  +    I  ILA ILHLGN+ F   D+   +I    E L +   L+G   +++  WLC R ++T  ET  KP+SK +A   RDA  K +Y+ LF+WIV   N+ L + V                  +  FI VLDIYGFETF  NSFEQFCIN+ANEKLQ QFN+HVFKLEQEEYM E + WT ID+Y+NQPCI+LIES+LG+LDLLDEECK+ KG+D+ W  K+Y+ HLNK A F KP++SN  FII+HFA  VEY+C GF+EKN+D+V EEQI +LK+S  +++ ELF+D E  I  T+ +    +  +      +  +  +  ++ KKTVG QFRNSL  LM+ LN T PHYVRCIKPND K PFTF  +RAVQQLRACGVLETIR+SAAGFPSRWTY +F+ RY +LM   +V   D K   Q ++E LI   D ++FG TK+FFR GQVA LEKLR  K+ ++   IQ  +RG + RK+YL + +  + +Q Y+R   A   A  L + +A   IQ ++RMY+ R+ +   + A + ++ + R  +     +   +E+  +I Q  VR ++ R  + +  + +I +Q  +RR  AK  LK LKIEARS+   K ++ G+ENKI++L +K+D + K+  CL++             EK    +       E AK+    V  LQ EI +L+K+L +   EK  I   ADK      YK++   L  NL EE   LK     +   ++    E  +++ +   E  K +     +E++ +Q L+ E+ +LE +Y++L KE + +  +  KP     + T + +E+E TFS + A+ E ++ + +  T K+                        D+++ ++LQ  ++ L QE   +++ + + E+++L+ +     +KG         EL    + +K  +      +L +E+  L+K L ++S  +        +   M +LT   +   +  EE  + R+   SQKEA +             +L++++ +K +  ++ +A   +++    L+ QL  Q     +  E L    Q+LK               L P+ R++  +Q+EI+R+  ENL L E+ ++      +LK+ LK FA ++ + E   + N +  + + + I+ V    K K           G+++    +    +K+ I +L P          L  YI+FM  R  D+  ++ ++ + L+  I ++K+ ++KR +  E +   LSN    ++  +QYSG + F   NT+   +H   ++DL E+ ++L +L + ++Q +++ +++N+L Q + +  +L HE I  +  +   G + +++        + + + + L S   ++  H +   +I Q+   + Y++ A  LN LL R D+C +SKG+QI+YN+S  E W+R + L++SGA + L P+ +A QLLQ    +D+DA+ +C MC  L T Q+VK+LN + P + +  R+S   I  I+ +++  R D P   +L        P+  PF  + ++L    IP  L L 
Sbjct:    1 MAASELYTKFARVWIPDPEEVWKSAELLKDYKPGDKVLLLHLEEGKDLEYRLDPKTSELPHLRNPDILVGENDLTALSYLHEPAVLHNLRVRFIDSKLIYTYCGIVLVAINPYEQLPIYGEDIINAYSGQNMGDMDPHIFAVAEEAYKQMARDERNQSIIVSGESGAGKTVSAKYAMRYFATVSGSA-------SEANVEEKVLASNPIMESIGNAKTTRNDNSSRFGKYIEIGFDKRYRIIGANMRTYLLEKSRVVFQAEEERNYHIFYQLCASAKLPEFKMLRLG---NADSFHYTKQGGSPMIEGVDDAKEMAHTRQACTLLGISESYQMGIFRILAGILHLGNVGFASRDSDSCTIPPKHEPLIIFCDLMGVDYEEMCHWLCHRKLATATETYIKPISKLQATNARDALAKHIYAKLFNWIVGHVNQALHSAVK-----------------QHSFIGVLDIYGFETFEINSFEQFCINYANEKLQQQFNMHVFKLEQEEYMKEQIPWTLIDFYDNQPCINLIESKLGILDLLDEECKMPKGTDDTWAQKLYNTHLNKCALFEKPRMSNKAFIIKHFADKVEYQCEGFLEKNKDTVFEEQIKVLKSSKFKMLPELFQDDEKAISPTSATSSGRTPLTRVPVKPTKGRPGQTAKEHKKTVGLQFRNSLHLLMETLNATTPHYVRCIKPNDFKFPFTFDEKRAVQQLRACGVLETIRISAAGFPSRWTYQEFFSRYRVLMKQKDVLG-DRKQTCQNVLEKLILDKDKYQFGKTKIFFRAGQVAYLEKLRADKLRAACIRIQKTIRGWLLRKRYLCMQRAAITVQRYVRGYQARCYAKFLRRTKAATTIQKYWRMYVVRRKYKIRRAATIVLQSYLRGYLARNRYRKILREHKAVIIQKRVRGWLARTHYKRTMKAIIYLQCCFRRMMAKRELKKLKIEARSVERYKKLHIGMENKIMQLQRKVDEQNKDYKCLMEKLTNLEGVYNSETEKLRNDVERLQLSEEEAKVATGRVLSLQEEIAKLRKDLEQTRSEKKSIEERADK------YKQETEQLVSNLKEENTLLKQEKETLNHLMVEQAKEMTETMERKLVEETKQLELDLNDERLRYQNLLNEFSRLEERYDDL-KEEMTLMLNVPKPGHKRTDSTHSSNESEYTFSSEFAETEDIAPRTEEPTEKK---------------------VPLDMSLFLKLQKRVTELGQEKQLMQDELDRKEEQVLRSK-----AKGGERPQIRGAEL--GYESLKRQELESENKKLKNELNELRKALSEKSAPEVNAPGAPAYRVLMEQLTAVSEELDVRKEEVLILRSQLVSQKEAIQPKDDKNTMTDSTILLEDVQKMK-DKGEIAQAYIGLKETNRLLESQLQSQKRSHENEAEALRGEIQSLKEENNRQQQLLAQNLQLPPEARIEASLQHEITRLTNENLDLMEQLEKQDKTVRKLKKQLKVFAKKIGELEVGQMENISPGQIIDEPIRPVNIPRKGKDFQ--------GMLEYKREDEQKLVKNLILELKPRGVAVNLISGLPAYILFMCVRHADYLDDDQKVRSLLTSTINSIKKVLKKRGDDFETVSFWLSNTCRFLHCLKQYSGEEGFMKHNTSRQNEHCLTNFDLAEYRQVLSDLAIQIYQQLVR-VLENIL-QPMIVSGMLEHETIQGVSGVKPTGLRKRTSSIADEGTYTLDSILRQLNSFHSVMCQHGMDPELIKQVVKQMFYIVGAITLNNLLLRKDMCSWSKGMQIRYNVSQLEEWLRDKNLMNSGAKETLEPLIQAAQLLQVKKKTDDDAEAICSMCNALTTAQIVKVLNLYTPVNEFEERVSVSFIRTIQVRLR-DRKDSP---QLLMDAKHIFPVTFPFNPSSLALETIQIPASLGLG 1823          
BLAST of Dach-2 vs. UniProt/SwissProt
Match: sp|Q99104|MYO5A_MOUSE (Unconventional myosin-Va OS=Mus musculus OX=10090 GN=Myo5a PE=1 SV=2)

HSP 1 Score: 1095.49 bits (2832), Expect = 0.000e+0
Identity = 710/1930 (36.79%), Postives = 1084/1930 (56.17%), Query Frame = 2
Query:   47 MALYEMYSKGVKIWIPDEESVWIGATVLQFHKEKN-VIKIITDNGISKELNLSSKKCA-PFLRNPDILIGQKDLTYLSYLNEPEVLYNLQIRFCERREIYTYCGIVLVAINPYQELSIYGKEIINAYHSQNSVDLDPHIFAVAENAFRRMSSFGENQSIIVSGESGAGKTVSAKYTMRYFALVGGSKTKQSFNLTETQIERKVLLSNPILEAFGNAKTIRNDNSSRFGKYLEILFNPRNQVIGANMCTYLLEKSRVVFQNLGERNYHIFYQIVTHCQSEDELLMNTGLVNNVEMYDYLRYGESLEIDGVDDSHEFLITKNSFLQLGIDLNKFKTICEILAAILHLGNIRFRFHDATDSSIIENPELLKLIAGLLGCSIDQLKIWLCFRTISTFQETLHKPLSKAEAQYFRDAFVKTLYSNLFDWIVKQANKVLSTDVSINIKKKLKKTIVVNQEDKKKFIAVLDIYGFETFAENSFEQFCINFANEKLQLQFNLHVFKLEQEEYMNEGLEWTFIDYYNNQPCIDLIESRXXXXXXXXXXXXXXXXSDENWCCKIYSHHLNKSANFNKPKLSNMVFIIEHFAGPVEYKCAGFIEKNRDSVLEEQINLLKASDVQLIAELFRDSEIEIFDTNNXXXXXXXXXXXXXXXXXXQ--ENTRKMKKTVGSQFRNSLKSLMDALNKTNPHYVRCIKPNDLKLPFTFCPERAVQQLRACGVLETIRLSAAGFPSRWTYSDFYHRYYILMSNFNVKNHDFKAGSQKIVETLITVPDAFRFGNTKLFFRPGQVALLEKLRGHKIESSVTLIQSILRGSIERKKYLIIHKLTVQIQTYIRRKLAIEKATKLSQIRAVIIIQSFYRMYLARKLFVKMKCAVLAIEKWRRKIITTRLKQAYKKENCVIICQAIVRRFIQRRKFLKIQRGVILIQNHYRRRKAKETLKILKIEARSINHIKFVNKGLENKIIELTQKLDTKEKEM-CXXXXXX--------XXXXXXXXXXXXXXXAESAKIYQNTVQDLQTEIIQLKKELNREIVEKNKI--FADKELLEINYKKKINYL-ENLIEE---LKSSPSVIEPNIICNGDEAQQSICQD--EHQKFI-----NEQMDHQKLVREYEKLEMKYENLYKEFLFVKSSNQKPSINYDNQTSNDSETESTFSKDDADVESLSDKVDAKTTKEHXXXXXXXXXXLPNFISESISTAGDLAVVMQLQMNISSLSQENNRLKETVQQFEDELLKYEQCAEDSKGLVIHNEYDNELLSIIKDIKGMDEHGLKSRLIDEVANLKKKL-KQSNEDYQKLRLHIFDGSMSKLTGNLDHESINSEEEELKRA-FESQKEANRK------------MLKEIEGIKANNVDLKKALFQIRKDKEQLQVQLGKQHLMIRHGVEYL----QNLK---------------LTPKERLDKFVQNEISRILLENLKLQ----------------------------ERNDQIISETIELKRGLKYFAFRLQKYEGSLVPNPNKEEDLLQLIQNVIYHSKMKTIGKRECYSEIGLIDLNMSELSIFIKSFIFDLSP-SICLQYEPYHLVPYIIFMVTRKFDFYKEEDQMTNFLSKLIVALKRTIRKRRNYIEYLVMLLSNVFCLVNLXXXXXXXXXXXXLNTAEDIQHYFVHYDLNEFIRLLKELCVTLFQMILKTIVDNLLPQSLCIDAILVHEAI--IDFLSKDGTKYKSNIETQPKNTSFNVLTKNLQSVLEILKNHKIPQLIINQIFVHIAYLINAYCLNTLLFRTDLCYFSKGLQIKYNLSSFETWIRYQKLIDSGALQCLRPMTEAVQLLQTLIDSDEDAKFVCDMCEYLNTRQVVKILNNFNPRDGYGCRLSSGLIAKIETQMKIKRGDEPSESKLETPTVIEIPIDIPFIHNGVSLCRTIIPKPLYLS 5566
            MA  E+Y+K  ++WIPD E VW  A +L+ +K  + V+ +  + G   E  L  K    P LRNPDIL+G+ DLT LSYL+EP VL+NL++RF + + IYTYCGIVLVAINPY++L IYG++IINAY  QN  D+DPHIFAVAE A+++M+    NQSIIVSGESGAGKTVSAKY MRYFA V GS        +E  +E KVL SNPI+E+ GNAKT RNDNSSRFGKY+EI F+ R ++IGANM TYLLEKSRVVFQ   ERNYHIFYQ+    +  +  ++  G   N + + Y + G S  I+GVDD+ E   T+ +   LGI  +    I  ILA ILHLGN+ F   D+   +I    E L +   L+G   +++  WLC R ++T  ET  KP+SK +A   RDA  K +Y+ LF+WIV   N+ L + V                  +  FI VLDIYGFETF  NSFEQFCIN+ANEKLQ QFN+HVFKLEQEEYM E + WT ID+Y+NQPCI+LIES+LG+LDLLDEECK+ KG+D+ W  K+Y+ HLNK A F KP++SN  FII+HFA  VEY+C GF+EKN+D+V EEQI +LK+S  +++ ELF+D E  I  T+ +    +  +      +  +  +  ++ KKTVG QFRNSL  LM+ LN T PHYVRCIKPND K PFTF  +RAVQQLRACGVLETIR+SAAGFPSRWTY +F+ RY +LM   +V   D K   + ++E LI   D ++FG TK+FFR GQVA LEKLR  K+ ++   IQ  +RG + RK+YL + +  + +Q Y+R   A   A  L + +A   IQ ++RMY+ R+ +   + A + I+ + R  +T    +   +E   +I Q  VR ++ R  + +  + ++ +Q  +RR  AK  LK LKIEARS+   K ++ G+ENKI++L +K+D + K+  CL++             EK    +       E AK+    V  LQ EI +L+K+L +   EK  I   ADK      YK++ + L  NL EE   LK     +   I+    E  +++ +   E  K +     +E++ +Q L+ E+ +LE +Y++L KE + +  +  KP     + T + +E+E TFS + A+ E ++ + +    K+                        D+++ ++LQ  ++ L QE   +++ + + E+++ +  +  E+ +  +   E + E L      K  +      +L +E+  L+K L ++S  +        +   M +LT   +   +  EE  + R+   SQKEA +             +L++++ +K +  ++ +A   +++    L+ QL  Q     +  E L    Q+LK               L P+ R++  +Q+EI+R+  ENL  +                            E+ D+ +    +LK+ LK FA ++ + E   + N +  + + + I+ V    K K           G+++    +    +K+ I +L P  + +   P  L  YI+FM  R  D+  ++ ++ + L+  I ++K+ ++KR +  E +   LSN    ++  +QYSG + F   NT+   +H   ++DL E+ ++L +L + ++Q +++ +++N+L Q + +  +L HE I  +  +   G + +++        + + + + L S   ++  H +   +I Q+   + Y++ A  LN LL R D+C +SKG+QI+YN+S  E W+R + L++SGA + L P+ +A QLLQ    +D+DA+ +C MC  L T Q+VK+LN + P + +  R+S   I  I+ +++  R D P   +L        P+  PF  + ++L    IP  L L 
Sbjct:    1 MAASELYTKFARVWIPDPEEVWKSAELLKDYKPGDKVLLLHLEEGKDLEYRLDPKTGELPHLRNPDILVGENDLTALSYLHEPAVLHNLRVRFIDSKLIYTYCGIVLVAINPYEQLPIYGEDIINAYSGQNMGDMDPHIFAVAEEAYKQMARDERNQSIIVSGESGAGKTVSAKYAMRYFATVSGSA-------SEANVEEKVLASNPIMESIGNAKTTRNDNSSRFGKYIEIGFDKRYRIIGANMRTYLLEKSRVVFQAEEERNYHIFYQLCASAKLPEFKMLRLG---NADSFHYTKQGGSPMIEGVDDAKEMAHTRQACTLLGISESYQMGIFRILAGILHLGNVGFASRDSDSCTIPPKHEPLTIFCDLMGVDYEEMCHWLCHRKLATATETYIKPISKLQATNARDALAKHIYAKLFNWIVDHVNQALHSAVK-----------------QHSFIGVLDIYGFETFEINSFEQFCINYANEKLQQQFNMHVFKLEQEEYMKEQIPWTLIDFYDNQPCINLIESKLGILDLLDEECKMPKGTDDTWAQKLYNTHLNKCALFEKPRMSNKAFIIKHFADKVEYQCEGFLEKNKDTVFEEQIKVLKSSKFKMLPELFQDDEKAISPTSATSSGRTPLTRVPVKPTKGRPGQTAKEHKKTVGHQFRNSLHLLMETLNATTPHYVRCIKPNDFKFPFTFDEKRAVQQLRACGVLETIRISAAGFPSRWTYQEFFSRYRVLMKQKDVLG-DRKQTCKNVLEKLILDKDKYQFGKTKIFFRAGQVAYLEKLRADKLRAACIRIQKTIRGWLLRKRYLCMQRAAITVQRYVRGYQARCYAKFLRRTKAATTIQKYWRMYVVRRRYKIRRAATIVIQSYLRGYLTRNRYRKILREYKAVIIQKRVRGWLARTHYKRTMKAIVYLQCCFRRMMAKRELKKLKIEARSVERYKKLHIGMENKIMQLQRKVDEQNKDYKCLMEKLTNLEGVYNSETEKLRNDVERLQLSEEEAKVATGRVLSLQEEIAKLRKDLEQTRSEKKSIEERADK------YKQETDQLVSNLKEENTLLKQEKETLNHRIVEQAKEMTETMERKLVEETKQLELDLNDERLRYQNLLNEFSRLEERYDDL-KEEMTLMLNVPKPGHKRTDSTHSSNESEYTFSSEFAETEDIAPRTEEPIEKK---------------------VPLDMSLFLKLQKRVTELEQEKQLMQDELDRKEEQVFR-SKAKEEERPQIRGAELEYESL------KRQELESENKKLKNELNELRKALSEKSAPEVTAPGAPAYRVLMEQLTSVSEELDVRKEEVLILRSQLVSQKEAIQPKDDKNTMTDSTILLEDVQKMK-DKGEIAQAYIGLKETNRLLESQLQSQKRSHENEAEALRGEIQSLKEENNRQQQLLAQNLQLPPEARIEASLQHEITRLTNENLYFEELYADDPKKYQSYRISLYKRMIDLMEQLEKQDKTVR---KLKKQLKVFAKKIGELEVGQMENISPGQIIDEPIRPVNIPRKEKDFQ--------GMLEYKREDEQKLVKNLILELKPRGVAVNLIP-GLPAYILFMCVRHADYLNDDQKVRSLLTSTINSIKKVLKKRGDDFETVSFWLSNTCRFLHCLKQYSGEEGFMKHNTSRQNEHCLTNFDLAEYRQVLSDLAIQIYQQLVR-VLENIL-QPMIVSGMLEHETIQGVSGVKPTGLRKRTSSIADEGTYTLDSILRQLNSFHSVMCQHGMDPELIKQVVKQMFYIVGAITLNNLLLRKDMCSWSKGMQIRYNVSQLEEWLRDKNLMNSGAKETLEPLIQAAQLLQVKKKTDDDAEAICSMCNALTTAQIVKVLNLYTPVNEFEERVSVSFIRTIQMRLR-DRKDSP---QLLMDAKHIFPVTFPFNPSSLALETIQIPASLGLG 1848          
BLAST of Dach-2 vs. UniProt/SwissProt
Match: sp|P21271|MYO5B_MOUSE (Unconventional myosin-Vb OS=Mus musculus OX=10090 GN=Myo5b PE=1 SV=2)

HSP 1 Score: 1094.34 bits (2829), Expect = 0.000e+0
Identity = 713/1902 (37.49%), Postives = 1080/1902 (56.78%), Query Frame = 2
Query:   47 MALYEMYSKGVKIWIPDEESVWIGATVLQFHKEKN---VIKIITDNGISKELNLSSKKCAPFLRNPDILIGQKDLTYLSYLNEPEVLYNLQIRFCERREIYTYCGIVLVAINPYQELSIYGKEIINAYHSQNSVDLDPHIFAVAENAFRRMSSFGENQSIIVSGESGAGKTVSAKYTMRYFALVGGSKTKQSFNLTETQIERKVLLSNPILEAFGNAKTIRNDNSSRFGKYLEILFNPRNQVIGANMCTYLLEKSRVVFQNLGERNYHIFYQIVTHCQSEDELLMNTGLVNNVEMYDYLRYGESLEIDGVDDSHEFLITKNSFLQLGIDLNKFKTICEILAAILHLGNIRFRFHDATDS-SIIENPELLKLIAGLLGCSIDQLKIWLCFRTISTFQETLHKPLSKAEAQYFRDAFVKTLYSNLFDWIVKQANKVLSTDVSINIKKKLKKTIVVNQEDKKKFIAVLDIYGFETFAENSFEQFCINFANEKLQLQFNLHVFKLEQEEYMNEGLEWTFIDYYNNQPCIDLIESRXXXXXXXXXXXXXXXXSDENWCCKIYSHHLNKSANFNKPKLSNMVFIIEHFAGPVEYKCAGFIEKNRDSVLEEQINLLKASDVQLIAELFRDSEIEIFDTNNXXXXXXXXXXXXXXXXXXQENTRKMKKTVGSQFRNSLKSLMDALNKTNPHYVRCIKPNDLKLPFTFCPERAVQQLRACGVLETIRLSAAGFPSRWTYSDFYHRYYILMSNFNVKNHDFKAGSQKIVETLITVPDAFRFGNTKLFFRPGQVALLEKLRGHKIESSVTLIQSILRGSIERKKYLIIHKLTVQIQTYIRRKLAIEKATKLSQIRAVIIIQSFYRMYLARKLFVKMKCAVLAIEKWRRKIITTRLKQAYKKENCVIICQAIVRRFIQRRKFLKIQRGVILIQNHYRRRKAKETLKILKIEARSINHIKFVNKGLENKIIELTQKLDTKEKEMCXXXXXXXXXXXXXXXXXXXXXAESAKIYQNTVQD----LQTEIIQLKKELNREIVEKNKIFAD---KELLEINYKKKINYLENLIEELKSSPSVIEPNIICNGD-EAQQSICQDE---HQKFINEQMDHQKLVREYEKLEMKYENLYKEFLFVKSSNQKPSINYDNQTSNDSETESTFSKDDADVESLSDKVDAKTTKEHXXXXXXXXXXLPNFISESISTAGDLAVVMQLQMNISSLSQENNRLKETVQQFEDELLKYEQCAEDSKGLVIHNEYD----------------------NELLSIIKDIKGMDEHGLKSRLIDEVANLKKKLKQSNEDYQK-------LRLHIFDGSMSKLTGNLDHESINS-----------EEEELKRAFESQKEANRKMLKEIEGIKANNVDLKKALFQIRKDKEQLQVQLGKQHLMIRHGVEYLQNLKLTPKERLDKFVQNEISRILLENLKLQERNDQIISETIELKRGLKYFAFRLQKYEG--SLVPNPNKEEDLLQLIQNVIYHSKMKTIGKRECYSEIGLIDLNMSELSIFIKSFIFDLSPSICLQYEPYHLVPYIIFMVTRKFDFYKEEDQMTNFLSKLIVALKRTIRKRRNYIEYLVMLLSNVFCLVNLXXXXXXXXXXXXLNTAEDIQHYFVHYDLNEFIRLLKELCVTLFQMILKTIVDNLLPQSLCIDAILVHEAI--IDFLSKDGTKYKSNIETQPKNT-SFNVLTKNLQSVLEILKNHKIPQLIINQIFVHIAYLINAYCLNTLLFRTDLCYFSKGLQIKYNLSSFETWIRYQKLIDSGALQCLRPMTEAVQLLQTLIDSDEDAKFVCDMCEYLNTRQVVKILNNFNPRDGYGCRLSSGLIAKIETQMKIKRGDEPSESKLETPTVIEIPIDIPFIHNGVSLCRTIIPKPLYLSCL 5572
            M+  E+Y++  ++WIPD + VW  A + + +KE +    +++  D  +   +++ + +  PFLRNPDIL+G+ DLT LS+L+EP VL+NL++RF E   IYTYCGIVLVAINPY++L IYG+++I AY  QN  D+DPHIFAVAE A+++M+   +NQSIIVSGESGAGKTVSAKY MRYFA VGGS +       +T IE KVL S+PI+EA GNAKT RNDNSSRFGK++EI F+ +  +IGANM TYLLEKSRVVFQ   ERNYHIFYQ+   C +          +   E + Y  +G +  I+GV+D+ +F  T+ +   LG+  +   +I +I+A+ILHLG++  +     DS SI    E L     LLG    Q++ WLC R + T  ET  K +S  +    RDA  K +Y+ LF WIV+  NK L T                    +  FI VLDIYGFETF  NSFEQFCIN+ANEKLQ QFN HVFKLEQEEYM E + WT ID+Y+NQPCIDLIE++LG+LDLLDEECK+ KG+D+NW  K+Y  H N S +F KP++SN  FI+ HFA  VEY   GF+EKNRD+V EEQIN+LKAS   L+A+LF D +     TN +K + S K + +S   + +   ++ KK+VG QFR SL  LM+ LN T PHYVRCIKPND KLPF F P+RAVQQLRACGVLETIR+SAAG+PSRWTY DF++RY +LM    + N D K   + ++E+LI  PD F+FG TK+FFR GQVA LEKLR  K   +  +IQ  +RG ++R KY  +   T+ +Q + R  LA   A  L + RA I+ Q  YRM  AR+ + ++  A + I+ + R +   R  +    E+   I Q   R ++ R++FL+ +   I+IQ  +RR KA++ LK LKIEARS  H+K +N G+ENK+++L +K+D + KE   +  QL        + ++  + E A   QN   D    LQ E+  L+ EL +   E+ ++  D   KE  E+  +K++  LE+    LK     +   I+C    E+ QS  ++     ++   E+  +Q LV+EY +LE +YENL  E        Q P   +    SN S  ES  +        + D  DA    E +                    A D+ V ++LQ  +  L QE  +L+  +++ + +  K  Q  + + GL +  + D                      NEL   + D + M ++   S   D  + L  +LK +NE+ +        LR  I +    +L+G     +IN+           ++E+   A+    + NR +  +++   A +++ ++ +  ++   E L+ ++ KQ         + Q L L+P+ +++  VQ EISR+  ENL  +E  +++     +LK+ LK +  ++Q  E   +L  +  +  +L + +          T+ ++E   + G+++ +  + ++ I++ + DL P +     P  L  YI++M  R  D+  ++ ++ + LS  I  +K+ ++K  +  E     LSN    ++  +QYSG + F   NTA+  +H   ++DL E+ ++L +L + ++Q ++K I + LL Q + + A+L +E+I  +  +   G + +S+     +N+     + + + S   +L +  +   II Q+F  + Y+INA  LN LL R D C +S G+Q++YN+S  E W+R + L  SGA+Q + P+ +A QLLQ    + EDA+ +C +C  L+T+Q+VKILN + P + +  R++   I  I+ Q++ +R D P +  L++  V   P+  P+  + +++    IP  L L  L
Sbjct:    1 MSYSELYTRYTRVWIPDPDEVWRSAELTKDYKEGDKSLQLRLEDDTILEYPVDVQNNQ-VPFLRNPDILVGENDLTALSHLHEPAVLHNLKVRFLESNHIYTYCGIVLVAINPYEQLPIYGQDVIYAYSGQNMGDMDPHIFAVAEEAYKQMARDEKNQSIIVSGESGAGKTVSAKYAMRYFATVGGSAS-------DTNIEEKVLASSPIMEAIGNAKTTRNDNSSRFGKFIEIGFDKKYHIIGANMRTYLLEKSRVVFQADDERNYHIFYQL---CAAASLPEFKELALTCAEDFFYTAHGGNTTIEGVNDADDFEKTRQALTLLGVRDSHQISIFKIIASILHLGSVEIQSERDGDSCSISPQDEHLSNFCSLLGIEHSQMEHWLCHRKLVTTSETYVKTMSLQQVVNARDALAKHIYAQLFSWIVEHINKALHTS-----------------HKQHSFIGVLDIYGFETFEINSFEQFCINYANEKLQQQFNSHVFKLEQEEYMKEQIPWTLIDFYDNQPCIDLIEAKLGILDLLDEECKVPKGTDQNWAQKLYERHSN-SQHFQKPRMSNTAFIVNHFADKVEYLSDGFLEKNRDTVYEEQINILKASKFPLVADLFHDDKDSAPATNTAKNRSSSKINVRSSRPLIKVPNKEHKKSVGYQFRTSLNLLMETLNATTPHYVRCIKPNDEKLPFHFDPKRAVQQLRACGVLETIRISAAGYPSRWTYHDFFNRYRVLMKKRELTNTDKKNICKSVLESLIKDPDKFQFGRTKIFFRAGQVAYLEKLRADKFREATIMIQKSVRGWLQRVKYRRLRAATLSLQRFCRGYLARRLAEHLRRTRAAIVFQKQYRMLKARRAYRRVCRATVIIQSFTRAMFVRRNYRQVLMEHKATIIQKYARGWMARKRFLRERDAAIVIQCAFRRLKARQELKALKIEARSAEHLKRLNVGMENKVVQLQRKIDDQNKEFKTLSEQLSAVTSSHAVEVEKLKKELAHYQQNQEADTSLQLQEEVQSLRTELQKAHSER-RVLEDAHNKENGEL--RKRVADLEHENALLKDEKEYLNNQILCQSKAESSQSSVEENLLMKKELEEERSRYQNLVKEYSQLEQRYENLRDE--------QTPG--HRKNPSNQSSLESDSNYPSISTSEIGDTEDALQQVEEIGIE---------------KAAMDMTVFLKLQKRVRELEQERKKLQAQLEKGQQD-SKKGQVEQQNNGLDVDQDADIAYNSLKRQELESENKKLKNDLNELRKAVAD-QAMQDNSTHSS-PDSYSLLLNQLKLANEELEVRKEEVLILRTQIMNADQRRLSGKNMEPNINARTSWPNSEKHVDQEDAIEAYHGVCQTNRLLEAQLQ---AQSLEHEEEVEHLKAQVEALKEEMDKQQQT------FCQTLLLSPEAQVEFGVQQEISRLTNENLDFKELVEKLEKNERKLKKQLKIYMKKVQDLEAAQALAQSDRRHHELTRQV----------TVQRKEKDFQ-GMLEYHKEDEALLIRNLVTDLKPQMLSGTVPC-LPAYILYMCIRHADYTNDDLKVHSLLSSTINGIKKVLKKHNDDFEMTSFWLSNTCRFLHCLKQYSGDEGFMTQNTAKQNEHCLKNFDLTEYRQVLSDLSIQIYQQLIK-IAEGLL-QPMIVSAMLENESIQGLSGVRPTGYRKRSSSMVDGENSYCLEAIVRQMNSFHTVLCDQGLDPEIILQVFKQLFYMINAVTLNNLLLRKDACSWSTGMQLRYNISQLEEWLRGKNLHQSGAVQTMEPLIQAAQLLQLKKKTHEDAEAICSLCTSLSTQQIVKILNLYTPLNEFEERVTVSFIRTIQAQLQ-ERND-PQQLLLDSKHV--FPVLFPYNPSALTMDSIHIPACLNLEFL 1815          
BLAST of Dach-2 vs. UniProt/SwissProt
Match: sp|Q9ULV0|MYO5B_HUMAN (Unconventional myosin-Vb OS=Homo sapiens OX=9606 GN=MYO5B PE=1 SV=3)

HSP 1 Score: 1091.26 bits (2821), Expect = 0.000e+0
Identity = 716/1915 (37.39%), Postives = 1064/1915 (55.56%), Query Frame = 2
Query:   47 MALYEMYSKGVKIWIPDEESVWIGATVLQFHKE--KNVIKIITDNGISKELNLSSKKCAPFLRNPDILIGQKDLTYLSYLNEPEVLYNLQIRFCERREIYTYCGIVLVAINPYQELSIYGKEIINAYHSQNSVDLDPHIFAVAENAFRRMSSFGENQSIIVSGESGAGKTVSAKYTMRYFALVGGSKTKQSFNLTETQIERKVLLSNPILEAFGNAKTIRNDNSSRFGKYLEILFNPRNQVIGANMCTYLLEKSRVVFQNLGERNYHIFYQIVTHCQSEDELLMNTGLVNNVEMYDYLRYGESLEIDGVDDSHEFLITKNSFLQLGIDLNKFKTICEILAAILHLGNIRFRFHDATDSSIIENPEL-LKLIAGLLGCSIDQLKIWLCFRTISTFQETLHKPLSKAEAQYFRDAFVKTLYSNLFDWIVKQANKVLSTDVSINIKKKLKKTIVVNQEDKKKFIAVLDIYGFETFAENSFEQFCINFANEKLQLQFNLHVFKLEQEEYMNEGLEWTFIDYYNNQPCIDLIESRXXXXXXXXXXXXXXXXSDENWCCKIYSHHLNKSANFNKPKLSNMVFIIEHFAGPVEYKCAGFIEKNRDSVLEEQINLLKASDVQLIAELFRDSEIEIFDTNNXXXXXXXXXXXXXXXXXXQENTRKMKKTVGSQFRNSLKSLMDALNKTNPHYVRCIKPNDLKLPFTFCPERAVQQLRACGVLETIRLSAAGFPSRWTYSDFYHRYYILMSNFNVKNHDFKAGSQKIVETLITVPDAFRFGNTKLFFRPGQVALLEKLRGHKIESSVTLIQSILRGSIERKKYLIIHKLTVQIQTYIRRKLAIEKATKLSQIRAVIIIQSFYRMYLARKLFVKMKCAVLAIEKWRRKIITTRLKQAYKKENCVIICQAIVRRFIQRRKFLKIQRGVILIQNHYRRRKAKETLKILKIEARSINHIKFVNKGLENKIIELTQKLDTKEKEMCXXXXXXXXXXXXXXXXXXXXXAESAKIYQNTVQD----LQTEIIQLKKELNREIVEKNKIFADKELLEIN-YKKKINYLENLIEELKSSPSVIEPNIICNGDE--AQQSICQDEHQKFINEQMD-HQKLVREYEKLEMKYENLYKEFLFVKSSNQKPSINYDNQTSNDSETESTFSKDDADVESLSDKVDAKTTKEHXXXXXXXXXXLPNFISESISTAGDLAVVMQLQMNISSLSQENNRLKETVQQFEDELLKYEQCAEDSKGLVIHNEYD----------------------NELLSIIKD--IKGMDEHGLK---SRLIDEVANLKKKLKQSNEDYQKLRLHIFDGSMSKLTGNLDHESINS-----------EEEELKRAFESQKEANRKMLKEIEGIKANNVDLKKALFQIRKDKEQLQVQLGKQHL-------------------MIRHGVEYLQNLKLTPKERLDKFVQNEISRILLENLKLQERNDQIISETIELKRGLKYFAFRLQKYEG--SLVPNPNKEEDLLQLIQNVIYHSKMKTIGKRECYSEIGLIDLNMSELSIFIKSFIFDLSPSICLQYEPYHLVPYIIFMVTRKFDFYKEEDQMTNFLSKLIVALKRTIRKRRNYIEYLVMLLSNVFCLVNLXXXXXXXXXXXXLNTAEDIQHYFVHYDLNEFIRLLKELCVTLFQMILKTIVDNLLPQSLCIDAILVHEAIIDFLSKDGTKYK---SNIETQPKNTSFNVLTKNLQSVLEILKNHKIPQLIINQIFVHIAYLINAYCLNTLLFRTDLCYFSKGLQIKYNLSSFETWIRYQKLIDSGALQCLRPMTEAVQLLQTLIDSDEDAKFVCDMCEYLNTRQVVKILNNFNPRDGYGCRLSSGLIAKIETQMKIKRGDEPSESKLETPTVIEIPIDIPFIHNGVSLCRTIIPKPLYLSCL 5572
            M++ E+YS+  ++WIPD + VW  A + + +KE  K++   + D  I +      +   PFLRNPDIL+G+ DLT LSYL+EP VL+NL++RF E   IYTYCGIVLVAINPY++L IYG+++I  Y  QN  D+DPHIFAVAE A+++M+   +NQSIIVSGESGAGKTVSAKY MRYFA VGGS +       ET IE KVL S+PI+EA GNAKT RNDNSSRFGKY++I F+ R  +IGANM TYLLEKSRVVFQ   ERNYHIFYQ+   C +          + + E + Y   G    I+GVDD+ +F  T+ +F  LG+  +   +I +I+A+ILHLG++  +     DS  I   ++ L     LLG    Q++ WLC R + T  ET  K +S  +    R+A  K +Y+ LF WIV+  NK L T +                  +  FI VLDIYGFETF  NSFEQFCIN+ANEKLQ QFN HVFKLEQEEYM E + WT ID+Y+NQPCIDLIE++LG+LDLLDEECK+ KG+D+NW  K+Y  H + S +F KP++SN  FII HFA  VEY   GF+EKNRD+V EEQIN+LKAS   L+A+LF D +  +  T   K   S  S   +   +K  N ++ KKTVG QFR SL  LM+ LN T PHYVRCIKPND KLPF F P+RAVQQLRACGVLETIR+SAAG+PSRW Y DF++RY +L+    + N D KA  + ++E LI  PD F+FG TK+FFR GQVA LEKLR  K  ++  +IQ  +RG +++ KY  +   T+ +Q Y R  LA   A  L +IRA +++Q  YRM  AR+ + +++ A + I+ + R +   R  +    E+     Q  VR ++ RR F +++   I+IQ  +R  KA+  LK L+IEARS  H+K +N G+ENK+++L +K+D + KE   +  QL        + ++  + E     Q+  +D    LQ E+  L+ EL R   E+ KI  D    E +  +K++  LE     LK     +   I+C   +  AQ S+ ++  +K + E+   +Q LV+EY +LE +Y+NL  E   +K   Q P   +    SN S  ES  +        + D  DA    E +                    A D+ V ++LQ  +  L QE  +L+  +++ E +  K  Q       + +    D                      NEL   + D   +    HG     S L++++    ++L+   E+   LR  I      +L G     +IN+           ++E+   A+    + N K   E  G    + +L  A   +++    L+ QL  Q L                   M +    + Q L L+P+ +++  VQ EISR+  ENL L+E  +++     +LK+ LK +  + Q  E   +L  +  K  +L          ++  T+ ++E   + G+++ +  + ++ I++ + DL P +     P  L  YI++M  R  D+  ++ ++ + L+  I  +K+ ++K  +  E     LSN   L++  +QYSG + F   NTA+  +H   ++DL E+ ++L +L + ++Q ++K I + +L Q + + A+L +E+I        T Y+   S++     +     + + + +   ++ +  +   II Q+F  + Y+INA  LN LL R D+C +S G+Q++YN+S  E W+R + L  SGA+Q + P+ +A QLLQ    + EDA+ +C +C  L+T+Q+VKILN + P + +  R++   I  I+ Q++ +R D P +  L+   +   P+  PF  + +++    IP  L L  L
Sbjct:    1 MSVGELYSQCTRVWIPDPDEVWRSAELTKDYKEGDKSLQLRLEDETILEYPIDVQRNQLPFLRNPDILVGENDLTALSYLHEPAVLHNLKVRFLESNHIYTYCGIVLVAINPYEQLPIYGQDVIYTYSGQNMGDMDPHIFAVAEEAYKQMARDEKNQSIIVSGESGAGKTVSAKYAMRYFATVGGSAS-------ETNIEEKVLASSPIMEAIGNAKTTRNDNSSRFGKYIQIGFDKRYHIIGANMRTYLLEKSRVVFQADDERNYHIFYQL---CAAAGLPEFKELALTSAEDFFYTSQGGDTSIEGVDDAEDFEKTRQAFTLLGVKESHQMSIFKIIASILHLGSVAIQAERDGDSCSISPQDVYLSNFCRLLGVEHSQMEHWLCHRKLVTTSETYVKTMSLQQVINARNALAKHIYAQLFGWIVEHINKALHTSLK-----------------QHSFIGVLDIYGFETFEVNSFEQFCINYANEKLQQQFNSHVFKLEQEEYMKEQIPWTLIDFYDNQPCIDLIEAKLGILDLLDEECKVPKGTDQNWAQKLYDRH-SSSQHFQKPRMSNTAFIIVHFADKVEYLSDGFLEKNRDTVYEEQINILKASKFPLVADLFHDDKDPVPATTPGKGSSSKISVRSARPPMKVSN-KEHKKTVGHQFRTSLHLLMETLNATTPHYVRCIKPNDEKLPFHFDPKRAVQQLRACGVLETIRISAAGYPSRWAYHDFFNRYRVLVKKRELANTDKKAICRSVLENLIKDPDKFQFGRTKIFFRAGQVAYLEKLRADKFRTATIMIQKTVRGWLQKVKYHRLKGATLTLQRYCRGHLARRLAEHLRRIRAAVVLQKHYRMQRARQAYQRVRRAAVVIQAFTRAMFVRRTYRQVLMEHKATTIQKHVRGWMARRHFQRLRDAAIVIQCAFRMLKARRELKALRIEARSAEHLKRLNVGMENKVVQLQRKIDEQNKEFKTLSEQLSVTTSTYTMEVERLKKELVHYQQSPGEDTSLRLQEEVESLRTELQRAHSER-KILEDAHSREKDELRKRVADLEQENALLKDEKEQLNNQILCQSKDEFAQNSVKENLMKKELEEERSRYQNLVKEYSQLEQRYDNLRDEMTIIK---QTPG--HRRNPSNQSSLESDSNYPSISTSEIGDTEDALQQVEEIGLE---------------KAAMDMTVFLKLQKRVRELEQERKKLQVQLEKREQQDSKKVQAEPPQTDIDLDPNADLAYNSLKRQELESENKKLKNDLNELRKAVADQATQNNSSHGSPDSYSLLLNQLKLAHEELEVRKEEVLILRTQIVSADQRRLAGRNAEPNINARSSWPNSEKHVDQEDAIEAYHGVCQTNSKT--EDWGYLNEDGELGLAYQGLKQVARLLEAQLQAQSLEHEEEVEHLKAQLEALKEEMDKQQQTFCQTLLLSPEAQVEFGVQQEISRLTNENLDLKELVEKLEKNERKLKKQLKIYMKKAQDLEAAQALAQSERKRHEL----------NRQVTVQRKEKDFQ-GMLEYHKEDEALLIRNLVTDLKPQMLSGTVPC-LPAYILYMCIRHADYTNDDLKVHSLLTSTINGIKKVLKKHNDDFEMTSFWLSNTCRLLHCLKQYSGDEGFMTQNTAKQNEHCLKNFDLTEYRQVLSDLSIQIYQQLIK-IAEGVL-QPMIVSAMLENESIQGLSGVKPTGYRKRSSSMADGDNSYCLEAIIRQMNAFHTVMCDQGLDPEIILQVFKQLFYMINAVTLNNLLLRKDVCSWSTGMQLRYNISQLEEWLRGRNLHQSGAVQTMEPLIQAAQLLQLKKKTQEDAEAICSLCTSLSTQQIVKILNLYTPLNEFEERVTVAFIRTIQAQLQ-ERND-PQQLLLDAKHM--FPVLFPFNPSSLTMDSIHIPACLNLEFL 1845          
BLAST of Dach-2 vs. TrEMBL
Match: A0A481MTK7 (Dach-2 OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 3545.36 bits (9192), Expect = 0.000e+0
Identity = 1830/1851 (98.87%), Postives = 1832/1851 (98.97%), Query Frame = 2
Query:   47 MALYEMYSKGVKIWIPDEESVWIGATVLQFHKEKNVIKIITDNGISKELNLSSKKCAPFLRNPDILIGQKDLTYLSYLNEPEVLYNLQIRFCERREIYTYCGIVLVAINPYQELSIYGKEIINAYHSQNSVDLDPHIFAVAENAFRRMSSFGENQSIIVSGESGAGKTVSAKYTMRYFALVGGSKTKQSFNLTETQIERKVLLSNPILEAFGNAKTIRNDNSSRFGKYLEILFNPRNQVIGANMCTYLLEKSRVVFQNLGERNYHIFYQIVTHCQSEDELLMNTGLVNNVEMYDYLRYGESLEIDGVDDSHEFLITKNSFLQLGIDLNKFKTICEILAAILHLGNIRFRFHDATDSSIIENPELLKLIAGLLGCSIDQLKIWLCFRTISTFQETLHKPLSKAEAQYFRDAFVKTLYSNLFDWIVKQANKVLSTDVSINIKKKLKKTIVVNQEDKKKFIAVLDIYGFETFAENSFEQFCINFANEKLQLQFNLHVFKLEQEEYMNEGLEWTFIDYYNNQPCIDLIESRXXXXXXXXXXXXXXXXSDENWCCKIYSHHLNKSANFNKPKLSNMVFIIEHFAGPVEYKCAGFIEKNRDSVLEEQINLLKASDVQLIAELFRDSEIEIFDTNNXXXXXXXXXXXXXXXXXXQENTRKMKKTVGSQFRNSLKSLMDALNKTNPHYVRCIKPNDLKLPFTFCPERAVQQLRACGVLETIRLSAAGFPSRWTYSDFYHRYYILMSNFNVKNHDFKAGSQKIVETLITVPDAFRFGNTKLFFRPGQVALLEKLRGHKIESSVTLIQSILRGSIERKKYLIIHKLTVQIQTYIRRKLAIEKATKLSQIRAVIIIQSFYRMYLARKLFVKMKCAVLAIEKWRRKIITTRLKQAYKKENCVIICQAIVRRFIQRRKFLKIQRGVILIQNHYRRRKAKETLKILKIEARSINHIKFVNKGLENKIIELTQKLDTKEKEMCXXXXXXXXXXXXXXXXXXXXXAESAKIYQNTVQDLQTEIIQLKKELNREIVEKNKIFADKELLEINYKKKINYLENLIEELKSSPSVIEPNIICNGDEAQQSICQDEHQKFINEQMDHQKLVREYEKLEMKYENLYKEFLFVKSSNQKPSINYDNQTSNDSETESTFSKDDADVESLSDKVDAKTTKEHXXXXXXXXXXLPNFISESISTAGDLAVVMQLQMNISSLSQENNRLKETVQQFEDELLKYEQCAEDSKGLVIHNEYDNELLSIIKDIKGMDEHGLKSRLIDEVANLKKKLKQSNEDYQKLRLHIFDGSMSKLTGNLDHESINSEEEELKRAFESQKEANRKMLKEIEGIKANNVDLKKALFQIRKDKEQLQVQLGKQHLMIRHGVEYLQNLKLTPKERLDKFVQNEISRILLENLKLQERNDQIISETIELKRGLKYFAFRLQKYEGSLVPNPNKEEDLLQLIQNVIYHSKMKTIGKRECYSEIGLIDLNMSELSIFIKSFIFDLSPSICLQYEPYHLVPYIIFMVTRKFDFYKEEDQMTNFLSKLIVALKRTIRKRRNYIEYLVMLLSNVFCLVNLXXXXXXXXXXXXLNTAEDIQHYFVHYDLNEFIRLLKELCVTLFQMILKTIVDNLLPQSLCIDAILVHEAIIDFLSKDGTKYKSNIETQPKNTSFNVLTKNLQSVLEILKNHKIPQLIINQIFVHIAYLINAYCLNTLLFRTDLCYFSKGLQIKYNLSSFETWIRYQKLIDSGALQCLRPMTEAVQLLQTLIDSDEDAKFVCDMCEYLNTRQVVKILNNFNPRDGYGCRLSSGLIAKIETQMKIKRGDEPSESKLETPTVIEIPIDIPFIHNGVSLCRTIIPKPLYLSCLTVLSEKDLL 5599
            MALYEMYSKGVKIWIPDEESVWIGATVLQFHKEKNVIKIITDNGISKELNLSSKKCAPFLRNPDILIGQKDLTYLSYLNEPEVLYNLQIRFCERREIYTYCGIVLVAINPYQELSIYGKEIINAYHSQNSVDLDPHIFAVAENAFRRMSSFGENQSIIVSGESGAGKTVSAKYTMRYFALVGGSKTKQSFNLTETQIERKVLLSNPILEAFGNAKTIRNDNSSRFGKYLEILFNPRNQVIGANMCTYLLEKSRVVFQNLGERNYHIFYQIVTHCQSEDELLMNTGLVNNVEMYDYLRYGESLEIDGVDDSHEFLITKNSFLQLGIDLNKFKTICEILAAILHLGNIRFR HDATDSSIIENPELLKLIAGLLGCSIDQLKIWLCFRTISTFQETLHKPLSKAEAQYFRDAFVKTLYSNLFDWIVKQANKVLSTDVSINIKKKLKKTIVVNQEDKKKFIAVLDIYGFETF ENSFEQFCINFANEKLQLQFNLHVFKLEQEEYMNEGLEWTFIDYYNNQPCIDLIESRLGLLDLLDEECKLLKGSDENWCCKIYSHHLNKS NFNKPKLSNMVFIIEHFAGPVEYKCAGFIEKNRDSVLEEQINLLKASDVQLIAELFRDSEIEI DTNNSKPKVSIKSSTKSIMSIKQENTRKMKKTVGSQFRNSLKSLMDALNKTNPHYVRCIKPNDLKLPFTFCPERAVQQLRACGVLETIRLSAAGFPSRWTYSDFYHRYYILMSNFNVKNHDFKAGSQKIVETLITVPDAFRFGNTKLFFRPGQVALLEKLRGHKIESSVTLIQSILRGSIERKKYLIIHKLTVQIQTYIRRKLAIEKATKLSQIRAVIIIQSFYRMYLARKLFVKMKCAVLAIEKWRRKIITTRLKQAYKKENCVIICQAIVRRFIQRRKFLKIQRGVILIQNHYRRRKAKETLKILKIEARSINHIKFVNKGLENKIIELTQKLDTKEKEMCLIQNQLIKEKKIEILNLKLNQAESAKIYQNTVQDLQTEIIQLKKELNREIVEKNKIFADKELLEINYKKKINYLENLIEELKSSPSVIEPNIICNGDEAQQSICQDEHQKFINEQMDHQKLVREYEKLEMKYENLYKEFLFVKSSNQKPSINYDNQTSNDSETESTFSKDDAD ESLSD+VDAKTTKEHVVKSSVVVKKLPNFISESISTAGDLAVVMQLQMNISSLSQENNRLKETVQQFEDELLKYEQCAEDSKGLVIHNEYDNELLSIIKDIKGMDEHGLKSRLIDEVANLKKKLKQS EDYQKLRLHIFDGSMSKL GNLDHESINSEEEELKRAFESQKEANRKMLKEIEGIKANNVDLKKALFQIRKDKEQLQVQLGK   +I        NLKLTPKERLDKFVQNEISRILLENLKLQERNDQI SETIELKRGLKYFAFRLQKYEGSLVPNPNKEEDLLQLIQNVIYHSKMKTIGKRECYSEIGLIDLNMSELSIFIKSFIFDLSPSICLQYEPYHLVPYIIFMVTRKFDFYKEEDQMTNFLSKLIVALKRTIRKRRNYIEYLVMLLSNVFCLVNLFQQYSGSQQFSGLNTAEDIQHYFVHYDLNEFIRLLKELCVTLFQMILKTIVDNLLPQSLCIDAILVHEAIIDFLSKDGTKYKSNIETQPKNTSFNVLTKNLQSVLEILKNHKIPQLIINQIFVHIAYLINAYCLNTLLFRTDLCYFSKGLQIKYNLSSFETWIRYQKLIDSGALQCLRPMTEAVQLLQTLIDSDEDAKFVCDMCEYLNTRQVVKILNNFNPRDGYGCRLSSGLIAKIETQMKIKRGDEPSESKLETPTVIEIPIDIPFIHNGVSLCRTIIPKPLYLSCLTVLSEKDLL
Sbjct:    1 MALYEMYSKGVKIWIPDEESVWIGATVLQFHKEKNVIKIITDNGISKELNLSSKKCAPFLRNPDILIGQKDLTYLSYLNEPEVLYNLQIRFCERREIYTYCGIVLVAINPYQELSIYGKEIINAYHSQNSVDLDPHIFAVAENAFRRMSSFGENQSIIVSGESGAGKTVSAKYTMRYFALVGGSKTKQSFNLTETQIERKVLLSNPILEAFGNAKTIRNDNSSRFGKYLEILFNPRNQVIGANMCTYLLEKSRVVFQNLGERNYHIFYQIVTHCQSEDELLMNTGLVNNVEMYDYLRYGESLEIDGVDDSHEFLITKNSFLQLGIDLNKFKTICEILAAILHLGNIRFRSHDATDSSIIENPELLKLIAGLLGCSIDQLKIWLCFRTISTFQETLHKPLSKAEAQYFRDAFVKTLYSNLFDWIVKQANKVLSTDVSINIKKKLKKTIVVNQEDKKKFIAVLDIYGFETFEENSFEQFCINFANEKLQLQFNLHVFKLEQEEYMNEGLEWTFIDYYNNQPCIDLIESRLGLLDLLDEECKLLKGSDENWCCKIYSHHLNKSVNFNKPKLSNMVFIIEHFAGPVEYKCAGFIEKNRDSVLEEQINLLKASDVQLIAELFRDSEIEILDTNNSKPKVSIKSSTKSIMSIKQENTRKMKKTVGSQFRNSLKSLMDALNKTNPHYVRCIKPNDLKLPFTFCPERAVQQLRACGVLETIRLSAAGFPSRWTYSDFYHRYYILMSNFNVKNHDFKAGSQKIVETLITVPDAFRFGNTKLFFRPGQVALLEKLRGHKIESSVTLIQSILRGSIERKKYLIIHKLTVQIQTYIRRKLAIEKATKLSQIRAVIIIQSFYRMYLARKLFVKMKCAVLAIEKWRRKIITTRLKQAYKKENCVIICQAIVRRFIQRRKFLKIQRGVILIQNHYRRRKAKETLKILKIEARSINHIKFVNKGLENKIIELTQKLDTKEKEMCLIQNQLIKEKKIEILNLKLNQAESAKIYQNTVQDLQTEIIQLKKELNREIVEKNKIFADKELLEINYKKKINYLENLIEELKSSPSVIEPNIICNGDEAQQSICQDEHQKFINEQMDHQKLVREYEKLEMKYENLYKEFLFVKSSNQKPSINYDNQTSNDSETESTFSKDDADFESLSDEVDAKTTKEHVVKSSVVVKKLPNFISESISTAGDLAVVMQLQMNISSLSQENNRLKETVQQFEDELLKYEQCAEDSKGLVIHNEYDNELLSIIKDIKGMDEHGLKSRLIDEVANLKKKLKQSTEDYQKLRLHIFDGSMSKLAGNLDHESINSEEEELKRAFESQKEANRKMLKEIEGIKANNVDLKKALFQIRKDKEQLQVQLGKLGDLI-------GNLKLTPKERLDKFVQNEISRILLENLKLQERNDQITSETIELKRGLKYFAFRLQKYEGSLVPNPNKEEDLLQLIQNVIYHSKMKTIGKRECYSEIGLIDLNMSELSIFIKSFIFDLSPSICLQYEPYHLVPYIIFMVTRKFDFYKEEDQMTNFLSKLIVALKRTIRKRRNYIEYLVMLLSNVFCLVNLFQQYSGSQQFSGLNTAEDIQHYFVHYDLNEFIRLLKELCVTLFQMILKTIVDNLLPQSLCIDAILVHEAIIDFLSKDGTKYKSNIETQPKNTSFNVLTKNLQSVLEILKNHKIPQLIINQIFVHIAYLINAYCLNTLLFRTDLCYFSKGLQIKYNLSSFETWIRYQKLIDSGALQCLRPMTEAVQLLQTLIDSDEDAKFVCDMCEYLNTRQVVKILNNFNPRDGYGCRLSSGLIAKIETQMKIKRGDEPSESKLETPTVIEIPIDIPFIHNGVSLCRTIIPKPLYLSCLTVLSEKDLL 1844          
BLAST of Dach-2 vs. TrEMBL
Match: V4ACD4 (Uncharacterized protein (Fragment) OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_122399 PE=3 SV=1)

HSP 1 Score: 1169.07 bits (3023), Expect = 0.000e+0
Identity = 732/1885 (38.83%), Postives = 1076/1885 (57.08%), Query Frame = 2
Query:   77 VKIWIPDEESVWIGATVLQFHKEKNVIKIITDNGISKELNLSSKKCAPFLRNPDILIGQKDLTYLSYLNEPEVLYNLQIRFCERREIYTYCGIVLVAINPYQELSIYGKEIINAYHSQNSVDLDPHIFAVAENAFRRMSSFGENQSIIVSGESGAGKTVSAKYTMRYFALVGGSKTKQSFNLTETQIERKVLLSNPILEAFGNAKTIRNDNSSRFGKYLEILFNPRNQVIGANMCTYLLEKSRVVFQNLGERNYHIFYQIVTHCQSEDELLMNTGLVNNVEMYDYLRYGESLEIDGVDDSHEFLITKNSFLQLGIDLNKFKTICEILAAILHLGNIRFRFHDATDSSIIENPELLKLIAGLLGCSIDQLKIWLCFRTISTFQETLHKPLSKAEAQYFRDAFVKTLYSNLFDWIVKQANKVLSTDVSINIKKKLKKTIVVNQEDKKKFIAVLDIYGFETFAENSFEQFCINFANEKLQLQFNLHVFKLEQEEYMNEGLEWTFIDYYNNQPCIDLIESRXXXXXXXXXXXXXXXXSDENWCCKIYSHHLNKSANFNKPKLSNMVFIIEHFAGPVEYKCAGFIEKNRDSVLEEQINLLKASDVQLIAELFRDSEIEIFDTNNXXXXXXXXXXXXXXXXXXQENTRKMKKTVGSQFRNSLKSLMDALNKTNPHYVRCIKPNDLKLPFTFCPERAVQQLRACGVLETIRLSAAGFPSRWTYSDFYHRYYILMSNFNVKNHDFKAGSQKIVETLITVPDAFRFGNTKLFFRPGQVALLEKLRGHKIESSVTLIQSILRGSIERKKYLIIHKLTVQIQTYIRRKLAIEKATKLSQIRAVIIIQSFYRMYLARKLFVKMKCAVLAIEKWRRKIITTRLKQAYKKENCVIICQAIVRRFIQRRKFLKIQRGVILIQNHYRRRKAKETLKILKIEARSINHIKFVNKGLENKIIELTQKLDTKEKEMCXXXXXXXX-XXXXXXXXXXXXXAESAKIYQNTVQDLQTEIIQLKKELNREIVEKNKIFADKELLEINYKKKINYLENLIEELKSSPSVIEPNIICNGDEAQQSICQDEH-------QKFINEQMDHQKLVREYEKLEMKYENLYKEFLFVKSSNQKPSINYDNQTSNDSETESTFSKDDADVESLSDKVDAKTTKEHXXXXXXXXXXLPNFISESISTAGDLAVVMQLQMNISSLSQENNRLKETVQQFEDELLKYEQCAEDSKGLV------------IHNEYD------NELLSIIKDIKGMDEHG-----LKSRLIDEVANLKKKLKQSNEDYQKLRLHIFDGSMSKLTGNLDHESINS------EEEELKRAFESQKEANRKMLKEIEGIKAN----NVDLKKALFQIRKDKEQLQVQLGKQHLMIRHGVEYLQNLKLTPKERLDKFVQNEISRILLENL---------KLQERNDQIISETIELKRGLKYFAFRLQKYEGSLVPNPNKEEDLLQLIQNVIYHSKMKTIGKRECYSEIGLIDLNMSELSIFIKSFIFDLSPSICLQYEPYHLVPYIIFMVTRKFDFYKEEDQMTNFLSKLIVALKRTIRKRRNYIEYLVMLLSNVFCLVNLXXXXXXXXXXXXLNTAEDIQHYFVHYDLNEFIRLLKELCVTLFQMILKTIVDNLLPQSLCIDAILVHEAIIDFLSKDGTKYKSNI-----ETQPKNTSFNVLTKNLQSVLEILKNHKIPQLIINQIFVHIAYLINAYCLNTLLFRTDLCYFSKGLQIKYNLSSFETWIRYQKLIDSGALQCLRPMTEAVQLLQTLIDSDEDAKFVCDMCEYLNTRQVVKILNNFNPRDGYGCRLSSGLIAKIETQMKIKRGDEPSESKLETPTVIEIPIDIPFIHNGVSLCRTIIPKPLYLS 5566
             +IWIPD E+VW  A +L+ +  +    I  +      L++  K   P LRNPDILIG+ DLT LSYLNEPEVLYNL++RF E   IYTYCGIVLVAINPY++L IY  +II+AY  Q+   +DPHIFAVAE AF++MS F  NQSIIVSGESGAGKTVSAKY MRYFA VGGS+T       ETQ+E+KVL SNPI+EA GNAKT RNDNSSRFGKY+E+ F+  N +IGANM TYLLEKSRVVFQ   ERNYHIFYQ+   C S          + + + + Y   G + EI+ VDD+ +   T+ +   LG+   +  +I +ILAAILH GN+  R  +     I +N + LK++  LL     Q+KIWLC R I+T  E L+KPL++++A+  RDA  K +YSNLF+WIV Q NK L +                    + +FI VLDIYGFETF  NSFEQFCIN+ANEKLQ  FN+HVFKLEQEEY+ E +EW+FID+Y+NQPCIDLIES+LG+LDLLDEECK+ +GSD NWC K+Y  HL KS +FNKP++S   F+I HFA  V Y   GF+EKNRD+VLEEQIN+LKAS+++L+ ELF +                 K   K I    +  +++ KKTVGSQFR+SL  LM  LN T PHY+RCIKPND K  FTF  +RAV+QLRACGVLETIR+SAAG+PSRWTY +F+ RY +L     +   + +   + I+  LI   D +RFG +K+FFR GQVA LEKLR  K+ +   +IQ  +RG + R+KY  I K  + +Q Y R  LA   A  L Q  A  +IQ  ++ Y  RK + K++  +  ++   R +   R   +  K +   I Q  VR F+ +R++  + RG+IL+Q+HYRRRKA+  LKILK+EA+S++H+K VNKGLENKIIEL QKLD K KE+  ++ +  K  +    +       E A+   N + +L  EI +LK EL  E  EK  + ++KEL++ ++ K I+ +    E++K+  ++ +  +     EA+ S              +F +E+  HQKLV+E+ +L+ ++ENL  E   V S             +    T S  S     +ES S   DA+                     +      D+++V++LQ  +  L +E   L+E + ++ED+ L  +   E+S  L             + NE D        L++ I +   +D+          + ++    +  +L +  E+  +LR  + D ++S  T ++  ES +       E++EL  A+++QK+ NR +  +++  + +      +L+K + +++KD E+ Q  +G             QNL L P+ +++  +Q+EI+R+  ENL          L+E  D    +  +LK+ LK ++ +L+  E  L    N E +             + T+  RE  + +G+++L   + +  IK+ + DL P +     P  L  YI+FM+ R+ DF  +++++   L+  I  +K+ +++  + ++ + + L+N   L++  +QYSG + F   N+ +  +    ++DL+E+ ++  +L V ++Q +LK + + + P    + AIL HEAI    +   +  +        E    + S + L ++L + + I+  H +   +  QIF  + Y I A  LN LL R D+C +SKG+QI+YNLS  E W+R  KL +SGA+  L P+ +A QLLQ    +D D   + +MC  L   Q+VKILN + P D +  R+    I KI  Q K+K  D+ + + L   T    P+  PF  + + L    +P  L++S
Sbjct:    1 ARIWIPDVENVWRAAELLEDYTGQKTTAIKYEEAEESTLDID-KNNLPHLRNPDILIGENDLTSLSYLNEPEVLYNLRVRFLESNLIYTYCGIVLVAINPYEQLDIYSNDIIHAYSGQDMGAMDPHIFAVAEEAFKQMSRFERNQSIIVSGESGAGKTVSAKYAMRYFATVGGSQT-------ETQVEKKVLASNPIMEAIGNAKTTRNDNSSRFGKYIELGFSRSNSIIGANMRTYLLEKSRVVFQAQDERNYHIFYQM---CASAHIPEFKKMELQHADDFFYTSQGGAPEINDVDDAKDLNSTREALSILGLSEQQQMSIFQILAAILHFGNVSIREGEGETCEIPDNDQSLKMMCKLLAIEESQMKIWLCNRKITTVNEVLNKPLTESQAKDSRDALAKHIYSNLFNWIVTQVNKALHS-----------------TSKQHRFIGVLDIYGFETFEINSFEQFCINYANEKLQQIFNMHVFKLEQEEYVREQIEWSFIDFYDNQPCIDLIESKLGILDLLDEECKMPRGSDSNWCQKLYDKHLGKSKHFNKPRMSRTAFVIIHFADQVTYTADGFLEKNRDTVLEEQINILKASEIELVGELFSEG------------GEGKKGREKPIKQQPKAGSKQHKKTVGSQFRDSLSLLMATLNATTPHYIRCIKPNDEKCAFTFDSKRAVEQLRACGVLETIRISAAGYPSRWTYPEFFQRYRVLAKTKQIIKGNMRKTCESILPDLIADEDKYRFGKSKIFFRAGQVAYLEKLRSDKLRACGIMIQKHIRGWLLRRKYSKIRKSALLLQCYGRGLLARRHAQYLRQTHAATVIQKTWKGYKDRKQYSKLRTTMCVLQACIRGLFARRKYASLLKNHKAKIIQRHVRTFLAKRRYKHVLRGIILLQSHYRRRKARTKLKILKVEAKSVDHVKKVNKGLENKIIELQQKLDQKAKEVVEVKQEEAKIVQLKSEITKLKENKEVAQDSSNKITELLAEIQRLKAELETERGEKQDLISEKELMKKDHNKIIDEVLEEKEKIKNQLNLAQEKL----KEAESSTADKLEAANKLLLAEFESERSHHQKLVKEHARLQQRFENLQGELEIVTSP------------TGHKRTPSDISA--VSIESYSSSADAERNN--------------EEKEKEEEAEVDVSLVLKLQNKVKELEKERQHLQERIDRYEDKRLDEQNIEEESHFLGGDMAFQSLKMQELENENDKLKREVTRLMNAIAESTDLDDRSGELSPTGKKFMERYDAMGDELDRRREECLQLRAMLADRTIS--THSIAKESYSGQDNLVNEDDELSMAYKTQKDLNRLLQSQLDKTEKDAKRIQDELRKEIKELKKDNERQQKLIG-------------QNLSLGPEAKIEATMQHEITRLTSENLVSLMSILLCDLREMIDDQTQQIRKLKKVLKVYSKKLRAGEAELDRAENGEGN-----------GSLATVKHRE-RTFMGMLELKKDDENTLIKNLVLDLKPKVAAGLIP-GLPAYILFMIVRQTDFTNDDEKVRGLLTNTINGIKKVVKRHNDDLDRITLWLANTCRLLHTLKQYSGEKAFQPENSTKQNEQCLRNFDLSEYRQVFSDLAVWIYQGLLKRMEELIQPS--IVPAILEHEAISGLNASKPSGLRGRSSSSARELDSNDYSLDSLMRSLNNYMRIVTQHAVDPELGKQIFRQVFYYICAGSLNNLLLRKDMCNWSKGMQIRYNLSHLEQWLRDNKLSESGAITALDPIIQASQLLQAR-KTDSDVDSISEMCSKLTNAQIVKILNLYTPVDEFEERVPISFIRKI--QEKLKSRDDTNNTLL-MDTKYSYPVTFPFNPSNIQLETIEVPDILHIS 1779          
BLAST of Dach-2 vs. TrEMBL
Match: A0A2T7PSZ8 (Uncharacterized protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_03491 PE=3 SV=1)

HSP 1 Score: 1143.26 bits (2956), Expect = 0.000e+0
Identity = 735/1903 (38.62%), Postives = 1100/1903 (57.80%), Query Frame = 2
Query:   59 EMYSKGVKIWIPDEESVWIGATVLQFHKEKNVIKIITDNGISKELNLSSKKCAPFLRNPDILIGQKDLTYLSYLNEPEVLYNLQIRFCERREIYTYCGIVLVAINPYQELSIYGKEIINAYHSQNSVDLDPHIFAVAENAFRRMSSFGENQSIIVSGESGAGKTVSAKYTMRYFALVGGSKTKQSFNLTETQIERKVLLSNPILEAFGNAKTIRNDNSSRFGKYLEILFNPRNQVIGANMCTYLLEKSRVVFQNLGERNYHIFYQIVTHCQSEDELLMNTGLVNNVEMYDYLRYGESLEIDGVDDSHEFLITKNSFLQLGIDLNKFKTICEILAAILHLGNIRFRFHDATDSSIIENPELLKLIAGLLGCSIDQLKIWLCFRTISTFQETLHKPLSKAEAQYFRDAFVKTLYSNLFDWIVKQANKVLSTDVSINIKKKLKKTIVVNQEDKKKFIAVLDIYGFETFAENSFEQFCINFANEKLQLQFNLHVFKLEQEEYMNEGLEWTFIDYYNNQPCIDLIESRXXXXXXXXXXXXXXXXSDENWCCKIYSHHLNKSANFNKPKLSNMVFIIEHFAGPVEYKCAGFIEKNRDSVLEEQINLLKASDVQLIAELFRDSEIEIFDTNNXXXXXXXXXXXXXXXXXXQE---NTRKMKKTVGSQFRNSLKSLMDALNKTNPHYVRCIKPNDLKLPFTFCPERAVQQLRACGVLETIRLSAAGFPSRWTYSDFYHRYYILMSNFNVKNHDFKAGSQKIVETLITVPDAFRFGNTKLFFRPGQVALLEKLRGHKIESSVTLIQSILRGSIERKKYLIIHKLTVQIQTYIRRKLAIEKATKLSQIRAVIIIQSFYRMYLARKLFVKMKCAVLAIEKWRRKIITTRLKQAYKKENCVIICQAIVRRFIQRRKFLKIQRGVILIQNHYRRRKAKETLKILKIEARSINHIKFVNKGLENKIIELTQKLDTKEKEMCXXXXXXXXXXXXXXXXXXXXXA-ESAKIYQNTVQDLQTEIIQLKKELNREIVEKNKIFADKELLEINYKKKINYLENLIEE--------------LKSSPSVIEPNIICNGDEAQQSICQDEHQKFINEQMDHQKLVREYEKLEMKYENLYKEFLFVKSSNQKPSINYDNQTSNDSETESTFSKDDADVESLSDKVDAKTTKEHXXXXXXXXXXLPNFISESISTA--------GDLAVVMQLQMNISSLSQENNRLKETVQQFEDELLKYEQ-----CAEDS-KGLVIHNEYD---NELLSIIKDIKGMDEHG--------LKSRLIDEVANLKKKLKQSNEDYQKLRLHIFD-----GSMSKLT-GNLDHESINSEEEELKRAFESQKEANRKMLKEIEGI----KANNVDLKKALFQIRKDKEQLQVQLGKQHLMIRHGVEYLQNLKLTPKERLDKFVQNEISRILLENLKLQERNDQIISETIELKRGLKYFAFRLQKYEGSLVPNPNKEEDLLQLIQNVIYHSKMKTIGKRECYSEIGLIDLNMSELSIFIKSFIFDLSPSICLQYEPYHLVPYIIFMVTRKFDFYKEEDQMTNFLSKLIVALKRTIRKRRNYIEYLVMLLSNVFCLVNLXXXXXXXXXXXXLNTAEDIQHYFVHYDLNEFIRLLKELCVTLFQMILKTIVDNLLPQSLCIDAILVHEAIIDFLSKDGTKYKSNIETQPKNT--------SFNVLTKNLQSVLEILKNHKIPQLIINQIFVHIAYLINAYCLNTLLFRTDLCYFSKGLQIKYNLSSFETWIRYQKLIDSGALQCLRPMTEAVQLLQTLIDSDEDAKFVCDMCEYLNTRQVVKILNNFNPRDGYGCRLSSGLIAKIETQMKIKRGDEPSESK-LETPTVIEIPIDIPFIHNGVSLCRTIIPKPLYLSCLTVL 5581
            E Y KG +IWIPD + +W  A +L+ +K +N IKI  + G    +++S  K  P LRNP+ILIG+ DLT LSYLNEPEVLYNL++RF E+  IYTYCGIVLVAINPY+ L IYG +II+AY  Q+   +DPHI+AVAE AF++MS F +NQSIIVSGESGAGKTVSAKY MRYFA+VGGS+  +     +TQ+E KVL SNPI+EA GNAKT RNDNSSRFGKY+EI FN ++ +IGANM TYLLEKSRVVFQ   ERNYHIFYQ+   C S D+       + + + + Y   G +  I GVDD+ E   T+ +F  LG        I +I++AILH GN+     +     I  N + L     LLG    Q+++WLC R I T  ETL KPLS+++A + RDA VK +YS +FDWIV   NK L + V ++                 KFI VLDIYGFETF  NSFEQFCIN+ANEKLQ  FN+HVFKLEQEEY+ E +EW+FID+Y+NQPCIDLIES+LG+LDLLDEECK+ KGSD NWC K+Y  HL KS +F+KP+ SNM FII HFA  VEY+  GF+EKNRD+VLEEQ+N+LKAS+ +L+AELF + +       +S      ++S+ S   IK +    +++ KKTVGSQFR SL  LM+ LN T PHY+RCIKPND K  F+                             WTY++F+ RY +L +   +  ++ +   + I+ TLI   + +RFG TK+FFR GQVA LEKLRG K+++   +IQ  +RG ++R+KY  IH+  + +QTY R  LA  KA  L + +A I IQ+ +R Y  RK + +   A++ ++   R     R  +   +E+  ++ QA +R F+ RRKF  + RG+IL+Q+HYRRRKA+  LK+LKIEA+S+ HIK VNKGLENKIIEL QKLD + KE+ ++++Q    K++++   +L  + E AK+  N V DL+ E+ +L+ EL  E+V + +  A +E +E+  K+    L +++EE              +K   S  E  +    + A++ + Q+    F  E+  HQ+LV+E+ +L+ + ENL  E   + S    P+ ++    S+ S   +      AD E   D  D     +   +    V+K+P+F  +S +           D+ ++++LQ  +  L ++  RL E ++++EDE    E       A D+ K   + NE D    E+  ++K I      G             +D+   +  +L++  E+  +LR  + D      S++K + G  D   I +E+ EL+ A+++QK+ NR +  ++E +    K  +   ++ L ++RK+ E+ Q  +G             Q+L L P+ +++  +Q+EI+R+  ENL L+E  D+   +  +LK+ LK +A +L+  E + +    ++++     ++    +   T+  RE  + +G+ +    +    IK+ I +L P +     P  L  Y++FM  R  D+  ++D++   L+  I  +K+ ++K  + +E + + L+N   L++  +QYSG +QF   N     +    ++DL+E+ ++  +L + ++Q ++K + + L P    + AIL HEAI    +   +  +    +  ++         S + L + L S + IL  H +   ++ QIF  + Y + A  LN LL R D+C +SKG+QI+YNLS  E W+R  KL +SGA   L P+ +A QLLQ    +D D + +C+MC  L   Q++KILN + P D +  R+    I KI++++K +     + S  L   T    P+  PF  + + L    +P+ L+L  L  L
Sbjct:   71 ECYIKGARIWIPDPDHIWRAAELLEDYKGQNKIKIQYEEGEESAISISDTKL-PHLRNPEILIGENDLTSLSYLNEPEVLYNLKVRFLEQNLIYTYCGIVLVAINPYEYLEIYGNDIIHAYSGQDMGAMDPHIYAVAEEAFKQMSRFEQNQSIIVSGESGAGKTVSAKYAMRYFAMVGGSQADE-----QTQVEAKVLASNPIMEAIGNAKTTRNDNSSRFGKYIEISFNKQHAIIGANMRTYLLEKSRVVFQASEERNYHIFYQL---CDSADDPEYEKFELGSADDFFYTSQGGAPVIKGVDDAAELKRTREAFTMLGFSGKNQMLILQIISAILHFGNVHISEKEGEACEIPANDKALTTTCKLLGIQESQMRMWLCHRKIETVGETLTKPLSESQAAFGRDALVKHIYSRVFDWIVTHINKNLRSTVKVH-----------------KFIGVLDIYGFETFQVNSFEQFCINYANEKLQQIFNMHVFKLEQEEYVREAIEWSFIDFYDNQPCIDLIESKLGILDLLDEECKMPKGSDANWCQKLYDKHLKKSKHFDKPRTSNMAFIINHFADRVEYQAEGFLEKNRDTVLEEQVNILKASEFELVAELFTEEDNMGGSQGSSAAHGRKRTSSTSTQPIKAQPKGASKQHKKTVGSQFRESLHLLMETLNATTPHYIRCIKPNDSKESFS-----------------------------WTYAEFFQRYRVLATFKLIVKNNMRKTCEAILPTLIADEEKYRFGKTKIFFRAGQVAYLEKLRGDKLKACGVMIQKHIRGWLQRRKYRRIHRSALLLQTYGRGLLARRKALYLRRTKAAINIQTMWRCYRERKAYRETFKAIVVLQAHIRAQFARRQYRGLLEEHKAVLIQAHIRAFLMRRKFRLVLRGIILVQSHYRRRKARLQLKLLKIEAKSVEHIKVVNKGLENKIIELQQKLDERAKELNVLKDQETTMKQLKVEMERLKSSDEVAKVSSNKVLDLEDELARLRAEL--EVVTRERDRAVREKIEM-MKENEEVLTSILEEKMSLKEQLEEANRRIKLQESNSEDFVKDQVEAAKRGLIQE----FEAERSHHQRLVKEHARLQQRLENLQGEMQVLTS----PTGHHHRTPSDISAISTESFASSADTEKRED--DEDQGYDTAKRKGEAVRKVPSFSEKSPAERLAPKKTEDVDVGLLLKLQNKVKDLEKDRARLLERLEKYEDEGGPGESGFIRDSAFDALKMQELENEKDKLKREVERLMKSIAATTNFGDNGGQVSPAAKEFLDQFEAMTDELERRREECLQLRAMMADRMITMHSIAKESYGGQD--DIVNEDNELEMAYKTQKDLNRLLQNQLENVEKELKRKDKAYQQELVELRKENERQQKLIG-------------QSLTLGPEAKIEATMQHEITRMTAENLDLRETIDKQSEQIRKLKKMLKIYAKKLKDGEAAEIAAELEQDE-----KDKGGATMGATVKLRE-RTYMGMFEYRREDEGALIKNLILELKPKVAAGLIP-GLPSYVLFMCVRHTDYINDDDKVKALLTGTINGIKKVVKKHTDDLERVTLWLANTCRLMHTLKQYSGDKQFQVDNQPRQNEMCLRNFDLSEYRQVFSDLAIWIYQTLIKFMQELLQPS--IVPAILEHEAIAGLTASKPSGLRGRSSSNARDLDDGKEDAHSLDALMRTLNSYMRILTQHAVDPELVKQIFRQLYYFMCAGALNNLLLRKDMCNWSKGMQIRYNLSHMEQWLRDNKLQESGAQLALDPIVQASQLLQAR-KTDSDVESICEMCSKLTIAQIIKILNLYTPVDEFEERVPISFIRKIQSRLKSRPDAAAAGSNTLLMDTKFTYPVTFPFNPSSILLDSVEVPEQLHLGFLKKL 1880          
BLAST of Dach-2 vs. TrEMBL
Match: A0A0F7VJF0 (Eka-NinaC protein (Fragment) OS=Euperipatoides kanangrensis OX=488523 GN=Eka-NinaC PE=2 SV=1)

HSP 1 Score: 1131.32 bits (2925), Expect = 0.000e+0
Identity = 738/1907 (38.70%), Postives = 1089/1907 (57.11%), Query Frame = 2
Query:   47 MALYEMYSKGVKIWIPDEESVWIGATVLQFHKEKNVIKIITDNGISKELNLSSKKCAPFLRNPDILIGQKDLTYLSYLNEPEVLYNLQIRFCERREIYTYCGIVLVAINPYQELSIYGKEIINAYHSQNSVDLDPHIFAVAENAFRRMSSFGENQSIIVSGESGAGKTVSAKYTMRYFALVGGSKTKQSFNLTETQIERKVLLSNPILEAFGNAKTIRNDNSSRFGKYLEILFNPRNQVIGANMCTYLLEKSRVVFQNLGERNYHIFYQIVTHCQSEDELLMNTGLVNNVEMYDYLRYGESLEIDGVDDSHEFLITKNSFLQLGIDLNKFKTICEILAAILHLGNIRF--RFHDATDSSIIENPELLKLIAGLLGCSIDQLKIWLCFRTISTFQETLHKPLSKAEAQYFRDAFVKTLYSNLFDWIVKQANKVLSTDVSINIKKKLKKTIVVNQEDKKKFIAVLDIYGFETFAENSFEQFCINFANEKLQLQFNLHVFKLEQEEYMNEGLEWTFIDYYNNQPCIDLIESRXXXXXXXXXXXXXXXXSDENWCCKIY-----SHHLNKSANFNKPKLSNMVFIIEHFAGPVEYKCAGFIEKNRDSVLEEQINLLKASDVQLIAELFRDSEIEIFDTNNXXXXXXXXXXXXXXXXXXQENTRKMKKTVGSQFRNSLKSLMDALNKTNPHYVRCIKPNDLKLPFTFCPERAVQQLRACGVLETIRLSAAGFPSRWTYSDFYHRYYILMSNFNVKNHDFKAGSQKIVETLITVPDAFRFGNTKLFFRPGQVALLEKLRGHKIESSVTLIQSILRGSIERKKYLIIHKLTVQIQTYIRRKLAIEKATKLSQIRAVIIIQSFYRMYLARKLFVKMKCAVLAIEKWRRKIITTRLKQAYKKENCVIICQAIVRRFIQRRKFLKIQRGVILIQNHYRRRKAKETLKILKIEARSINHIKFVNKGLENKIIELTQKLDTKEKEMCXXXXXXXXXXXXXXXXXXXXXAESAKIYQNTVQDLQTEIIQLKKELNREIVEKNKIFADKELLEINYKKKINYLENLIEELKSSPSVIEPNIICNGDEAQQ---SICQDE---HQKFINEQMDHQKLVREYEKLEMKYENLYKE-----------------FLFVKSSNQKPSIN--YDNQTSNDSETESTFSKDD--ADVESLSDKVDAKTTKEHXXXXXXXXXXLPNFISESISTAGDLAVVMQLQMNISSLSQENNRLKETVQQFEDELLKYEQCAEDSKGLVIHN-EYDN-ELLSIIKDIKGMDEHGLKSR----LIDEVANLKKKLKQSNEDYQKLRLHIFDGSM-----SKLTGNLDHESINSEEEELKRAFESQKEANRKMLKEIEGIKANNV----DLKKALFQIRKDKEQLQVQLGKQHLMIRHGVEYLQNLKLTPKERLDKFVQNEISRILLENLKLQERNDQIISETIELKRGLKYFAFRL------QKYEGSLVPNPNKEEDLLQLIQNVIYHSKMKTIGKRECYSEIGLIDLNMSELSIFIKSFIFDLSPSICLQYEPYHLVPYIIFMVTRKFDFYKEEDQMTNFLSKLIVALKRTIRKRRNYIEYLVMLLSNVFCLVNLXXXXXXXXXXXXLNTAEDIQHYFVHYDLNEFIRLLKELCVTLFQMILKTIVDNLLPQSLCIDAILVHEAIIDFLSKD--GTKYKSNIETQPKNTSFNVLTKNLQSVLEILKN--------HKIPQLIINQIFVHIAYLINAYCLNTLLFRTDLCYFSKGLQIKYNLSSFETWIRYQKLIDSGALQCLRPMTEAVQLLQTLIDSDEDAKFVCDMCEYLNTRQVVKILNNFNPRDGYGCRLSSGLIAKIETQMKIKRGDEPSESKLETPTVIEIPIDIPFIHNGVSLCRTIIPKPLYLSCL 5572
            M   E+Y KG  +W+PD   VW  A + +  K    +++  ++G  + L + +K   P LRNP ILIG+ DLT LSYL+EP VLYNLQ+RF +R  IYTYCGIVLVAINPY++L IYG + I  Y  Q   DLDPHIFAVAE A+ +M     NQSIIVSGESGAGKTVSAKY MRYFA VGGS         ET IE+KVL SNPI+EA GNAKT RNDNSSRFGKY+EI FN +  +IGANM TYLLEKSRVVFQ   ERNYHIFYQ+   C S D+  +    +++ + + Y   GES  I  +DD+H F  T+++F  LG D +    I  ILAA+LH GN+       ++  S I ++   L ++  LL    DQ+++WLC R  +T  E L KPLS ++A + RDA  K +Y+ LF+WIV   NK L+                       KFI VLDIYGFETF  NSFEQFCIN+ANEKLQ QFN HVFKLEQEEYM E +EW+ ID+Y+NQPCIDLIES+LG+LDLLDEECK+ KG+D  WC K++     SHH      F KP+LSN  FII HFA  V+Y+C GF+EKNRD+V+EEQ+N+LKAS + L+ ELF + +      +         + +        +  +  KKTVGSQFR+SL  LM+ LN T P YVRCIKPND KL FTF P+RA+QQLRACGVLETIR+SAAG+PSRWTY +F++RY +L    ++K +D K     I+E +I   D ++FG TK+FFR GQVA LEKLR  K+ +   LIQ  +RG + R +Y  +    +QIQ YIR  LA   A  L + +A I IQ + R Y   K +  ++ ++++++ + R +   +       +    I Q  VR ++ R K+ K  + ++L+Q+  RR  A+  LK LKIEARS+ H+K +N+GLENKII L QK+D   KE   +++   +  K++ L          K   + +  L+ EI+ L+ +L  E  EK +I  +KE   I  +K +        ELK    +    I     E ++   S  + E   H +F +E++++QK++++Y +LE ++ENL  E                  + ++S+  +P+ N   DN+      T S  + +D    +E++   + ++  KE         K       + +    D+ +V++LQ  I  L   N RL++ ++  +D     +      + L I + E +N +L      I+   E G K +    ++D+ + L+ +L++  ++  +LR  + + S+     SK     + E IN E+ EL + + +Q++  R++ KE++G K N      DL+K + ++R+D E+      +Q L+ +   +   +L+++P+ + +  +Q+EI+R+  ENL LQE+ D+      +LK+ LK +A +L      Q    SL+       D+   ++    +  M  +  +E  + +G+ +         IKS I DL PSI +   P  L  YI+FM  R  D+  +++++ + L+  I  +KR I+K+    E +V+ L+N+  L++  +QYSG + F   NT +  +    ++DL+E+ ++L ++ V ++Q I+K + + + P    + AIL HEAI     K   G + +S   TQ +NTS     K+L S+ + L N           P+ II+QIF  I Y I A  LN LL R DLC++SKG+Q++YN S  E W+R  KL + GA++ L P+ +A QLLQ    +DED   +CDMC+ L   Q++K+LN + P D +  R+    I KI+ +++ +RG+   +  ++T      P+  PF  + V L    IP+ L +S L
Sbjct:    4 MTTAELYVKGAGVWVPDPSLVWKAAVLAEDFKNTKKLEVAYEDGSKEILEVKNKDKLPPLRNPQILIGENDLTSLSYLHEPAVLYNLQVRFVDRNAIYTYCGIVLVAINPYEQLPIYGLDTIMLYRGQAMGDLDPHIFAVAEEAYTKMEREERNQSIIVSGESGAGKTVSAKYAMRYFATVGGS-------TAETNIEKKVLASNPIMEAIGNAKTTRNDNSSRFGKYIEINFNKQYHIIGANMRTYLLEKSRVVFQAPEERNYHIFYQL---CASFDQEDIKELQLSHQDNFLYTNQGESPNIHNIDDAHSFEETRSAFKLLGFDDDVQMNIFRILAAVLHFGNVNIIESEKESDQSRISKDDNHLSILCKLLAIDEDQMRMWLCRRKFTTVNEVLTKPLSVSQAMFSRDALAKHIYAQLFNWIVAGINKSLAFTAKAF-----------------KFIGVLDIYGFETFEINSFEQFCINYANEKLQQQFNQHVFKLEQEEYMKEAIEWSLIDFYDNQPCIDLIESKLGILDLLDEECKMPKGTDGTWCQKLFDKCKASHH------FEKPRLSNTAFIIHHFADNVQYECGGFLEKNRDTVIEEQLNILKASQIDLVVELFAEKKAAPSGKSRGPQVTVKSAVSTL------KTQKTHKKTVGSQFRDSLTLLMETLNATTPQYVRCIKPNDQKLSFTFDPKRAIQQLRACGVLETIRISAAGYPSRWTYVEFFNRYRVLSRTKDIKRNDMKTTCLNILEKIIKDTDKYKFGKTKIFFRAGQVAYLEKLRSDKMRACCILIQKHVRGWLHRNRYQRMRWAAIQIQRYIRGFLARRLARFLRRTKAAICIQRYLRGYYEWKKYQHIRRSIISLQSYARGMWARQHYVELLHDAKATIIQKCVRGWLARLKYQKSLKAIVLLQSCVRRMYARRELKKLKIEARSVEHVKKLNQGLENKIISLQQKMDQLTKENNQMKSYEAELIKLKNLIDARGGEAEMKRMSSRIDQLEKEILTLRADLLNEQTEKEEILNEKEKSIIELQKVLTVWNKDTAELKEKLCLANETIKNQEKELEEILISKSESEKMLHDEFESERVNYQKILKDYARLEQRFENLQSENQVMKKQTHQRTPSNLSTISIESTGTEPARNEEMDNEDLGYGSTRSMRALEDQHKKLENVDWSIASQVEKEEKEAQLKSEKPTVCVTRDDV----DIGLVLKLQQRIKELQDRNKRLEDKLENKDDLSPSEKHEMRPFEALRIQDLEMENAKLKDNFNKIRSTIETGNKDKQIQLIVDQHSALEDELERRRDECLQLRTLLANKSLDSHAISKEMYGGNDELIN-EDGELYQLYHAQRQIIRQLEKELQGNKVNYSNEIDDLRKEMGRLREDNER------QQKLIGQLTGDSFAHLQMSPEAKTEAIMQHEITRLTGENLDLQEKADEYKETIKQLKKRLKIYAKKLKDGGTGQSQRSSLLSPYGS--DVGTELERRDSNENMPAVKHKEV-NYLGMFEYKKESEPYLIKSLIIDLKPSIAVNLLP-GLPAYILFMCIRHTDYINDDEKVRSLLTSTINGIKRVIKKKHEDFEIVVLWLTNICRLLHNLKQYSGDKTFQVDNTPKQNEQCLRNFDLSEYRQILSDIAVWIYQGIVKIMEETIQP--FVVAAILEHEAIAGLSGKKPLGMRGRSMSTTQ-ENTSPTSPAKSLDSLNKALDNFYDGFIKFGSDPE-IISQIFRQIFYFICAGALNNLLLRKDLCHWSKGMQMRYNCSHMEQWLRDHKLQECGAVEQLSPIIQASQLLQAR-KTDEDVDSICDMCDKLTLSQIIKMLNLYTPADVFEERVPVSFIRKIQAKLQ-ERGEANPQLLMDTKHA--FPVRFPFNPSNVQLEDIEIPESLNISFL 1848          
BLAST of Dach-2 vs. TrEMBL
Match: A0A1V4JEV1 (Unconventional myosin-Va isoform D OS=Patagioenas fasciata monilis OX=372326 GN=MYO5A PE=3 SV=1)

HSP 1 Score: 1117.84 bits (2890), Expect = 0.000e+0
Identity = 723/1902 (38.01%), Postives = 1087/1902 (57.15%), Query Frame = 2
Query:   62 MYSKGVKIWIPDEESVWIGATVLQFHKEKN-VIKIITDNGISKELNLSSK-KCAPFLRNPDILIGQKDLTYLSYLNEPEVLYNLQIRFCERREIYTYCGIVLVAINPYQELSIYGKEIINAYHSQNSVDLDPHIFAVAENAFRRMSSFGENQSIIVSGESGAGKTVSAKYTMRYFALVGGSKTKQSFNLTETQIERKVLLSNPILEAFGNAKTIRNDNSSRFGKYLEILFNPRNQVIGANMCTYLLEKSRVVFQNLGERNYHIFYQIVTHCQSEDELLMNTGLVNNVEMYDYLRYGESLEIDGVDDSHEFLITKNSFLQLGIDLNKFKTICEILAAILHLGNIRFRFHDATDSSIIENPELLKLIAGLLGCSIDQLKIWLCFRTISTFQETLHKPLSKAEAQYFRDAFVKTLYSNLFDWIVKQANKVLSTDVSINIKKKLKKTIVVNQEDKKKFIAVLDIYGFETFAENSFEQFCINFANEKLQLQFNLHVFKLEQEEYMNEGLEWTFIDYYNNQPCIDLIESRXXXXXXXXXXXXXXXXSDENWCCKIYSHHLNKSANFNKPKLSNMVFIIEHFAGPVEYKCAGFIEKNRDSVLEEQINLLKASDVQLIAELFRDSEIEIFDTNNXXXXXXXXXXXXXXXXXXQ--ENTRKMKKTVGSQFRNSLKSLMDALNKTNPHYVRCIKPNDLKLPFTFCPERAVQQLRACGVLETIRLSAAGFPSRWTYSDFYHRYYILMSNFNVKNHDFKAGSQKIVETLITVPDAFRFGNTKLFFRPGQVALLEKLRGHKIESSVTLIQSILRGSIERKKYLIIHKLTVQIQTYIRRKLAIEKATKLSQIRAVIIIQSFYRMYLARKLFVKMKCAVLAIEKWRRKIITTRLKQAYKKENCVIICQAIVRRFIQRRKFLKIQRGVILIQNHYRRRKAKETLKILKIEARSINHIKFVNKGLENKIIELTQKLDTKEKEMCXXXXXXXXXXXXXXXXXXXXXA---------ESAKIYQNTVQDLQTEIIQLKKELNREIVEKNKI--FADKELLEINYKKKINYLENLIEELKSSPSVI-----EPNIICNGDEAQQSICQDEHQKFI-----------NEQMDHQKLVREYEKLEMKYENLYKEFLFVKSSNQKPSINYDNQTSNDSETESTFSKDDADVESLSDKVDAKTTKEHXXXXXXXXXXLPNFISESISTAGDLAVVMQLQMNISSLSQENNRLKETVQQFEDELLKYEQCAEDSKGLVIHNEYDNELLSIIKDIKGMDEHGLKSRLIDEVANLKKKLKQS-NEDYQKLRLHIFDGSMSKLTGNLDHESINSEEEELKRA-FESQKEANRK---------MLKEIEGIKANNVDLKKALFQIRKDKEQLQVQLGKQHLMIRHGVEYL----QNLK---------------LTPKERLDKFVQNEISRILLENLKLQERNDQIISETIELKRGLKYFAFRLQKYEGSLVPNPNKEEDLLQLIQNVIYHSKMKTIGKRECYSEIGLIDLNMSELSIFIKSFIFDLSP-SICLQYEPYHLVPYIIFMVTRKFDFYKEEDQMTNFLSKLIVALKRTIRKRRNYIEYLVMLLSNVFCLVNLXXXXXXXXXXXXLNTAEDIQHYFVHYDLNEFIRLLKELCVTLFQMILKTIVDNLLPQSLCIDAILVHEAI--IDFLSKDGTKYKSNIETQPKNTSFNVLTKNLQSVLEILKNHKIPQLIINQIFVHIAYLINAYCLNTLLFRTDLCYFSKGLQIKYNLSSFETWIRYQKLIDSGALQCLRPMTEAVQLLQTLIDSDEDAKFVCDMCEYLNTRQVVKILNNFNPRDGYGCRLSSGLIAKIETQMKIKRGDEPSESKLETPTVIEIPIDIPFIHNGVSLCRTIIPKPLYLSCLT 5575
            MY K  ++WIPD E VW  A +L+ +K  + V+++  + G   E  L  K K  P LRNPDIL+G+ DLT LSYL+EP VL+NL++RF + + IYTYCGIVLVAINPY++L IYG++IINAY  QN  D+DPHIFAVAE A+++M+    NQSIIVSGESGAGKTVSAKY MRYFA V GS        +E  +E KVL SNPI+E+ GNAKT RNDNSSRFGKY+EI F+ R ++IGANM TYLLEKSRVVFQ   ERNYHIFYQ+   C S       T  + N   + Y + G S  IDGVDD+ E L T+ +   LGI  +    I  ILA ILHLGN+ F   D+   ++    E L +   L+G   +++  WLC R ++T  ET  KP+SK  A   RDA  K +Y+NLF+WIV   NK L   V                  +  FI VLDIYGFETF  NSFEQFCIN+ANEKLQ QFN+HVFKLEQEEYM E + WT ID+Y+NQPCI+LIE+++G+LDLLDEECK+ KGSD+ W  K+Y+ HLNK A F KP+LSN  FII+HFA  VEY+C GF+EKN+D+V EEQI +LK+S  +L+ ELF+D E  +  T+ +       S T    +  +  + +++ KKTVG QFRNSL  LM+ LN T PHYVRCIKPND K PFTF  +RAVQQLRACGVLETIR+SAAGFPSRWTY +F+ RY +LM   +V + D K   + ++E LI   D ++FG TK+FFR GQVA LEK+R  K+ ++   IQ  +RG + RKKY+ + K  + IQ ++R   A   A  L + RA I IQ F RMY+ RK + +M+ A +A++   R  +     Q   +E+  +I Q  VR ++ R ++ +  + ++ +Q  YRR  AK  LK LKIEARS+   K ++ GLENKI++L +K+D + KE   +  ++   +       +  ++         E AK   N V  LQ EI +L+KEL++   EK  I  +ADK      YK +    E L+ ELK   +++     E N   + D+A++ I +   +K +           +E++ +Q L+ E+ +LE +Y++L K+ + +  S  KP     + T + +E+E TFS +  + E L  +++  + K+                        D+++ ++LQ  ++ L QE   L++ + + E++ L+  +  E+ +  +   E + E L      K  +      +L +E+  L+K L ++ + +        +   + +LT   +   +  EE  + R+   SQKEA +          +L++++ +K +  ++ +A   +++    L+ QL  Q     + +E L    Q LK               L P+ R++  +Q+EI+R+  ENL L E+ ++      +LK+ LK FA ++ + E   + N +  + + + I+ V    K K           G+++    +    +K+ I +L P  + +   P  L  YI+FM  R  D+  ++ ++ + L+  I  +K+ ++KR +  E +   LSN    ++  +QYSG + F   NT    +H   ++DL E+ ++L +L + ++Q +++ +++N+L Q + +  +L HE I  +  +   G + +++        + + + + L S   ++  H +   +I Q+   + Y+I A  LN LL R D+C +SKG+QI+YN+S  E W+R + L++SGA + L P+ +A QLLQ    +DEDA+ +C MC  L T Q+VK+LN + P + +  R+    I  I+ +++  R D P   +L        P+  PF  + ++L    IP  L L  ++
Sbjct:   98 MYVKYARVWIPDPEEVWKSAELLKDYKPGDKVLQLRLEEGKDLEYCLDPKTKELPPLRNPDILVGENDLTALSYLHEPAVLHNLKVRFIDSKLIYTYCGIVLVAINPYEQLPIYGEDIINAYSGQNMGDMDPHIFAVAEEAYKQMARDERNQSIIVSGESGAGKTVSAKYAMRYFATVSGSA-------SEANVEEKVLASNPIMESIGNAKTTRNDNSSRFGKYIEIGFDKRYRIIGANMRTYLLEKSRVVFQAEEERNYHIFYQL---CASAALPEFQTLRLGNANYFHYTKQGGSPVIDGVDDAKEMLNTRQACTLLGISDSYQMGIFRILAGILHLGNVEFASRDSDSCAVPPKHEPLTIFCDLMGVEYEEMAHWLCHRKLATATETYIKPISKLHAINARDALAKHIYANLFNWIVDHVNKALHATVK-----------------QHSFIGVLDIYGFETFEINSFEQFCINYANEKLQQQFNMHVFKLEQEEYMKEQIPWTLIDFYDNQPCINLIEAKMGVLDLLDEECKMPKGSDDTWAQKLYNTHLNKCALFEKPRLSNKAFIIKHFADKVEYQCEGFLEKNKDTVYEEQIKVLKSSKFKLLPELFQDEEKVLSPTSAAPSGRVPLSRTAVKAAKARPGQASKEHKKTVGHQFRNSLHLLMETLNATTPHYVRCIKPNDFKFPFTFDEKRAVQQLRACGVLETIRISAAGFPSRWTYQEFFSRYRVLMKQRDVLS-DRKQTCKNVLEKLILDKDKYQFGKTKIFFRAGQVAYLEKIRADKLRAACIRIQKTIRGWLMRKKYVRMRKAAIAIQRHVRGYQARCYAKFLRRTRAAITIQKFQRMYVVRKRYQRMRDATIALQALLRGYMARNKYQMMLREHKSVIIQKHVRGWLARLRYGRTLKAIVYLQCCYRRMMAKRELKKLKIEARSVERYKKLHIGLENKIMQLQRKIDEQNKEYKSLLEKMSSLEITYSTETEKLRSDVERLRMSEEEAKNATNRVLSLQDEIAKLRKELHQTQAEKKTIEEWADK------YKHET---EQLVSELKEQNTLLKTEKEELNRRIH-DQARE-ITETMEKKLVEETKQLELDLNDERLRYQNLLNEFSRLEERYDDL-KDEMNLMVSVPKPGHKRTDSTHSSNESEYTFSSEITEAEDLPVRMEEPSEKK---------------------APLDMSLFLKLQKRVTELEQEKQSLQDELDRKEEQALR-AKAKEEERPPIRGAELEYESL------KRQELESENKKLKNELNELQKALTETRSPEVTAPGAPAYRVLLDQLTSVSEELEVRKEEVLILRSQLVSQKEAIQPKNTMTDSTILLEDVQKMK-DKGEIAQAYIGLKETNRLLESQLQSQKKSHENELELLRGEIQGLKEENNRQQQLLAQNLQLPPEARIEASLQHEITRLTNENLDLMEQLEKQDKTVRKLKKQLKVFAKKIGELEVGQMENISPGQIIDEPIRPVNIPRKEKDFQ--------GMLEYKKEDEQKLVKNLILELKPRGVAVNLIP-GLPAYILFMCVRHADYLNDDQKVRSLLTSTINGIKKVLKKRGDDFETVSFWLSNTCRFLHCLKQYSGEEGFMKHNTPRQNEHCLTNFDLAEYRQVLSDLAIQIYQQLVR-VLENIL-QPMIVSGMLEHETIQGVSGVKPTGLRKRTSSIADEGTYTLDSIIRQLNSFHSVMCQHGMDPELIKQVVKQMFYIIGAVTLNNLLLRKDMCSWSKGMQIRYNVSQLEEWLRDKNLMNSGAKETLEPLIQAAQLLQVKKKTDEDAEAICSMCNALTTAQIVKVLNLYTPVNEFEERVLVSFIRTIQMRLR-DRKDSP---QLLMDAKHIFPVTFPFNPSSLALETIQIPASLGLGFIS 1915          
BLAST of Dach-2 vs. Ensembl Cavefish
Match: myo5aa (myosin VAa [Source:ZFIN;Acc:ZDB-GENE-041027-2])

HSP 1 Score: 1088.95 bits (2815), Expect = 0.000e+0
Identity = 717/1892 (37.90%), Postives = 1069/1892 (56.50%), Query Frame = 2
Query:   83 IWIPDEESVWIGATVLQFHKEKN-VIKIITDNGISKELNLSSK-KCAPFLRNPDILIGQKDLTYLSYLNEPEVLYNLQIRFCERREIYTYCGIVLVAINPYQELSIYGKEIINAYHSQNSVDLDPHIFAVAENAFRRMSSFGENQSIIVSGESGAGKTVSAKYTMRYFALVGGSKTKQSFNLTETQIERKVLLSNPILEAFGNAKTIRNDNSSRFGKYLEILFNPRNQVIGANMCTYLLEKSRVVFQNLGERNYHIFYQIVTHCQSEDELLMNTGLVNNVEMYDYLRYGESLEIDGVDDSHEFLITKNSFLQLGIDLNKFKTICEILAAILHLGNIRFRFHDATDSSIIENPELLKLIAGLLGCSIDQLKIWLCFRTISTFQETLHKPLSKAEAQYFRDAFVKTLYSNLFDWIVKQANKVLSTDVSINIKKKLKKTIVVNQEDKKKFIAVLDIYGFETFAENSFEQFCINFANEKLQLQFNLHVFKLEQEEYMNEGLEWTFIDYYNNQPCIDLIESRXXXXXXXXXXXXXXXXSDENWCCKIYSHHLNKSANFNKPKLSNMVFIIEHFAGPVEYKCAGFIEKNRDSVLEEQINLLKASDVQLIAELFRDSEIEIFDTNNXXXXXXXXXXXXXXXXXXQ-ENTRKMKKTVGSQFRNSLKSLMDALNKTNPHYVRCIKPNDLKLPFTFCPERAVQQLRACGVLETIRLSAAGFPSRWTYSDFYHRYYILMSNFNVKNHDFKAGSQKIVETLITVPDAFRFGNTKLFFRPGQVALLEKLRGHKIESSVTLIQSILRGSIERKKYLIIHKLTVQIQTYIRRKLAIEKATKLSQIRAVIIIQSFYRMYLARKLFVKMKCAVLAIEKWRRKIITTRLKQAYKKENCVIICQAIVRRFIQRRKFLKIQRGVILIQNHYRRRKAKETLKILKIEARSINHIKFVNKGLENKIIELTQKLDTKEKE---------MCXXXXXXXXXXXXXXXXXXXXXAESAKIYQNTVQDLQTEIIQLKKELNREIVEKNKIFADKELLEINYKKKINYLENLIEELKSSPSVI--EPNIICNGDEAQQSICQDEHQKFINEQMD------------HQKLVREYEKLEMKYENLYKEFLFVKSSNQKPSINYDNQTSNDSETESTFSKDDADVESLSDKVDAKTTKEHXXXXXXXXXXLPNFISESISTAGDLAVVMQLQMNISSLSQE----NNRLKETVQQF---------------EDELLKYEQCAEDSKGLVIH-NEYDNELLSIIKDIKGMDEHGLKSRLIDEVANLKKKLKQSNEDYQKLRLHIFDGSMS-----KLTGNLDH-ESIN--SEEEELKRAFESQKEANRKMLKEIEGIKANNVDLKKALFQIRKDKEQLQVQLGKQHLMI----RHGVEYLQNLKLTPKERLDKFVQNEISRILLENLKLQERNDQIISETIELKRGLKYFAFRLQKYEGSLVPNPNKEEDLLQLIQNVIYHSKMKTIGKRECYSEIGLIDLNMSELSIFIKSFIFDLSP-SICLQYEPYHLVPYIIFMVTRKFDFYKEEDQMTNFLSKLIVALKRTIRKRRNYIEYLVMLLSNVFCLVNLXXXXXXXXXXXXLNTAEDIQHYFVHYDLNEFIRLLKELCVTLFQMILKTIVDNLLPQSLCIDAILVHEAI--IDFLSKDGTKYKSNIETQPKNTSFNVLTKNLQSVLEILKNHKIPQLIINQIFVHIAYLINAYCLNTLLFRTDLCYFSKGLQIKYNLSSFETWIRYQKLIDSGALQCLRPMTEAVQLLQTLIDSDEDAKFVCDMCEYLNTRQVVKILNNFNPRDGYGCRLSSGLIAKIETQMKIKRGDEPSESKLETPTVIEIPIDIPFIHNGVSLCRTIIPKPLYLSCLT 5575
            +WIPD E VW  A + + +K+ + ++ +  ++G   E  L  K K  P LRNPDIL+G+ DLT LSYL+EP VL+NL++RF + + IYTYCGIVLVAINPY+ L IYG +IINAY  QN  D+DPHIFAVAE A+++M+    NQSIIVSGESGAGKTVSAKY MRYFA V GS +       E  +E KVL SNPI+EA GNAKT RNDNSSRFGKY+EI F+ +  +IGANM TYLLEKSRVVFQ   ERNYHIFYQ+       +   +  G  N+   + Y + G +  IDGVDD+ E   T+N+F+ LGI+ +    + ++LAAILHLGN+  +  DA  S I  N   L +   L+G +   +  WLC R + T  ET  KP+ K +A   RDA  K +Y+ LF+WIV   NK L + V                  +  FI VLDIYGFETF  NSFEQFCIN+ANEKLQ QFN+HVFKLEQEEYM E + WT ID+Y+NQPCI+LIE+++G+LDLLDEECK+ KGSD++W  K+Y+ HL     F KP++SN  FII+HFA  VEY+C GF+EKN+D+V EEQI++LKAS   L+ ELF+D E     T            +      K  +++++ KKTVG QFRNSL+ LM+ LN T PHYVRCIKPND K  FTF P+RAVQQLRACGVLETIR+SAAGFPSRWTY +F+ RY +LM   +V   D K   + ++E L+  PD ++FG TK+FFR GQVA LEKLR  K+ ++   IQ  +R  + RKK+L + +  + IQ ++R   A   AT L + RA IIIQ + RMY+AR ++ + + A LA++   R  +  +L +  ++   VII Q +VR ++ R+ + +    ++ +Q   RR +AK  LK LKIEARS+ H K +N G+ENKI++L +K+D + KE            + +    E+    L+      E AK   N V  LQ E+ +L+ EL     EK  I    E     Y+   + +E +I ELK   S++  E N +    + Q     ++ Q+ + E+              +Q L+ E+ +LE KY++L KE + +  +  KP     + T + +E+E T++ + A+ E  S  ++                  P+          D+A+ ++LQ  ++ L QE     N L    +QF               E E LK ++   ++K L  + N+    L+                 L+D++ +  ++L+   E+   LR  +     +      +T  L H E ++  ++ +E+ +A+   K+ NR +  +++              Q R  + +L+V  G+   +     R      QNL+L P+ R++  +Q+EI+R+  ENL L E+ ++      +LK+ LK FA ++   EG  + N +  +   + I+ V       +I +RE   + G+++    +    +K+ I +L P  + +   P  L  YI+FM  R  D+  ++ ++   L+  I ++K+ ++KR +  E +   L+N    ++  +QYSG +QF   NT +  +H   ++DL E+ ++L +L + ++Q ++K + +N+L Q + +  +L HE I  +  +   G + +++        + + + + L S   I+  H     +I Q+     Y+I A  LN LL R D+C +SKG+QI+YN+S  E W+R + L+  GA++ L+P+ +A QLLQ    +DEDA+ +C MC  L T Q+VK+LN + P + +  R+S   I  I+T+++    D     +L   T I  P+  PF  + ++L    IP  L L+ LT
Sbjct:   20 VWIPDPEEVWRSAELTKDYKQGDALLHLQLEDGTDLEHKLDPKTKNLPHLRNPDILVGENDLTALSYLHEPAVLHNLKVRFIDSKLIYTYCGIVLVAINPYETLPIYGTDIINAYSGQNMGDMDPHIFAVAEEAYKQMARDERNQSIIVSGESGAGKTVSAKYAMRYFATVSGSAS-------EANVEEKVLASNPIMEAIGNAKTTRNDNSSRFGKYIEIGFDKKYHIIGANMRTYLLEKSRVVFQADEERNYHIFYQLCASAHLPEFKALKLGGAND---FHYTKQGRNPVIDGVDDAKEMSTTRNAFILLGINESYQMGLFQVLAAILHLGNVEVKDRDADSSIIPPNNRHLTVFCELMGVTYQDMSHWLCHRKLKTATETYIKPIPKLQAINARDALAKHIYAKLFNWIVDHVNKALHSTVK-----------------QHSFIGVLDIYGFETFEINSFEQFCINYANEKLQQQFNMHVFKLEQEEYMKEQIPWTLIDFYDNQPCINLIEAKMGILDLLDEECKMPKGSDDSWAQKLYNTHLKTCTLFEKPRMSNKAFIIQHFADKVEYQCDGFLEKNKDTVNEEQIHVLKASKFDLLVELFQDEEKATSPTGAPPTTGGRTRLSVKPDKGKPGKSSKEHKKTVGLQFRNSLQLLMETLNATTPHYVRCIKPNDYKHAFTFDPKRAVQQLRACGVLETIRISAAGFPSRWTYQEFFSRYRVLMKQKDVLA-DKKMTCKNVLEKLVQDPDKYQFGKTKIFFRAGQVAYLEKLRADKLRAACIRIQKTIRCWLARKKFLRMKRAAITIQRHVRGYQARCLATFLRRTRAAIIIQKYQRMYVARTMYRRKQAAALAMQCILRAYMARQLYKLLREHKAVII-QKMVRGWLARQWYKRSLDALVYLQCCVRRMRAKRELKKLKIEARSVEHYKKLNIGMENKIMQLQRKVDEQNKENRTLTERLNGLEVAHTAESERLRRELSRLRCAEEDAKNSNNRVITLQEELERLRAELQSTQKEKKAI----EDWAQTYQ---DEMEKMISELKDQNSLLKNEKNDLNRIIQEQGQQWTEKMQRALKEETTQLESDLNEERSRYQNLLTEHLRLEEKYDDL-KEEISLSVNVPKPGHRRTDSTHSSNESEYTYNSEFAESEEGSRGME------------------PSL---------DMALFLKLQKRVTELEQEKQGLQNELDRKDEQFQRDHEEHKKARSAELEYESLKRQELESENKKLKHNLNDMRQSLMGNTGAASAAPGSPAYKVLLDQLNSSNEELEVRKEEVLILRSQLVSQKEAMQHKETMTEPLHHVEDVHKLTDAKEISQAYMGLKDTNRLLESQLQS-------------QRRSHESELEVLRGELQSVKEENNRQQQLLAQNLQLPPEARIEASLQHEITRLTNENLDLMEQLEKQDKTVRKLKKQLKVFAKKINDLEGGQIENVSPGQMADEPIRPV-------SIPRREKDFQ-GMLEYKKEDELKLVKNLILELKPRGVAVNLIP-GLPAYILFMCLRHADYINDDQKVRALLTSTINSIKKILKKRGDDFETVSFWLANTCRFLHCLKQYSGDEQFMKYNTPKQNEHCLSNFDLAEYRQVLSDLAIQIYQQLIKCM-ENIL-QPMIVSGMLEHETIQGVSGVKPTGLRKRTSSIADEGTYTLDSIIRQLNSFHSIMCQHGTDPELIKQVVKQQFYIIGAVTLNNLLLRKDMCSWSKGMQIRYNVSQLEEWLRDKNLVVCGAMETLQPLIQAAQLLQVKKKTDEDAEAICSMCNALTTSQIVKVLNLYTPVNAFEERVSVTFIRTIQTRLR----DRKESPQLLLDTKIIYPVTFPFNPSPLALETIQIPGSLNLAFLT 1819          
BLAST of Dach-2 vs. Ensembl Cavefish
Match: myo5b (myosin VB [Source:ZFIN;Acc:ZDB-GENE-031219-7])

HSP 1 Score: 988.793 bits (2555), Expect = 0.000e+0
Identity = 675/1805 (37.40%), Postives = 999/1805 (55.35%), Query Frame = 2
Query:  338 YTYCGIVLVAINPYQELSIYGKEIINAYHSQNSVDLDPHIFAVAENAFRRMSSFGENQSIIVSGESGAGKTVSAKYTMRYFALVGGSKTKQSFNLTETQIERKVLLSNPILEAFGNAKTIRNDNSSRFGKYLEILFNPRNQVIGANMCTYLLEKSRVVFQNLGERNYHIFYQI-VTHCQSEDELLMNTGLVNNVEMYDYLRYGESLEIDGVDDSHEFLITKNSFLQLGIDLNKFKTICEILAAILHLGNIRF-RFHDATDSSIIENPELLKLIAGLLGCSIDQLKIWLCFRTISTFQETLHKPLSKAEAQYFRDAFVKTLYSNLFDWIVKQANKVLSTDVSINIKKKLKKTIVVNQEDKKKFIAVLDIYGFETFAENSFEQFCINFANEKLQLQFNLHVFKLEQEEYMNEGLEWTFIDYYNNQPCIDLIESRXXXXXXXXXXXXXXXXSDENWCCKIYSHHLNKSANFNKPKLSNMVFIIEHFAGPVEYKCAGFIEKNRDSVLEEQINLLKASDVQLIAELFRDSEIEIFDTNNXXXXXXXXXXXXXXXXXXQENTRKMKKTVGSQFRNSLKSLMDALNKTNPHYVRCIKPNDLKLPFTFCPERAVQQLRACGVLETIRLSAAGFPSRWTYSDFYHRYYILMSNFNVKNHDFKAGSQKIVETLITVPDAFRFGNTKLFFRPGQVALLEKLRGHKIESSVTLIQSILRGSIERKKYLIIHKLTVQIQTYIRRKLA-----------IEKATKLSQIRAVIIIQSFYRMYLARKLFVKMKCAVLAIEKWRRKIITTRLKQAYKKENCVIICQAIVRRFIQRRKFLKIQRGVILIQNHYRRRKAKETLKILKIEARSINHIKFVNKGLENKIIELTQKLDTKEKEMCXXXXXXXXXXXXXXXXXXXXXAESAKIYQNTVQDLQTEIIQLKKELNREIVEKNKIFADKELLEINYKKKINYLENL--IEELKSSPSVIEP------NIICNGDEAQQSICQDE---HQKFINEQMDHQKLVREYEKLEMKYENLYKEFLFVKSSNQKPSINYDNQTSNDSET--ESTFSKDDADVESLSDKVDAKTTKEHXXXXXXXXXXLPNFISESISTAGDLAVVMQLQMNISSLSQENNRLKETVQQFEDELLKYEQCAEDSK-----GLVIHNEYDNELLSIIKDIKGMDEHGLKSRLIDEVAN-------------LKKKLKQSNE--DYQK---LRLHIFDGSMSKLT-GNLDHESIN------SEEEELKRAFESQKEANRKMLKEIEGIKANNVDLKKALFQIRKDKEQLQVQLGKQHLMIRHGVEYLQNLKLTPKERLDKF-VQNEISRILLENLKLQERNDQIISETIELKRGLKYFAFRLQKYEGSLVPNPNKEEDLLQLIQNVIYHSKMKTIGKRECYSEIGLIDLNMSELSIFIKSFIFDLSPSICLQYEPYHLVPYIIFMVTRKFDFYKEEDQMTNFLSKLIVALKRTIRKRRNYIEYLVMLLSNVFCLVNLXXXXXXXXXXXXLNTAEDIQHYFVHYDLNEFIRLLKELCVTLFQMILKTIVDNLLPQSLCIDAILVHEAIIDFLSKDGTKYKSNIETQ---PKNTSFNVLTKNLQSVLEILKNHKIPQLIINQIFVHIAYLINAYCLNTLLFRTDLCYFSKGLQIKYNLSSFETWIRYQKLIDSGALQCLRPMTEAVQLLQTLIDSDEDAKFVCDMCEYLNTRQVVKILNNFNPRDGYGCRLSSGLIAKIETQMKIKRGDEPSESKLETPTVIEIPIDIPFIHNGVSLCRTIIPKPLYLSCL 5572
            + + GIVLVAINPY++L IYG+E+INAY  QN  D++PHIFAVAE A+++M+   +NQSIIVSGESGAGKTVSAKY MRYFA VGGS         +T +E KVL S+PI+EA GNAKT RNDNSSRFGKY++I F+ R  +IGANM TYLLEKSRVVFQ   ERNYHIFYQ+  + C  E + L  T    + E + Y  +GE++ I+GV+D+ +   T+ +   LG+      +I +I+A+ILHLGN+      D     I  +   L     LLG  ++Q++ WLC R + T  ET  K +S A+A   RDA  K +Y++LFDWIV+  NK L T                    +  FI VLDIYGFETF  NSFEQFCIN+ANEKLQ QFN HVFKLEQEEYM E + WT ID+Y+NQPCIDLIE++LG+LDLLDEECK+ KG+D+NW  K+YS HL KS +F KP++SN  FI+ HFA  VEY+C GF+EKNRD+V EEQIN+LKAS  QL+A+LF++ +             S + + +      + + R+ +KTVG QFRNSL  LM+ LN T PHYVRCIKPND K  F F   RAVQQLRACGVLETIR+SAAG+PSRWTY DFY RY +LM+  ++   D K   + ++E+LI  PD F+FG TK+FFR GQVA LEKLR  K   +   IQ  +RG ++R++YL I K  + +Q Y R  LA            E A  L   +A +I Q  YRM   R+ ++ ++ AV+ I+ + R + T RL Q +   +  II Q  VR ++ R+KFL+ +   I+IQ  YRR  AK  LK LKIEARS+  IK +N G+ENKI++L +K+D + KE      QL          +   Q E   +   + Q   T++  +++EL +      +  A ++ LE  Y  +   LE +  +EEL+   S+++         I      + S  Q E     +   E++ +Q L++E  +LE + +NL +E  F     + PS    NQ+S  SE+   S    D ++ + +  ++D    +                     + A DL+V M+LQ  +  L QE  RL+  +++ E EL +++     S+      L  ++    EL S  K +K  D + L+  L+D  +              L  +LK +NE  D +K   L L     S SK T  N +H +++      +E+ EL  A++  K+  R +  +++     + D  +AL          Q+++ K+ L  +   E L +    P E L +F VQ EI+R+  ENL L+E  +++     +LK+ L+ +  ++Q+ E S            +L + V    K K           G+++    + ++ I++ + D+ P +     P  L  YI+FM  R  D+  ++ ++ + L+  I A+K+ ++K  +  E     L+N   L++  +QYSG + F   NT +  +H   ++DL E+ ++L +L + ++Q ++K I + +L Q + + A+L   ++            S+++ +   P   +   L + L     I+  H +   I  Q+   + Y INA  LN LL R D+C +S G+Q++YN+S  E W+R + L  SG L  + P+ +A QLLQ    + +DA+ +C +C  L T+Q+VKILN + P + +  R++   I  I+ +++    D     +L   T    P+  P+  + +SL    +P  L L  L
Sbjct:   11 FCFTGIVLVAINPYEQLQIYGEEVINAYSGQNMGDMNPHIFAVAEEAYKQMARDEKNQSIIVSGESGAGKTVSAKYAMRYFATVGGSA-------NDTNVEEKVLASSPIMEAIGNAKTTRNDNSSRFGKYIQIGFDRRFHIIGANMRTYLLEKSRVVFQAEDERNYHIFYQLCASACLPEFKDLALT----SAEDFTYTSFGENIFIEGVNDAEDLEKTREALSLLGVKEIHQMSIFKIIASILHLGNVEIVSERDGESCHINRDDSHLHHFCQLLGVELEQMEHWLCHRKLVTTSETYVKNMSCAQATNARDALAKHIYAHLFDWIVEHVNKALHTS-----------------SKQHSFIGVLDIYGFETFEINSFEQFCINYANEKLQQQFNSHVFKLEQEEYMKEQIPWTLIDFYDNQPCIDLIEAKLGILDLLDEECKVPKGTDQNWTQKLYSQHL-KSDHFEKPRMSNTSFIVVHFADKVEYQCDGFLEKNRDTVYEEQINILKASKFQLVADLFQEGK---EGPAPPPSGKSSRINVRPAKPAIKGHNREHRKTVGHQFRNSLHLLMETLNATTPHYVRCIKPNDSKEAFVFDSRRAVQQLRACGVLETIRISAAGYPSRWTYLDFYSRYRVLMTKKDMTVGDKKQVCRNLLESLIKDPDKFQFGKTKIFFRAGQVAYLEKLRADKFRFACIKIQKTVRGWLQRRRYLKIRKSAIMLQRYGRGYLAPYFAWIYCIYLTEHAEYLRLTKAALICQKQYRMVRVRRAYLTIRQAVITIQAFTRGMFTRRLYQEFLLHHKAIIIQRTVRGWLDRKKFLRARNAAIVIQCAYRRVLAKRQLKQLKIEARSVKRIKELNIGMENKIVQLQRKMDDQSKEYKNQNEQLSVTNTALGTEVNKLQKELETL--RSRQGDNTQLTSMQEELEKLRAALQESHAQRKRLEEEYSSEKLGLEQVRRVEELEKENSMLKTEKEEMNQKIRRSTSQEGSASQKEARLQAELDEERLRYQNLLKEISRLEQRCDNLQEE--FAPGHRRNPS----NQSSIGSESPFPSIAMSDVSETDGVIQQIDDMGPE---------------------NAAMDLSVFMKLQKRVRDLEQERKRLQTNLEKME-ELSQHKVSNSTSEVDGNTDLAYNSLKRQELESENKKLKN-DLNELRKALVDRASESCSSNELQDSYNLLLSQLKAANEELDVRKEEVLMLKTQIVSSSKATPDNTNHIALSEDWGYLNEDGELGLAYQGLKQVARLLETQLQSQSRKHQDELEAL--------HTQIEVLKEDLEKKQ--ETLNHFNTLPPEALVEFSVQQEITRLTNENLDLKEVMEKLEKNERKLKKQLRIYIKKVQELEVSQAVAAQSSRARPELTRQVTVQRKDKDFE--------GMLEYIKEDEALLIRTLVTDMKPHVVSATVPC-LPAYILFMCIRHADYINDDQKVHSMLTSTINAVKKVLKKNNDDFEMTSFWLANTSRLLHCLKQYSGDEAFMTQNTPKQNEHCLKNFDLAEYRQVLSDLSIQIYQQLIK-IAEAIL-QPMIVSAMLESGSLTGVKPMGYRNRSSSMDCETGGPGGYTLEALIRQLGQFNTIMGEHGLDPEIGQQVIRQLFYSINAVTLNNLLLRKDVCSWSTGMQLRYNISQMEEWLRGRNLHQSGVLATIEPLIQAAQLLQVKKKTSQDAEAICTLCSALTTQQIVKILNLYTPLNEFEERVTVSFIRDIQNRLQ----DRIENKQLLVDTKHTFPVLFPYTPSALSLETIHMPASLNLDFL 1727          
BLAST of Dach-2 vs. Ensembl Cavefish
Match: myo5ab (myosin VAb [Source:ZFIN;Acc:ZDB-GENE-050411-72])

HSP 1 Score: 968.763 bits (2503), Expect = 0.000e+0
Identity = 675/1899 (35.55%), Postives = 1007/1899 (53.03%), Query Frame = 2
Query:   62 MYSKGVKIWIPDEESVWIGATVLQ-FHKEKNVIKIITDNGISKELNLSSKKCA-PFLRNPDILIGQKDLTYLSYLNEPEVLYNLQIRFCERREIYTYCGIVLVAINPYQELSIYGKEIINAYHSQNSVDLDPHIFAVAENAFRRMSSFGE-NQSIIVSGESGAGKTVSAKYTMRYFALVGGSKTKQSFNLTETQIERKVLLSNPILEAFGNAKTIRNDNSSRFGKYLEILFNPRNQVIGANMCTYLLEKSRVVFQNLGERNYHIFYQIVTHCQSEDELLMNTGLVNNVEMYDYLRYGESLEIDGVDDSHEFLITKNSFLQLGIDLNKFKTICEILAAILHLGNIRFRFHDATDSSIIENPELLKLIAGLLGCSIDQLKIWLCFRTISTFQETLHKPLSKAEAQYFRDAFVKTLYSNLFDWIVKQANKVLSTDVSINIKKKLKKTIVVNQEDKKKFIAVLDIYGFETFAENSFEQFCINFANEKLQLQFNLHVFKLEQEEYMNEGLEWTFIDYYNNQPCIDLIESRXXXXXXXXXXXXXXXXSDENWCCKIYSHHLNKSANFNKPKLSNMVFIIEHFAGPVEYKCAGFIEKNRDSVLEEQINLLKASDVQLIAELFRDSEIEIFDTNNXXXXXXXXXXXXXXXXXXQENTRKMKKTVGSQFRNSLKSLMDALNKTNPHYVRCIKPNDLKLPFTFCPERAVQQLRACGVLETIRLSAAGFPSRWTYSDFYHRYYILMSNFNVKNHDFKAGSQKIVETLITVPDAFRFGNTKLFFRPGQVALLEKLRGHKIESSVTLIQSILRGSIERKKYLIIHKLTVQIQTYIRRKLAIEKATKLSQIRAVIIIQSFYRMYLARKLFVKMKCAVLAIEKWRRKIITTRLKQAYKKENCVIICQAIVRRFIQRRKFLKIQRGVILIQNHYRRRKAKETLKILKIEARSINHIKFVNKGLENKIIELTQKLD--TKEKEMCXXXXXXXXXXXXXXXXXXXXXAESAKIYQNTVQDLQTEIIQLKKELNR--EIVEKNKIFADKELLEINYKKKINYLENLIEELKSSPSVIEPNIICNGDEAQQSICQDEHQKFIN-----EQMDHQKLVREYEKLEMKYENLYKEFLFVKSSNQKPSINYDNQTSNDSETESTFSKDDADVESLSDKVDAKTTKEHXXXXXXXXXXLPNFISESISTAG-----DLAVVMQLQMNISSLSQENNRLKETVQQFEDELLKY-----EQCAEDSKGLVIHNEYD------------------NELLSIIKDIKGMDEHGLKSR----LIDEVANLKKKLKQSNEDYQKLRLHIF--------------DGSMSKLTGNLDHESINSEEEELKRAFESQKEANRKMLKEIEGIKANNVDLKKALFQIRKDKEQLQVQLGKQHLMIRHGVEYLQNLKLTPKERLDKFVQNEISRILLENLKLQERNDQIISETIELKRGLKYFAFRLQKYEGSLVPNPNKEEDLLQLIQNVIYHSKMKTIGKRECYSEIGLIDLNMSELSIFIKSFIFDLSP-SICLQYEPYHLVPYIIFMVTRKFDFYKEEDQMTNFLSKLIVALKRTIRKRRNYIEYLVMLLSNVFCLVNLXXXXXXXXXXXXLNTAEDIQHYFVHYDLNEFIRLLKELCVTLFQMILKTIVDNLLPQSLCIDAILVHEAIIDFLSKDGTKYKSNIETQPKNTSFNV--LTKNLQSVLEILKNHKIPQLIINQIFVHIAYLINAYCLNTLLFRTDLCYFSKGLQIKYNLSSFETWIRYQKLIDSGALQCLRPMTEAVQLLQTLIDSDEDAKFVCDMCEYLNTRQVVKILNNFNPRDGYGCRLSSGLIAKIETQMKIKRGDEPSESKLETPTVIEIPIDIPFIHNGVSLCRTIIPKPLYLSCLT 5575
            +YSK  ++WIPD   VW  A + + +      +++  ++G   E  L  K    P LRNPDIL+G+ DLT LSYL+EP VL+NL +RF + + IYTYCGI+LVAINPY+ L IYG +IINAY  QN  D+DPHIFAVAE A+++M+ F E NQSIIVSGESGAGKTVSAKYTMRYFA V GS T       ET +E KVL S+PI+EA GNAKT RNDNSSRFGKY+EI F+    +IGANM TYLLEKSRVVFQ   ERNYHIFYQ+       +   +  G  ++   +     G +  IDGVDD  E   T+ +F  LGI   +   + +ILAAILHLGN+      + +SS+      L +   LL  S + +  WLC + + T  ET +KPL+K EA   RDA  K +Y+ LF WIV Q NK L                 ++   +  FI VLDIYGFETF  NSFEQFCIN+ANEKLQ QFN+HVFKLEQEEY+ E + WT ID+Y+NQPCI+LIE+++G+LDLLDEEC  +    E W C IYS +   +                H    VEY+C GF+EKN+D+V EEQIN+LK+S   L+ ELF++ +     T          +        + ++ R+ KK+VG QFRNSL  LMD LN T PHYVRCIKPND K PF   P RA QQLRACGVLETIR+SAAGFPSRWTY +F+ RY +LM   +V + D K   Q +++ LI  PD ++FG TK+FFR GQVA LEKLR  K+ ++   IQ  +R  + RKKYL +   T+ IQ Y+R + A      L + +A ++IQ + RM  AR+L+ + + A + +++  R        +  + E  V++ Q  VR ++ R ++ +  + V+ +Q   RR  A+  LK LKIEARS+ H K +N G+ENKI++L +K+D   KE +  L +  +I+   +  L     Q E+ +  +   + L  ++  L++EL    E +EKN+    K + E+N K  +         LKS    +   I    ++ QQ     EH + +      E+  +Q L+ E+ KLE ++ +L            K  +N          T+S +S ++++    S+                       F    +S  G     D+A++++LQ  ++ L QE   L+      ED L ++     E+C     G     +Y+                  NEL + +   KG       S     L+++++++ ++L+   E+   LR  +               D   +  +  LD   +N E+ EL   +E  KE NR +  +++  + +     +AL   + + + L+ +  +Q  ++ H       L+L    R+   +Q EISR+   N+ L E+ D+      +LK+ LK +  + ++ +   V  P  E  +++ +  +    K     +R C    G+++    + S  +K  I +L P  + +   P  L  YI+FM  R  DF   + ++   L+  I  +K  ++K+ +  E +   L+N   L++  +QYSG + ++  NTA+  +   +++DL E+ ++L +L + ++Q ++K + +N+L Q + +  +L  + I   L    T  +    + P+++SF++  L K L S    L  H     +I Q+     Y I A  LN+LL R D+C ++KGLQI+YN+S  E W+    +   G  + L P+ +A +LLQ    ++EDA+ +  MC  L     V +  +      + C  SS        Q  +K   E  +  +++  V   PI  PF  + V+L    IP  L LS LT
Sbjct:    7 LYSKYARVWIPDPVDVWKSAELTKDYTPGDTALQLELEDGTELEYKLDPKNSTLPPLRNPDILVGENDLTALSYLHEPAVLHNLSVRFIDSKLIYTYCGIILVAINPYESLPIYGADIINAYSGQNMGDMDPHIFAVAEEAYKQMARFDERNQSIIVSGESGAGKTVSAKYTMRYFATVSGSST-------ETSVEEKVLASSPIMEAIGNAKTTRNDNSSRFGKYIEIGFDKNYYIIGANMRTYLLEKSRVVFQANEERNYHIFYQLCASAHLPEFKALQLGRADD---FHCTNQGGNPVIDGVDDVQEMQATQRAFSLLGISEKQQMDLFQILAAILHLGNVEVMGKGSGNSSVSAQNHHLTVFCELLMVSQEDIAHWLCHKKLKTATETFNKPLAKTEAVDGRDALAKHIYARLFTWIVSQINKAL-----------------LSSSKQHSFIGVLDIYGFETFEINSFEQFCINYANEKLQQQFNMHVFKLEQEEYLKEQIPWTLIDFYDNQPCINLIEAKMGILDLLDEECMFVVYYFECWHCSIYSGYKKST----------------HPCSNVEYQCEGFLEKNKDTVNEEQINVLKSSKFALLLELFQEEDKAPGPT--------ATAVPSRFKVGRSQSLREHKKSVGLQFRNSLNLLMDTLNATTPHYVRCIKPNDHKSPFMMDPRRAAQQLRACGVLETIRISAAGFPSRWTYQEFFIRYRVLMKQKDVLS-DGKLTCQNVLQQLIQDPDKYKFGKTKIFFRAGQVAYLEKLRADKLRAACVQIQKTIRCYVARKKYLRLRWSTITIQRYVRGQQARALCKSLRRTKAAVVIQKYQRMCAARRLYQRKQLAAVLLQRLLRGYAARLQYKQLRYEQKVVVVQRWVRGWLARVQYRRTMQAVVYLQCCVRRMLARRELKKLKIEARSVEHYKKLNVGMENKIMQLQRKVDEQNKENKELLERISVIESSSVAELKKLRPQIEALRGVEEDARRLNDKVSTLEEELQVTCEELEKNR----KMVEELNEKNSL---------LKSEKDELNTMI---KEQGQQITAHQEHVELLQTELYEERSRYQNLLTEHLKLEEQHADL------------KSEMNEHVSKLGRLGTDSAYSSNESEYTRCSE-----------------------FTGSEVSLQGQEGGVDVALLLKLQRRVAELEQEKLNLQSEWDSREDLLQQHHAKELEECRRTVGG---ERDYEAQKRQELESDNKRLKKDLNELRASLSVKKGSGRASPGSSAYNVLLEQLSSVTEELEVRKEEVLLLRTQLVSLEAFKYKEAASEGDAGDTSRSPTLDLHELN-EDGELWIVYEGLKETNRLLESQLQSEREHQAQELQAL---KAELQTLKEERDQQQQLLSH------TLQLPKDGRVHTALQLEISRLTRHNVDLLEQMDKQDKTIRKLKKQLKIYMKKAEETDYVHVDEPIPENRVIEAMPEISILRK-----ERHCR---GMLEYGNDDESKLVKILITELKPRGVAVSMIPC-LPAYILFMCLRHADFTNNDQRVCTLLNCSINCIKSVLKKKGDDFETVSFWLANTCRLLHCLKQYSGEEDYTKHNTAQQNEQCLLNFDLTEYRQVLSDLIIQIYQQLIKCM-ENIL-QPMIVAGMLEQDTIPVLLGPKPTGLRKRTSSFPQDSSFSLESLLKQLSSFHSTLLQHGNDPDLIRQVVKQQFYFIGAVTLNSLLLRKDMCSWNKGLQIRYNVSQLEEWLMDAGVQGGGMREMLEPLIQATKLLQVNKKTEEDAEAIATMCTALTIDISVFVYLSV-----HVCARSSLNFLLCSPQALLKNRQESPQLLMDSKIV--FPITFPFNPSPVALESIQIPASLNLSFLT 1771          
BLAST of Dach-2 vs. Ensembl Cavefish
Match: myo5c (myosin VC [Source:ZFIN;Acc:ZDB-GENE-131127-196])

HSP 1 Score: 779.63 bits (2012), Expect = 0.000e+0
Identity = 429/922 (46.53%), Postives = 595/922 (64.53%), Query Frame = 2
Query:   47 MALYEMYSKGVKIWIPDEESVWIGATVLQ-FHKEKNVIKIITDNGISKELNLSSKKCAPFLRNPDILIGQKDLTYLSYLNEPEVLYNLQIRFCERREIYTYCGIVLVAINPYQELSIYGKEIINAYHSQNSVDLDPHIFAVAENAFRRMSSFGENQSIIVSGESGAGKTVSAKYTMRYFALVGGSKTKQSFNLTETQIERKVLLSNPILEAFGNAKTIRNDNSSRFGKYLEILFNPRNQVIGANMCTYLLEKSRVVFQNLGERNYHIFYQIVTHCQSEDELLMNTGLVNNVEMYDYLRYGESLEIDGVDDSHEFLITKNSFLQLGIDLNKFKTICEILAAILHLGNIRFRFHDATDSSIIENPELLKLIAGLLGCSIDQLKIWLCFRTISTFQETLHKPLSKAEAQYFRDAFVKTLYSNLFDWIVKQANKVLSTDVSINIKKKLKKTIVVNQEDKKKFIAVLDIYGFETFAENSFEQFCINFANEKLQLQFNLHVFKLEQEEYMNEGLEWTFIDYYNNQPCIDLIESRXXXXXXXXXXXXXXXXSDENWCCKIYSHHLNKSANFNKPKLSNMVFIIEHFAGPVEYKCAGFIEKNRDSVLEEQINLLKASDVQLIAELFRDSEIEIFDTNNXXXXXXXXXXXXXXXXXXQENTRKMKKTVGSQFRNSLKSLMDALNKTNPHYVRCIKPNDLKLPFTFCPERAVQQLRACGVLETIRLSAAGFPSRWTYSDFYHRYYILMSNFNVKNHDFKAGSQKIVETLITVPDAFRFGNTKLFFRPGQVALLEKLRGHKIESSVTLIQSILRGSIERKKYLIIHKLTVQIQTYIRRKLAIEKATKLSQIRAVIIIQSFYRMYLARKLFVKMKCAVLAIEKWRRKIITTRLKQAYKKENCVIICQAIVRRFIQRRKFLKIQRGVILIQNHYR 2809
            MAL E+Y+K  ++WIPD E VW  A +L+ F      + +  ++G   +  +      P LRNPDIL+G+ DLT LSYL+EP VL+NL++RF + R IYTYCGI+LVA+NPY++L IYG  +I+AY  QN  DLDPHIFAVAE A+++M+   +NQSIIVSGESGAGKTVSA+Y MRYFA+V  S + +       ++E KVL SNPI EA GNAKT RNDNSSRFGKY EI F+ R Q+IGANM TYLLEKSRVVFQ+  ERNYH+FYQ+   C   D+    +  + + + ++Y   G   EI GVDD  +   T+ +F  LG+  +    + ++LA ILHLGN+  +   +  SSI  +   L +   LLG   +++  WLC R I    ET+ KP  K  A   RDA  K LY+ LFD ++ + N+ L                      +  FI VLDIYGFETF  NSFEQFCIN+ANEKLQ QFNLHVFKLEQEEYM E + WT ID+Y+NQP IDLIE+++G+LDLLDEEC   +G+D+NW  K+Y++ L    +F KP+LSN  F+I+HFA  V+Y+C GF+EKNRD++ EE +++++AS   L+ + F + E      NN+  KV +K++   +    +   ++++ TVG +FR+SL  LM+ LN T PHYVRCIKPN+ KLPF +  +R VQQLRACGVLET+ +SA  +PSRWTY +FY RY ILMS   ++  D K   + +++ LI   + ++FG TK+FFR GQVA LEKLR  ++ ++  +IQ  LRG  +R++YL + +  + IQ YIR K     A  L Q  A ++IQ   R YL R+L+  ++ A + I+ + R  +  +  +   +E+  ++ Q   R ++ RR+F  ++R V+ +Q  YR
Sbjct:    1 MALQELYTKYNRVWIPDSEQVWKSAEILKDFSPGDPTLHLQLEDGTVLQYPVEGPGQLPHLRNPDILVGENDLTALSYLHEPAVLHNLRVRFVDSRIIYTYCGIILVAVNPYKQLPIYGDGVIHAYSGQNMGDLDPHIFAVAEEAYKQMARNNQNQSIIVSGESGAGKTVSARYAMRYFAMVSKSSSNK-------RVEDKVLASNPITEAIGNAKTTRNDNSSRFGKYTEISFDRRYQIIGANMRTYLLEKSRVVFQSENERNYHVFYQM---CACADQPEFKSLRLLSADKFNYTCMGGDTEIQGVDDCADMAETRRTFSLLGLKEDFQSDVFKMLAGILHLGNVVIKAVGSDQSSISSSDSHLVVFCDLLGVRGEEMSRWLCHRRIVLASETVVKPQPKERAINARDALAKHLYAYLFDCVILRINQALRVPGK-----------------QHSFIGVLDIYGFETFDVNSFEQFCINYANEKLQQQFNLHVFKLEQEEYMKEDIPWTLIDFYDNQPVIDLIEAKMGILDLLDEECLFPQGTDKNWLQKLYNY-LGSKPHFEKPRLSNEAFVIQHFADKVQYQCRGFLEKNRDTLYEELVDVMRASKFPLLTDFFTEEE------NNAVTKVKVKAARPGV----KPANKQLRSTVGDKFRSSLYLLMETLNATTPHYVRCIKPNEEKLPFEYDSKRVVQQLRACGVLETVHISAQSYPSRWTYIEFYSRYSILMSQAELRAGDKKQICRTVLQRLIHDSNQYKFGRTKIFFRAGQVAYLEKLRLDRLRTACIIIQKHLRGWSQRRRYLRLRQAAIIIQEYIRGKRRTVTAAALKQGWAAVVIQRHCRGYLVRRLYQLLRVAAITIQAYVRGWMARKRYKKMMEEHKALVLQKYARAWLVRRRFQTMRRLVLNVQLSYR 884          

HSP 2 Score: 150.599 bits (379), Expect = 7.803e-36
Identity = 156/668 (23.35%), Postives = 313/668 (46.86%), Query Frame = 2
Query: 3608 LQMNISSLSQENNRLKETVQQFEDELLKYEQCAEDSKGLVIHN-EYDNELLSIIKDIKGMDEHGLKSRLIDEVANLKKKLKQSNEDYQKLRLHIFDGSMSKLTGNLDHESINSEEEELKRAFESQKEANRKMLKEIEGIKANNV---DLKKALFQIRKDKEQLQVQLGKQHLMIRHGVEYLQNLKLTPKERLDKFVQNEISRILLENLKLQERNDQIISETIELKRGLKYFAFRLQKYEGSLVPNPNKEEDLLQLIQNVIYH-SKMKTIGKRECYSEIGLIDLNMSELSIFIKSFIFDLSPSICLQYEPYHLVPYIIFMVTRKFDFYKEEDQMTNFLSKLIVALKRTIRKRRNYIEYLVMLLSNVFCLVNLXXXXXXXXXXXXLNTAEDIQHYFVHYDLNEFIRLLKELCVTLFQMILKTIVDNLLPQSLCIDAILVHEAI--IDFLSKDGTKYKSNI---ETQPKNTSFNV--LTKNLQSVLEILKNHKIPQLIINQIFVHIAYLINAYCLNTLLFRTDLCYFSKGLQIKYNLSSFETWIRYQKLIDSGALQCLRPMTEAVQLLQTLIDSDEDAKFVCDMCEYLNTRQVVKILNNFNPRDGYGCRLSSGLIAKIETQMKIKRGDEPSESKLETPTVIEIPIDIPFIHNGVSLCRTIIPKPLYLSCLT 5575
            L+  I +L +EN R++E   Q + +  +  Q  ++ K     N E + +LL     ++        +R+++       +LK+  E Y        +  M  L    DH  +  E ++L+  F+ + + N+ + +E+  + A N+   DLK+ + + ++ +++L+ QL +Q+  +   +     L L  + R     + EI   L E  +  E+  ++     E K  L+    RL           + ++  ++ +Q+ I    K   +  +E    +G+++    +    ++  I +L P   +      L   ++FM  R  D+  + +++ + +  +I A+K+ I   +   E L   LSN + L+N F+QYSG ++F   NT    ++   ++DL+E  ++L +L + ++   +  + D L P  + + A+L HE++  I  +   G + +SN    E + +  +++V  + + + S    +    +   +  Q    + YLI A  LN++L R DLC   KG+QI+ N+S  E W+R + L    A++ L P+++A  LLQ    +DEDA  +   C  L+  Q+VKILN++ P D +  R++   + K++  ++ + G     ++L         +  PF  +  +L    +P  L+L  LT
Sbjct:  965 LEKEILALKEENRRMREEKLQLQTQASEDTQINKEMKKEAAENSENEGDLLFAFDGLQ------TATRVVE------TQLKEQRESY--------ESQMEALVFKNDH--LARENQQLQALFQEKSDVNQSIGQEVARLTAENMVIPDLKQQVAESQRHRQELETQLKEQNTEMTGELFSNNELLLEERNRESTIEREEIQGRLEELEEEMEQLKRLHQTENETKNKLRQETSRLTAENMDFEEQIDMKDRTIKRLQDQIKALQKAAQVLPKEY---LGMLEYKKEDEDKLVRMLIRELKPRGVVVNMIPGLAANLLFMCVRHSDYLNDGNKLKSLMHAIITAIKQVITDHQENFEILSFWLSNTYYLLNCFKQYSGEEEFMKHNTPRQNKNCLQNFDLSEHRQILSDLAIRIYHQFINIMEDTLFP--MIVPAMLEHESLQGISSMKPTGFRKRSNSLLEEGRSEGQAYSVSSILQLMNSFHNAMAQQGMELQLQGQAIRQLFYLIGATSLNSILLRKDLCSCRKGMQIRCNISYLEEWLREKGLQGCSAMETLGPLSQAAWLLQVNKTTDEDAAEIRQQCRELSAVQIVKILNSYTPIDDFEKRVAPSFVRKVQGLLQEREGS----NQLMMDAQYRFQVTFPFCPSTQALELLQVPSSLHLGFLT 1601          
BLAST of Dach-2 vs. Ensembl Cavefish
Match: myo5c (myosin VC [Source:ZFIN;Acc:ZDB-GENE-131127-196])

HSP 1 Score: 554.673 bits (1428), Expect = 9.053e-177
Identity = 304/611 (49.75%), Postives = 403/611 (65.96%), Query Frame = 2
Query:   80 KIWIPDEESVWIGATVLQ-FHKEKNVIKIITDNGISKELNLSSKKCAPFLRNPDILIGQKDLTYLSYLNEPEVLYNLQIRFCERREIYTYCGIVLVAINPYQELSIYGKEIINAYHSQNSVDLDPHIFAVAENAFRRMSSFGENQSIIVSGESGAGKTVSAKYTMRYFALVGGSKTKQSFNLTETQIERKVLLSNPILEAFGNAKTIRNDNSSRFGKYLEILFNPRNQVIGANMCTYLLEKSRVVFQNLGERNYHIFYQIVTHCQSEDELLMNTGLVNNVEMYDYLRYGESLEIDGVDDSHEFLITKNSFLQLGIDLNKFKTICEILAAILHLGNIRFRFHDATDSSIIENPELLKLIAGLLGCSIDQLKIWLCFRTISTFQETLHKPLSKAEAQYFRDAFVKTLYSNLFDWIVKQANKVLSTDVSINIKKKLKKTIVVNQEDKKKFIAVLDIYGFETFAENSFEQFCINFANEKLQLQFNLHVFKLEQEEYMNEGLEWTFIDYYNNQPCIDLIESRXXXXXXXXXXXXXXXXSDENWCCKIYSHHLNKSANFNKPKLSNMVFIIEHFAGPVEYKCAGFIEKNRDSVLEEQINLLKASDVQLIAELFRDSE 1909
            ++WIPD E VW  A +L+ F      + +  ++G   +  +      P LRNPDIL+G+ DLT LSYL+EP VL+NL++RF + R IYTYCGI+LVA+NPY++L IYG  +I+AY  QN  DLDPHIFAVAE A+++M+    NQSIIVSGESGAGKTVSA+Y MRYFA+V  S + +       ++E KVL SNPI EA GNAKT RNDNSSRFGKY EI F+ R Q+IGANM TYLLEKSRVVFQ+  ERNYH+FYQ+   C   D+    +  + + + ++Y   G   EI GVDD  +   T+ +F  LG+  +    + ++LA ILHLGN+  +   +  SSI  +   L +   LLG   +++  WLC R I    ET+ KP  K  A   RDA  K LY+ LFD ++ + N+ L                      +  FI VLDIYGFETF  NSFEQFCIN+ANEKLQ QFNLHVFKLEQEEYM E + WT ID+Y+NQP IDLIE+++G+LDLLDEEC   +G+D+NW  K+Y+ +L    +F KP+LSN  F+I+HFA  V+Y+C GF+EKNRD++ EE +++++AS   L+ + F + E
Sbjct:   10 RVWIPDSEQVWKSAEILKDFSPGDPTLHLQLEDGTVLQYPVEGPGQLPHLRNPDILVGENDLTALSYLHEPAVLHNLRVRFVDSRIIYTYCGIILVAVNPYKQLPIYGDGVIHAYSGQNMGDLDPHIFAVAEEAYKQMAR--SNQSIIVSGESGAGKTVSARYAMRYFAMVSKSSSNK-------RVEDKVLASNPITEAIGNAKTTRNDNSSRFGKYTEISFDRRYQIIGANMRTYLLEKSRVVFQSENERNYHVFYQM---CACADQPEFKSLRLLSADKFNYTCMGGDTEIQGVDDCADMAETRRTFSLLGLKEDFQSDVFKMLAGILHLGNVVIKAVGSDQSSISSSDSHLVVFCDLLGVRGEEMSRWLCHRRIVLASETVVKPQPKERAINARDALAKHLYAYLFDCVILRINQALRV-----------------PGKQHSFIGVLDIYGFETFDVNSFEQFCINYANEKLQQQFNLHVFKLEQEEYMKEDIPWTLIDFYDNQPVIDLIEAKMGILDLLDEECLFPQGTDKNWLQKLYN-YLGSKPHFEKPRLSNEAFVIQHFADKVQYQCRGFLEKNRDTLYEELVDVMRASKFPLLTDFFTEEE 590          
BLAST of Dach-2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000498.1 (pep scaffold:Pmarinus_7.0:GL479744:368:24152:-1 gene:ENSPMAG00000000443.1 transcript:ENSPMAT00000000498.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 692.189 bits (1785), Expect = 0.000e+0
Identity = 379/696 (54.45%), Postives = 467/696 (67.10%), Query Frame = 2
Query:  242 LIGQKDLTYLSYLNEPEVLYNLQIRFCERREIYTYCGIVLVAINPYQELSIYGKEIINAYHSQNSVDLDPHIFAVAENAFRRMSSFGENQSIIVSGESGAGKTVSAKYTMRYFALVGGSKTKQSFNLTETQIERKVLLSNPILEAFGNAKTIRNDNSSRFGKYLEILFNPRNQVIGANMCTYLLEKSRVVFQNLGERNYHIFYQIVTHCQSEDELLMNTGLVNNVEMYDYLRYGESLEIDGVDDSHEFLITKNSFLQLGIDLNKFKTICEILAAILHLGNIRFRFHDATDSSIIENPE--LLKLIAGLLGCSIDQLKIWLCFRTISTFQETLHKPLSKAEAQYFRDAFVKTLYSNLFDWIVKQANKVLSTDVSINIKKKLKKTIVVNQEDKKKFIAVLDIYGFETFAENSFEQFCINFANEKLQLQFNLHVFKLEQEEYMNEGLEWTFIDYYNNQPCIDLIESRXXXXXXXXXXXXXXXXSDENWCCKIYSHHLNKSANFNKPKLSNMVFIIEHFAGPVEYKCAGFIEKNRDSVLEEQINLLKASDVQLIAELFRDSEIEIFDTNNXXXXXXXXXXXXXXXXXXQENTRKMKKTVGSQFRNSLKSLMDALNKTNPHYVRCIKPNDLKLPFTFCPERAVQQLRACGVLETIRLSAAGFPSRWTYSDFYHRYYILMSNFNVKNHDFKAGSQKIVETLI 2323
            L+G+ DLT LSYL+EP VL+NL++RF E   IYTYCGIVLVAINPY++L IYG++II AY  QN  D+DPHIFAVAE A+++M+   +NQSIIVSGESGAGKTVSAKY MRYFA VGGS        +E  IE KVL SNPI+EA GNAKT RNDNSSRFGKY+EI FN +  ++GANM TYLLEKSRVVFQ   ERNYH+FYQ+   C S +        +   E + Y   G +  I+ VDD  +   T+ +F  LGI  +    I +I+A ILHLGN+  +  D    +   N E   L +   LLG   DQ+  WLC R IST  ET  KP+ +A+AQ  RDA  K +Y+ LF WIV + NK L +                    +  FI VLDIYGFETF  NSFEQFCIN+ANEKLQ QFNLHVFKLEQEEYM E + WT ID+Y+NQPCIDLIE++LG+LDLLDEECK+ KGSD++W  K+Y  HL +  +F KP++SN+ FII HFA  VEY+C GF+EKNRD+V EEQIN+LKAS   L+   F  S         + P    ++ST+         T+        QFRNSL  LM+ LN T PHYVRCIKPND K+ FTF P+RAVQQLRACGVLETIRLSAAG+PSRWTY +F++RY +LM   ++ + D K   Q ++E +I
Sbjct:    1 LVGENDLTALSYLHEPAVLHNLKVRFAESNHIYTYCGIVLVAINPYEQLPIYGEDIIFAYSGQNMGDMDPHIFAVAEEAYKQMARDEKNQSIIVSGESGAGKTVSAKYAMRYFATVGGSA-------SEANIEEKVLASNPIMEAIGNAKTTRNDNSSRFGKYIEIGFNRQYLIVGANMRTYLLEKSRVVFQAEEERNYHVFYQL---CASAELPEFKDLHLEPAEAFVYTAQGGNAVIEDVDDGEDLERTRRAFTLLGIGASYQMGIFKIIAGILHLGNVEVQSQDREQETCFVNKEDKHLNIFCELLGLERDQMAHWLCHRKISTGAETYVKPMGRAQAQNARDALAKHVYAQLFSWIVHRINKALRSSTK-----------------QHSFIGVLDIYGFETFEINSFEQFCINYANEKLQQQFNLHVFKLEQEEYMREEIPWTLIDFYDNQPCIDLIEAKLGVLDLLDEECKMPKGSDQSWAQKLYEKHLGRGKHFLKPRMSNVAFIICHFADKVEYQCDGFLEKNRDTVYEEQINILKASQSSLLTLAFV-SRPPCLHPTGTPPPRRRRNSTEGNRHRSSARTKARSHVATFQFRNSLHLLMETLNATTPHYVRCIKPNDDKMAFTFDPKRAVQQLRACGVLETIRLSAAGYPSRWTYQEFFNRYRVLMRKKDIVSDDKKQTVQNVLEHVI 668          
BLAST of Dach-2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000499.1 (pep scaffold:Pmarinus_7.0:GL479744:9258:25467:-1 gene:ENSPMAG00000000443.1 transcript:ENSPMAT00000000499.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 595.89 bits (1535), Expect = 0.000e+0
Identity = 325/601 (54.08%), Postives = 409/601 (68.05%), Query Frame = 2
Query:   77 VKIWIPDEESVWIGATVLQFHKEKN-VIKIITDNGISKELNLSSKKCAPFLRNPDILIGQKDLTYLSYLNEPEVLYNLQIRFCERREIYTYCGIVLVAINPYQELSIYGKEIINAYHSQNSVDLDPHIFAVAENAFRRMSSFGENQSIIVSGESGAGKTVSAKYTMRYFALVGGSKTKQSFNLTETQIERKVLLSNPILEAFGNAKTIRNDNSSRFGKYLEILFNPRNQVIGANMCTYLLEKSRVVFQNLGERNYHIFYQIVTHCQSEDELLMNTGLVNNVEMYDYLRYGESLEIDGVDDSHEFLITKNSFLQLGIDLNKFKTICEILAAILHLGNIRFRFHDATDSSIIENPE--LLKLIAGLLGCSIDQLKIWLCFRTISTFQETLHKPLSKAEAQYFRDAFVKTLYSNLFDWIVKQANKVLSTDVSINIKKKLKKTIVVNQEDKKKFIAVLDIYGFETFAENSFEQFCINFANEKLQLQFNLHVFKLEQEEYMNEGLEWTFIDYYNNQPCIDLIESRXXXXXXXXXXXXXXXXSDENWCCKIYSHHLNKSANFNKPKLSNMVFIIEHFAGPVEYKCAGFIEKNRDSVLEEQINLLKAS 1870
             K+WIP  + VW+ A + Q +++ + ++++  ++G   +  L   +  P LRNPDIL+G+ DLT LSYL+EP VL+NL++RF E   IYTYCGIVLVAINPY++L IYG++II AY  QN  D+DPHIFAVAE A+++M+   +NQSIIVSGESGAGKTVSAKY MRYFA VGGS        +E  IE KVL SNPI+EA GNAKT RNDNSSRFGKY+EI FN +  ++GANM TYLLEKSRVVFQ   ERNYH+FYQ+   C S +        +   E + Y   G +  I+ VDD  +   T+ +F  LGI  +    I +I+A ILHLGN+  +  D    +   N E   L +   LLG   DQ+  WLC R IST  ET  KP+ +A+AQ  RDA  K +Y+ LF WIV + NK L +                    +  FI VLDIYGFETF  NSFEQFCIN+ANEKLQ QFNLHVFKLEQEEYM E + WT ID+Y+NQPCIDLIE++LG+LDLLDEECK+ KGSD++W  K+Y  HL +  +F KP++SN+ FII HFA  VEY+C GF+EKNRD+V EEQIN+LKAS
Sbjct:   14 TKVWIPHADEVWVSAEICQDYRDGDRLLQLRLEDGRVVQHPLEGGQLPP-LRNPDILVGENDLTALSYLHEPAVLHNLKVRFAESNHIYTYCGIVLVAINPYEQLPIYGEDIIFAYSGQNMGDMDPHIFAVAEEAYKQMARDEKNQSIIVSGESGAGKTVSAKYAMRYFATVGGSA-------SEANIEEKVLASNPIMEAIGNAKTTRNDNSSRFGKYIEIGFNRQYLIVGANMRTYLLEKSRVVFQAEEERNYHVFYQL---CASAELPEFKDLHLEPAEAFVYTAQGGNAVIEDVDDGEDLERTRRAFTLLGIGASYQMGIFKIIAGILHLGNVEVQSQDREQETCFVNKEDKHLNIFCELLGLERDQMAHWLCHRKISTGAETYVKPMGRAQAQNARDALAKHVYAQLFSWIVHRINKALRSSTK-----------------QHSFIGVLDIYGFETFEINSFEQFCINYANEKLQQQFNLHVFKLEQEEYMREEIPWTLIDFYDNQPCIDLIEAKLGVLDLLDEECKMPKGSDQSWAQKLYEKHLGRGKHFLKPRMSNVAFIICHFADKVEYQCDGFLEKNRDTVYEEQINILKAS 586          
BLAST of Dach-2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004078.1 (pep scaffold:Pmarinus_7.0:GL478761:5289:25008:-1 gene:ENSPMAG00000003722.1 transcript:ENSPMAT00000004078.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 473.011 bits (1216), Expect = 3.475e-143
Identity = 299/832 (35.94%), Postives = 458/832 (55.05%), Query Frame = 2
Query:  230 NPDILIGQKDLTYLSYLNEPEVLYNLQIRFCERREIYTYCGIVLVAINPYQELSIYGKEIINAYHSQNSVDLDPHIFAVAENAFRRMSSFGENQSIIVSGESGAGKTVSAKYTMRYFALVGGSKTKQSFNLTETQIERKVLLSNPILEAFGNAKTIRNDNSSRFGKYLEILFNPRNQVIGANMCTYLLEKSRVVFQNLGERNYHIFYQIVTHCQSEDELLMNTGLVNNVEMYDYLRYGESLEIDGVDDSHEFLITKNSFLQLGIDLNKFKTICEILAAILHLGNIRFRFHDATDSSIIENPELLKLIAGLLGCSIDQLKIWLCFRTISTFQETLHKPLSKAEAQYFRDAFVKTLYSNLFDWIVKQANKVLSTDVSINIKKKLKKTIVVNQEDKKKFIAVLDIYGFETFAENSFEQFCINFANEKLQLQFNLHVFKLEQEEYMNEGLEWTFIDYYNN-QPCIDLIESRXXXXXXXXXXXXXXXXSDENWCCKIYSHHLNKSANFNKPKL----SNMVFIIEHFAGPVEYKCAGFIEKNRDSVLEEQINLLKASDVQLIAELFRDSEIEIFDTNNXXXXXXXXXXXXXXXXXXQENTRKMKKTVGSQFRNSLKSLMDALNKTNPHYVRCIKPNDLKLPFTFCPERAVQQLRACGVLETIRLSAAGFPSRWTYSDFYHRYYILMSNFNVKNH--DFKAGSQKIVETLITVPDAFRFGNTKLFFRPGQVALLEKLRGHKIESSVTLIQSILRGSIERKKYLIIHKLTVQIQTYIRRKLAIEKATKLSQIRAVIIIQSFYRMYLARKLFVKMKCAVLAIEKWRRKIITTRLKQAYKK 2704
            NP      +D+  L++LNEP VL+NL+ R+     IYTY G+  V +NPY+ L +Y  + +NAY  +   +  PHIF+++       S+  ENQSI+++GESGAGKTV+ K  ++YFA +  + TK+  + ++  +E +++ +NP LEAFGNAKT+RNDNSSRFGK++ I F    ++  A++ T  LEKSRV FQ   ERNYHIFYQI++  Q + ELL    + +N   Y ++  G+ + + G+DD  E + T +++  LG    +  ++ ++  AI+H GN+ F+     + +  +  E     + L+G +   L   LC   +    E + K  +  +  Y   A  K++Y  +F+W+V + N+ L T                    ++ FI VLDI GFE F  NSFEQ CINF NEKLQ  FN H+F LEQEEY  EG+EWTFID+  + Q CI+LIE  +G++ +L+EEC   K SD+++  K+Y +HL KS NF KP++        F + H+AG V+Y  +G++ KN+D + E  + L + S ++L+A LF +               +   S         +      +TV +  R +L  LM  L  T+PH+VRCI PN+ K P        + QLR  GVLE IR+   GFPSR  Y DF HRY IL  N   +    D +  ++K++ TL      ++FG+TK+FF+ G +  LE++R  ++   +TL+Q+  RG + RK++  I          I R+ A+        IRA + ++++  M L  K+   +K A    E    K    +LK+AY K
Sbjct:   78 NPPKFDKIEDMAMLTFLNEPSVLFNLKERYAAWM-IYTYSGLFCVTVNPYKWLPVYSSQCVNAYRGKKRQEAPPHIFSISLYISDLHSADRENQSILITGESGAGKTVNTKRVIQYFASIAAAGTKR--DASKGTLEDQIVSANPALEAFGNAKTLRNDNSSRFGKFIRIHFGTTGKLASADIET--LEKSRVTFQLKAERNYHIFYQILS--QRKPELLEMLLVTSNPYDYAFISQGQ-VTVAGLDDGDELMATDSAYDILGFVPEEKASVYKLTGAIMHFGNMHFKQKQREEQAEADGTEDADKASYLMGLNSADLIKGLCHPRVKVGNEYVTKGQNVQQVSYSIGALAKSVYEKMFNWMVVRINQSLETKAP-----------------RQHFIGVLDIAGFEIFDFNSFEQLCINFTNEKLQQFFNHHMFVLEQEEYKKEGIEWTFIDFGMDLQACIELIEKPMGIMSILEEECMFPKASDQSFKAKLYDNHLGKSNNFQKPRIVKGKPEAHFALVHYAGVVDYNISGWLVKNKDPLNETVVGLYQKSSLKLLASLFAN--------------YAGADSAADTSKKGAKKKGSSFQTVSALHRENLNKLMTNLRSTHPHFVRCIIPNEEKKPGAMDNALVMHQLRCNGVLEGIRICRKGFPSRILYGDFTHRYRILNPNAVPEGQFMDSRKSAEKLLSTLDIDHTQYKFGHTKVFFKAGLLGTLEEMRDDRLSKIITLLQARCRGLLSRKEFAKI----------IERRDAL--LVIQYNIRAFMGVKNWPWMKLFFKIKPLLKSAETEKEMQNMKEDFLKLKEAYAK 858          
BLAST of Dach-2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005411.1 (pep scaffold:Pmarinus_7.0:GL476612:1285:44967:1 gene:ENSPMAG00000004885.1 transcript:ENSPMAT00000005411.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 460.299 bits (1183), Expect = 1.371e-138
Identity = 291/831 (35.02%), Postives = 446/831 (53.67%), Query Frame = 2
Query:   86 WIPDEESVWIGATVLQFHKEKNV-IKIITDNGISKELNLSSKKCAPFLRNPDILIGQKDLTYLSYLNEPEVLYNLQIRFCERREIYTYCGIVLVAINPYQELSIYGKEIINAYHSQNSVDLDPHIFAVAENAFRRM--SSFGENQSIIVSGESGAGKTVSAKYTMRYFALVGGSKTKQSFNLTETQIERKVLLSNPILEAFGNAKTIRNDNSSRFGKYLEILFNPRNQVIGANMCTYLLEKSRVVFQNLGERNYHIFYQIVTHCQSEDELLMNTGLVNNVEMYDYLRYGESLEIDGVDDSHEFLITKNSFLQLGIDLNKFKTICEILAAILHLGNIRFRFHDATDSSIIENPELLKLIAGLLGCSIDQLKIWLCFRTISTFQETLHKPLSKAEAQYFR-------DAFVKTLYSNLFDWIVKQANKVLSTDVSINIKKKLKKTIVVNQEDKKKFIAVLDIYGFETFAENSFEQFCINFANEKLQLQFNLHVFKLEQEEYMNEGLEWTFIDY-YNNQPCIDLIESRXXXXXXXXXXXXXXXXSDENWCCKIYSHHLNKSANFNKPKLSN-----MVFIIEHFAGPVEYKCAGFIEKNRDSVLEEQINLLKASDVQLIAELFRDSEIEIFDTNNXXXXXXXXXXXXXXXXXXQENTRKMKKTVGSQFRNSLKSLMDALNKTNPHYVRCIKPNDLKLPFTFCPERAVQQLRACGVLETIRLSAAGFPSRWTYSDFYHRYYILMSNFNVKNHDFKAGSQKIVETLITVPDAFRFGNTKLFFRPGQVALLEKLRGHKIESSVTLIQSILRGSIERK---KYLIIHKLTVQIQTYIR 2521
            W+ DE+  ++ A +   H +  V +K   +N I+K      KK      NP      +D+  L++LNE  VL NL+ R+ + R IYTY G+  V INPY+ L IYG  +   Y  +   ++ PH+F++++NA+  M  ++   NQS++++GESGAGKT + K  ++YFA +GG  TKQ     +  +E +++ +NP+LEAFGNAKT RN+NSSRFGK++ I F    ++ GA++ TYLLEKSRV+ Q   ER YHIFYQ+++       LL   GLVNN + Y  +  G +  ++ +DD+ E ++T  +F  LG    +  ++ ++   I+H GN++FR     + + ++  E+   +A L G    +L+  +    +    E + K  +  +  +          A  K +Y  +F W+V + NK L T                  + ++ FI VLDI GFE F  NSFEQ CINF NEKLQ  FN H+F LEQEEY  EG+ W FID+  +   CIDL+E  +G+  +L+E+C   K +D  +   +Y +HL KSA F KPK          F + H+AG V Y   G++EKN+D + E  ++L + S + L++ LF++ E                +   S  + +++      +TV   +R  L  LM  L+ T+PH+VRCI PN+ K          + QL   GVLE IR+   GFP+R  Y +F  RY I+         D KA ++K++++   V D +R G TK+FFR G +  LE  R   I   +T +Q+  RG + R+   K L      V IQ+ +R
Sbjct:   36 WVKDEKEGFLQALIQDDHGDNTVSVKFTVNNEIAK-----VKKDIVQEMNPPKFEQIEDMANLTFLNEASVLNNLKERYVKMR-IYTYSGLFCVTINPYKWLPIYGSRVAKMYRGKKRNEVPPHLFSISDNAYSDMLITADKANQSMLITGESGAGKTENTKKVIQYFANIGGG-TKQIDQSKQGSLEDQIIQANPVLEAFGNAKTTRNNNSSRFGKFIRIHFAVSGKLSGADIETYLLEKSRVISQQPAERGYHIFYQLLSG--KVPNLLEEIGLVNNPKEYASISQGVT-SVENMDDAEEMMLTDEAFDVLGFTPEEKMSLYKLTGGIMHFGNMKFRQKPREEQAEVDGTEVADRVASLAGIDSSELQKGITRPKVKVGNEYVQKNQNMDQVYHLPQKCMSSIGALAKAIYDRMFKWLVARVNKTLDT-----------------TKPRQYFIGVLDIAGFEIFEFNSFEQLCINFTNEKLQQFFNHHMFVLEQEEYKKEGINWVFIDFGLDLAACIDLLEKPMGIFSILEEQCVFPKATDATFKAAMYDNHLGKSAPFQKPKAGKKAGQEATFELVHYAGTVGYNTQGWLEKNKDPLNETVVSLFQNSSMPLLSVLFKEEE---------------AADASSAGAKQKQKKGSAFQTVSVFYREQLNKLMATLHSTSPHFVRCIVPNEFKKSGVVDAHLILHQLACNGVLEGIRICRKGFPNRTLYPEFVQRYSIINLLAGKTETDPKAITEKVLKSTNLVEDEYRIGFTKVFFRAGVLGKLEDFRDDCICRFITKLQASCRGKVFRRDFQKVLDKRDAMVIIQSNVR 824          
BLAST of Dach-2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002731.1 (pep scaffold:Pmarinus_7.0:GL478284:11062:40470:1 gene:ENSPMAG00000002428.1 transcript:ENSPMAT00000002731.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 464.537 bits (1194), Expect = 1.823e-134
Identity = 299/839 (35.64%), Postives = 457/839 (54.47%), Query Frame = 2
Query:  230 NPDILIGQKDLTYLSYLNEPEVLYNLQIRFCERREIYTYCGIVLVAINPYQELSIYGKEIINAYHSQNSVDLDPHIFAVAENAFRRMSSFGENQSIIVSGESGAGKTVSAKYTMRYFALVGGSKTKQSFNLTETQIERKVLLSNPILEAFGNAKTIRNDNSSRFGKYLEILFNPRNQVIGANMC------TYLLEKSRVVFQNLGERNYHIFYQIVTHCQSEDELLMNTGLVNNVEMYDYLRYGESLEIDGVDDSHEFLITKNSFLQLGIDLNKFKTICEILAAILHLGNIRFRFHDATDSSIIENPELLKLIAGLLGCSIDQLKIWLCFRTISTFQETLHKPLSKAEAQYFRDAFVKTLYSNLFDWIVKQANKVLSTDVSINIKKKLKKTIVVNQEDKKKFIAVLDIYGFETFAENSFEQFCINFANEKLQLQFNLHVFKLEQEEYMNEGLEWTFIDYYNN-QPCIDLIESRXXXXXXXXXXXXXXXXSDENWCCKIYSHHLNKSANFNKPKL----SNMVFIIEHFAGPVEYKCAGFIEKNRDSVLEEQINLLKASDVQLIAELFRDSEIEIFDTNNXXXXXXXXXXXXXXXXXXQENTRKMKKTVGSQFRNSLKSLMDALNKTNPHYVRCIKPNDLKLPFTFCPERAVQQLRACGVLETIRLSAAGFPSRWTYSDFYHRYYILMSNFNVKNHDF---KAGSQKIVETLITVPDAFRFGNTKLFFRPGQVALLEKLRGHKIESSVTLIQSILRGSIERKKYLIIHKLTVQIQTYIRRKLAIEKATKLSQIRAVIIIQSFYRMYLARKLFVKMKCAVLAIEKWRRKIITTRLKQAYKK 2704
            NP      +D+  L++LNEP VL+NL+ R+     IYTY G+  V +NPY+ L +Y  + +NAY  +   +  PHIF++++NA++ M S  ENQS++++GESGAGKTV+ K  ++YFA +  + TK+  + ++  +E +++ +NP LEAFGNAKT+RNDNSSRF  Y+ +L         +N+C       +LLEKSRV FQ   ERNYHIFYQI++  Q + ELL    +  N   Y ++  G+ + + G+DD  E + T ++F  LG    +  ++ ++  AI+H GN+ F+     + +  +  E     + L+G +   L   LC   +    E + K     +  Y   A  K++Y  +F+W+V + N+ L T                    ++ FI VLDI GFE F  NSFEQ CINF NEKLQ  FN H+F LEQEEY  EG+EW FID+  + Q CI+LIE  +G++ +L+EEC   K SD+++  K+Y +HL KS NF KP++        F + H+AG V+Y  +G++ KN+D + E  + L + S ++L++ LF +      D           SS                +TV +  R +L  LM  L  T+PH+VRCI PN+ K P        + QLR  GVLE IR+   GFP+R  Y DF  R Y +++   V    F   +  ++K++ TL      ++FG+TK+FF+ G +  LE+LR  ++   +TL+QS  RG + RK++  I          I R+ A+        IRA + ++++  M L  K+   +K A    E    K    +LK+AY K
Sbjct:   78 NPPKFDKIEDMAMLTFLNEPSVLFNLKERYAAWM-IYTYSGLFCVTVNPYKWLPVYSSQCVNAYRGKKRQEAPPHIFSISDNAYQYMLSDRENQSVLITGESGAGKTVNTKRVIQYFASIAAAGTKR--DASKGTLEDQIVSANPALEAFGNAKTLRNDNSSRFTTYVFVL---------SNVCLSVHLSLHLLEKSRVTFQLKAERNYHIFYQILS--QRKPELLEMLLVTTNPYDYSFISQGQ-VTVAGMDDGDELMATDSAFDILGFTAEEKASVYKLTGAIMHFGNMHFKQKQREEQAEADGTEDADKASYLMGLNSADLIKGLCHPRVKVGNEYVTKGQDVQQVSYSIGALAKSVYEKMFNWMVVRINQSLETKAP-----------------RQHFIGVLDIAGFEIFDFNSFEQICINFTNEKLQQFFNHHMFVLEQEEYKKEGIEWVFIDFGMDLQACIELIEKPMGIMSILEEECMFPKASDQSFKAKLYDNHLGKSNNFQKPRIVKGRPEAHFALMHYAGVVDYNISGWLIKNKDPLNETVVGLYQKSSLKLLSVLFANYAAADADAAKKGGAKKKGSSF---------------QTVSALHRENLNKLMTNLRSTHPHFVRCIIPNEEKKPGAMDNALVMHQLRCNGVLEGIRICRKGFPNRILYGDFKQRQYRILNPNAVPEGQFMDSRKSAEKLLSTLDIDHTQYKFGHTKVFFKAGLLGTLEELRDDRLSKIITLMQSQCRGFLSRKEFAKI----------IERRDAL--LVIQYNIRAFMGVKNWPWMKLFFKIKPLLKSAETEKEMQNMKEDFLKLKEAYAK 857          
BLAST of Dach-2 vs. Ensembl Yeast
Match: MYO2 (Type V myosin motor involved in actin-based transport of cargos; required for the polarized delivery of secretory vesicles, the vacuole, late Golgi elements, peroxisomes, and the mitotic spindle; MYO2 has a paralog, MYO4, that arose from the whole genome duplication [Source:SGD;Acc:S000005853])

HSP 1 Score: 683.33 bits (1762), Expect = 0.000e+0
Identity = 409/983 (41.61%), Postives = 596/983 (60.63%), Query Frame = 2
Query:   74 GVKIWIPDEESVWIGATVL--QFHKEKNVIKI-ITDNGI----SKELNLSSKKCAPFLRNPDILIGQKDLTYLSYLNEPEVLYNLQIRFCERREIYTYCGIVLVAINPYQELS-IYGKEIINAYHSQNSVDLDPHIFAVAENAFRRMSSFGENQSIIVSGESGAGKTVSAKYTMRYFALV---GGSKTKQSFNLTETQIERKVLLSNPILEAFGNAKTIRNDNSSRFGKYLEILFNPRNQVIGANMCTYLLEKSRVVFQNLGERNYHIFYQIVTH--CQSEDELLMNTGLVNNVEMYDYLRYGESLEIDGVDDSHEFLITKNSFLQLGIDLNKFKTICEILAAILHLGNIRFRFHDATDSSIIENPELLKLIAGLLGCSIDQLKIWLCFRTISTFQETLHKPLSKAEAQYFRDAFVKTLYSNLFDWIVKQANKVLSTDVSINIKKKLKKTIVVNQEDKKKFIAVLDIYGFETFAENSFEQFCINFANEKLQLQFNLHVFKLEQEEYMNEGLEWTFIDYYNNQPCIDLIESRXXXXXXXXXXXXXXXXSDENWCCKIYSHHLNKSAN---FNKPKLSNMVFIIEHFAGPVEYKCAGFIEKNRDSVLEEQINLLKASDVQLIAELFRDSEIEIFDTNNXXXXXXXXXXXXXXXXXXQENTRKMKKTVGSQFRNSLKSLMDALNKTNPHYVRCIKPNDLKLPFTFCPERAVQQLRACGVLETIRLSAAGFPSRWTYSDFYHRYYILMSN------FNVKN---HDFKAGSQKIVETLITVPDAFRFGNTKLFFRPGQVALLEKLRGHKIESSVTLIQSILRGSIERKKYLIIHKLTVQIQTYIRRKLAIEKATKLSQIRAVIIIQSFYRMYLARK-LFVKMKCAVLAIEKWRRKIITTRLKQAYKKENCVIICQAIVRRFIQRRKFLKIQRGVILIQNHYRRRKAKETLKILKIEARSINHIKFVNKGLENKIIELTQKLDTKEKE 2944
            G + W P +E  WIGA V+  +F+  K  +++ + D+ I    +K+LN    +  P LRNP IL   +DLT LSYLNEP VL+ ++ R+ +   IYTY GIVL+A NP+  +  +Y +++I AY  +   +L+PH+FA+AE A+R M +  +NQ+I+VSGESGAGKTVSAKY MRYFA V     +  +    ++ET  E+K+L +NPI+EAFGNAKT RNDNSSRFGKYLEILF+    +IGA + TYLLE+SR+V+Q   ERNYHIFYQ++     Q+++EL +      +   Y Y+  G   +I+G+DD+ E+ IT ++   +GI       I +ILAA+LH+GNI  +     D+S+  +   LKL   LLG        W+  + I T  E +   L+ ++A   +D+  K +YS LFDW+V+  N VL  + ++N             +    FI VLDIYGFE F +NSFEQFCIN+ANEKLQ +FN HVFKLEQEEY+ E +EW+FI++ +NQPCIDLIE++LG+L LLDEE +L  GSDE+W  K+Y   L+KS     F+KP+     FI+ H+A  V Y   GFIEKNRD+V +  + +LKAS  + +  +    E         +    ++             T   K T+GS F+ SL  LM+ +N TN HY+RCIKPN  K  + F     + QLRACGVLETIR+S AGFPSRWT+ +F  RYYIL+ +      F  K     D  +  + I++  +     ++ GNTK+FF+ G +A LEKLR +K+ +S+ +IQ  +R    RK+YL I +    +Q  I+  +  ++     ++    ++Q+ YR +  R  +F  ++      +K R+++   +LKQ ++  N  +  Q+ VR F  R +FL+ ++  +++Q+  RRR A+  LK LK +A+S+NH+K V+  LENK+IELTQ L +K KE
Sbjct:    6 GTRCWYPHKELGWIGAEVIKNEFNDGKYHLELQLEDDEIVSVDTKDLNNDKDQSLPLLRNPPILEATEDLTSLSYLNEPAVLHAIKQRYSQLN-IYTYSGIVLIATNPFDRVDQLYTQDMIQAYAGKRRGELEPHLFAIAEEAYRLMKNDKQNQTIVVSGESGAGKTVSAKYIMRYFASVEEENSATVQHQVEMSET--EQKILATNPIMEAFGNAKTTRNDNSSRFGKYLEILFDKDTSIIGARIRTYLLERSRLVYQPPIERNYHIFYQLMAGLPAQTKEELHLT-----DASDYFYMNQGGDTKINGIDDAKEYKITVDALTLVGITKETQHQIFKILAALLHIGNIEIK-KTRNDASLSADEPNLKLACELLGIDAYNFAKWVTKKQIITRSEKIVSNLNYSQALVAKDSVAKFIYSALFDWLVENINTVLC-NPAVN-------------DQISSFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEFNQHVFKLEQEEYVKEEIEWSFIEFNDNQPCIDLIENKLGILSLLDEESRLPAGSDESWTQKLY-QTLDKSPTNKVFSKPRFGQTKFIVSHYALDVAYDVEGFIEKNRDTVSDGHLEVLKASTNETLINILEGLEKA---AKKLEEAKKLELEQAGSKKPGPIRTVNRKPTLGSMFKQSLIELMNTINSTNVHYIRCIKPNADKEAWQFDNLMVLSQLRACGVLETIRISCAGFPSRWTFEEFVLRYYILIPHEQWDLIFKKKETTEEDIISVVKMILDATVKDKSKYQIGNTKIFFKAGMLAYLEKLRSNKMHNSIVMIQKKIRAKYYRKQYLQISQAIKYLQNNIKGFIIRQRVNDEMKVNCATLLQAAYRGHSIRANVFSVLRTITNLQKKIRKELKQRQLKQEHEY-NAAVTIQSKVRTFEPRSRFLRTKKDTVVVQSLIRRRAAQRKLKQLKADAKSVNHLKEVSYKLENKVIELTQNLASKVKE 960          

HSP 2 Score: 60.4622 bits (145), Expect = 3.199e-9
Identity = 33/164 (20.12%), Postives = 79/164 (48.17%), Query Frame = 2
Query: 4883 CIDAILVHEAIIDFLSKDGTKYKSNIETQPKNTSFNVLTKNLQSVLEILKNHKIPQLIINQIFVHIAYLINAYCLNTLLFRTDLCYFSKGLQIKYNLSSFETWIRYQKLIDSGALQCLRPMTEAVQLLQTLIDSDEDAKFVCDMCEYLNTRQVVKILNNFNPRD 5374
             I+A+++ E++  F + + + + + I    +  + + +     S+   +K+  I   + + +   +   ++A C N L+ + +   + +GLQ+ YN++  E W +   L D    +CL+ + +  +LLQ    + ED   +  +C  L   Q+ K+++ +   D
Sbjct: 1321 AINAVVISESLPGFSAGETSGFLNKIFANTEEYTMDDILTFFNSIYWCMKSFHIENEVFHAVVTTLLNYVDAICFNELIMKRNFLSWKRGLQLNYNVTRLEEWCKTHGLTD--GTECLQHLIQTAKLLQVRKYTIEDIDILRGICYSLTPAQLQKLISQYQVAD 1482          
BLAST of Dach-2 vs. Ensembl Yeast
Match: MYO4 (Type V myosin motor involved in actin-based transport of cargos; required for mRNA transport, including ASH1 mRNA, and facilitating the growth and movement of ER tubules into the growing bud along with She3p; MYO4 has a paralog, MYO2, that arose from the whole genome duplication [Source:SGD;Acc:S000000027])

HSP 1 Score: 617.461 bits (1591), Expect = 0.000e+0
Identity = 383/972 (39.40%), Postives = 552/972 (56.79%), Query Frame = 2
Query:   74 GVKIWIPDEESVWIGATVLQ-------FHKEKNVIKIITDNGISKELNL----SSKKCAPFLRNPDILIGQKDLTYLSYLNEPEVLYNLQIRFCERREIYTYCGIVLVAINPYQELS-IYGKEIINAYHSQNSVDLDPHIFAVAENAFRRMSSFGENQSIIVSGESGAGKTVSAKYTMRYFALVGGSKTKQSFNLTETQIERKVLLSNPILEAFGNAKTIRNDNSSRFGKYLEILFNPRNQVIGANMCTYLLEKSRVVFQNLGERNYHIFYQIVTHCQSEDELLMNTGLVNNVEMYDYLRYGESLEIDGVDDSHEFLITKNSFLQLGIDLNKFKTICEILAAILHLGNIRFRFHDATDSSIIENPELLKLIAGLLGCSIDQLKIWLCFRTISTFQETLHKPLSKAEAQYFRDAFVKTLYSNLFDWIVKQANKVLSTDVSINIKKKLKKTIVVNQEDKKKFIAVLDIYGFETFAENSFEQFCINFANEKLQLQFNLHVFKLEQEEYMNEGLEWTFIDYYNNQPCIDLIESRXXXXXXXXXXXXXXXXSDENWCCKIYSHHLNKSAN--FNKPKLSNMVFIIEHFAGPVEYKCAGFIEKNRDSVLEEQINLLKASDVQLIAELFRDSEIEIFDTNNXXXXXXXXXXXXXXXXXXQENTRK----------MKKTVGSQFRNSLKSLMDALNKTNPHYVRCIKPNDLKLPFTFCPERAVQQLRACGVLETIRLSAAGFPSRWTYSDFYHRYYIL---------MSNFNVKNHDFKAGSQKIVETLITVPDAFRFGNTKLFFRPGQVALLEKLRGHKIESSVTLIQSILRGSIERKKYLIIHKLTVQIQTYIRRKLAIEKATKLSQIRAVIIIQSFYRMYLARKLF-------VKMKCAVLAIEKWRRKIITTRLKQAYKKENCVIICQAIVRRFIQRRKFLKIQRGVILIQNHYRRRKAKETLKILK--IEARSI 2863
            G K W P +E  WIG  V +       FH E   +K+     +S E N           P LRNP IL    DLT LSYLNEP VL+ ++ R+    +IYTY GIVL+A NP+ ++  +Y +E+I  Y S+   +L+PH+FA+AE A+R M     NQ+++VSGESGAGKTVSAKY MRYFA V  S  ++   +  +QIE ++L +NPI+EAFGNAKT RNDNSSRFGKYL+ILF+    + G+ + TYLLEKSR+V+Q   ERNYHIFYQI+   +   E +     +++ + Y Y   G    I G+D++ E+ IT ++   +GI+      I +ILA +LH+GNI  +     D+S+    + L++   LLG        W+  + I T  E +   L+  +A   RD+  K +YS LFDW+V             NI K L    +  Q+    FI +LDIYGFE F +NSFEQFCIN+ANEKLQ +FN HVFKLEQEEY+ E +EW+FI++ +NQPCIDLIE++LG+L LLDEE +L  GSDE+W  K+YS      +N  F+KP+     FI+ H+A  VEY+  GFIEKNRDSV    +++ KA+   +  ++  + E+   D                    +++NT K           K T+GS F+ SL  LM  +N TN HY+RCIKPN  K P+ F     + QLRACGVLETIR+S AGFPSRWT+ +F  RY++L         + N ++         Q I++  I+    ++ GNTK+FF+ G +A LEKLR +K+     +IQ  +R    R +YL   +   + Q+ IR  L   +     + RA I++Q+  R    R+ +       +K++C        +RK+I   + + +     VII Q+ +R +  +  +  ++R  IL+Q+  R + A+    +L+  +E R+I
Sbjct:    6 GTKCWYPHKEQGWIGGEVTKNDFFEGTFHLE---LKLEDGETVSIETNSFENDDDHPTLPVLRNPPILESTDDLTTLSYLNEPAVLHAIKKRYM-NGQIYTYSGIVLIAANPFDKVDHLYSREMIQNYSSKRKDELEPHLFAIAEEAYRFMVHEKANQTVVVSGESGAGKTVSAKYIMRYFASVQESNNREG-EVEMSQIESQILATNPIMEAFGNAKTTRNDNSSRFGKYLQILFDENTTIRGSKIRTYLLEKSRLVYQPETERNYHIFYQIL---EGLPEPVKQELHLSSPKDYHYTNQGGQPNIAGIDEAREYKITTDALSLVGINHETQLGIFKILAGLLHIGNIEMKM-TRNDASLSSEEQNLQIACELLGIDPFNFAKWIVKKQIVTRSEKIVTNLNYNQALIARDSVAKFIYSTLFDWLVD------------NINKTLYDPELDQQDHVFSFIGILDIYGFEHFEKNSFEQFCINYANEKLQQEFNQHVFKLEQEEYVKEEIEWSFIEFSDNQPCIDLIENKLGILSLLDEESRLPSGSDESWASKLYSAFNKPPSNEVFSKPRFGQTKFIVSHYAVDVEYEVEGFIEKNRDSVSLGHLDVFKATTNPIFKQILDNRELRSDDA------------------PEEQNTEKKIMIPARLSQKKPTLGSMFKKSLGELMAIINSTNVHYIRCIKPNSEKKPWEFDNLMVLSQLRACGVLETIRISCAGFPSRWTFDEFVQRYFLLTDYSLWSGILYNPDLPKEAIVNFCQSILDATISDSAKYQIGNTKIFFKAGMLAFLEKLRTNKMNEICIIIQKKIRARYYRLQYLQTMESIKKCQSQIRSLLVRTRVDHELKTRAAILLQTNIRALWKREYYRAAIGQIIKLQCTC------KRKLILDSVNRKFMLMAAVII-QSYIRSYGHKTDYRTLKRSSILVQSAMRMQLARRRYIVLQKEVEERNI 931          
BLAST of Dach-2 vs. Ensembl Yeast
Match: MYO1 (Type II myosin heavy chain; required for wild-type cytokinesis and cell separation; localizes to the actomyosin ring; binds to myosin light chains Mlc1p and Mlc2p through its IQ1 and IQ2 motifs respectively [Source:SGD;Acc:S000001065])

HSP 1 Score: 419.853 bits (1078), Expect = 5.423e-120
Identity = 304/854 (35.60%), Postives = 464/854 (54.33%), Query Frame = 2
Query:   68 SKGVKIWIPDEESVWIGATVL-------QFHKEKNVIKIITDNGISKELNLSSKKCAP-FLRNPDILIGQKDLTYLSYLNEPEVLYNLQIRF-CERREIYTYCGIVLVAINPYQELSIYGKEIINAYH------SQNSVD------LDPHIFAVAENAFRRMSSFGENQSIIVSGESGAGKTVSAKYTMRYFAL-----------VGGSKTKQSFNLTETQIERKVLLSNPILEAFGNAKTIRNDNSSRFGKYLEILFNPRNQVIGANMCTYLLEKSRVVFQNLGERNYHIFYQIVTHCQSEDELLMNTGLVN-NVEMYDYLRYGESLEIDGVDDSHEFLITKNSFLQLGIDLNKFKTICEILAAILHLGNIRFRFHDATDSSIIENPELLKLIAGLLGCSIDQLKIWLCFRTISTFQETLHKPLSKAEAQYFRDAFVKTLYSNLFDWIVKQANKVLS-TDVSINIKKKLKKTIVVNQEDKKKFIAVLDIYGFETFAENSFEQFCINFANEKLQLQFNLHVFKLEQEEYMNEGLEWTFIDYYNN-QPCIDLIESR---XXXXXXXXXXXXXXXXSDENWCCKIYSHHLNKSANFNKPKLSNMVFIIEHFAGPVEYKCAGFIEKNRDSVLEEQINLLKASDVQLIAELFRDSEIEIFDTNNXXXXXXXXXXXXXXXXXXQENTRKMK----KTVGSQFRNSLKSLMDALNKTNPHYVRCIKPNDLKLPFTFCPERAVQQLRACGVLETIRLSAAGFPSRWTYSDFYHRYYIL------MSNFNVKNHDFKAGSQKIVETLITV----PDAFRFGNTKLFFRPGQVALLEKLRGHKIESSVTLIQSILRGSIERKK 2473
            S  + +WIPDE+ V++   ++       +F  ++  I I+     ++  NL   + +  F  NP      ++++ L++LNEP VLYNL+ R+ C+   IYTY G+ LVAINPY  L++Y ++ IN YH      S++ +D      L PHIFA+AE A+  + S G++QSI+V+GESGAGKT + K  ++Y A            V GS   +SF       E K+L SNPILE+FGNA+T+RN+NSSRFGK+++I FN    + GA++  YLLEKSR+V QN  ERNYHIFYQ+++    +D  L N  L + NV+ Y  L       I G++D   F    ++   +G   ++ + I +++A IL +GNI F   D  + +  +N   +  I   LG      +  +        +E + +  +  +A++  +A  + LY  LF +IV   NK L     ++N                  +I +LDI GFE F  NSFEQ CIN+ NEKLQ  FN H+F LEQ EY+ E ++W +IDY  + Q  IDLIES+    G+L LLDEE  L K +DE++  K+ S     S+ F + +L N  FI++H+AG VEY   G++ KN+D + +  ++LL +S   +I++LF+                   S+        QE  +  +    KT  S+ R    +L++ L  T+PH+VRCI PN++K   TF     + QLR  GVLE IRL+  G+P+R  + +F+ RY IL       + F+ K    KA +++  E L+T        ++ GNTKLFF+ G +A LEK +  K+ + +  + + +RG   RK+
Sbjct:    8 SSNMIVWIPDEKEVFVKGELMSTDINKNKFTGQEEQIGIVHPLDSTEVSNLVQVRISDVFPVNPSTFDKVENMSELTHLNEPSVLYNLEKRYDCDL--IYTYSGLFLVAINPYHNLNLYSEDHINLYHNKHNRLSKSRLDENSHEKLPPHIFAIAEEAYENLLSEGKDQSILVTGESGAGKTENTKKILQYLASITSGSPSNIAPVSGSSIVESF-------EMKILQSNPILESFGNAQTVRNNNSSRFGKFIKIEFNEHGMINGAHIEWYLLEKSRIVHQNSKERNYHIFYQLLSGL--DDSELKNLRLKSRNVKDYKILSNSNQDIIPGINDVENFKELLSALNIIGFSKDQIRWIFQVVAIILLIGNIEF-VSDRAEQASFKND--VSAICSNLGVDEKDFQTAILRPRSKAGKEWVSQSKNSQQAKFILNALSRNLYERLFGYIVDMINKNLDHGSATLN------------------YIGLLDIAGFEIFENNSFEQLCINYTNEKLQQFFNNHMFVLEQSEYLKENIQWDYIDYGKDLQLTIDLIESKGPPTGVLPLLDEEAVLPKSTDESFYSKLISTWDQNSSKFKRSRLKNG-FILKHYAGDVEYTVEGWLSKNKDPLNDNLLSLLSSSQNDIISKLFQ------------PEGEKSSSAGVEANISNQEVKKSARTSTFKTTSSRHREQQITLLNQLASTHPHFVRCIIPNNVKKVKTFNRRLILDQLRCNGVLEGIRLAREGYPNRIAFQEFFQRYRILYPENSTTTTFSSK---LKASTKQNCEFLLTSLQLDTKVYKIGNTKLFFKAGVLADLEKQKDVKLNNIMIKLTATIRGYTVRKE 813          
BLAST of Dach-2 vs. Ensembl Yeast
Match: MYO5 (One of two type I myosin motors; contains proline-rich tail homology 2 (TH2) and SH3 domains; MYO5 deletion has little effect on growth, but myo3 myo5 double deletion causes severe defects in growth and actin cytoskeleton organization; MYO5 has a paralog, MYO3, that arose from the whole genome duplication [Source:SGD;Acc:S000004715])

HSP 1 Score: 374.785 bits (961), Expect = 3.087e-108
Identity = 240/754 (31.83%), Postives = 379/754 (50.27%), Query Frame = 2
Query:  245 IGQKDLTYLSYLNEPEVLYNLQIRFCERREIYTYCGIVLVAINPYQELSIYGKEIINAYHSQNSVDLDPHIFAVAENAFRRMSSFGENQSIIVSGESGAGKTVSAKYTMRYFALVGGSKTKQSFNLTETQIERKVLLSNPILEAFGNAKTIRNDNSSRFGKYLEILFNPRNQVIGANMCTYLLEKSRVVFQNLGERNYHIFYQIVTHCQSEDELLMNTGLVNNVEMYDYLRYGESLEIDGVDDSHEFLITKNSFLQLGIDLNKFKTICEILAAILHLGNIRFRFHDATDSSIIENPELLKLIAGLLGCSIDQLKIWLCFRTISTFQ-----ETLHKPLSKAEAQYFRDAFVKTLYSNLFDWIVKQANKVLSTDVSINIKKKLKKTIVVNQEDKKKFIAVLDIYGFETFAENSFEQFCINFANEKLQLQFNLHVFKLEQEEYMNEGLEWTFIDYYNNQPCIDLIESRXXXXX-XXXXXXXXXXXSDENWCCKIYSHHLNKSANFNKPKLSNMVFIIEHFAGPVEYKCAGFIEKNRDSVLEEQINLLKASDVQLIAELFRDSEIEIFDTNNXXXXXXXXXXXXXXXXXXQENTRKMKKTVGSQFRNSLKSLMDALNKTNPHYVRCIKPNDLKLPFTFCPERAVQQLRACGVLETIRLSAAGFPSRWTYSDFYHRYYILMSNFN-VKNHDFKAGSQKIVETLI---TVPDA-FRFGNTKLFFR-PGQVALLEKLRGHKIESSVTLIQSILRGSIERK 2470
            +G  DLT LS +++  +  NL+ RF     IYTY G VL+++NP+++L IY   ++N Y  +N +++ PH+FA+AE+ +  M S+ ENQ +I+SGESGAGKT +AK  M+Y A    + T+     +  +I+  VL +NP+LE+FG AKT+RN+NSSR GKYLEI FN + +    N+  YLLEK RVV Q   ERN+HIFYQ     +   +    T  V   E Y Y      +  + +DD  ++  T  +   +G+   +   I  +LAAIL +GN+ F   +   ++ + +  +   +A LL      L   L  R + T          H PL+  +A   RDA  K +Y+NLFDWIV + NK L                       +K I +LDIYGFE F  NSFEQ CIN+ NEKLQ  F     K EQE Y  E ++WT I Y++N+   DLIE+R          +      +D N   + ++  LN         L +  F+I+H+AG V Y   G  +KN+D + ++ + L+  +    +A +F D+                              +++   T G +   S   L++ L+K  P Y+R IKPN+ K P  +   + + Q++  G+ E +R+  AGF  R  +  F  R+Y+L  + +   ++ ++  +   V+ ++   ++P   ++ G T +F + P  +  LE +R     +    IQ   R  ++R+
Sbjct:   36 VGVSDLTLLSKISDEAINENLKKRFLNA-TIYTYIGHVLISVNPFRDLGIYTDAVMNEYKGKNRLEVPPHVFAIAESMYYNMKSYNENQCVIISGESGAGKTEAAKRIMQYIAAASSTHTE-----SIGKIKDMVLATNPLLESFGCAKTLRNNNSSRHGKYLEIKFNNQFEPCAGNITNYLLEKQRVVSQIKNERNFHIFYQF---TKGASDAYRQTFGVQKPEQYVYTAAAGCISAETIDDLQDYQETLKAMRVIGLGQEEQDQIFRMLAAILWIGNVSF-IENEEGNAQVRDTSVTDFVAYLLQIDSQLLIKSLVERIMETNHGMKRGSVYHVPLNIVQADAVRDALAKAIYNNLFDWIVSRVNKSLQAFPGA-----------------EKSIGILDIYGFEIFEHNSFEQICINYVNEKLQQIFIQLTLKSEQETYEREKIQWTPIKYFDNKVVCDLIEARRPPGIFAAMNDSVATAHADSNAADQAFAQRLNLFTTNPHFDLRSNKFVIKHYAGDVTYDIDGITDKNKDQLQKDLVELIGTTTNTFLATIFPDT--------------------------VDRESKRRPPTAGDKIIKSANDLVETLSKAQPSYIRTIKPNETKSPNDYDDRQVLHQIKYLGLQENVRIRRAGFAYRQVFEKFVERFYLLSPHCSYAGDYTWQGDTLDAVKYILQDSSIPQQEYQLGVTSVFIKTPETLFALEHMRDRYWHNMAARIQRAWRRFLQRR 736          
BLAST of Dach-2 vs. Ensembl Yeast
Match: MYO3 (One of two type I myosins; localizes to actin cortical patches; deletion of MYO3 has little effect on growth, but myo3 myo5 double deletion causes severe defects in growth and actin cytoskeleton organization; MYO3 has a paralog, MYO5, that arose from the whole genome duplication [Source:SGD;Acc:S000001612])

HSP 1 Score: 371.318 bits (952), Expect = 1.011e-106
Identity = 251/794 (31.61%), Postives = 393/794 (49.50%), Query Frame = 2
Query:  209 KCAPFLRNPDILIGQKDLTYLSYLNEPEVLYNLQIRFCERREIYTYCGIVLVAINPYQELSIYGKEIINAYHSQNSVDLDPHIFAVAENAFRRMSSFGENQSIIVSGESGAGKTVSAKYTMRYFALVGGSKTKQSFNLTETQIERKVLLSNPILEAFGNAKTIRNDNSSRFGKYLEILFNPRNQVIGANMCTYLLEKSRVVFQNLGERNYHIFYQIVTHCQSEDELLMNTGLVNNVEMYDYLRYGESLEIDGVDDSHEFLITKNSFLQLGIDLNKFKTICEILAAILHLGNIRFRFHDATDSSIIENPELLKLIAGLLGCSIDQLKIWLCFRTISTFQ-----ETLHKPLSKAEAQYFRDAFVKTLYSNLFDWIVKQANKVLSTDVSINIKKKLKKTIVVNQEDKKKFIAVLDIYGFETFAENSFEQFCINFANEKLQLQFNLHVFKLEQEEYMNEGLEWTFIDYYNNQPCIDLIESRXXXX-XXXXXXXXXXXXSDENWCCKIYSHHLNKSANFNKPKLSNMVFIIEHFAGPVEYKCAGFIEKNRDSVLEEQINLLKASDVQLIAELFRDSEIEIFDTNNXXXXXXXXXXXXXXXXXXQENTRKMKKTVGSQFRNSLKSLMDALNKTNPHYVRCIKPNDLKLPFTFCPERAVQQLRACGVLETIRLSAAGFPSRWTYSDFYHRYYILMSNFN-VKNHDFKAGSQKIVETLI---TVPDA-FRFGNTKLFFR-PGQVALLEKLRGHKIESSVTLIQSILRGSIERKKYLIIHKLTVQIQTYIRRKLAIEKATKL 2554
            K A F  N    +G  DLT LS +++  +  NL+ RF +   IYTY G VL+++NP+++L IY   ++ +Y  +N +++ PH+FA+AE+ +  + S+ ENQ +I+SGESGAGKT +AK  M+Y A    S ++     +  +I+  VL +NP+LE+FG AKT+RN+NSSR GKYLEI FN + +    N+  YLLEK RVV Q   ERN+HIFYQ         + +     V   E Y Y         D +DD  ++  T  +   +G+   +   I  +LAAIL +GNI F   +   ++ + +  +   +A LL      L   L  R + T          H PL+  +A   RDA  K +Y+NLFDWIV + N  L      +                 K I +LDIYGFE F  NSFEQ CIN+ NEKLQ  F     K EQE Y  E ++WT I Y++N+   DLIE++          +      +D N   + ++  LN   +    +L    F+I+H+AG V Y   G  +KN+D + ++ I L+  +    ++ +F D                             +++++   T G +   S   L++ L+K  P Y+R IKPN  K P  +   + + Q++  G+ E +R+  AGF  R T+  F  R+Y+L  + +   ++ +   + + V+ ++    +P+  F+ G T +F + P  +  LE +R     +    IQ   R  ++R+         ++IQ  IR K    K  KL
Sbjct:   24 KKATFDANKKKEVGISDLTLLSKISDESINENLKKRF-KNGIIYTYIGHVLISVNPFRDLGIYTNAVLESYKGKNRLEVPPHVFAIAESMYYNLKSYNENQCVIISGESGAGKTEAAKRIMQYIAAASNSHSE-----SIGKIKDMVLATNPLLESFGCAKTLRNNNSSRHGKYLEIKFNSQFEPCAGNITNYLLEKQRVVGQIKNERNFHIFYQFTKGASDTYKQMFG---VQMPEQYIYTAAAGCTTADTIDDVKDYEGTLEAMRTIGLVQEEQDQIFRMLAAILWIGNISF-IENEEGNAQVGDTSVTDFVAYLLQVDASLLVKCLVERIMQTSHGMKRGSVYHVPLNPVQATAVRDALAKAIYNNLFDWIVDRVNVSLQAFPGAD-----------------KSIGILDIYGFEIFEHNSFEQICINYVNEKLQQIFIQLTLKAEQETYEREKIKWTPIKYFDNKVVCDLIEAKNPPGILAAMNDSIATAHADSNAADQAFAQRLNLFNSNPYFELRANKFVIKHYAGDVTYDINGITDKNKDQLQKDLIELIGTTTNTFLSTIFPDD--------------------------VDKDSKRRPPTAGDKIIKSANELVETLSKAEPSYIRTIKPNQTKSPNDYDDHQVLHQVKYLGLQENVRIRRAGFAYRQTFEKFVERFYLLSPDCSYAGDYTWDGDTLEAVKLILRDAMIPEKEFQLGVTSVFIKTPESLFALEDMRDKYWYNMAARIQRAWRRFLQRR-----IDAAIKIQRTIREKKGGNKYVKL 759          
BLAST of Dach-2 vs. Ensembl Nematostella
Match: EDO41819 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S3A8])

HSP 1 Score: 845.884 bits (2184), Expect = 0.000e+0
Identity = 453/952 (47.58%), Postives = 622/952 (65.34%), Query Frame = 2
Query:   77 VKIWIPDEESVWIGATVLQFHKEKNVIKIITDNGISKELNLSSKKCA-PFLRNPDILIGQKDLTYLSYLNEPEVLYNLQIRFCERREIYTYCGIVLVAINPYQELSIYGKEIINAYHSQNSVDLDPHIFAVAENAFRRMSSFGENQSIIVSGESGAGKTVSAKYTMRYFALVGGSKTKQSFNLTETQIERKVLLSNPILEAFGNAKTIRNDNSSRFGKYLEILFNPRNQVIGANMCTYLLEKSRVVFQNLGERNYHIFYQIVTHCQSEDELLMNTGLVNNVEMYDYLRYGESLEIDGVDDSHEFLITKNSFLQLGIDLNKFKTICEILAAILHLGNIRFRFHDATDSSIIENPELLKLIAGLLGCSIDQLKIWLCFRTISTFQETLHKPLSKAEAQYFRDAFVKTLYSNLFDWIVKQANKVLSTDVSINIKKKLKKTIVVNQEDKKKFIAVLDIYGFETFAENSFEQFCINFANEKLQLQFNLHVFKLEQEEYMNEGLEWTFIDYYNNQPCIDLIESRXXXXXXXXXXXXXXXXSDENWCCKIYSHHLNKSANFNKPKLSNMVFIIEHFAGPVEYKCAGFIEKNRDSVLEEQINLLKASDVQLIAELFRDSEIEIFDTNNXXXXXXXXXXXXXXXXXXQENTRKMKKTVGSQFRNSLKSLMDALNKTNPHYVRCIKPNDLKLPFTFCPERAVQQLRACGVLETIRLSAAGFPSRWTYSDFYHRYYILMSNFNVKNHDFKAGSQKIVETLITVPDAFRFGNTKLFFRPGQVALLEKLRGHKIESSVTLIQSILRGSIERKKYLIIHKLTVQIQTYIRRKLAIEKATKLSQIRAVIIIQSFYRMYLARKLFVKMKCAVLAIEKWRRKIITTRLKQAYKKENCVIICQAIVRRFIQRRKFLKIQRGVILIQNHYRRRKAKETLKILKIEARSINHIKFVNKGLENKIIELTQKLD 2929
             ++WIP  + VWIG  + +  ++K +++I+ ++G  +E+ + ++K   P LRNP+IL+G+ DLT LSYL+EP VL+NL +RF +   IYTYCGIVLVAINPY+EL +YG +I+ AY  ++  D+DPHIFAVAE+AF+ M     NQS+IVSGESGAGKTVSAKY MRYF+ VGG+ T       ETQIE+KV+ +NPI+EA GNAKTIRNDNSSRFGKYLEI F+  + +IGA+M TYLLEKSRVVFQ   ERNYH+FYQ+   C+  +   M    + + + + YL  G++  +D +DD+  F   + +   +GI+ ++   +  IL+AILHLGN+        + ++ EN   L++ A LLG   +QL+ WLC R I T  E L KPLS  EA Y R+A  K +YS LF W+V   N  L++                       FI VLDIYGFETF  NSFEQFCIN+ANEKLQ QF  HVFKLEQ+EY+ E ++W+FI++Y+NQPCIDLIE++LG+LDLLDEECK+ KGSD  W  K+Y  HL KS +F+KP++SN+ F+I HFA  VEY  +GF+EKNRD+V +E + LL+AS+ +++ E+F +++             + +    S    +     KM K+VGSQF  SL  LM+ LN T PHYVRCIKPND K PF F P+R++QQLRACGVLETIR+SAAG+PSRWTY +F+ RY +L+ +  +     +   + I+ET I   D F+ G TK+FFR GQVA LEKLRG K+  S  +IQ   R   E K YL + K  + IQ ++R   A   A  L + ++   IQ +YR +  R+ +++   A+L I+ + R +   R +Q         + Q   R +  R+K+    + +I +Q+  RR +A++ LK LKIEARS+ H K +NKG+ENKIIEL Q+LD
Sbjct:    1 ARVWIPHPDLVWIGGELTKDIEDK-ILEILLEDG--REIIIDTRKSRLPPLRNPEILVGENDLTTLSYLHEPAVLHNLNVRFIQSNAIYTYCGIVLVAINPYEELPLYGPDIVAAYRGRSMGDMDPHIFAVAEDAFQSMIRDERNQSVIVSGESGAGKTVSAKYAMRYFSAVGGAST-------ETQIEKKVIATNPIMEAIGNAKTIRNDNSSRFGKYLEISFDRNHHIIGAHMRTYLLEKSRVVFQAAEERNYHVFYQMCAACELPE---MKDFRLAHPDNFSYLNQGDAPVVDSIDDADCFEELREALSMVGINDDEQLMLFRILSAILHLGNVEILQAGDDECTVEENDFHLEMTAVLLGIDKNQLRKWLCNRKIVTVGEVLIKPLSITEANYGREAISKRIYSQLFKWVVNTINCTLTS-----------------TSKPHSFIGVLDIYGFETFEINSFEQFCINYANEKLQQQFTQHVFKLEQDEYVREEIQWSFINFYDNQPCIDLIEAKLGILDLLDEECKMPKGSDSQWAQKLYKQHLQKSKHFSKPRMSNLAFVIHHFADHVEYFVSGFVEKNRDTVNDEHLALLRASEDEMVGEMFTENDAH----------SAPRKRAASRAGKQGGKGGKMFKSVGSQFSVSLSKLMETLNSTTPHYVRCIKPNDTKAPFEFHPKRSIQQLRACGVLETIRISAAGYPSRWTYREFFARYIMLLPSKKINRKKPRETIKLILETFIKDEDMFQMGKTKIFFRAGQVAYLEKLRGDKLRRSCVMIQKNYRCYREHKLYLRMRKAAILIQAWVRGDQARNLARSLRRNKSATTIQRYYRGFHLRQAYLRKHAAILTIQSYARGMSARRQRQVLLYNAKAGVIQRCWRGYKGRQKYRNYFKKIIFLQSCVRRMRARKELKKLKIEARSVEHFKALNKGMENKIIELQQRLD 912          
BLAST of Dach-2 vs. Ensembl Nematostella
Match: EDO49515 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGF6])

HSP 1 Score: 448.358 bits (1152), Expect = 3.878e-134
Identity = 286/814 (35.14%), Postives = 437/814 (53.69%), Query Frame = 2
Query:  236 DILIGQKDLTYLSYLNEPEVLYNLQIRFCERREIYTYCGIVLVAINPYQELSIYGKEIINAYHSQNSVDLDPHIFAVAENAFRRMSSFGENQSIIVSGESGAGKTVSAKYTMRYFALVGGSKTKQSFNLTETQIERKVLLSNPILEAFGNAKTIRNDNSSRFGKYLEILFNPRNQVIGANMCTYLLEKSRVVFQNLGERNYHIFYQIVTHCQSEDELLMNTGLVNNVEMYDYLRYGESLEIDGVDDSHEFLITKNSFLQLGIDLNKFKTICEILAAILHLGNI---RFRFHDATDSSIIENPELLKLIAGLLGCSIDQLKIWLCFRTISTFQETLHKPLSKAEAQYFRDAFVKTLYSNLFDWIVKQANKVLSTDVSINIKKKLKKTIVVNQEDKKKFIAVLDIYGFETFAENSFEQFCINFANEKLQLQFNLHVFKLEQEEYMNEGLEWTFIDYYNNQPCIDLIESRXXXXXXXXXXX--XXXXXSDENWCCKI---YSHHLNKSANFNKPKLSNMV-----FIIEHFAGPVEYKCAGFIEKNRDSVLEEQINLLKASDVQLIAELFRDSEIEIFDTNNXXXXXXXXXXXXXXXXXXQENTRKMKKTVGSQFRNSLKSLMDALNKTNPHYVRCIKPNDLKLPFTFCPERAVQQLRACGVLETIRLSAAGFPSRWTYSDFYHRYYIL----MSNFNVKNHDFKAGSQKIVETLITVPDAFRFGNTKLFFR-PGQVALLEKLRGHKIESSVTLIQSILRGSIERKKYLIIHKLTVQIQTYIRRKLAIEKATKLSQIR-AVIIIQSFYRMYLARKLF 2620
            D ++G  D+  L  L E  ++ NL  R+   + IYTY G V+V+INPY++  +Y +E+I  Y S+N  +L PHI+A+A++A+R M    ++Q II++GESG+GKT ++K  M+Y A V G   +        +++ ++L SNPILEAFGNAKT+RNDNSSRFGKY++I F+ +   +G  +  YLLEKSR+V+QN GERN+HIFY ++    + D LL +  L  + + Y YL   E + +   DD  +F + + +   +G   ++   + ++L+AIL+LGN     F   D T++  + N ++LK    +L C ++ L   L  RT+ T  E +H PL+ A+A Y RDA  K +Y  LF WIV + N       SI ++K+           K+K I VLDIYGFE F +NSFEQF IN+ NEKLQ  F     K EQEEY+ EG+EWT I+Y+NN    +LIE     +  L +E   +  + SD  +  K+   + HH +  +  +K  LS+       F ++H+AG V Y   GF++KN D +       + + +  L  +LF +                             +++++  KT  +QF+ S+  LM  L   NP+Y+RCIKPN+ K    F       Q+R  G++E IR+  AGF  R  Y     RY +L      N+     D   G  ++++ L   P  + +G TK+F R P  +  LE+ R   +E    +IQ I RG   +K+Y  + +  + I  Y RR           ++R A I+I S+ R + ARK +
Sbjct:   18 DNMVGVSDMVLLEPLTEDAIMENLWDRY-NAKAIYTYIGNVVVSINPYRKFPLYTREVIAEYRSRNIYELPPHIYAIADDAYRSMRDHNKDQCIIITGESGSGKTEASKVIMQYVAAVCGKGREVD------RVKEQLLQSNPILEAFGNAKTLRNDNSSRFGKYMDIEFDFKGDPVGGVITKYLLEKSRLVYQNKGERNFHIFYHLLR--GASDNLLDDLRLTRDFDGYHYLNQSECVSVPTKDDKEDFSVVEKAMEVVGFTEDEISAVYKLLSAILNLGNTELEEFTTSDGTEAVTVLNEQVLKNTCEMLQCDVELLLNSLRERTVETKTERVHTPLNVAQASYARDALAKAVYQRLFAWIVDRVND------SIQVRKR----------GKRKVIGVLDIYGFEIFVDNSFEQFIINYCNEKLQQIFIELTLKSEQEEYVREGIEWTTIEYFNNAVICELIEKNHSGILALLDEECLRPGEVSDLTFLEKLDKQWIHHEHYESRKDKKYLSDKTLPHGYFRLKHYAGKVTYDVDGFLDKNNDLLFRGLSQCMYSCNHPLTKKLFPEG-------------------------CPTKSSKRRPKTTATQFKESVAELMKNLKSKNPNYIRCIKPNERKAAGVFDERLIKHQVRYLGLMENIRVRRAGFAFRQEYPVALQRYKMLCPRTWPNWLGAPRD---GIVELLKHLNVKPTEYAYGRTKIFIRNPRTLFALEEKRKDGMEDLAVIIQKIFRGWRRKKQYQNMRRSEITIAKYYRR---FRDQRDYRRMRNAAILIASYARGWKARKAY 775          
BLAST of Dach-2 vs. Ensembl Nematostella
Match: EDO45563 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RSH2])

HSP 1 Score: 434.491 bits (1116), Expect = 2.820e-132
Identity = 300/858 (34.97%), Postives = 451/858 (52.56%), Query Frame = 2
Query:   68 SKGVKIWI---PDEESVWIGATVLQFHKEKNVIKIITDNGISKELNLSSKKCAPFLRN--PDILIGQKDLTYLSYLNEPEVLYNLQIRFCERREIYTYCGIVLVAINPYQELSIYGKEIINAYH-SQNSVDLDPHIFAVAENAFRRMSSFGENQSIIVSGESGAGKTVSAKYTMRYFALVGGSKTKQSFNLTETQIERKVLLSNPILEAFGNAKTIRNDNSSRFGKYLEILFNPRNQVIGANMCTYLLEKSRVVFQNLGERNYHIFYQIVTHCQSEDELLMNTGLVNNVEMYDYLRYGESLEIDGVDDSHEFLITKNSFLQLGIDLNKFKTICEILAAILHLGNIRF--RFHDATDSSIIENPELLKLIAGLLGCSIDQLKIWLCFRTISTFQE--TLHKPLSKAEAQYFRDAFVKTLYSNLFDWIVKQANKVLSTDVSINIKKKLKKTIVVNQEDKKKFIAVLDIYGFETFAENSFEQFCINFANEKLQLQFNLHVFKLEQEEYMNEGLEWTFIDYYNNQPCIDLI-ESRXXXXXXXXXXXXXXXXSDENWCCKI-YSHHLNKSANFNKPKLS-NMVFIIEHFAGPVEYKCAGFIEKNRDSVLEEQINLLKASDVQLIAELFRDSEIEIFDTNNXXXXXXXXXXXXXXXXXXQENTRKMKKTVGSQFRNSLKSLMDALNKTNPHYVRCIKPNDLKLPFTFCPERAVQQLRACGVLETIRLSAAGFPSRWTYSDFYHRYYILMSNFNVKNHDFKAGSQKIVETLITVPDAFRFGNTKLFFRPGQVALLEKLRGHKIESSV-----------------------TLIQSILRGSIERKKYLIIHKLTVQIQTYIR-RKL 2530
            ++G  +W+     E  V IGA V    KE     +I  +   KE+ +  +  A  L++  P  + G +++  L  L+E  +L NL IR+    +IYTY G VLVA+NPY    IYG   I+ Y  + N+ DL PHI+A  E +F  M     NQ +++SGESGAGKT S K+ ++Y   V G           + IE ++L +NPILEAFGNAKTIRNDNSSRFGKY+++ FN    + GA +  YLLE+SR+V Q   ERNYHIFY+++     +++  ++   + + + Y YL  G  L  +G+DD++E+ + + +   L     + + I   +AA+LHLGNI F  +  D  ++  + NPE +   A LL    + ++    F   STF E   ++ P+S   A   RDAFVK LYS +F WIV + N         +I K   K    +    ++ I VLDI+GFE F  NSFEQ CIN+ANE LQ  F   +FK EQEEY  EG+EW F+ + +NQ  +D++ E  +  + L+DEE +  +G+DE++  K+ Y+H  NK  +F +PK      F + HFAG V Y   GF++KNR++   + ++L+ +S       +F                                 TRK   T+G QFR SL  LM  L      +VRC+KPN+ K P  F  E   QQLR  G+LET+R+  +G+  R T+ +F  RY++L+ + ++++   +  S  I  +L+   + ++ G  ++F +  Q  LLE+ R   + S +                        LIQS  RG   RK +L + +   ++Q   R RKL
Sbjct:    5 AQGDHVWLEAGDGENDVAIGACV----KEVQGASVILVDDEGKEVVID-RSVAESLKHMHPSSVEGVENMIELGDLDEAGILRNLLIRY-RANKIYTYVGSVLVAVNPYCSFPIYGTAYISRYQKAVNATDLPPHIYATGEMSFAMMKREKHNQCVVISGESGAGKTESTKFILQYLTAVSGR---------HSTIEEQILDANPILEAFGNAKTIRNDNSSRFGKYIDVHFNDSWVIEGAKIDHYLLEQSRIVAQMPNERNYHIFYRMLAGMSPQEKKSLH---LTHAQDYYYLSQGNCLTCEGMDDAYEYDVIRKAMTALWFTEEETQFIFRSIAAVLHLGNISFEAKMEDNIEACDVMNPETVAAAADLLQVPKEHME--EAFTRKSTFAEGEMIYSPVSVERATDIRDAFVKGLYSKVFIWIVNKINS--------SIYKPRGK----DDTSGRQSIGVLDIFGFEKFDMNSFEQLCINYANENLQQFFVAQIFKNEQEEYDREGIEWNFVTFVDNQEVLDMLAEKPMNFIALIDEESRFPQGTDESFLDKLNYNHKDNK--HFVRPKSRVQSQFGVVHFAGTVYYDTTGFLDKNRNTFSADLVDLISSSKCNFFLNMF------------------------FKERSMGTETRKRSPTLGVQFRRSLDVLMKTLASCRSFFVRCVKPNNYKKPMEFDRELCWQQLRYSGMLETVRIRKSGYAMRHTFEEFVTRYHMLVRD-SLRDMSSRDASHLIATSLLG-QENWKLGTKRIFLKESQDVLLEESRAQLLSSKIIFLQRAMRRYLRMRRARRTRKGAVLIQSRWRGYRNRKAFLAMKRGFARLQATFRARKL 802          
BLAST of Dach-2 vs. Ensembl Nematostella
Match: EDO45835 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRW9])

HSP 1 Score: 410.609 bits (1054), Expect = 9.865e-122
Identity = 267/762 (35.04%), Postives = 411/762 (53.94%), Query Frame = 2
Query:  248 GQKDLTYLSYLNEPEVLYNLQIRFCERREIYTYCGIVLVAINPYQELSIYGKEIINAYHSQNSVDLDPHIFAVAENAFRRMSSFGENQSIIVSGESGAGKTVSAKYTMRYFALVGGSKTKQSFNLT-ETQIERK---VLLSNPILEAFGNAKTIRNDNSSRFGKYLEILFNPRNQVIGANMCTYLLEKSRVVFQNLGERNYHIFYQIVTHCQSEDELLMNTGLVNNVEMYDYLRYGESLEIDGVDDSHEFLITKNSFLQLGIDLNKFKTICEILAAILHLGNIRFRFHDATDSSIIENPELLKLIAGLLGCSIDQLKIWLCFRTISTFQETLHKPLSKAEAQYFRDAFVKTLYSNLFDWIVKQANKVLSTDVSINIKKKLKKTIVVNQEDKKKFIAVLDIYGFETFAENSFEQFCINFANEKLQLQFNLHVFKLEQEEYMNEGLEW------TFIDYYNNQPCIDLIES--RXXXXXXXXXXXXXXXXSDE---NWCCKIYSHHLNKSANFNKPKLSNMV----FIIEHFAGPVEYKCAGFIEKNRDSVLEEQINLLKASDVQLIAELFRDSEIEIFDTNNXXXXXXXXXXXXXXXXXXQENTRKMKKTVGSQFRNSLKSLMDALNKTNPHYVRCIKPNDLKLPFTFCPERAVQQLRACGVLETIRLSAAGFPSRWTYSDFYHRYYILMSNF--NVKNHDFKAGSQKIVETLITVPDAFRFGNTKLFFR-PGQVALLEKLRGHKIESSVTLIQSILRGSIER 2467
            G+ D   L  + +   + NL+ RF + R IYTY G V+V++NPY+ L IYG + I  Y  +   +  PHIFA+A+ ++R M    E+  I++SGESG+GKT ++K  MRY A +         NL+ + +IER    +L SN ILE+FGNA+T RNDNSSRFGKY++I F+ +   IG ++  YLLEKSRVV Q  GERN+H FYQ+ +     D ++   GL  +  +Y Y + G+  +I  ++DS  + +  ++   +G    + KT+ +++AAILHLGN+ F  H+  + +++EN ++L++IA LLG S + L+  LC+R ++   E + K  ++ EA + RDA  K  Y  LF WIV + N       SI ++ K        +  K   I VLDIYGFE F  NSFEQ CIN+ NEKLQ  F   V K EQEEY  EG+EW      + ++Y+NN+   DLIE   +  +  + +    + K +D+       K  + H +  +    P   +M     F I+H+AG V Y    F++KN+D++ ++   LL  S  + + +++ + +  I                          T +   T G+ F+NS+ +L++ L    P YVRCIKPN++K P  F  +    Q+   G+LE +R+  AG+  R  Y  F  RY +  +    +    D   G ++IV++     D  ++G TK+F R P  +  LEK R  K+   V ++Q   RG I R
Sbjct:   10 GKGDFVLLDEVTKTAFMENLESRFHKER-IYTYIGEVVVSVNPYKTLDIYGDDKIQEYKMREMYERPPHIFALADASYRAMKRRSEDTCIMISGESGSGKTEASKIIMRYIAAIT--------NLSKQKEIERVKDILLKSNAILESFGNARTNRNDNSSRFGKYMDIDFDFKGDPIGGHIFNYLLEKSRVVKQQEGERNFHSFYQVPS-----DSMIGEYGLERDAMLYYYTKQGKVPKISTINDSSLYKLNCDAMKSVGFSAEEQKTVWKLVAAILHLGNVVFT-HEDHEQAVVENKDVLQIIAKLLGLSHEMLERALCYRVVAARGEVMEKGHNEKEAYHGRDALAKAAYDRLFSWIVSRIND------SIEVRDK-------KEHGKCTVIGVLDIYGFEIFETNSFEQLCINYCNEKLQQLFIELVLKEEQEEYQREGIEWKSIHRCSQVEYFNNKIICDLIEQSHKGIIAIMDEGCLNVGKVTDQMLLQTMDKKLAKHPHYRSRLTDPSDKSMEFHRDFCIKHYAGNVIYSVEEFLDKNKDTLFQDFKRLLYNSKHKSLKDMWPEGQESI------------------------TKTTQRPATAGTLFKNSMIALVEKLISKRPFYVRCIKPNEIKSPVAFDEKVVGNQVDYLGLLENVRVRRAGYAFRMHYKRFLLRYKMTDAKTWPSYPGQDID-GVREIVDSH-GFSDDVKYGTTKIFIRTPQTIFELEKSRAAKLPDLVFMLQRCWRGGIAR 717          
BLAST of Dach-2 vs. Ensembl Nematostella
Match: EDO35007 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SMP8])

HSP 1 Score: 392.889 bits (1008), Expect = 1.306e-118
Identity = 259/772 (33.55%), Postives = 396/772 (51.30%), Query Frame = 2
Query:  257 DLTYLSYLNEPEVLYNLQIRFCERREIYTYCGIVLVAINPYQELSIYGKEIINAYHSQ--NSVDLDPHIFAVAENAFRRMSSFGENQSIIVSGESGAGKTVSAKYTMRYFALVGGSKTKQSFNLTETQIERK---VLLSNPILEAFGNAKTIRNDNSSRFGKYLEILFNPRNQVIGANMCTYLLEKSRVVFQNLGERNYHIFYQIVTHCQSED--ELLMNTGLVNNVEMYDYLRYGESLEIDGVDDSHEFLITKNSFLQLGIDLNKFKTICEILAAILHLGNIRFRFHD----ATDSSIIENPE-LLKLIAGLLGCSIDQLKIWLCFRTISTFQETLHKPLSKAEAQYFRDAFVKTLYSNLFDWIVKQANKVLSTDVSINIKKKLKKTIVVNQEDKKKFIAVLDIYGFETFAENSFEQFCINFANEKLQLQFNLHVFKLEQEEYMNEGLEWTFIDYYNNQPCIDLIESRXXXXXXXXXXXXXXXXSDENWCCKIYSHHLNKSANFNKPKLSNMV----------------FIIEHFAGPVEYKCAGFIEKNRDSVLEEQINLLKASDVQLIAELFRDSEIEIFDTNNXXXXXXXXXXXXXXXXXXQENTRKMKKTVG-SQFRNSLKSLMDALNKTNPHYVRCIKPNDLKLPFTFCPERAVQQLRACGVLETIRLSAAGFPSRWTYSDFYHRYYILMSNFNVKNH--DFKAGSQKIVETLITVPDAFRFGNTKLFFR-PGQVALLEKLRGHKIESSVTLIQSILRGSIERKKY 2476
            D+  +  ++E  +  NL+IR  ++ EIYT  G VL+++NP+++++IYG + +  Y  +  N     PH++ VA N F  M   G++Q +I+SGESGAGKTVSAK+ M + + V G  +        T++ER    ++ SNP+LEAFGNAKT+ N+NSSRFGK++EI ++   Q  G  + T+LLEKSRVV Q  GERNYHIFYQ+++ C  ++  EL ++ G     E Y YL       I+G DD  ++  T N+   +GI  +   T+ +++A +LHLGNI+F   D      D S+++ P  LL +   +L   +D+L  +          E   K L+K +A   RDA  K ++  LF+++V+  N  ++T                   D+  +I VLDIYGFE+F  N FEQF IN+ NEKLQ  F     K+EQEEY  EG+ W+ IDY+NN   + LIESR     +            ++ C  +++     SAN    KL  ++                F I H+AG V Y+  GF EKN+D++  + + L+++S    + ++F DS                        +      RK K   G S+ R    +L+  +    PHYVRC+KP + K+P  +  ++ + Q+R  G+ E I++  AGF  R  +     RY  L+    V+ H  D  A  + I+         ++ G TKLF + P  +  LE+ R   I      IQ++ RG   RK Y
Sbjct:    7 DMIEIPDVSEASIANNLKIRL-KQEEIYTNIGRVLISVNPFKKINIYGMDAVELYSGKKHNEGAKPPHLYEVANNMFENMLIEGDSQCVIISGESGAGKTVSAKHVMGFLSKVCGEGS--------TEVERVKDIIMQSNPLLEAFGNAKTVMNNNSSRFGKFMEIQYSRSGQPNGGKISTFLLEKSRVVSQGQGERNYHIFYQLLSGCTPDEMSELEIDLG---PAESYKYLNQTGVYTIEGTDDVSDYAATINAMEVIGIASSTRNTVLKLVATVLHLGNIQFTEEDNQAVPVDVSMLDAPSRLLSVDKDIL---LDKLTSYSMETRWGGKVEVTKKTLNKDQAVIARDALAKAIFFQLFEYLVEAVNSTMAT------------------RDQDFYIGVLDIYGFESFKVNGFEQFSINYVNEKLQNLFIDFTLKMEQEEYAEEGISWSDIDYFNNDVVLQLIESRRPPGIMGVL---------DDVCSTLHAVS-EGSANTLMDKLRGVIGSNSSFAKYFQAQARHFAITHYAGKVSYESEGFCEKNKDTLSNDLVCLMQSSTEPFVRDMFPDS---------------------LYGASAGVGGRKAKSNTGSSKIRTQAHALVSKIRMCTPHYVRCVKPTESKIPLDWDDKKVLHQVRYLGLAENIKVRRAGFAFRREFPRIVERYS-LLDPITVRKHQSDPVAACKAILLAGNLDMTKYQVGKTKLFLKEPQMINQLEEARNAIITKYALTIQTVYRGYRARKIY 713          
BLAST of Dach-2 vs. Ensembl Medaka
Match: myo5ab (unconventional myosin-Va [Source:NCBI gene;Acc:101173462])

HSP 1 Score: 994.956 bits (2571), Expect = 0.000e+0
Identity = 684/1934 (35.37%), Postives = 1036/1934 (53.57%), Query Frame = 2
Query:   53 LYEMYSKGVKIWIPDEESVWIGATVLQFHKEKNVIKIIT-DNGISKELNLSSKKCA-PFLRNPDILIGQKDLTYLSYLNEPEVLYNLQIRFCERREIYTYCGIVLVAINPYQELSIYGKEIINAYHSQNSVDLDPHIFAVAENAFRRMSSFGENQSIIVSGESGAGKTVSAKYTMRYFALVGGSKTKQSFNLTETQIERKVLLSNPILEAFGNAKTIRNDNSSRFGKYLEILFNPRNQVIGANMCTYLLEKSRVVFQNLGERNYHIFYQIVTHCQSEDELLMNTGLVNNVEMYDYLRYGESLEIDGVDDSHEFLITKNSFLQLGIDLNKFKTICEILAAILHLGNIRFRFHDATDSSIIENPELLKLIAGLLGCSIDQLKIWLCFRTISTFQETLHKPLSKAEAQYFRDAFVKTLYSNLFDWIVKQANKVLSTDVSINIKKKLKKTIVVNQEDKKKFIAVLDIYGFETFAENSFEQFCINFANEKLQLQFNLHVFKLEQEEYMNEGLEWTFIDYYNNQPCIDLIESRXXXXXXXXXXXXXXXXSDENWCCKIYSHHLNKSANFNKPKLSNMVFIIEHFAGPVEYKCAGFIEKNRDSVLEEQINLLKASDVQLIAELFRDSEIEIFDTNNXXXXXXXXXXXXXXXXXXQENTRKMKKTVGSQFRNSLKSLMDALNKTNPHYVRCIKPNDLKLPFTFCPERAVQQLRACGVLETIRLSAAGFPSRWTYSDFYHRYYILMSNFNVKNHDFKAGSQKIVETLITVPDAFRFGNTKLFFRPGQVALLEKLRGHKIESSVTLIQSILRGSIERKKYLIIHKLTVQIQTYIRRKLAIEKATKLSQIRAVIIIQSFYRMYLARKLFVKMKCAVLAIEKWRRKIITTRLKQAYKK---ENCVIICQAIVRRFIQRRKFLKIQRGVILIQNHYRRRKAKETLKILKIEARSINHIKFVNKGLENKIIELTQKLDTKEKE---------MCXXXXXXXXXXXXXXXXXXXXXAESAKIYQNTVQDLQTEIIQLKKELNREIVEKNKIFADKELLEINYKKKINYLENLIEELKSSPSVIEPNIICNGDEAQQSICQDEHQ----------------KFINEQMDHQKLVREYEKLEMKYENLYKEFLFVKSSNQKPSINYD-NQTSNDSE-TES--TFSKDDADVESLSDKVDAKTTKEHXXXXXXXXXXLPNFISESISTAGDLAVVMQLQMNISSLSQENNRLKETVQQFEDELLKYEQCAEDSKGLVIHNEYDNELLSIIKDIKGMDEHGLKSRLIDEVANLKKKLKQSNEDYQK-------------------------------LRLHIFD----------------------GSMSKLTGNLDHESINSEEEELKRAFESQKEANRKMLKEI-EGIKANNVDLKKALFQIRK---DKEQLQVQLGKQHLMIRHGVEYLQNLKLTPKERLDKFVQNEISRILLENLKLQERNDQIISETIELKRGLKYFAFRLQKYEGSLVPNPNKEEDLLQLIQNVIYHSKMKTIGKRECYSEIGLIDLNMSELSIFIKSFIFDLSP-SICLQYEPYHLVPYIIFMVTRKFDFYKEEDQMTNFLSKLIVALKRTIRKRRNYIEYLVMLLSNVFCLVNLXXXXXXXXXXXXLNTAEDIQHYFVHYDLNEFIRLLKELCVTLFQMILKTIVDNLLPQSLCIDAILVHEAIIDFL-SKDGTKYKSNIETQPKNTSFNVLTKNLQSVLEILKNHKIPQLIINQIFVHIAYLINAYCLNTLLFRTDLCYFSKGLQIKYNLSSFETWIRYQKLIDSGALQCLRPMTEAVQLLQTLIDSDEDAKFVCDMCEYLNTRQVVKILNNFNPRDGYGCRLSSGLIAKIETQMKIKRGDEPSESKLETPTVIEIPIDIPFIHNGVSLCRTIIPKPLYLSCLT 5575
            L   + +  ++W+PD  +VW  A + + +   ++   +  ++G + E  ++ +  + P LRNPDIL+G+ DLT LSYL+EP VL+NL++RF + + IYTYCGIVLVAINPY+ L IY  +IINAY  QN  D+DPHIFAVAE A+++M+    NQSII+SGESGAGKTVSAKY MRYFA V  S         E  +E +VL S+PI+EAFGNAKT RNDNSSRFGKY+EI F+ +  +IGANM TYLLEKSRVVFQ  GERNYHIFYQ+   C S       T  +   + +   + G+S  IDGV+D+ E   T+ +F  LG++      I +IL+A+LHL N+  +      SSI  +   + +   L+G   ++   WLC R + T +E+  KP+ +  A   RDA  K +Y+ LF WIV   N  L +    N                  FI VLDIYGFETF  NSFEQFCIN+ANEKLQ QFNLHVFKL+QEEYM EG+ WT ID+Y+NQPCI+LIE++LG+LDLLDEECK+ KGSD+ W  K+Y+  L ++++F KP+LSN  FII HFA  VEY+C GF+EKN+D+V EEQIN LK +    + +LF + +      N   P  +             ++ R  KKTVG QFR SL  LM+ LN T PHYVRCIKPNDLK PF   P RAVQQLRACGVLETIR+SAAGFPSRW+Y +F+ RY +LM   +V   D K   + ++E LI   + ++FG  K+FFR GQVA LEKLR  K+  +   IQ  +R  + R+KYL   +  + IQ Y R   A      L Q RA + IQ   RM+L RK +++ + A +AI+   R  +    KQ Y K   E   +I Q  VR ++ ++ + +    V+L+Q+  RR KAK+ L+ LK+EARS+ H K +N G+ENKI++L QKL+ ++KE         +      L +E++   +       E  +    TV  L  ++  L+++L     EK+++     +    YK++    + ++++L    ++++ NI    D+  + I Q   Q                    E+  +Q L+ E+  LE ++++L +E +   +S+++     D N +SN SE T+S  +F  +D+ +++ ++                              T  DL ++++LQ  +  L QE   L + + + E+   + E+  E  +  V   E D E L      K ++      +L  ++ +L+K L   N D                                  LR H+                         S   +  + D  ++N E+ EL  A+E  KE NR +  ++ E  + ++   +K L ++ K   +KEQ Q  L              Q+L L    R++  +++EI+R+  ENL+  E+ ++      +L + LK +  +++ +E S V   +   D ++++           I ++E   + G+++   S+LS  +K  I DL P  + + + P  L  YI+FM  R  D   ++ +++  L+  I ++K  ++++    E +   L+N   L++  +QYSG + F   NTA+  +    +++L+E+ +L  +L + ++  ++K + DN+L Q L + ++L HE I   L SK     K +  T     +  VL + L   L  +  H +   ++ QI     Y+I A  LN LL R D+C +SKGL I+YN+   E W+   +L DSGA + L P+ +A QLLQ    ++ DA  +C+MC  L T Q++K+L  + P   +  R+S+  I+ I+  +K    D    + L         +  PF  + V+L    IP  L L+ LT
Sbjct:   13 LLSCFIQHARVWLPDAATVWQSAELTKDYTPGDLTLCLQLEDGTNVEHKINPQTTSLPPLRNPDILVGENDLTALSYLHEPAVLHNLKVRFIDSKLIYTYCGIVLVAINPYESLPIYEPDIINAYSGQNMGDMDPHIFAVAEEAYKQMARDQRNQSIIISGESGAGKTVSAKYAMRYFATVSCSS-------GEANVEERVLASSPIMEAFGNAKTTRNDNSSRFGKYIEIGFDKKYCIIGANMRTYLLEKSRVVFQAHGERNYHIFYQL---CASSHLPEFKTFKLGCADDFHCTKQGQSPIIDGVNDAKELCSTRRAFSLLGMEEEDQMEIYQILSALLHLSNVEIKDQSGDRSSISPDDVHMMVFCELMGVPCEETAHWLCHRKLKTSKESFVKPVPRVNAVQGRDALAKHIYARLFSWIVGCVNGALKSTGKQN-----------------SFIGVLDIYGFETFDVNSFEQFCINYANEKLQQQFNLHVFKLDQEEYMREGIPWTLIDFYDNQPCINLIEAKLGVLDLLDEECKMPKGSDDTWTQKLYNILLKQNSHFEKPRLSNRAFIIHHFADKVEYQCLGFLEKNKDTVNEEQINALKKTKFDFLLKLFDEDDKGTGSPNKLTPGRAG------------QSQRDNKKTVGLQFRQSLHLLMETLNSTTPHYVRCIKPNDLKAPFVLDPVRAVQQLRACGVLETIRISAAGFPSRWSYPEFFTRYRVLMKQKDVLP-DRKQTCKDLLEKLIKNQEKYQFGKNKIFFRAGQVAYLEKLRSDKLRLACVSIQKTIRCWLARRKYLKTRRSVITIQKYTRGHQARRYVDFLRQTRAAVTIQCNVRMWLERKRYLQKRSAAIAIQSMLRAHMA---KQQYYKLLFEQKAVIIQKWVRGWLAKQHYRRTLAAVVLLQSCVRRIKAKKELRKLKVEARSVEHFKNLNVGMENKIVQLQQKLNEQQKENKEFSERLSVLEKTLTLERERQSREIESLRRSEEETRAKAETVPSLLEQLSFLQQKLETTCREKDELEEQTRI----YKEQT---QQVVDDLNLKNTLLQSNI----DDLNKEIIQQAQQLTETKANFEDTKQLEKDLTEERSRYQSLLSEHLHLEERHKDLKEEMILSNNSSKRGHKRTDSNYSSNSSEFTQSLDSFEGEDSVIQAENEN----------------------------KTTVDLPILLRLQRRVKELEQEKQSLWQQLDKNEEAQQQKEKDIE-KQSTVGRTELDLETL------KRIELESENKKLKQDLTDLRKSLSSENSDAAPPAPGSLPYKTLLEQLTSSIEELEMRKDEVLLLRSHMVRQEALKHRDSILGENAKLELGEIASFQDVNKSTDVHALN-EDGELWLAYEGLKETNRLLECQMQEEQRVHDERYQKLLEEVNKLKAEKEQQQKLLA-------------QSLILPEDARIEASLKHEITRLTNENLERMEQQEKQEKTIRKLTKQLKMYMKKVEDFEAS-VQQASVTTDPVRVV----------NITRKEKEYQ-GMLEYKESDLSRLLKYLIIDLKPRGVAVTFTP-GLPAYIVFMCLRYTDNISDDRRVSTLLNSTISSIKGVVKRKGEDFEVISFWLANTCRLMHCLKQYSGDEAFMVHNTAKQNEQCLTNFELSEYHQLFGDLAIQIYHQLIKCL-DNIL-QPLIVASMLEHEPIQGVLGSKPTGLRKRSTSTSDGAVTIEVLLQRLSVFLTTMSQHGMDVHVVKQIIKQEFYVIGAVTLNHLLLRKDMCSWSKGLHIRYNVWQLEEWLAENELTDSGAKESLEPLIQAAQLLQIKKKTEADALAICNMCTALTTAQIIKVLTLYTPVIDFEERVSTTFISTIKNLLK----DRNDSATLMMDAKKIFSVIFPFTPSSVALETLQIPASLNLAFLT 1824          
BLAST of Dach-2 vs. Ensembl Medaka
Match: myo5ab (unconventional myosin-Va [Source:NCBI gene;Acc:101173462])

HSP 1 Score: 987.638 bits (2552), Expect = 0.000e+0
Identity = 671/1882 (35.65%), Postives = 1017/1882 (54.04%), Query Frame = 2
Query:   53 LYEMYSKGVKIWIPDEESVWIGATVLQFHKEKNVIKIIT-DNGISKELNLSSKKCA-PFLRNPDILIGQKDLTYLSYLNEPEVLYNLQIRFCERREIYTYCGIVLVAINPYQELSIYGKEIINAYHSQNSVDLDPHIFAVAENAFRRMSSFGENQSIIVSGESGAGKTVSAKYTMRYFALVGGSKTKQSFNLTETQIERKVLLSNPILEAFGNAKTIRNDNSSRFGKYLEILFNPRNQVIGANMCTYLLEKSRVVFQNLGERNYHIFYQIVTHCQSEDELLMNTGLVNNVEMYDYLRYGESLEIDGVDDSHEFLITKNSFLQLGIDLNKFKTICEILAAILHLGNIRFRFHDATDSSIIENPELLKLIAGLLGCSIDQLKIWLCFRTISTFQETLHKPLSKAEAQYFRDAFVKTLYSNLFDWIVKQANKVLSTDVSINIKKKLKKTIVVNQEDKKKFIAVLDIYGFETFAENSFEQFCINFANEKLQLQFNLHVFKLEQEEYMNEGLEWTFIDYYNNQPCIDLIESRXXXXXXXXXXXXXXXXSDENWCCKIYSHHLNKSANFNKPKLSNMVFIIEHFAGPVEYKCAGFIEKNRDSVLEEQINLLKASDVQLIAELFRDSEIEIFDTNNXXXXXXXXXXXXXXXXXXQENTRKMKKTVGSQFRNSLKSLMDALNKTNPHYVRCIKPNDLKLPFTFCPERAVQQLRACGVLETIRLSAAGFPSRWTYSDFYHRYYILMSNFNVKNHDFKAGSQKIVETLITVPDAFRFGNTKLFFRPGQVALLEKLRGHKIESSVTLIQSILRGSIERKKYLIIHKLTVQIQTYIRRKLAIEKATKLSQIRAVIIIQSFYRMYLARKLFVKMKCAVLAIEKWRRKIITTRLKQAYKK---ENCVIICQAIVRRFIQRRKFLKIQRGVILIQNHYRRRKAKETLKILKIEARSINHIKFVNKGLENKIIELTQKLDTKEKE---------MCXXXXXXXXXXXXXXXXXXXXXAESAKIYQNTVQDLQTEIIQLKKELNREIVEKNKIFADKELLEINYKKKINYLENLIEELKSSPSVIEPNIICNGDEAQQSICQDEHQ----------------KFINEQMDHQKLVREYEKLEMKYENLYKEFLFVKSSNQKPSINYD-NQTSNDSE-TES--TFSKDDADVESLSDKVDAKTTKEHXXXXXXXXXXLPNFISESISTAGDLAVVMQLQMNISSLSQENNRLKETVQQFEDELLKYEQCAEDSKGLVIHNEYDNELLSIIKDIKGMDEHGLKSRLIDEVANLKKKLKQSNEDYQK-------------------------------LRLHIFD----------------------GSMSKLTGNLDHESINSEEEELKRAFESQKEANRKMLKEI-EGIKANNVDLKKALFQIRK---DKEQLQVQLGKQHLMIRHGVEYLQNLKLTPKERLDKFVQNEISRILLENLKLQERNDQIISETIELKRGLKYFAFRLQKYEGSLVPNPNKEEDLLQLIQNVIYHSKMKTIGKRECYSEIGLIDLNMSELSIFIKSFIFDLSP-SICLQYEPYHLVPYIIFMVTRKFDFYKEEDQMTNFLSKLIVALKRTIRKRRNYIEYLVMLLSNVFCLVNLXXXXXXXXXXXXLNTAEDIQHYFVHYDLNEFIRLLKELCVTLFQMILKTIVDNLLPQSLCIDAILVHEAIIDFL-SKDGTKYKSNIETQPKNTSFNVLTKNLQSVLEILKNHKIPQLIINQIFVHIAYLINAYCLNTLLFRTDLCYFSKGLQIKYNLSSFETWIRYQKLIDSGALQCLRPMTEAVQLLQTLIDSDEDAKFVCDMCEYLNTRQVVKILNNFNPRDGYGCRLSSGLIAKIE 5419
            L   + +  ++W+PD  +VW  A + + +   ++   +  ++G + E  ++ +  + P LRNPDIL+G+ DLT LSYL+EP VL+NL++RF + + IYTYCGIVLVAINPY+ L IY  +IINAY  QN  D+DPHIFAVAE A+++M+    NQSII+SGESGAGKTVSAKY MRYFA V  S         E  +E +VL S+PI+EAFGNAKT RNDNSSRFGKY+EI F+ +  +IGANM TYLLEKSRVVFQ  GERNYHIFYQ+   C S       T  +   + +   + G+S  IDGV+D+ E   T+ +F  LG++      I +IL+A+LHL N+  +      SSI  +   + +   L+G   ++   WLC R + T +E+  KP+ +  A   RDA  K +Y+ LF WIV   N  L +    N                  FI VLDIYGFETF  NSFEQFCIN+ANEKLQ QFNLHVFKL+QEEYM EG+ WT ID+Y+NQPCI+LIE++LG+LDLLDEECK+ KGSD+ W  K+Y+  L ++++F KP+LSN  FII HFA  VEY+C GF+EKN+D+V EEQIN LK +    + +LF + +      N   P  +             ++ R  KKTVG QFR SL  LM+ LN T PHYVRCIKPNDLK PF   P RAVQQLRACGVLETIR+SAAGFPSRW+Y +F+ RY +LM   +V   D K   + ++E LI   + ++FG  K+FFR GQVA LEKLR  K+  +   IQ  +R  + R+KYL   +  + IQ Y R   A      L Q RA + IQ   RM+L RK +++ + A +AI+   R  +    KQ Y K   E   +I Q  VR ++ ++ + +    V+L+Q+  RR KAK+ L+ LK+EARS+ H K +N G+ENKI++L QKL+ ++KE         +      L +E++   +       E  +    TV  L  ++  L+++L     EK+++     +    YK++    + ++++L    ++++ NI    D+  + I Q   Q                    E+  +Q L+ E+  LE ++++L +E +   +S+++     D N +SN SE T+S  +F  +D+ +++ ++                              T  DL ++++LQ  +  L QE   L + + + E+   + E+  E  +  V   E D E L      K ++      +L  ++ +L+K L   N D                                  LR H+                         S   +  + D  ++N E+ EL  A+E  KE NR +  ++ E  + ++   +K L ++ K   +KEQ Q  L              Q+L L    R++  +++EI+R+  ENL+  E+ ++      +L + LK +  +++ +E S V   +   D ++++           I ++E   + G+++   S+LS  +K  I DL P  + + + P  L  YI+FM  R  D   ++ +++  L+  I ++K  ++++    E +   L+N   L++  +QYSG + F   NTA+  +    +++L+E+ +L  +L + ++  ++K + DN+L Q L + ++L HE I   L SK     K +  T     +  VL + L   L  +  H +   ++ QI     Y+I A  LN LL R D+C +SKGL I+YN+   E W+   +L DSGA + L P+ +A QLLQ    ++ DA  +C+MC  L T Q++K+L  + P   +  R+S+  I+ I+
Sbjct:   13 LLSCFIQHARVWLPDAATVWQSAELTKDYTPGDLTLCLQLEDGTNVEHKINPQTTSLPPLRNPDILVGENDLTALSYLHEPAVLHNLKVRFIDSKLIYTYCGIVLVAINPYESLPIYEPDIINAYSGQNMGDMDPHIFAVAEEAYKQMARDQRNQSIIISGESGAGKTVSAKYAMRYFATVSCSS-------GEANVEERVLASSPIMEAFGNAKTTRNDNSSRFGKYIEIGFDKKYCIIGANMRTYLLEKSRVVFQAHGERNYHIFYQL---CASSHLPEFKTFKLGCADDFHCTKQGQSPIIDGVNDAKELCSTRRAFSLLGMEEEDQMEIYQILSALLHLSNVEIKDQSGDRSSISPDDVHMMVFCELMGVPCEETAHWLCHRKLKTSKESFVKPVPRVNAVQGRDALAKHIYARLFSWIVGCVNGALKSTGKQN-----------------SFIGVLDIYGFETFDVNSFEQFCINYANEKLQQQFNLHVFKLDQEEYMREGIPWTLIDFYDNQPCINLIEAKLGVLDLLDEECKMPKGSDDTWTQKLYNILLKQNSHFEKPRLSNRAFIIHHFADKVEYQCLGFLEKNKDTVNEEQINALKKTKFDFLLKLFDEDDKGTGSPNKLTPGRAG------------QSQRDNKKTVGLQFRQSLHLLMETLNSTTPHYVRCIKPNDLKAPFVLDPVRAVQQLRACGVLETIRISAAGFPSRWSYPEFFTRYRVLMKQKDVLP-DRKQTCKDLLEKLIKNQEKYQFGKNKIFFRAGQVAYLEKLRSDKLRLACVSIQKTIRCWLARRKYLKTRRSVITIQKYTRGHQARRYVDFLRQTRAAVTIQCNVRMWLERKRYLQKRSAAIAIQSMLRAHMA---KQQYYKLLFEQKAVIIQKWVRGWLAKQHYRRTLAAVVLLQSCVRRIKAKKELRKLKVEARSVEHFKNLNVGMENKIVQLQQKLNEQQKENKEFSERLSVLEKTLTLERERQSREIESLRRSEEETRAKAETVPSLLEQLSFLQQKLETTCREKDELEEQTRI----YKEQT---QQVVDDLNLKNTLLQSNI----DDLNKEIIQQAQQLTETKANFEDTKQLEKDLTEERSRYQSLLSEHLHLEERHKDLKEEMILSNNSSKRGHKRTDSNYSSNSSEFTQSLDSFEGEDSVIQAENEN----------------------------KTTVDLPILLRLQRRVKELEQEKQSLWQQLDKNEEAQQQKEKDIE-KQSTVGRTELDLETL------KRIELESENKKLKQDLTDLRKSLSSENSDAAPPAPGSLPYKTLLEQLTSSIEELEMRKDEVLLLRSHMVRQEALKHRDSILGENAKLELGEIASFQDVNKSTDVHALN-EDGELWLAYEGLKETNRLLECQMQEEQRVHDERYQKLLEEVNKLKAEKEQQQKLLA-------------QSLILPEDARIEASLKHEITRLTNENLERMEQQEKQEKTIRKLTKQLKMYMKKVEDFEAS-VQQASVTTDPVRVV----------NITRKEKEYQ-GMLEYKESDLSRLLKYLIIDLKPRGVAVTFTP-GLPAYIVFMCLRYTDNISDDRRVSTLLNSTISSIKGVVKRKGEDFEVISFWLANTCRLMHCLKQYSGDEAFMVHNTAKQNEQCLTNFELSEYHQLFGDLAIQIYHQLIKCL-DNIL-QPLIVASMLEHEPIQGVLGSKPTGLRKRSTSTSDGAVTIEVLLQRLSVFLTTMSQHGMDVHVVKQIIKQEFYVIGAVTLNHLLLRKDMCSWSKGLHIRYNVWQLEEWLAENELTDSGAKESLEPLIQAAQLLQIKKKTEADALAICNMCTALTTAQIIKVLTLYTPVIDFEERVSTTFISTIK 1776          
BLAST of Dach-2 vs. Ensembl Medaka
Match: myo5c (myosin VC [Source:NCBI gene;Acc:101162444])

HSP 1 Score: 651.744 bits (1680), Expect = 0.000e+0
Identity = 370/806 (45.91%), Postives = 498/806 (61.79%), Query Frame = 2
Query:  440 DLDPHIFAVAENAFRRMSSFGENQSIIVSGESGAGKTVSAKYTMRYFALVGGSKTKQSFNLTETQIERKVLLSNPILEAFGNAKTIRNDNSSRFGKYLEILFNPRNQVIGANMCTYLLEKSRVVFQNLGERNYHIFYQIVTHCQSEDELLMNTGLVNNVEMYDYLRYGESLEIDGVDDSHEFLITKNSFLQLGIDLNKFKTICEILAAILHLGNIRFRFHDATDSSIIENPELLKLIAGLLGCSIDQLKIWLCFRTISTFQETLHKPLSKAEAQYFRDAFVKTLYSNLFDWIVKQANKVLSTDVSINIKKKLKKTIVVNQEDKKKFIAVLDIYGFETFAENSFEQFCINFANEKLQLQFNLHVFKLEQEEYMNEGLEWTFIDYYNNQPCIDLIESRXXXXXXXXXXXXXXXXSDENWCCKIYSHHLNKSANFNKPKLSNMVFIIEHFAGPVEYKCAGFIEKNRDSVLEEQINLLKASDVQLIAELFRDSEIEIFDTNNXXXXXXXXXXXXXXXXXXQENTRKMKKTVGSQFRNSLKSLMDALNKTNPHYVRCIKPNDLKLPFTFCPERAVQQLRACGVLETIRLSAAGFPSRWTYSDFYHRYYILMSNFNVKNHDFKAGSQKIVETLITVPDAFRFGNTKLFFRPGQVALLEKLRGHKIESSVTLIQSILRGSIERKKYLIIHKLTVQIQTYIRRKLAIEK---ATKLSQIRAVIIIQSFYRMYLARKLFVKMKCAVLAIEKWRRKIITTRLKQAYKKENCVIICQAIVRRFIQRRKFLKIQRGVILIQNHYR----RRKAKETLK 2836
            D+DPHIFAVAE A+++M+   +NQSIIVSGESGAGKTVSA+Y MRYFA+V  S  K        ++E KVL SNPI EA GNAKT RNDNSSRFGKY EI F+ + ++IGANM TYLLEKSRVVFQ   ERNYHIFYQ+   C   D     +  + + + + Y   G  + I+GVDD  +   T+ +F  LG+  +    + ++LAAILHLGN+  R      SSI      L +   LL  S + L  WLC R I    ET+ KP+ K  A   RDA  K  Y++LFD IV + N  L      +                  FI VLDIYGFETF  NSFEQFCIN+ANEKLQ QFNLHVFKLEQEEYM E + WT ID+Y+NQP IDLIE++LG++DLLDEEC   +G+D++W  K+Y ++L+ +  F KP+LSN  F+I+HFA  VEY+C GF+EKNRD++ EE ++ ++AS +  +A  F++ E+    T N   KV             +   ++++ +VG +FR+SL  LM+ LN T PHYVRCIKPND KLPF +   R VQQLRACGVLETIR+SA  +PSRWTY +FY RY ILMS+      D K   + +++ LI   + ++FG TK+FFR GQVA LEKLR  ++  +  +IQ   R   +R+KYL I    + +Q YIR +  I K   A  L Q  A ++IQ  +R Y  R+++  +  A + I+ + R  +  +  +   + +  +I Q   R ++ RR+F  ++R V+ +Q  YR    R+K +E  K
Sbjct:    3 DMDPHIFAVAEEAYKQMARNHKNQSIIVSGESGAGKTVSARYAMRYFAVVSKSSNK-------NRVEDKVLASNPITEAIGNAKTTRNDNSSRFGKYTEISFDKKYRIIGANMSTYLLEKSRVVFQADDERNYHIFYQM---CSCADLPEFKSLRLLSADKFLYTCMGGDIAIEGVDDKSDMNETRRTFSLLGLKEDFQADVFKVLAAILHLGNVEIRDQGNDKSSIAPTDPHLAVFCELLEVSAEGLLRWLCNRRIVLSAETVVKPVPKERAVAARDALAKQTYAHLFDCIVNRINTALQVPGKPHA-----------------FIGVLDIYGFETFDINSFEQFCINYANEKLQQQFNLHVFKLEQEEYMKEDIPWTLIDFYDNQPVIDLIEAKLGIMDLLDEECLFPQGTDQSWLQKLY-NYLDANPLFEKPRLSNKAFVIQHFADKVEYQCKGFLEKNRDTLYEELVDTMRASKLSFLANFFQEEELT--PTANKSFKVKPARPPV------KATNKQLRTSVGDKFRSSLFLLMETLNATTPHYVRCIKPNDEKLPFEYDSRRVVQQLRACGVLETIRISAQSYPSRWTYIEFYSRYSILMSHLEADVRDKKETCKCVLQRLIHDTNQYKFGRTKIFFRAGQVAYLEKLRLDRLREACVIIQKHFRAWSQRRKYLRIRDAAIVLQQYIRGQKTIRKTVTAEALKQGWAAVVIQRHWRGYCMRQIYQAVCQATITIQAFTRGWMARKQYKKMMEAHKAMILQKYTRAWLARRRFQTMRRLVLNVQLSYRVQQLRKKIEEQTK 772          

HSP 2 Score: 156.377 bits (394), Expect = 1.462e-37
Identity = 107/389 (27.51%), Postives = 201/389 (51.67%), Query Frame = 2
Query: 4424 IGLIDLNMSELSIFIKSFIFDLSP-SICLQYEPYHLVPYIIFMVTRKFDFYKEEDQMTNFLSKLIVALKRTIRKRRNYIEYLVMLLSNVFCLVNLXXXXXXXXXXXXLNTAEDIQHYFVHYDLNEFIRLLKELCVTLFQMILKTIVDNLLPQSLCIDAILVHEAIIDFLSKDGTKYK----SNIETQPKNTSFNVLTKNLQSVLEILKNHKIPQLIINQIFVHIAYLINAYCLNTLLFRTDLCYFSKGLQIKYNLSSFETWIRYQKLIDSGALQCLRPMTEAVQLLQTLIDSDEDAKFVCDMCEYLNTRQVVKILNNFNPRDGYGCRLSSGLIAKIETQMKIKRGDEPSESKLETPTVIEIPIDIPFIHNGVSLCRTIIPKPLYLSCLT 5575
            +G+++    + S  +++ I DL P  + +   P  L  YI+FM  R  D+  ++ ++ + +S +I A+K+ I  R      L   LSN   L+NL +QYSG ++F   ++    ++   ++DL+E  ++  +L + ++   +  +   L P    +  +L HE++    S   T ++    S  + + KN + + + K L      + +H + Q +INQ+   + +L+ A  LN ++ R D+C   KG+QI+ N+S  E W++ + L  S A++ L P+ +A  LLQ    +D+DAK + + C  LN  Q+VKILN++ P D +  R++S  + K+++ + I  G     ++L   T     +  PF  +  +L    +P  L+L  LT
Sbjct: 1227 LGMLEFKREDESRLVQNVILDLQPKGVVVNMIPC-LPAYILFMCVRHADYLNDDAKLKSLMSAIICAVKKVILSRCKDFVLLSFWLSNTHQLINLLKQYSGEEEFLKQSSPRQRKNCLQNFDLSEHRQIFSDLAIHIYHQFISVLQKILTP--AIVPGMLEHESLQGISSMKPTGFRKRSSSLYDEESKNFTISSIIKQLSVFHSTMIHHGMDQNLINQVTKQLFFLVAATTLNQIMLRKDMCSCRKGMQIRCNISYLEEWLKEKDLQSSNAMETLTPLAQAAWLLQVNKSTDDDAKEITEKCTELNPVQIVKILNSYTPIDDFEKRVTSSFVRKVQSLL-IHEGS----TQLMLDTDFHFQVTFPFQSSSQALELLQVPASLHLDFLT 1607          
BLAST of Dach-2 vs. Ensembl Medaka
Match: myo5c (myosin VC [Source:NCBI gene;Acc:101162444])

HSP 1 Score: 624.009 bits (1608), Expect = 0.000e+0
Identity = 358/784 (45.66%), Postives = 480/784 (61.22%), Query Frame = 2
Query:  506 NQSIIVSGESGAGKTVSAKYTMRYFALVGGSKTKQSFNLTETQIERKVLLSNPILEAFGNAKTIRNDNSSRFGKYLEILFNPRNQVIGANMCTYLLEKSRVVFQNLGERNYHIFYQIVTHCQSEDELLMNTGLVNNVEMYDYLRYGESLEIDGVDDSHEFLITKNSFLQLGIDLNKFKTICEILAAILHLGNIRFRFHDATDSSIIENPELLKLIAGLLGCSIDQLKIWLCFRTISTFQETLHKPLSKAEAQYFRDAFVKTLYSNLFDWIVKQANKVLSTDVSINIKKKLKKTIVVNQEDKKKFIAVLDIYGFETFAENSFEQFCINFANEKLQLQFNLHVFKLEQEEYMNEGLEWTFIDYYNNQPCIDLIESRXXXXXXXXXXXXXXXXSDENWCCKIYSHHLNKSANFNKPKLSNMVFIIEHFAGPVEYKCAGFIEKNRDSVLEEQINLLKASDVQLIAELFRDSEIEIFDTNNXXXXXXXXXXXXXXXXXXQENTRKMKKTVGSQFRNSLKSLMDALNKTNPHYVRCIKPNDLKLPFTFCPERAVQQLRACGVLETIRLSAAGFPSRWTYSDFYHRYYILMSNFNVKNHDFKAGSQKIVETLITVPDAFRFGNTKLFFRPGQVALLEKLRGHKIESSVTLIQSILRGSIERKKYLIIHKLTVQIQTYIRRKLAIEK---ATKLSQIRAVIIIQSFYRMYLARKLFVKMKCAVLAIEKWRRKIITTRLKQAYKKENCVIICQAIVRRFIQRRKFLKIQRGVILIQNHYR----RRKAKETLK 2836
            NQSIIVSGESGAGKTVSA+Y MRYFA+V  S  K        ++E KVL SNPI EA GNAKT RNDNSSRFGKY EI F+ + ++IGANM TYLLEKSRVVFQ   ERNYHIFYQ+   C   D     +  + + + + Y   G  + I+GVDD  +   T+ +F  LG+  +    + ++LAAILHLGN+  R      SSI      L +   LL  S + L  WLC R I    ET+ KP+ K  A   RDA  K  Y++LFD IV + N  L      +                  FI VLDIYGFETF  NSFEQFCIN+ANEKLQ QFNLHVFKLEQEEYM E + WT ID+Y+NQP IDLIE++LG++DLLDEEC   +G+D++W  K+Y ++L+ +  F KP+LSN  F+I+HFA  VEY+C GF+EKNRD++ EE ++ ++AS +  +A  F++ E+    T N   KV             +   ++++ +VG +FR+SL  LM+ LN T PHYVRCIKPND KLPF +   R VQQLRACGVLETIR+SA  +PSRWTY +FY RY ILMS+      D K   + +++ LI   + ++FG TK+FFR GQVA LEKLR  ++  +  +IQ   R   +R+KYL I    + +Q YIR +  I K   A  L Q  A ++IQ  +R Y  R+++  +  A + I+ + R  +  +  +   + +  +I Q   R ++ RR+F  ++R V+ +Q  YR    R+K +E  K
Sbjct:    9 NQSIIVSGESGAGKTVSARYAMRYFAVVSKSSNK-------NRVEDKVLASNPITEAIGNAKTTRNDNSSRFGKYTEISFDKKYRIIGANMSTYLLEKSRVVFQADDERNYHIFYQM---CSCADLPEFKSLRLLSADKFLYTCMGGDIAIEGVDDKSDMNETRRTFSLLGLKEDFQADVFKVLAAILHLGNVEIRDQGNDKSSIAPTDPHLAVFCELLEVSAEGLLRWLCNRRIVLSAETVVKPVPKERAVAARDALAKQTYAHLFDCIVNRINTALQVPGKPHA-----------------FIGVLDIYGFETFDINSFEQFCINYANEKLQQQFNLHVFKLEQEEYMKEDIPWTLIDFYDNQPVIDLIEAKLGIMDLLDEECLFPQGTDQSWLQKLY-NYLDANPLFEKPRLSNKAFVIQHFADKVEYQCKGFLEKNRDTLYEELVDTMRASKLSFLANFFQEEELT--PTANKSFKVKPARPPV------KATNKQLRTSVGDKFRSSLFLLMETLNATTPHYVRCIKPNDEKLPFEYDSRRVVQQLRACGVLETIRISAQSYPSRWTYIEFYSRYSILMSHLEADVRDKKETCKCVLQRLIHDTNQYKFGRTKIFFRAGQVAYLEKLRLDRLREACVIIQKHFRAWSQRRKYLRIRDAAIVLQQYIRGQKTIRKTVTAEALKQGWAAVVIQRHWRGYCMRQIYQAVCQATITIQAFTRGWMARKQYKKMMEAHKAMILQKYTRAWLARRRFQTMRRLVLNVQLSYRVQQLRKKIEEQTK 756          

HSP 2 Score: 156.762 bits (395), Expect = 1.267e-37
Identity = 107/389 (27.51%), Postives = 201/389 (51.67%), Query Frame = 2
Query: 4424 IGLIDLNMSELSIFIKSFIFDLSP-SICLQYEPYHLVPYIIFMVTRKFDFYKEEDQMTNFLSKLIVALKRTIRKRRNYIEYLVMLLSNVFCLVNLXXXXXXXXXXXXLNTAEDIQHYFVHYDLNEFIRLLKELCVTLFQMILKTIVDNLLPQSLCIDAILVHEAIIDFLSKDGTKYK----SNIETQPKNTSFNVLTKNLQSVLEILKNHKIPQLIINQIFVHIAYLINAYCLNTLLFRTDLCYFSKGLQIKYNLSSFETWIRYQKLIDSGALQCLRPMTEAVQLLQTLIDSDEDAKFVCDMCEYLNTRQVVKILNNFNPRDGYGCRLSSGLIAKIETQMKIKRGDEPSESKLETPTVIEIPIDIPFIHNGVSLCRTIIPKPLYLSCLT 5575
            +G+++    + S  +++ I DL P  + +   P  L  YI+FM  R  D+  ++ ++ + +S +I A+K+ I  R      L   LSN   L+NL +QYSG ++F   ++    ++   ++DL+E  ++  +L + ++   +  +   L P    +  +L HE++    S   T ++    S  + + KN + + + K L      + +H + Q +INQ+   + +L+ A  LN ++ R D+C   KG+QI+ N+S  E W++ + L  S A++ L P+ +A  LLQ    +D+DAK + + C  LN  Q+VKILN++ P D +  R++S  + K+++ + I  G     ++L   T     +  PF  +  +L    +P  L+L  LT
Sbjct: 1211 LGMLEFKREDESRLVQNVILDLQPKGVVVNMIPC-LPAYILFMCVRHADYLNDDAKLKSLMSAIICAVKKVILSRCKDFVLLSFWLSNTHQLINLLKQYSGEEEFLKQSSPRQRKNCLQNFDLSEHRQIFSDLAIHIYHQFISVLQKILTP--AIVPGMLEHESLQGISSMKPTGFRKRSSSLYDEESKNFTISSIIKQLSVFHSTMIHHGMDQNLINQVTKQLFFLVAATTLNQIMLRKDMCSCRKGMQIRCNISYLEEWLKEKDLQSSNAMETLTPLAQAAWLLQVNKSTDDDAKEITEKCTELNPVQIVKILNSYTPIDDFEKRVTSSFVRKVQSLL-IHEGS----TQLMLDTDFHFQVTFPFQSSSQALELLQVPASLHLDFLT 1591          
BLAST of Dach-2 vs. Ensembl Medaka
Match: myo5b (myosin VB [Source:ZFIN;Acc:ZDB-GENE-031219-7])

HSP 1 Score: 590.882 bits (1522), Expect = 0.000e+0
Identity = 326/602 (54.15%), Postives = 413/602 (68.60%), Query Frame = 2
Query:   77 VKIWIPDEESVWIGATVLQFHKEKN-VIKIITDNGISKELNLSSKKCA-PFLRNPDILIGQKDLTYLSYLNEPEVLYNLQIRFCERREIYTYCGIVLVAINPYQELSIYGKEIINAYHSQNSVDLDPHIFAVAENAFRRMSSFGENQSIIVSGESGAGKTVSAKYTMRYFALVGGSKTKQSFNLTETQIERKVLLSNPILEAFGNAKTIRNDNSSRFGKYLEILFNPRNQVIGANMCTYLLEKSRVVFQNLGERNYHIFYQIVTHCQSEDELLMNTGLVNNVEMYDYLRYGESLEIDGVDDSHEFLITKNSFLQLGIDLNKFKTICEILAAILHLGNIRFRFHDATDSSIIENPELLKLIAGLLGCSIDQLKIWLCFRTISTFQETLHKPLSKAEAQYFRDAFVKTLYSNLFDWIVKQANKVLSTDVSINIKKKLKKTIVVNQEDKKKFIAVLDIYGFETFAENSFEQFCINFANEKLQLQFNLHVFKLEQEEYMNEGLEWTFIDYYNNQPCIDLIESRXXXXXXXXXXXXXXXXSDENWCCKIYSHHLNKSANFNKPKLSNMVFIIEHFAGPVEYKCAGFIEKNRDSVLEEQINLLKASDV 1876
             ++WIPD E VW GA +++ +KE + V+ +  ++  + E  +   +   PFLRNPDIL+G+ DLT LSYL+EP VL+NL++RF E   IYTYCGIVLVAINPY+ L IYG+E+INAY  QN  D+DPHIFAVAE A+++M+    NQSIIVSGESGAGKTVSAKY MR+FA VGGS        T+T +E KVL S+PI+EA GNAKT RNDNSSRFGKY++I F+    +IGANM TYLLEKSRVVFQ   ERNYHIFYQ+       +    + GL  + E + Y   GE++ I+GV+D+ +F  T+ +F  LGI  +   +I  I+A+ILHLGNI+       +S  I +         LLG  + Q++ WLC R + T  ET  K +   +A   RDA  K +Y+ LFDWIV+  NK L T                    +  FI VLDIYGFETF  NSFEQFCIN+ANEKLQ QFN HVFKLEQEEYM E + WT ID+++NQPCIDLIE+RLG+LDLLDEECK+ KG+D+NW  K+Y  H N SA+F KP++SN+ FI+ HFA  VEY+C GF+EKNRD+V EEQIN+LKAS V
Sbjct:    8 TRVWIPDPEEVWKGAEIIKDYKEGDPVLHLKLEDETTLEYQVGPNQNPLPFLRNPDILVGENDLTALSYLHEPAVLHNLRVRFLESNHIYTYCGIVLVAINPYEPLQIYGEEVINAYSGQNMGDMDPHIFAVAEEAYKQMARDERNQSIIVSGESGAGKTVSAKYAMRFFATVGGSS-------TDTSVEEKVLASSPIMEAIGNAKTTRNDNSSRFGKYIQIGFSRHYHIIGANMRTYLLEKSRVVFQAEEERNYHIFYQLCASASLPE--FQDLGLT-SAEDFTYTSLGENIFIEGVNDAEDFCKTREAFTLLGIKDSSQSSIFRIVASILHLGNIQICSERDGESCHILS------FCKLLGVELQQMEHWLCHRKLVTASETYVKSMGAKQAVNARDALAKHIYARLFDWIVEHINKALHTS-----------------SKQHSFIGVLDIYGFETFEVNSFEQFCINYANEKLQQQFNSHVFKLEQEEYMKELIPWTLIDFHDNQPCIDLIEARLGILDLLDEECKVPKGTDQNWAQKLYKQHSN-SAHFQKPRMSNISFIVIHFADKVEYQCDGFLEKNRDTVYEEQINILKASQV 575          
BLAST of Dach-2 vs. Planmine SMEST
Match: SMESG000033540.1 (SMESG000033540.1)

HSP 1 Score: 3484.12 bits (9033), Expect = 0.000e+0
Identity = 1806/1851 (97.57%), Postives = 1817/1851 (98.16%), Query Frame = 2
Query:   47 MALYEMYSKGVKIWIPDEESVWIGATVLQFHKEKNVIKIITDNGISKELNLSSKKCAPFLRNPDILIGQKDLTYLSYLNEPEVLYNLQIRFCERREIYTYCGIVLVAINPYQELSIYGKEIINAYHSQNSVDLDPHIFAVAENAFRRMSSFGENQSIIVSGESGAGKTVSAKYTMRYFALVGGSKTKQSFNLTETQIERKVLLSNPILEAFGNAKTIRNDNSSRFGKYLEILFNPRNQVIGANMCTYLLEKSRVVFQNLGERNYHIFYQIVTHCQSEDELLMNTGLVNNVEMYDYLRYGESLEIDGVDDSHEFLITKNSFLQLGIDLNKFKTICEILAAILHLGNIRFRFHDATDSSIIENPELLKLIAGLLGCSIDQLKIWLCFRTISTFQETLHKPLSKAEAQYFRDAFVKTLYSNLFDWIVKQANKVLSTDVSINIKKKLKKTIVVNQEDKKKFIAVLDIYGFETFAENSFEQFCINFANEKLQLQFNLHVFKLEQEEYMNEGLEWTFIDYYNNQPCIDLIESRXXXXXXXXXXXXXXXXSDENWCCKIYSHHLNKSANFNKPKLSNMVFIIEHFAGPVEYKCAGFIEKNRDSVLEEQINLLKASDVQLIAELFRDSEIEIFDTNNXXXXXXXXXXXXXXXXXXQENTRKMKKTVGSQFRNSLKSLMDALNKTNPHYVRCIKPNDLKLPFTFCPERAVQQLRACGVLETIRLSAAGFPSRWTYSDFYHRYYILMSNFNVKNHDFKAGSQKIVETLITVPDAFRFGNTKLFFRPGQVALLEKLRGHKIESSVTLIQSILRGSIERKKYLIIHKLTVQIQTYIRRKLAIEKATKLSQIRAVIIIQSFYRMYLARKLFVKMKCAVLAIEKWRRKIITTRLKQAYKKENCVIICQAIVRRFIQRRKFLKIQRGVILIQNHYRRRKAKETLKILKIEARSINHIKFVNKGLENKIIELTQKLDTKEKEMCXXXXXXXXXXXXXXXXXXXXXAESAKIYQNTVQDLQTEIIQLKKELNREIVEKNKIFADKELLEINYKKKINYLENLIEELKSSPSVIEPNIICNGDEAQQSICQDEHQKFINEQMDHQKLVREYEKLEMKYENLYKEFLFVKSSNQKPSINYDNQTSNDSETESTFSKDDADVESLSDKVDAKTTKEHXXXXXXXXXXLPNFISESISTAGDLAVVMQLQMNISSLSQENNRLKETVQQFEDELLKYEQCAEDSKGLVIHNEYDNELLSIIKDIKGMDEHGLKSRLIDEVANLKKKLKQSNEDYQKLRLHIFDGSMSKLTGNLDHESINSEEEELKRAFESQKEANRKMLKEIEGIKANNVDLKKALFQIRKDKEQLQVQLGKQHLMIRHGVEYLQNLKLTPKERLDKFVQNEISRILLENLKLQERNDQIISETIELKRGLKYFAFRLQKYEGSLVPNPNKEEDLLQLIQNVIYHSKMKTIGKRECYSEIGLIDLNMSELSIFIKSFIFDLSPSICLQYEPYHLVPYIIFMVTRKFDFYKEEDQMTNFLSKLIVALKRTIRKRRNYIEYLVMLLSNVFCLVNLXXXXXXXXXXXXLNTAEDIQHYFVHYDLNEFIRLLKELCVTLFQMILKTIVDNLLPQSLCIDAILVHEAIIDFLSKDGTKYKSNIETQPKNTSFNVLTKNLQSVLEILKNHKIPQLIINQIFVHIAYLINAYCLNTLLFRTDLCYFSKGLQIKYNLSSFETWIRYQKLIDSGALQCLRPMTEAVQLLQTLIDSDEDAKFVCDMCEYLNTRQVVKILNNFNPRDGYGCRLSSGLIAKIETQMKIKRGDEPSESKLETPTVIEIPIDIPFIHNGVSLCRTIIPKPLYLSCLTVLSEKDLL 5599
            MALYEMYSKGVKIWIPDEESVWIGATVLQFHKEKNVIKIITDNGISKELNLSSK  APFLRNPDILIGQKDLTYLSYLNEPEVLYNLQIRFCERREIYTYCGIVLVAINPYQELSIYGKEIINAYHSQNSVDLDPHIFAVAENAFRRMSSFGENQSIIVSGESGAGKTVSAKYTMRYFALVGGSKTKQSFNLTETQIERKVLLSNPILEAFGNAKT+           + I+ +  N       C  L ++ +VVFQNLGERNYHIFYQIVTHCQSEDELLMNTGLVNNVEMYDYLRYGESLEIDGVDDSHEFLITKNSFLQLGIDLNKFKTICEILAAILHLGNIRFR +DATDSSIIENPELLKLIAGLLGCSIDQLKIWLCFRTISTFQETLHKPLSKAEAQYFRDAFVKTLYSNLFDWIVKQANKVLSTDVSINIKKKLKKTIVVNQEDKKKFIAVLDIYGFETFAENSFEQFCINFANEKLQLQFNLHVFKLEQEEYMNEGLEWTFIDYYNNQPCIDLIESRLGLLDLLDEECKLLKGSDENWCCKIYSHHLNKSANFNKPKLS+MVFIIEHFAGPVEYKCAGFIEKNRDSVLEEQINLLKASDVQLIAELFRDSE EI DTNNSKPKVSIKSSTKSIMSIKQENTRKMKKTVGSQFRNSLKSLMDALNKTNPHYVRCIKPNDLKLPFTFCPERAVQQLRACGVLETIRLSAAGFPSRWTYSDFYHRYYILMSNFNVKNHDFKAGSQKIVETLITVPDAFRFGNTKLFFRPGQVALLEKLRGHKIESSVTLIQSILRGSIERK+YLIIHKLTVQIQTYIRRKLAIEKATKLSQIRAVIIIQSFYRMYLARKLFVKMKCAVLAIEKWRRKIITTRLKQAYKKENCVIICQAIVRRFIQRRKFLKIQRGVILIQNHYRRRKAKETLKILKIEARSINHIKFVNKGLENKIIELTQKLDTKEKEMCLIQNQLIKEKKIEILNLKLNQAESAKIYQNTVQDLQTEIIQLKKELNREIVEKNKIFADKELLEINYKKKINYLENLIEELKSSPSVIEPNIICNGDEAQQSICQDEHQKFINEQMDHQKLVREYEKLEMKYENLYKEFLFVKSSNQKPSINYDNQTSNDSETESTFSKDDADVESLSD+VDAKTTKEHVVKSSVVVKKLPNFISESISTAGDLAVVMQLQMNISSLSQENNRLKETVQQFEDELLKYEQ AEDSKGLVIHNEYDNELLSIIKDIKGMDEHGLKSRLIDEVANLKKKLKQSNEDYQKLRLHIFDGSMSKLTGNLDHESINSEEEELKRAFESQKEANRKMLKEIEGIKANNVDLKKALFQIRKDKEQLQVQLGKQHLMIRHGVEYLQNLKLTPKERLDKFVQNEISRILLENLKLQERNDQI SETIELKRGLKYFAFRLQKYEGSLVPNPNKEEDLLQLIQNVIYHSKMKTIGKRECYSEIGLIDLNMSELSIFIKSFIFDLSPSICLQYEPYHLVPYIIFMVTRKFDFYKEEDQMTNFLSKLIVALKRTIRKRRNYIEYLVML SNVFCLVNLFQQYSGSQQFSGLNTAEDIQHYFVHYDLNEFIRLLKELCVTLFQMILKTIVDNLLPQSLCIDAILVHEAIIDFLSKDGTKYKSNIETQPKNTSFNVLTKNLQSVLEILKNHKIPQLIINQIFVHIAYLINAYCLNTLLFRTDLCYFSKGLQIKYNLSSFETWIRYQKLIDSGALQCLRPMTEAVQLLQTLIDSDEDAKFVCDMCEYLNTRQVVKILNNFNPRDGYGCRLSSGLIAKIETQMKIKRGDEPSESKLETPTVIEIPIDIPFIHNGVSLCRTIIPKPLYLSCLTVLSEKDLL
Sbjct:    1 MALYEMYSKGVKIWIPDEESVWIGATVLQFHKEKNVIKIITDNGISKELNLSSKIYAPFLRNPDILIGQKDLTYLSYLNEPEVLYNLQIRFCERREIYTYCGIVLVAINPYQELSIYGKEIINAYHSQNSVDLDPHIFAVAENAFRRMSSFGENQSIIVSGESGAGKTVSAKYTMRYFALVGGSKTKQSFNLTETQIERKVLLSNPILEAFGNAKTLE----------MTIVADLEN---IWKFC--LTQEIKVVFQNLGERNYHIFYQIVTHCQSEDELLMNTGLVNNVEMYDYLRYGESLEIDGVDDSHEFLITKNSFLQLGIDLNKFKTICEILAAILHLGNIRFRSNDATDSSIIENPELLKLIAGLLGCSIDQLKIWLCFRTISTFQETLHKPLSKAEAQYFRDAFVKTLYSNLFDWIVKQANKVLSTDVSINIKKKLKKTIVVNQEDKKKFIAVLDIYGFETFAENSFEQFCINFANEKLQLQFNLHVFKLEQEEYMNEGLEWTFIDYYNNQPCIDLIESRLGLLDLLDEECKLLKGSDENWCCKIYSHHLNKSANFNKPKLSDMVFIIEHFAGPVEYKCAGFIEKNRDSVLEEQINLLKASDVQLIAELFRDSETEILDTNNSKPKVSIKSSTKSIMSIKQENTRKMKKTVGSQFRNSLKSLMDALNKTNPHYVRCIKPNDLKLPFTFCPERAVQQLRACGVLETIRLSAAGFPSRWTYSDFYHRYYILMSNFNVKNHDFKAGSQKIVETLITVPDAFRFGNTKLFFRPGQVALLEKLRGHKIESSVTLIQSILRGSIERKRYLIIHKLTVQIQTYIRRKLAIEKATKLSQIRAVIIIQSFYRMYLARKLFVKMKCAVLAIEKWRRKIITTRLKQAYKKENCVIICQAIVRRFIQRRKFLKIQRGVILIQNHYRRRKAKETLKILKIEARSINHIKFVNKGLENKIIELTQKLDTKEKEMCLIQNQLIKEKKIEILNLKLNQAESAKIYQNTVQDLQTEIIQLKKELNREIVEKNKIFADKELLEINYKKKINYLENLIEELKSSPSVIEPNIICNGDEAQQSICQDEHQKFINEQMDHQKLVREYEKLEMKYENLYKEFLFVKSSNQKPSINYDNQTSNDSETESTFSKDDADVESLSDEVDAKTTKEHVVKSSVVVKKLPNFISESISTAGDLAVVMQLQMNISSLSQENNRLKETVQQFEDELLKYEQGAEDSKGLVIHNEYDNELLSIIKDIKGMDEHGLKSRLIDEVANLKKKLKQSNEDYQKLRLHIFDGSMSKLTGNLDHESINSEEEELKRAFESQKEANRKMLKEIEGIKANNVDLKKALFQIRKDKEQLQVQLGKQHLMIRHGVEYLQNLKLTPKERLDKFVQNEISRILLENLKLQERNDQITSETIELKRGLKYFAFRLQKYEGSLVPNPNKEEDLLQLIQNVIYHSKMKTIGKRECYSEIGLIDLNMSELSIFIKSFIFDLSPSICLQYEPYHLVPYIIFMVTRKFDFYKEEDQMTNFLSKLIVALKRTIRKRRNYIEYLVMLFSNVFCLVNLFQQYSGSQQFSGLNTAEDIQHYFVHYDLNEFIRLLKELCVTLFQMILKTIVDNLLPQSLCIDAILVHEAIIDFLSKDGTKYKSNIETQPKNTSFNVLTKNLQSVLEILKNHKIPQLIINQIFVHIAYLINAYCLNTLLFRTDLCYFSKGLQIKYNLSSFETWIRYQKLIDSGALQCLRPMTEAVQLLQTLIDSDEDAKFVCDMCEYLNTRQVVKILNNFNPRDGYGCRLSSGLIAKIETQMKIKRGDEPSESKLETPTVIEIPIDIPFIHNGVSLCRTIIPKPLYLSCLTVLSEKDLL 1836          
BLAST of Dach-2 vs. Planmine SMEST
Match: SMESG000033540.1 (SMESG000033540.1)

HSP 1 Score: 3474.49 bits (9008), Expect = 0.000e+0
Identity = 1801/1846 (97.56%), Postives = 1812/1846 (98.16%), Query Frame = 2
Query:   62 MYSKGVKIWIPDEESVWIGATVLQFHKEKNVIKIITDNGISKELNLSSKKCAPFLRNPDILIGQKDLTYLSYLNEPEVLYNLQIRFCERREIYTYCGIVLVAINPYQELSIYGKEIINAYHSQNSVDLDPHIFAVAENAFRRMSSFGENQSIIVSGESGAGKTVSAKYTMRYFALVGGSKTKQSFNLTETQIERKVLLSNPILEAFGNAKTIRNDNSSRFGKYLEILFNPRNQVIGANMCTYLLEKSRVVFQNLGERNYHIFYQIVTHCQSEDELLMNTGLVNNVEMYDYLRYGESLEIDGVDDSHEFLITKNSFLQLGIDLNKFKTICEILAAILHLGNIRFRFHDATDSSIIENPELLKLIAGLLGCSIDQLKIWLCFRTISTFQETLHKPLSKAEAQYFRDAFVKTLYSNLFDWIVKQANKVLSTDVSINIKKKLKKTIVVNQEDKKKFIAVLDIYGFETFAENSFEQFCINFANEKLQLQFNLHVFKLEQEEYMNEGLEWTFIDYYNNQPCIDLIESRXXXXXXXXXXXXXXXXSDENWCCKIYSHHLNKSANFNKPKLSNMVFIIEHFAGPVEYKCAGFIEKNRDSVLEEQINLLKASDVQLIAELFRDSEIEIFDTNNXXXXXXXXXXXXXXXXXXQENTRKMKKTVGSQFRNSLKSLMDALNKTNPHYVRCIKPNDLKLPFTFCPERAVQQLRACGVLETIRLSAAGFPSRWTYSDFYHRYYILMSNFNVKNHDFKAGSQKIVETLITVPDAFRFGNTKLFFRPGQVALLEKLRGHKIESSVTLIQSILRGSIERKKYLIIHKLTVQIQTYIRRKLAIEKATKLSQIRAVIIIQSFYRMYLARKLFVKMKCAVLAIEKWRRKIITTRLKQAYKKENCVIICQAIVRRFIQRRKFLKIQRGVILIQNHYRRRKAKETLKILKIEARSINHIKFVNKGLENKIIELTQKLDTKEKEMCXXXXXXXXXXXXXXXXXXXXXAESAKIYQNTVQDLQTEIIQLKKELNREIVEKNKIFADKELLEINYKKKINYLENLIEELKSSPSVIEPNIICNGDEAQQSICQDEHQKFINEQMDHQKLVREYEKLEMKYENLYKEFLFVKSSNQKPSINYDNQTSNDSETESTFSKDDADVESLSDKVDAKTTKEHXXXXXXXXXXLPNFISESISTAGDLAVVMQLQMNISSLSQENNRLKETVQQFEDELLKYEQCAEDSKGLVIHNEYDNELLSIIKDIKGMDEHGLKSRLIDEVANLKKKLKQSNEDYQKLRLHIFDGSMSKLTGNLDHESINSEEEELKRAFESQKEANRKMLKEIEGIKANNVDLKKALFQIRKDKEQLQVQLGKQHLMIRHGVEYLQNLKLTPKERLDKFVQNEISRILLENLKLQERNDQIISETIELKRGLKYFAFRLQKYEGSLVPNPNKEEDLLQLIQNVIYHSKMKTIGKRECYSEIGLIDLNMSELSIFIKSFIFDLSPSICLQYEPYHLVPYIIFMVTRKFDFYKEEDQMTNFLSKLIVALKRTIRKRRNYIEYLVMLLSNVFCLVNLXXXXXXXXXXXXLNTAEDIQHYFVHYDLNEFIRLLKELCVTLFQMILKTIVDNLLPQSLCIDAILVHEAIIDFLSKDGTKYKSNIETQPKNTSFNVLTKNLQSVLEILKNHKIPQLIINQIFVHIAYLINAYCLNTLLFRTDLCYFSKGLQIKYNLSSFETWIRYQKLIDSGALQCLRPMTEAVQLLQTLIDSDEDAKFVCDMCEYLNTRQVVKILNNFNPRDGYGCRLSSGLIAKIETQMKIKRGDEPSESKLETPTVIEIPIDIPFIHNGVSLCRTIIPKPLYLSCLTVLSEKDLL 5599
            MYSKGVKIWIPDEESVWIGATVLQFHKEKNVIKIITDNGISKELNLSSK  APFLRNPDILIGQKDLTYLSYLNEPEVLYNLQIRFCERREIYTYCGIVLVAINPYQELSIYGKEIINAYHSQNSVDLDPHIFAVAENAFRRMSSFGENQSIIVSGESGAGKTVSAKYTMRYFALVGGSKTKQSFNLTETQIERKVLLSNPILEAFGNAKT+           + I+ +  N       C  L ++ +VVFQNLGERNYHIFYQIVTHCQSEDELLMNTGLVNNVEMYDYLRYGESLEIDGVDDSHEFLITKNSFLQLGIDLNKFKTICEILAAILHLGNIRFR +DATDSSIIENPELLKLIAGLLGCSIDQLKIWLCFRTISTFQETLHKPLSKAEAQYFRDAFVKTLYSNLFDWIVKQANKVLSTDVSINIKKKLKKTIVVNQEDKKKFIAVLDIYGFETFAENSFEQFCINFANEKLQLQFNLHVFKLEQEEYMNEGLEWTFIDYYNNQPCIDLIESRLGLLDLLDEECKLLKGSDENWCCKIYSHHLNKSANFNKPKLS+MVFIIEHFAGPVEYKCAGFIEKNRDSVLEEQINLLKASDVQLIAELFRDSE EI DTNNSKPKVSIKSSTKSIMSIKQENTRKMKKTVGSQFRNSLKSLMDALNKTNPHYVRCIKPNDLKLPFTFCPERAVQQLRACGVLETIRLSAAGFPSRWTYSDFYHRYYILMSNFNVKNHDFKAGSQKIVETLITVPDAFRFGNTKLFFRPGQVALLEKLRGHKIESSVTLIQSILRGSIERK+YLIIHKLTVQIQTYIRRKLAIEKATKLSQIRAVIIIQSFYRMYLARKLFVKMKCAVLAIEKWRRKIITTRLKQAYKKENCVIICQAIVRRFIQRRKFLKIQRGVILIQNHYRRRKAKETLKILKIEARSINHIKFVNKGLENKIIELTQKLDTKEKEMCLIQNQLIKEKKIEILNLKLNQAESAKIYQNTVQDLQTEIIQLKKELNREIVEKNKIFADKELLEINYKKKINYLENLIEELKSSPSVIEPNIICNGDEAQQSICQDEHQKFINEQMDHQKLVREYEKLEMKYENLYKEFLFVKSSNQKPSINYDNQTSNDSETESTFSKDDADVESLSD+VDAKTTKEHVVKSSVVVKKLPNFISESISTAGDLAVVMQLQMNISSLSQENNRLKETVQQFEDELLKYEQ AEDSKGLVIHNEYDNELLSIIKDIKGMDEHGLKSRLIDEVANLKKKLKQSNEDYQKLRLHIFDGSMSKLTGNLDHESINSEEEELKRAFESQKEANRKMLKEIEGIKANNVDLKKALFQIRKDKEQLQVQLGKQHLMIRHGVEYLQNLKLTPKERLDKFVQNEISRILLENLKLQERNDQI SETIELKRGLKYFAFRLQKYEGSLVPNPNKEEDLLQLIQNVIYHSKMKTIGKRECYSEIGLIDLNMSELSIFIKSFIFDLSPSICLQYEPYHLVPYIIFMVTRKFDFYKEEDQMTNFLSKLIVALKRTIRKRRNYIEYLVML SNVFCLVNLFQQYSGSQQFSGLNTAEDIQHYFVHYDLNEFIRLLKELCVTLFQMILKTIVDNLLPQSLCIDAILVHEAIIDFLSKDGTKYKSNIETQPKNTSFNVLTKNLQSVLEILKNHKIPQLIINQIFVHIAYLINAYCLNTLLFRTDLCYFSKGLQIKYNLSSFETWIRYQKLIDSGALQCLRPMTEAVQLLQTLIDSDEDAKFVCDMCEYLNTRQVVKILNNFNPRDGYGCRLSSGLIAKIETQMKIKRGDEPSESKLETPTVIEIPIDIPFIHNGVSLCRTIIPKPLYLSCLTVLSEKDLL
Sbjct:    1 MYSKGVKIWIPDEESVWIGATVLQFHKEKNVIKIITDNGISKELNLSSKIYAPFLRNPDILIGQKDLTYLSYLNEPEVLYNLQIRFCERREIYTYCGIVLVAINPYQELSIYGKEIINAYHSQNSVDLDPHIFAVAENAFRRMSSFGENQSIIVSGESGAGKTVSAKYTMRYFALVGGSKTKQSFNLTETQIERKVLLSNPILEAFGNAKTLE----------MTIVADLEN---IWKFC--LTQEIKVVFQNLGERNYHIFYQIVTHCQSEDELLMNTGLVNNVEMYDYLRYGESLEIDGVDDSHEFLITKNSFLQLGIDLNKFKTICEILAAILHLGNIRFRSNDATDSSIIENPELLKLIAGLLGCSIDQLKIWLCFRTISTFQETLHKPLSKAEAQYFRDAFVKTLYSNLFDWIVKQANKVLSTDVSINIKKKLKKTIVVNQEDKKKFIAVLDIYGFETFAENSFEQFCINFANEKLQLQFNLHVFKLEQEEYMNEGLEWTFIDYYNNQPCIDLIESRLGLLDLLDEECKLLKGSDENWCCKIYSHHLNKSANFNKPKLSDMVFIIEHFAGPVEYKCAGFIEKNRDSVLEEQINLLKASDVQLIAELFRDSETEILDTNNSKPKVSIKSSTKSIMSIKQENTRKMKKTVGSQFRNSLKSLMDALNKTNPHYVRCIKPNDLKLPFTFCPERAVQQLRACGVLETIRLSAAGFPSRWTYSDFYHRYYILMSNFNVKNHDFKAGSQKIVETLITVPDAFRFGNTKLFFRPGQVALLEKLRGHKIESSVTLIQSILRGSIERKRYLIIHKLTVQIQTYIRRKLAIEKATKLSQIRAVIIIQSFYRMYLARKLFVKMKCAVLAIEKWRRKIITTRLKQAYKKENCVIICQAIVRRFIQRRKFLKIQRGVILIQNHYRRRKAKETLKILKIEARSINHIKFVNKGLENKIIELTQKLDTKEKEMCLIQNQLIKEKKIEILNLKLNQAESAKIYQNTVQDLQTEIIQLKKELNREIVEKNKIFADKELLEINYKKKINYLENLIEELKSSPSVIEPNIICNGDEAQQSICQDEHQKFINEQMDHQKLVREYEKLEMKYENLYKEFLFVKSSNQKPSINYDNQTSNDSETESTFSKDDADVESLSDEVDAKTTKEHVVKSSVVVKKLPNFISESISTAGDLAVVMQLQMNISSLSQENNRLKETVQQFEDELLKYEQGAEDSKGLVIHNEYDNELLSIIKDIKGMDEHGLKSRLIDEVANLKKKLKQSNEDYQKLRLHIFDGSMSKLTGNLDHESINSEEEELKRAFESQKEANRKMLKEIEGIKANNVDLKKALFQIRKDKEQLQVQLGKQHLMIRHGVEYLQNLKLTPKERLDKFVQNEISRILLENLKLQERNDQITSETIELKRGLKYFAFRLQKYEGSLVPNPNKEEDLLQLIQNVIYHSKMKTIGKRECYSEIGLIDLNMSELSIFIKSFIFDLSPSICLQYEPYHLVPYIIFMVTRKFDFYKEEDQMTNFLSKLIVALKRTIRKRRNYIEYLVMLFSNVFCLVNLFQQYSGSQQFSGLNTAEDIQHYFVHYDLNEFIRLLKELCVTLFQMILKTIVDNLLPQSLCIDAILVHEAIIDFLSKDGTKYKSNIETQPKNTSFNVLTKNLQSVLEILKNHKIPQLIINQIFVHIAYLINAYCLNTLLFRTDLCYFSKGLQIKYNLSSFETWIRYQKLIDSGALQCLRPMTEAVQLLQTLIDSDEDAKFVCDMCEYLNTRQVVKILNNFNPRDGYGCRLSSGLIAKIETQMKIKRGDEPSESKLETPTVIEIPIDIPFIHNGVSLCRTIIPKPLYLSCLTVLSEKDLL 1831          
BLAST of Dach-2 vs. Planmine SMEST
Match: SMESG000033540.1 (SMESG000033540.1)

HSP 1 Score: 3469.09 bits (8994), Expect = 0.000e+0
Identity = 1799/1846 (97.45%), Postives = 1811/1846 (98.10%), Query Frame = 2
Query:   62 MYSKGVKIWIPDEESVWIGATVLQFHKEKNVIKIITDNGISKELNLSSKKCAPFLRNPDILIGQKDLTYLSYLNEPEVLYNLQIRFCERREIYTYCGIVLVAINPYQELSIYGKEIINAYHSQNSVDLDPHIFAVAENAFRRMSSFGENQSIIVSGESGAGKTVSAKYTMRYFALVGGSKTKQSFNLTETQIERKVLLSNPILEAFGNAKTIRNDNSSRFGKYLEILFNPRNQVIGANMCTYLLEKSRVVFQNLGERNYHIFYQIVTHCQSEDELLMNTGLVNNVEMYDYLRYGESLEIDGVDDSHEFLITKNSFLQLGIDLNKFKTICEILAAILHLGNIRFRFHDATDSSIIENPELLKLIAGLLGCSIDQLKIWLCFRTISTFQETLHKPLSKAEAQYFRDAFVKTLYSNLFDWIVKQANKVLSTDVSINIKKKLKKTIVVNQEDKKKFIAVLDIYGFETFAENSFEQFCINFANEKLQLQFNLHVFKLEQEEYMNEGLEWTFIDYYNNQPCIDLIESRXXXXXXXXXXXXXXXXSDENWCCKIYSHHLNKSANFNKPKLSNMVFIIEHFAGPVEYKCAGFIEKNRDSVLEEQINLLKASDVQLIAELFRDSEIEIFDTNNXXXXXXXXXXXXXXXXXXQENTRKMKKTVGSQFRNSLKSLMDALNKTNPHYVRCIKPNDLKLPFTFCPERAVQQLRACGVLETIRLSAAGFPSRWTYSDFYHRYYILMSNFNVKNHDFKAGSQKIVETLITVPDAFRFGNTKLFFRPGQVALLEKLRGHKIESSVTLIQSILRGSIERKKYLIIHKLTVQIQTYIRRKLAIEKATKLSQIRAVIIIQSFYRMYLARKLFVKMKCAVLAIEKWRRKIITTRLKQAYKKENCVIICQAIVRRFIQRRKFLKIQRGVILIQNHYRRRKAKETLKILKIEARSINHIKFVNKGLENKIIELTQKLDTKEKEMCXXXXXXXXXXXXXXXXXXXXXAESAKIYQNTVQDLQTEIIQLKKELNREIVEKNKIFADKELLEINYKKKINYLENLIEELKSSPSVIEPNIICNGDEAQQSICQDEHQKFINEQMDHQKLVREYEKLEMKYENLYKEFLFVKSSNQKPSINYDNQTSNDSETESTFSKDDADVESLSDKVDAKTTKEHXXXXXXXXXXLPNFISESISTAGDLAVVMQLQMNISSLSQENNRLKETVQQFEDELLKYEQCAEDSKGLVIHNEYDNELLSIIKDIKGMDEHGLKSRLIDEVANLKKKLKQSNEDYQKLRLHIFDGSMSKLTGNLDHESINSEEEELKRAFESQKEANRKMLKEIEGIKANNVDLKKALFQIRKDKEQLQVQLGKQHLMIRHGVEYLQNLKLTPKERLDKFVQNEISRILLENLKLQERNDQIISETIELKRGLKYFAFRLQKYEGSLVPNPNKEEDLLQLIQNVIYHSKMKTIGKRECYSEIGLIDLNMSELSIFIKSFIFDLSPSICLQYEPYHLVPYIIFMVTRKFDFYKEEDQMTNFLSKLIVALKRTIRKRRNYIEYLVMLLSNVFCLVNLXXXXXXXXXXXXLNTAEDIQHYFVHYDLNEFIRLLKELCVTLFQMILKTIVDNLLPQSLCIDAILVHEAIIDFLSKDGTKYKSNIETQPKNTSFNVLTKNLQSVLEILKNHKIPQLIINQIFVHIAYLINAYCLNTLLFRTDLCYFSKGLQIKYNLSSFETWIRYQKLIDSGALQCLRPMTEAVQLLQTLIDSDEDAKFVCDMCEYLNTRQVVKILNNFNPRDGYGCRLSSGLIAKIETQMKIKRGDEPSESKLETPTVIEIPIDIPFIHNGVSLCRTIIPKPLYLSCLTVLSEKDLL 5599
            + SKGVKIWIPDEESVWIGATVLQFHKEKNVIKIITDNGISKELNLSSK  APFLRNPDILIGQKDLTYLSYLNEPEVLYNLQIRFCERREIYTYCGIVLVAINPYQELSIYGKEIINAYHSQNSVDLDPHIFAVAENAFRRMSSFGENQSIIVSGESGAGKTVSAKYTMRYFALVGGSKTKQSFNLTETQIERKVLLSNPILEAFGNAKT+           + I+ +  N       C  L ++ +VVFQNLGERNYHIFYQIVTHCQSEDELLMNTGLVNNVEMYDYLRYGESLEIDGVDDSHEFLITKNSFLQLGIDLNKFKTICEILAAILHLGNIRFR +DATDSSIIENPELLKLIAGLLGCSIDQLKIWLCFRTISTFQETLHKPLSKAEAQYFRDAFVKTLYSNLFDWIVKQANKVLSTDVSINIKKKLKKTIVVNQEDKKKFIAVLDIYGFETFAENSFEQFCINFANEKLQLQFNLHVFKLEQEEYMNEGLEWTFIDYYNNQPCIDLIESRLGLLDLLDEECKLLKGSDENWCCKIYSHHLNKSANFNKPKLS+MVFIIEHFAGPVEYKCAGFIEKNRDSVLEEQINLLKASDVQLIAELFRDSE EI DTNNSKPKVSIKSSTKSIMSIKQENTRKMKKTVGSQFRNSLKSLMDALNKTNPHYVRCIKPNDLKLPFTFCPERAVQQLRACGVLETIRLSAAGFPSRWTYSDFYHRYYILMSNFNVKNHDFKAGSQKIVETLITVPDAFRFGNTKLFFRPGQVALLEKLRGHKIESSVTLIQSILRGSIERK+YLIIHKLTVQIQTYIRRKLAIEKATKLSQIRAVIIIQSFYRMYLARKLFVKMKCAVLAIEKWRRKIITTRLKQAYKKENCVIICQAIVRRFIQRRKFLKIQRGVILIQNHYRRRKAKETLKILKIEARSINHIKFVNKGLENKIIELTQKLDTKEKEMCLIQNQLIKEKKIEILNLKLNQAESAKIYQNTVQDLQTEIIQLKKELNREIVEKNKIFADKELLEINYKKKINYLENLIEELKSSPSVIEPNIICNGDEAQQSICQDEHQKFINEQMDHQKLVREYEKLEMKYENLYKEFLFVKSSNQKPSINYDNQTSNDSETESTFSKDDADVESLSD+VDAKTTKEHVVKSSVVVKKLPNFISESISTAGDLAVVMQLQMNISSLSQENNRLKETVQQFEDELLKYEQ AEDSKGLVIHNEYDNELLSIIKDIKGMDEHGLKSRLIDEVANLKKKLKQSNEDYQKLRLHIFDGSMSKLTGNLDHESINSEEEELKRAFESQKEANRKMLKEIEGIKANNVDLKKALFQIRKDKEQLQVQLGKQHLMIRHGVEYLQNLKLTPKERLDKFVQNEISRILLENLKLQERNDQI SETIELKRGLKYFAFRLQKYEGSLVPNPNKEEDLLQLIQNVIYHSKMKTIGKRECYSEIGLIDLNMSELSIFIKSFIFDLSPSICLQYEPYHLVPYIIFMVTRKFDFYKEEDQMTNFLSKLIVALKRTIRKRRNYIEYLVML SNVFCLVNLFQQYSGSQQFSGLNTAEDIQHYFVHYDLNEFIRLLKELCVTLFQMILKTIVDNLLPQSLCIDAILVHEAIIDFLSKDGTKYKSNIETQPKNTSFNVLTKNLQSVLEILKNHKIPQLIINQIFVHIAYLINAYCLNTLLFRTDLCYFSKGLQIKYNLSSFETWIRYQKLIDSGALQCLRPMTEAVQLLQTLIDSDEDAKFVCDMCEYLNTRQVVKILNNFNPRDGYGCRLSSGLIAKIETQMKIKRGDEPSESKLETPTVIEIPIDIPFIHNGVSLCRTIIPKPLYLSCLTVLSEKDLL
Sbjct:    5 LSSKGVKIWIPDEESVWIGATVLQFHKEKNVIKIITDNGISKELNLSSKIYAPFLRNPDILIGQKDLTYLSYLNEPEVLYNLQIRFCERREIYTYCGIVLVAINPYQELSIYGKEIINAYHSQNSVDLDPHIFAVAENAFRRMSSFGENQSIIVSGESGAGKTVSAKYTMRYFALVGGSKTKQSFNLTETQIERKVLLSNPILEAFGNAKTLE----------MTIVADLEN---IWKFC--LTQEIKVVFQNLGERNYHIFYQIVTHCQSEDELLMNTGLVNNVEMYDYLRYGESLEIDGVDDSHEFLITKNSFLQLGIDLNKFKTICEILAAILHLGNIRFRSNDATDSSIIENPELLKLIAGLLGCSIDQLKIWLCFRTISTFQETLHKPLSKAEAQYFRDAFVKTLYSNLFDWIVKQANKVLSTDVSINIKKKLKKTIVVNQEDKKKFIAVLDIYGFETFAENSFEQFCINFANEKLQLQFNLHVFKLEQEEYMNEGLEWTFIDYYNNQPCIDLIESRLGLLDLLDEECKLLKGSDENWCCKIYSHHLNKSANFNKPKLSDMVFIIEHFAGPVEYKCAGFIEKNRDSVLEEQINLLKASDVQLIAELFRDSETEILDTNNSKPKVSIKSSTKSIMSIKQENTRKMKKTVGSQFRNSLKSLMDALNKTNPHYVRCIKPNDLKLPFTFCPERAVQQLRACGVLETIRLSAAGFPSRWTYSDFYHRYYILMSNFNVKNHDFKAGSQKIVETLITVPDAFRFGNTKLFFRPGQVALLEKLRGHKIESSVTLIQSILRGSIERKRYLIIHKLTVQIQTYIRRKLAIEKATKLSQIRAVIIIQSFYRMYLARKLFVKMKCAVLAIEKWRRKIITTRLKQAYKKENCVIICQAIVRRFIQRRKFLKIQRGVILIQNHYRRRKAKETLKILKIEARSINHIKFVNKGLENKIIELTQKLDTKEKEMCLIQNQLIKEKKIEILNLKLNQAESAKIYQNTVQDLQTEIIQLKKELNREIVEKNKIFADKELLEINYKKKINYLENLIEELKSSPSVIEPNIICNGDEAQQSICQDEHQKFINEQMDHQKLVREYEKLEMKYENLYKEFLFVKSSNQKPSINYDNQTSNDSETESTFSKDDADVESLSDEVDAKTTKEHVVKSSVVVKKLPNFISESISTAGDLAVVMQLQMNISSLSQENNRLKETVQQFEDELLKYEQGAEDSKGLVIHNEYDNELLSIIKDIKGMDEHGLKSRLIDEVANLKKKLKQSNEDYQKLRLHIFDGSMSKLTGNLDHESINSEEEELKRAFESQKEANRKMLKEIEGIKANNVDLKKALFQIRKDKEQLQVQLGKQHLMIRHGVEYLQNLKLTPKERLDKFVQNEISRILLENLKLQERNDQITSETIELKRGLKYFAFRLQKYEGSLVPNPNKEEDLLQLIQNVIYHSKMKTIGKRECYSEIGLIDLNMSELSIFIKSFIFDLSPSICLQYEPYHLVPYIIFMVTRKFDFYKEEDQMTNFLSKLIVALKRTIRKRRNYIEYLVMLFSNVFCLVNLFQQYSGSQQFSGLNTAEDIQHYFVHYDLNEFIRLLKELCVTLFQMILKTIVDNLLPQSLCIDAILVHEAIIDFLSKDGTKYKSNIETQPKNTSFNVLTKNLQSVLEILKNHKIPQLIINQIFVHIAYLINAYCLNTLLFRTDLCYFSKGLQIKYNLSSFETWIRYQKLIDSGALQCLRPMTEAVQLLQTLIDSDEDAKFVCDMCEYLNTRQVVKILNNFNPRDGYGCRLSSGLIAKIETQMKIKRGDEPSESKLETPTVIEIPIDIPFIHNGVSLCRTIIPKPLYLSCLTVLSEKDLL 1835          
BLAST of Dach-2 vs. Planmine SMEST
Match: SMESG000033540.1 (SMESG000033540.1)

HSP 1 Score: 3447.14 bits (8937), Expect = 0.000e+0
Identity = 1793/1851 (96.87%), Postives = 1804/1851 (97.46%), Query Frame = 2
Query:   47 MALYEMYSKGVKIWIPDEESVWIGATVLQFHKEKNVIKIITDNGISKELNLSSKKCAPFLRNPDILIGQKDLTYLSYLNEPEVLYNLQIRFCERREIYTYCGIVLVAINPYQELSIYGKEIINAYHSQNSVDLDPHIFAVAENAFRRMSSFGENQSIIVSGESGAGKTVSAKYTMRYFALVGGSKTKQSFNLTETQIERKVLLSNPILEAFGNAKTIRNDNSSRFGKYLEILFNPRNQVIGANMCTYLLEKSRVVFQNLGERNYHIFYQIVTHCQSEDELLMNTGLVNNVEMYDYLRYGESLEIDGVDDSHEFLITKNSFLQLGIDLNKFKTICEILAAILHLGNIRFRFHDATDSSIIENPELLKLIAGLLGCSIDQLKIWLCFRTISTFQETLHKPLSKAEAQYFRDAFVKTLYSNLFDWIVKQANKVLSTDVSINIKKKLKKTIVVNQEDKKKFIAVLDIYGFETFAENSFEQFCINFANEKLQLQFNLHVFKLEQEEYMNEGLEWTFIDYYNNQPCIDLIESRXXXXXXXXXXXXXXXXSDENWCCKIYSHHLNKSANFNKPKLSNMVFIIEHFAGPVEYKCAGFIEKNRDSVLEEQINLLKASDVQLIAELFRDSEIEIFDTNNXXXXXXXXXXXXXXXXXXQENTRKMKKTVGSQFRNSLKSLMDALNKTNPHYVRCIKPNDLKLPFTFCPERAVQQLRACGVLETIRLSAAGFPSRWTYSDFYHRYYILMSNFNVKNHDFKAGSQKIVETLITVPDAFRFGNTKLFFRPGQVALLEKLRGHKIESSVTLIQSILRGSIERKKYLIIHKLTVQIQTYIRRKLAIEKATKLSQIRAVIIIQSFYRMYLARKLFVKMKCAVLAIEKWRRKIITTRLKQAYKKENCVIICQAIVRRFIQRRKFLKIQRGVILIQNHYRRRKAKETLKILKIEARSINHIKFVNKGLENKIIELTQKLDTKEKEMCXXXXXXXXXXXXXXXXXXXXXAESAKIYQNTVQDLQTEIIQLKKELNREIVEKNKIFADKELLEINYKKKINYLENLIEELKSSPSVIEPNIICNGDEAQQSICQDEHQKFINEQMDHQKLVREYEKLEMKYENLYKEFLFVKSSNQKPSINYDNQTSNDSETESTFSKDDADVESLSDKVDAKTTKEHXXXXXXXXXXLPNFISESISTAGDLAVVMQLQMNISSLSQENNRLKETVQQFEDELLKYEQCAEDSKGLVIHNEYDNELLSIIKDIKGMDEHGLKSRLIDEVANLKKKLKQSNEDYQKLRLHIFDGSMSKLTGNLDHESINSEEEELKRAFESQKEANRKMLKEIEGIKANNVDLKKALFQIRKDKEQLQVQLGKQHLMIRHGVEYLQNLKLTPKERLDKFVQNEISRILLENLKLQERNDQIISETIELKRGLKYFAFRLQKYEGSLVPNPNKEEDLLQLIQNVIYHSKMKTIGKRECYSEIGLIDLNMSELSIFIKSFIFDLSPSICLQYEPYHLVPYIIFMVTRKFDFYKEEDQMTNFLSKLIVALKRTIRKRRNYIEYLVMLLSNVFCLVNLXXXXXXXXXXXXLNTAEDIQHYFVHYDLNEFIRLLKELCVTLFQMILKTIVDNLLPQSLCIDAILVHEAIIDFLSKDGTKYKSNIETQPKNTSFNVLTKNLQSVLEILKNHKIPQLIINQIFVHIAYLINAYCLNTLLFRTDLCYFSKGLQIKYNLSSFETWIRYQKLIDSGALQCLRPMTEAVQLLQTLIDSDEDAKFVCDMCEYLNTRQVVKILNNFNPRDGYGCRLSSGLIAKIETQMKIKRGDEPSESKLETPTVIEIPIDIPFIHNGVSLCRTIIPKPLYLSCLTVLSEKDLL 5599
            MALYEMYSKGVKIWIPDEESVWIGATVLQFHKEKNVIKIITDNGISKELNLSSK  APFLRNPDILIGQKDLTYLSYLNEPEVLYNLQIRFCERREIYTYCGIVLVAINPYQELSIYGKEIINAYHSQNSVDLDPHIFAVAENAFRRMSSFGENQSIIVSGESGAGKTVSAKYTMRYFALVGGSKTKQSFNLTETQIERKVLLSNPILEAFGNAKT+           + I+ +  N       C  L ++ +VVFQNLGERNYHIFYQIVTHCQSEDELLMNTGLVNNVEMYDYLRYGESLEIDGVDDSHEFLITKNSFLQLGIDLNKFKTICEILAAILHLGNIRFR +DATDSSIIENPELLKLIAGLLGCSIDQLKIWLCFRTISTFQETLHKPLSKAEAQYFRDAFVKTLYSNLFDWIVKQANKVLSTDVSINIKKKLKKTIVVNQEDKKKFIAVLDIYGFETFAENSFEQFCINFANEKLQLQFNLHVFKLEQEEYMNEGLEWTFIDYYNNQPCIDLIESRLGLLDLLDEECKLLKGSDENWCCKIYSHHLNKSANFNKPKLS+MVFIIEHFAGPVEYKCAGFIEKNRDSVLEEQINLLKASDVQLIAELFRDSE EI DTNNSKPKVSIKSSTKSIMSIKQENTRKMKKTVGSQFRNSLKSLMDALNKTNPHYVRCIKPNDLKLPFTFCPERAVQQLRACGVLETIRLSAAGFPSRWTYSDFYHRYYILMSNFNVKNHDFKAGSQKIVETLITVPDAFRFGNTKLFFRPGQVALLEKLRGHKIESSVTLIQSILRGSIERK+YLIIHKLTVQIQTYIRRKLAIEKATKLSQIRAVIIIQSFYRMYLARKLFVKMKCAVLAIEKWRRKIITTRLKQAYKKENCVIICQAIVRRFIQRRKFLKIQRGVILIQNHYRRRKAKETLKILKIEARSINHIKFVNKGLENKIIELTQKLDTKEKEMCLIQNQLIKEKKIEILNLKLNQAESAKIYQNTVQDLQTEIIQLKKELNREIVEKNKIFADKELLEINYKKKINYLENLIEELKSSPSVIEPNIICNGDEAQQSICQDEHQKFINEQMDHQKLVREYEKLEMKYENLYKEFLFVKSSNQKPSINYDNQTSNDSETESTFSKDDADVESLSD+VDAKTTKEHVVKSSVVVKKLPNFISESISTAGDLAVVMQLQMNISSLSQENNRLKETVQQFEDELLKYEQ AEDSKGLVIHNEYDNELLSIIKDIKGMDEHGLKSRLIDEVANLKKKLKQSNEDYQKLRLHIFDGSMSKLTGNLDHESINSEEEELKRAFESQKEANRKMLKEIEGIKANNVDLKKALFQIRKDKEQLQVQLGK             NLKLTPKERLDKFVQNEISRILLENLKLQERNDQI SETIELKRGLKYFAFRLQKYEGSLVPNPNKEEDLLQLIQNVIYHSKMKTIGKRECYSEIGLIDLNMSELSIFIKSFIFDLSPSICLQYEPYHLVPYIIFMVTRKFDFYKEEDQMTNFLSKLIVALKRTIRKRRNYIEYLVML SNVFCLVNLFQQYSGSQQFSGLNTAEDIQHYFVHYDLNEFIRLLKELCVTLFQMILKTIVDNLLPQSLCIDAILVHEAIIDFLSKDGTKYKSNIETQPKNTSFNVLTKNLQSVLEILKNHKIPQLIINQIFVHIAYLINAYCLNTLLFRTDLCYFSKGLQIKYNLSSFETWIRYQKLIDSGALQCLRPMTEAVQLLQTLIDSDEDAKFVCDMCEYLNTRQVVKILNNFNPRDGYGCRLSSGLIAKIETQMKIKRGDEPSESKLETPTVIEIPIDIPFIHNGVSLCRTIIPKPLYLSCLTVLSEKDLL
Sbjct:    1 MALYEMYSKGVKIWIPDEESVWIGATVLQFHKEKNVIKIITDNGISKELNLSSKIYAPFLRNPDILIGQKDLTYLSYLNEPEVLYNLQIRFCERREIYTYCGIVLVAINPYQELSIYGKEIINAYHSQNSVDLDPHIFAVAENAFRRMSSFGENQSIIVSGESGAGKTVSAKYTMRYFALVGGSKTKQSFNLTETQIERKVLLSNPILEAFGNAKTLE----------MTIVADLEN---IWKFC--LTQEIKVVFQNLGERNYHIFYQIVTHCQSEDELLMNTGLVNNVEMYDYLRYGESLEIDGVDDSHEFLITKNSFLQLGIDLNKFKTICEILAAILHLGNIRFRSNDATDSSIIENPELLKLIAGLLGCSIDQLKIWLCFRTISTFQETLHKPLSKAEAQYFRDAFVKTLYSNLFDWIVKQANKVLSTDVSINIKKKLKKTIVVNQEDKKKFIAVLDIYGFETFAENSFEQFCINFANEKLQLQFNLHVFKLEQEEYMNEGLEWTFIDYYNNQPCIDLIESRLGLLDLLDEECKLLKGSDENWCCKIYSHHLNKSANFNKPKLSDMVFIIEHFAGPVEYKCAGFIEKNRDSVLEEQINLLKASDVQLIAELFRDSETEILDTNNSKPKVSIKSSTKSIMSIKQENTRKMKKTVGSQFRNSLKSLMDALNKTNPHYVRCIKPNDLKLPFTFCPERAVQQLRACGVLETIRLSAAGFPSRWTYSDFYHRYYILMSNFNVKNHDFKAGSQKIVETLITVPDAFRFGNTKLFFRPGQVALLEKLRGHKIESSVTLIQSILRGSIERKRYLIIHKLTVQIQTYIRRKLAIEKATKLSQIRAVIIIQSFYRMYLARKLFVKMKCAVLAIEKWRRKIITTRLKQAYKKENCVIICQAIVRRFIQRRKFLKIQRGVILIQNHYRRRKAKETLKILKIEARSINHIKFVNKGLENKIIELTQKLDTKEKEMCLIQNQLIKEKKIEILNLKLNQAESAKIYQNTVQDLQTEIIQLKKELNREIVEKNKIFADKELLEINYKKKINYLENLIEELKSSPSVIEPNIICNGDEAQQSICQDEHQKFINEQMDHQKLVREYEKLEMKYENLYKEFLFVKSSNQKPSINYDNQTSNDSETESTFSKDDADVESLSDEVDAKTTKEHVVKSSVVVKKLPNFISESISTAGDLAVVMQLQMNISSLSQENNRLKETVQQFEDELLKYEQGAEDSKGLVIHNEYDNELLSIIKDIKGMDEHGLKSRLIDEVANLKKKLKQSNEDYQKLRLHIFDGSMSKLTGNLDHESINSEEEELKRAFESQKEANRKMLKEIEGIKANNVDLKKALFQIRKDKEQLQVQLGK-------------NLKLTPKERLDKFVQNEISRILLENLKLQERNDQITSETIELKRGLKYFAFRLQKYEGSLVPNPNKEEDLLQLIQNVIYHSKMKTIGKRECYSEIGLIDLNMSELSIFIKSFIFDLSPSICLQYEPYHLVPYIIFMVTRKFDFYKEEDQMTNFLSKLIVALKRTIRKRRNYIEYLVMLFSNVFCLVNLFQQYSGSQQFSGLNTAEDIQHYFVHYDLNEFIRLLKELCVTLFQMILKTIVDNLLPQSLCIDAILVHEAIIDFLSKDGTKYKSNIETQPKNTSFNVLTKNLQSVLEILKNHKIPQLIINQIFVHIAYLINAYCLNTLLFRTDLCYFSKGLQIKYNLSSFETWIRYQKLIDSGALQCLRPMTEAVQLLQTLIDSDEDAKFVCDMCEYLNTRQVVKILNNFNPRDGYGCRLSSGLIAKIETQMKIKRGDEPSESKLETPTVIEIPIDIPFIHNGVSLCRTIIPKPLYLSCLTVLSEKDLL 1823          
BLAST of Dach-2 vs. Planmine SMEST
Match: SMESG000033540.1 (SMESG000033540.1)

HSP 1 Score: 3436.74 bits (8910), Expect = 0.000e+0
Identity = 1788/1846 (96.86%), Postives = 1799/1846 (97.45%), Query Frame = 2
Query:   62 MYSKGVKIWIPDEESVWIGATVLQFHKEKNVIKIITDNGISKELNLSSKKCAPFLRNPDILIGQKDLTYLSYLNEPEVLYNLQIRFCERREIYTYCGIVLVAINPYQELSIYGKEIINAYHSQNSVDLDPHIFAVAENAFRRMSSFGENQSIIVSGESGAGKTVSAKYTMRYFALVGGSKTKQSFNLTETQIERKVLLSNPILEAFGNAKTIRNDNSSRFGKYLEILFNPRNQVIGANMCTYLLEKSRVVFQNLGERNYHIFYQIVTHCQSEDELLMNTGLVNNVEMYDYLRYGESLEIDGVDDSHEFLITKNSFLQLGIDLNKFKTICEILAAILHLGNIRFRFHDATDSSIIENPELLKLIAGLLGCSIDQLKIWLCFRTISTFQETLHKPLSKAEAQYFRDAFVKTLYSNLFDWIVKQANKVLSTDVSINIKKKLKKTIVVNQEDKKKFIAVLDIYGFETFAENSFEQFCINFANEKLQLQFNLHVFKLEQEEYMNEGLEWTFIDYYNNQPCIDLIESRXXXXXXXXXXXXXXXXSDENWCCKIYSHHLNKSANFNKPKLSNMVFIIEHFAGPVEYKCAGFIEKNRDSVLEEQINLLKASDVQLIAELFRDSEIEIFDTNNXXXXXXXXXXXXXXXXXXQENTRKMKKTVGSQFRNSLKSLMDALNKTNPHYVRCIKPNDLKLPFTFCPERAVQQLRACGVLETIRLSAAGFPSRWTYSDFYHRYYILMSNFNVKNHDFKAGSQKIVETLITVPDAFRFGNTKLFFRPGQVALLEKLRGHKIESSVTLIQSILRGSIERKKYLIIHKLTVQIQTYIRRKLAIEKATKLSQIRAVIIIQSFYRMYLARKLFVKMKCAVLAIEKWRRKIITTRLKQAYKKENCVIICQAIVRRFIQRRKFLKIQRGVILIQNHYRRRKAKETLKILKIEARSINHIKFVNKGLENKIIELTQKLDTKEKEMCXXXXXXXXXXXXXXXXXXXXXAESAKIYQNTVQDLQTEIIQLKKELNREIVEKNKIFADKELLEINYKKKINYLENLIEELKSSPSVIEPNIICNGDEAQQSICQDEHQKFINEQMDHQKLVREYEKLEMKYENLYKEFLFVKSSNQKPSINYDNQTSNDSETESTFSKDDADVESLSDKVDAKTTKEHXXXXXXXXXXLPNFISESISTAGDLAVVMQLQMNISSLSQENNRLKETVQQFEDELLKYEQCAEDSKGLVIHNEYDNELLSIIKDIKGMDEHGLKSRLIDEVANLKKKLKQSNEDYQKLRLHIFDGSMSKLTGNLDHESINSEEEELKRAFESQKEANRKMLKEIEGIKANNVDLKKALFQIRKDKEQLQVQLGKQHLMIRHGVEYLQNLKLTPKERLDKFVQNEISRILLENLKLQERNDQIISETIELKRGLKYFAFRLQKYEGSLVPNPNKEEDLLQLIQNVIYHSKMKTIGKRECYSEIGLIDLNMSELSIFIKSFIFDLSPSICLQYEPYHLVPYIIFMVTRKFDFYKEEDQMTNFLSKLIVALKRTIRKRRNYIEYLVMLLSNVFCLVNLXXXXXXXXXXXXLNTAEDIQHYFVHYDLNEFIRLLKELCVTLFQMILKTIVDNLLPQSLCIDAILVHEAIIDFLSKDGTKYKSNIETQPKNTSFNVLTKNLQSVLEILKNHKIPQLIINQIFVHIAYLINAYCLNTLLFRTDLCYFSKGLQIKYNLSSFETWIRYQKLIDSGALQCLRPMTEAVQLLQTLIDSDEDAKFVCDMCEYLNTRQVVKILNNFNPRDGYGCRLSSGLIAKIETQMKIKRGDEPSESKLETPTVIEIPIDIPFIHNGVSLCRTIIPKPLYLSCLTVLSEKDLL 5599
            MYSKGVKIWIPDEESVWIGATVLQFHKEKNVIKIITDNGISKELNLSSK  APFLRNPDILIGQKDLTYLSYLNEPEVLYNLQIRFCERREIYTYCGIVLVAINPYQELSIYGKEIINAYHSQNSVDLDPHIFAVAENAFRRMSSFGENQSIIVSGESGAGKTVSAKYTMRYFALVGGSKTKQSFNLTETQIERKVLLSNPILEAFGNAKT+           + I+ +  N       C  L ++ +VVFQNLGERNYHIFYQIVTHCQSEDELLMNTGLVNNVEMYDYLRYGESLEIDGVDDSHEFLITKNSFLQLGIDLNKFKTICEILAAILHLGNIRFR +DATDSSIIENPELLKLIAGLLGCSIDQLKIWLCFRTISTFQETLHKPLSKAEAQYFRDAFVKTLYSNLFDWIVKQANKVLSTDVSINIKKKLKKTIVVNQEDKKKFIAVLDIYGFETFAENSFEQFCINFANEKLQLQFNLHVFKLEQEEYMNEGLEWTFIDYYNNQPCIDLIESRLGLLDLLDEECKLLKGSDENWCCKIYSHHLNKSANFNKPKLS+MVFIIEHFAGPVEYKCAGFIEKNRDSVLEEQINLLKASDVQLIAELFRDSE EI DTNNSKPKVSIKSSTKSIMSIKQENTRKMKKTVGSQFRNSLKSLMDALNKTNPHYVRCIKPNDLKLPFTFCPERAVQQLRACGVLETIRLSAAGFPSRWTYSDFYHRYYILMSNFNVKNHDFKAGSQKIVETLITVPDAFRFGNTKLFFRPGQVALLEKLRGHKIESSVTLIQSILRGSIERK+YLIIHKLTVQIQTYIRRKLAIEKATKLSQIRAVIIIQSFYRMYLARKLFVKMKCAVLAIEKWRRKIITTRLKQAYKKENCVIICQAIVRRFIQRRKFLKIQRGVILIQNHYRRRKAKETLKILKIEARSINHIKFVNKGLENKIIELTQKLDTKEKEMCLIQNQLIKEKKIEILNLKLNQAESAKIYQNTVQDLQTEIIQLKKELNREIVEKNKIFADKELLEINYKKKINYLENLIEELKSSPSVIEPNIICNGDEAQQSICQDEHQKFINEQMDHQKLVREYEKLEMKYENLYKEFLFVKSSNQKPSINYDNQTSNDSETESTFSKDDADVESLSD+VDAKTTKEHVVKSSVVVKKLPNFISESISTAGDLAVVMQLQMNISSLSQENNRLKETVQQFEDELLKYEQ AEDSKGLVIHNEYDNELLSIIKDIKGMDEHGLKSRLIDEVANLKKKLKQSNEDYQKLRLHIFDGSMSKLTGNLDHESINSEEEELKRAFESQKEANRKMLKEIEGIKANNVDLKKALFQIRKDKEQLQVQLGK             NLKLTPKERLDKFVQNEISRILLENLKLQERNDQI SETIELKRGLKYFAFRLQKYEGSLVPNPNKEEDLLQLIQNVIYHSKMKTIGKRECYSEIGLIDLNMSELSIFIKSFIFDLSPSICLQYEPYHLVPYIIFMVTRKFDFYKEEDQMTNFLSKLIVALKRTIRKRRNYIEYLVML SNVFCLVNLFQQYSGSQQFSGLNTAEDIQHYFVHYDLNEFIRLLKELCVTLFQMILKTIVDNLLPQSLCIDAILVHEAIIDFLSKDGTKYKSNIETQPKNTSFNVLTKNLQSVLEILKNHKIPQLIINQIFVHIAYLINAYCLNTLLFRTDLCYFSKGLQIKYNLSSFETWIRYQKLIDSGALQCLRPMTEAVQLLQTLIDSDEDAKFVCDMCEYLNTRQVVKILNNFNPRDGYGCRLSSGLIAKIETQMKIKRGDEPSESKLETPTVIEIPIDIPFIHNGVSLCRTIIPKPLYLSCLTVLSEKDLL
Sbjct:    1 MYSKGVKIWIPDEESVWIGATVLQFHKEKNVIKIITDNGISKELNLSSKIYAPFLRNPDILIGQKDLTYLSYLNEPEVLYNLQIRFCERREIYTYCGIVLVAINPYQELSIYGKEIINAYHSQNSVDLDPHIFAVAENAFRRMSSFGENQSIIVSGESGAGKTVSAKYTMRYFALVGGSKTKQSFNLTETQIERKVLLSNPILEAFGNAKTLE----------MTIVADLEN---IWKFC--LTQEIKVVFQNLGERNYHIFYQIVTHCQSEDELLMNTGLVNNVEMYDYLRYGESLEIDGVDDSHEFLITKNSFLQLGIDLNKFKTICEILAAILHLGNIRFRSNDATDSSIIENPELLKLIAGLLGCSIDQLKIWLCFRTISTFQETLHKPLSKAEAQYFRDAFVKTLYSNLFDWIVKQANKVLSTDVSINIKKKLKKTIVVNQEDKKKFIAVLDIYGFETFAENSFEQFCINFANEKLQLQFNLHVFKLEQEEYMNEGLEWTFIDYYNNQPCIDLIESRLGLLDLLDEECKLLKGSDENWCCKIYSHHLNKSANFNKPKLSDMVFIIEHFAGPVEYKCAGFIEKNRDSVLEEQINLLKASDVQLIAELFRDSETEILDTNNSKPKVSIKSSTKSIMSIKQENTRKMKKTVGSQFRNSLKSLMDALNKTNPHYVRCIKPNDLKLPFTFCPERAVQQLRACGVLETIRLSAAGFPSRWTYSDFYHRYYILMSNFNVKNHDFKAGSQKIVETLITVPDAFRFGNTKLFFRPGQVALLEKLRGHKIESSVTLIQSILRGSIERKRYLIIHKLTVQIQTYIRRKLAIEKATKLSQIRAVIIIQSFYRMYLARKLFVKMKCAVLAIEKWRRKIITTRLKQAYKKENCVIICQAIVRRFIQRRKFLKIQRGVILIQNHYRRRKAKETLKILKIEARSINHIKFVNKGLENKIIELTQKLDTKEKEMCLIQNQLIKEKKIEILNLKLNQAESAKIYQNTVQDLQTEIIQLKKELNREIVEKNKIFADKELLEINYKKKINYLENLIEELKSSPSVIEPNIICNGDEAQQSICQDEHQKFINEQMDHQKLVREYEKLEMKYENLYKEFLFVKSSNQKPSINYDNQTSNDSETESTFSKDDADVESLSDEVDAKTTKEHVVKSSVVVKKLPNFISESISTAGDLAVVMQLQMNISSLSQENNRLKETVQQFEDELLKYEQGAEDSKGLVIHNEYDNELLSIIKDIKGMDEHGLKSRLIDEVANLKKKLKQSNEDYQKLRLHIFDGSMSKLTGNLDHESINSEEEELKRAFESQKEANRKMLKEIEGIKANNVDLKKALFQIRKDKEQLQVQLGK-------------NLKLTPKERLDKFVQNEISRILLENLKLQERNDQITSETIELKRGLKYFAFRLQKYEGSLVPNPNKEEDLLQLIQNVIYHSKMKTIGKRECYSEIGLIDLNMSELSIFIKSFIFDLSPSICLQYEPYHLVPYIIFMVTRKFDFYKEEDQMTNFLSKLIVALKRTIRKRRNYIEYLVMLFSNVFCLVNLFQQYSGSQQFSGLNTAEDIQHYFVHYDLNEFIRLLKELCVTLFQMILKTIVDNLLPQSLCIDAILVHEAIIDFLSKDGTKYKSNIETQPKNTSFNVLTKNLQSVLEILKNHKIPQLIINQIFVHIAYLINAYCLNTLLFRTDLCYFSKGLQIKYNLSSFETWIRYQKLIDSGALQCLRPMTEAVQLLQTLIDSDEDAKFVCDMCEYLNTRQVVKILNNFNPRDGYGCRLSSGLIAKIETQMKIKRGDEPSESKLETPTVIEIPIDIPFIHNGVSLCRTIIPKPLYLSCLTVLSEKDLL 1818          
The following BLAST results are available for this feature:
BLAST of Dach-2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MYO5A0.000e+037.64myosin VA [Source:HGNC Symbol;Acc:HGNC:7602][more]
MYO5A0.000e+037.59myosin VA [Source:HGNC Symbol;Acc:HGNC:7602][more]
MYO5A0.000e+037.09myosin VA [Source:HGNC Symbol;Acc:HGNC:7602][more]
MYO5A0.000e+037.62myosin VA [Source:HGNC Symbol;Acc:HGNC:7602][more]
MYO5B0.000e+037.39myosin VB [Source:HGNC Symbol;Acc:HGNC:7603][more]
back to top
BLAST of Dach-2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hum-21.101e-2040.16Heavy chain, Unconventional Myosin [Source:UniPro... [more]
hum-21.119e-2040.07Heavy chain, Unconventional Myosin [Source:UniPro... [more]
myo-65.810e-13333.82MYOsin heavy chain structural genes [Source:UniPr... [more]
myo-15.494e-13135.01Myosin-1 [Source:UniProtKB/Swiss-Prot;Acc:P02567][more]
myo-15.494e-13135.01Myosin-1 [Source:UniProtKB/Swiss-Prot;Acc:P02567][more]
back to top
BLAST of Dach-2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
didum0.000e+046.03gene:FBgn0261397 transcript:FBtr0089744[more]
didum0.000e+046.03gene:FBgn0261397 transcript:FBtr0089745[more]
didum0.000e+045.85gene:FBgn0261397 transcript:FBtr0089743[more]
Myo28B13.573e-13736.27gene:FBgn0040299 transcript:FBtr0079476[more]
Myo28B14.197e-13736.27gene:FBgn0040299 transcript:FBtr0079474[more]
back to top
BLAST of Dach-2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
myo5b0.000e+037.70myosin VB [Source:ZFIN;Acc:ZDB-GENE-031219-7][more]
myo5aa0.000e+037.60myosin VAa [Source:ZFIN;Acc:ZDB-GENE-041027-2][more]
myo5aa0.000e+037.22myosin VAa [Source:ZFIN;Acc:ZDB-GENE-041027-2][more]
myo5b0.000e+037.49myosin VB [Source:ZFIN;Acc:ZDB-GENE-031219-7][more]
myo5b0.000e+037.17myosin VB [Source:ZFIN;Acc:ZDB-GENE-031219-7][more]
back to top
BLAST of Dach-2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MYO5A0.000e+037.43myosin VA [Source:NCBI gene;Acc:100495365][more]
MYO5A0.000e+037.72myosin VA [Source:NCBI gene;Acc:100495365][more]
MYO5A0.000e+037.44myosin VA [Source:NCBI gene;Acc:100495365][more]
MYO5A0.000e+037.31myosin VA [Source:NCBI gene;Acc:100495365][more]
MYO5A0.000e+037.18myosin VA [Source:NCBI gene;Acc:100495365][more]
back to top
BLAST of Dach-2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Myo5a0.000e+037.33myosin VA [Source:MGI Symbol;Acc:MGI:105976][more]
Myo5a0.000e+036.79myosin VA [Source:MGI Symbol;Acc:MGI:105976][more]
Myo5b0.000e+037.49myosin VB [Source:MGI Symbol;Acc:MGI:106598][more]
Myo5b0.000e+037.32myosin VB [Source:MGI Symbol;Acc:MGI:106598][more]
Myo5a0.000e+043.67myosin VA [Source:MGI Symbol;Acc:MGI:105976][more]
back to top
BLAST of Dach-2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q02440|MYO5A_CHICK0.000e+038.20Unconventional myosin-Va OS=Gallus gallus OX=9031 ... [more]
sp|Q9QYF3|MYO5A_RAT0.000e+037.35Unconventional myosin-Va OS=Rattus norvegicus OX=1... [more]
sp|Q99104|MYO5A_MOUSE0.000e+036.79Unconventional myosin-Va OS=Mus musculus OX=10090 ... [more]
sp|P21271|MYO5B_MOUSE0.000e+037.49Unconventional myosin-Vb OS=Mus musculus OX=10090 ... [more]
sp|Q9ULV0|MYO5B_HUMAN0.000e+037.39Unconventional myosin-Vb OS=Homo sapiens OX=9606 G... [more]
back to top
BLAST of Dach-2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A481MTK70.000e+098.87Dach-2 OS=Schmidtea mediterranea OX=79327 PE=2 SV=... [more]
V4ACD40.000e+038.83Uncharacterized protein (Fragment) OS=Lottia gigan... [more]
A0A2T7PSZ80.000e+038.62Uncharacterized protein OS=Pomacea canaliculata OX... [more]
A0A0F7VJF00.000e+038.70Eka-NinaC protein (Fragment) OS=Euperipatoides kan... [more]
A0A1V4JEV10.000e+038.01Unconventional myosin-Va isoform D OS=Patagioenas ... [more]
back to top
BLAST of Dach-2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
myo5aa0.000e+037.90myosin VAa [Source:ZFIN;Acc:ZDB-GENE-041027-2][more]
myo5b0.000e+037.40myosin VB [Source:ZFIN;Acc:ZDB-GENE-031219-7][more]
myo5ab0.000e+035.55myosin VAb [Source:ZFIN;Acc:ZDB-GENE-050411-72][more]
myo5c7.803e-3646.53myosin VC [Source:ZFIN;Acc:ZDB-GENE-131127-196][more]
myo5c9.053e-17749.75myosin VC [Source:ZFIN;Acc:ZDB-GENE-131127-196][more]
back to top
BLAST of Dach-2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000000498.10.000e+054.45pep scaffold:Pmarinus_7.0:GL479744:368:24152:-1 ge... [more]
ENSPMAT00000000499.10.000e+054.08pep scaffold:Pmarinus_7.0:GL479744:9258:25467:-1 g... [more]
ENSPMAT00000004078.13.475e-14335.94pep scaffold:Pmarinus_7.0:GL478761:5289:25008:-1 g... [more]
ENSPMAT00000005411.11.371e-13835.02pep scaffold:Pmarinus_7.0:GL476612:1285:44967:1 ge... [more]
ENSPMAT00000002731.11.823e-13435.64pep scaffold:Pmarinus_7.0:GL478284:11062:40470:1 g... [more]
back to top
BLAST of Dach-2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
MYO23.199e-941.61Type V myosin motor involved in actin-based transp... [more]
MYO40.000e+039.40Type V myosin motor involved in actin-based transp... [more]
MYO15.423e-12035.60Type II myosin heavy chain; required for wild-type... [more]
MYO53.087e-10831.83One of two type I myosin motors; contains proline-... [more]
MYO31.011e-10631.61One of two type I myosins; localizes to actin cort... [more]
back to top
BLAST of Dach-2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO418190.000e+047.58Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO495153.878e-13435.14Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO455632.820e-13234.97Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO458359.865e-12235.04Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO350071.306e-11833.55Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Dach-2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
myo5ab0.000e+035.37unconventional myosin-Va [Source:NCBI gene;Acc:101... [more]
myo5ab0.000e+035.65unconventional myosin-Va [Source:NCBI gene;Acc:101... [more]
myo5c1.462e-3745.91myosin VC [Source:NCBI gene;Acc:101162444][more]
myo5c1.267e-3745.66myosin VC [Source:NCBI gene;Acc:101162444][more]
myo5b0.000e+054.15myosin VB [Source:ZFIN;Acc:ZDB-GENE-031219-7][more]
back to top
BLAST of Dach-2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000033540.10.000e+097.57SMESG000033540.1[more]
SMESG000033540.10.000e+097.56SMESG000033540.1[more]
SMESG000033540.10.000e+097.45SMESG000033540.1[more]
SMESG000033540.10.000e+096.87SMESG000033540.1[more]
SMESG000033540.10.000e+096.86SMESG000033540.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30009793 ID=SMED30009793|Name=Dach-2|organism=Schmidtea mediterranea sexual|type=transcript|length=5875bp
CCAAATTCTTAAATTTATGAAAAAAGAATTAATATTTTATATTTAGATGG
CGTTGTATGAAATGTATTCTAAGGGAGTAAAAATCTGGATTCCCGATGAA
GAGTCAGTTTGGATTGGAGCTACTGTTTTACAATTCCATAAAGAGAAAAA
TGTAATCAAAATTATCACAGATAATGGAATATCAAAAGAATTAAATTTAT
CGTCTAAAAAATGTGCGCCATTTCTAAGAAATCCAGATATTTTAATTGGA
CAAAAAGATTTAACTTATCTAAGCTATCTTAATGAACCTGAAGTGTTGTA
CAATTTGCAAATAAGATTTTGTGAACGAAGAGAAATTTATACATATTGTG
GTATAGTTTTGGTTGCAATAAATCCTTATCAAGAATTATCTATTTATGGT
AAAGAAATAATCAATGCCTATCATTCTCAGAATTCAGTTGATCTCGATCC
TCATATCTTTGCAGTAGCTGAAAACGCTTTTAGAAGAATGTCAAGTTTTG
GAGAAAACCAATCAATAATAGTGTCGGGTGAATCCGGTGCTGGCAAAACT
GTGTCTGCTAAATACACAATGCGGTATTTTGCACTTGTTGGAGGCTCAAA
GACCAAACAGTCGTTTAATCTTACCGAGACGCAAATTGAACGCAAGGTTT
TGCTGTCTAATCCAATATTAGAAGCATTCGGAAATGCTAAAACAATTAGA
AATGACAATAGTAGCAGATTTGGAAAATATTTGGAAATTTTGTTTAACCC
AAGAAATCAAGTTATTGGAGCTAATATGTGCACTTATTTGCTCGAAAAAT
CCAGAGTCGTCTTTCAGAATCTCGGAGAACGAAATTACCATATTTTCTAT
CAGATTGTTACACATTGCCAGTCAGAAGATGAATTATTGATGAATACTGG
ACTGGTGAATAATGTCGAAATGTACGACTATTTGAGATATGGTGAGTCTC
TGGAAATAGACGGCGTTGATGATTCTCACGAATTTTTGATCACTAAAAAT
TCATTTTTACAATTAGGGATTGATTTGAACAAATTTAAAACAATATGTGA
AATTTTGGCTGCTATTCTCCACCTTGGTAACATCAGATTCCGGTTCCATG
ACGCTACAGATAGTTCGATTATAGAAAATCCAGAACTACTGAAATTAATT
GCTGGCCTTTTGGGGTGTTCAATTGATCAATTGAAAATTTGGCTGTGTTT
TCGTACTATTTCAACCTTCCAAGAAACCCTTCATAAACCCTTATCAAAAG
CGGAAGCTCAATATTTTCGAGATGCTTTTGTTAAAACTTTATATTCAAAT
CTTTTCGATTGGATTGTGAAACAGGCCAACAAAGTATTATCTACTGACGT
CAGTATCAATATTAAAAAGAAGTTAAAGAAGACTATTGTTGTGAATCAGG
AAGACAAGAAAAAATTCATTGCAGTTCTCGATATTTATGGATTTGAAACT
TTTGCGGAAAACAGTTTTGAACAGTTTTGTATTAATTTTGCCAATGAAAA
GCTGCAATTGCAGTTTAATTTGCATGTTTTCAAACTCGAGCAAGAAGAAT
ACATGAATGAAGGTCTGGAGTGGACATTTATTGACTACTACAACAACCAG
CCTTGCATTGACTTGATTGAATCCAGGCTTGGTTTACTGGATCTACTTGA
TGAGGAATGCAAGCTATTGAAGGGTTCCGATGAGAATTGGTGTTGTAAAA
TTTATTCACATCATTTAAACAAGTCAGCAAATTTTAATAAACCAAAGTTA
TCCAATATGGTTTTTATCATTGAACATTTTGCTGGACCTGTTGAATATAA
ATGTGCTGGCTTCATTGAAAAAAATCGTGATTCGGTGCTTGAAGAACAAA
TCAATCTACTTAAAGCTAGTGATGTGCAATTAATTGCAGAATTATTCCGT
GACAGTGAAATAGAGATCTTCGATACAAATAATTCCAAACCTAAAGTTTC
AATAAAATCGTCCACCAAAAGTATTATGTCAATAAAACAAGAAAATACAA
GAAAAATGAAAAAGACTGTTGGTAGTCAATTTAGAAATTCCTTGAAATCC
CTAATGGATGCTCTCAATAAAACCAATCCACATTATGTGAGATGCATAAA
ACCAAATGATCTTAAATTGCCTTTTACATTTTGTCCAGAAAGAGCCGTTC
AACAGTTGAGAGCTTGTGGAGTCTTAGAAACTATTCGATTAAGTGCAGCA
GGATTTCCATCAAGATGGACTTATTCTGATTTTTATCATAGATATTACAT
TTTAATGTCTAATTTTAATGTTAAAAATCATGATTTTAAAGCAGGAAGTC
AGAAAATAGTCGAAACCTTAATTACGGTTCCAGACGCTTTTAGGTTTGGC
AATACTAAATTGTTTTTTCGACCTGGTCAAGTTGCACTTTTGGAAAAATT
AAGGGGACACAAAATAGAAAGTTCTGTCACGTTGATTCAGTCAATACTGA
GAGGTTCGATAGAAAGAAAAAAATATTTAATAATTCACAAGTTGACTGTT
CAAATTCAAACATATATTCGACGAAAATTAGCTATTGAAAAGGCTACGAA
ATTAAGTCAAATTCGAGCTGTTATCATAATCCAATCTTTTTATCGAATGT
ATTTGGCAAGAAAACTATTTGTAAAAATGAAATGCGCAGTTTTAGCTATT
GAAAAATGGCGAAGAAAGATAATAACTACTAGATTGAAGCAAGCTTATAA
AAAAGAGAATTGTGTTATAATTTGTCAGGCAATTGTACGAAGATTCATTC
AACGTAGAAAATTTTTAAAAATCCAAAGAGGTGTTATACTCATTCAAAAT
CATTATAGGCGAAGAAAAGCTAAAGAAACTTTGAAAATATTGAAGATCGA
GGCTAGATCAATAAATCACATAAAATTTGTGAATAAAGGACTGGAAAATA
AAATAATTGAATTAACTCAAAAATTAGATACAAAAGAAAAGGAAATGTGC
CTCATACAAAATCAGTTGATTAAAGAAAAGAAAATAGAAATATTAAATCT
TAAATTGAATCAAGCTGAATCTGCAAAAATATATCAAAATACAGTCCAAG
ACTTACAAACAGAAATTATTCAATTAAAAAAGGAACTAAATAGGGAGATT
GTGGAGAAGAATAAAATTTTTGCAGACAAAGAATTACTTGAAATTAACTA
TAAAAAAAAAATAAATTATTTGGAAAATTTAATAGAAGAATTGAAATCCT
CCCCATCAGTTATTGAACCAAATATCATTTGTAATGGAGATGAAGCACAG
CAATCAATCTGTCAAGACGAACATCAAAAATTCATAAATGAACAGATGGA
TCATCAAAAGCTCGTTAGGGAATATGAAAAATTGGAAATGAAATATGAAA
ACCTTTACAAAGAATTTTTGTTTGTAAAATCTTCAAACCAAAAACCTTCA
ATAAATTACGACAATCAGACTTCAAATGATTCAGAAACCGAATCAACATT
CAGTAAAGATGACGCTGATGTCGAGTCTCTGTCCGATAAAGTTGATGCGA
AAACTACCAAGGAACACGTAGTTAAATCTTCTGTAGTTGTAAAAAAGTTA
CCCAACTTTATCAGTGAAAGTATCTCCACTGCCGGAGATTTGGCTGTTGT
CATGCAGCTGCAAATGAATATCAGTAGTTTGAGTCAGGAAAATAACAGAC
TAAAAGAAACAGTGCAACAATTTGAAGATGAACTCTTGAAATATGAACAA
TGTGCGGAAGACTCTAAAGGCTTAGTTATTCACAATGAGTATGACAACGA
GTTACTTTCGATTATTAAAGATATTAAAGGAATGGATGAGCACGGATTAA
AATCAAGACTAATAGATGAAGTTGCCAATTTGAAAAAGAAATTGAAGCAG
TCAAATGAAGACTATCAGAAGTTGCGCTTGCATATATTTGATGGATCAAT
GAGTAAATTAACCGGTAATTTAGACCATGAATCCATTAATTCTGAAGAAG
AGGAATTAAAAAGGGCTTTTGAATCTCAAAAAGAAGCTAACAGAAAAATG
CTGAAAGAAATCGAAGGCATTAAAGCCAACAATGTAGATCTTAAAAAAGC
TTTGTTTCAAATAAGAAAAGATAAGGAACAATTACAAGTGCAATTAGGAA
AACAACATTTGATGATTAGACACGGTGTTGAATATCTACAAAATCTCAAA
TTGACTCCGAAAGAACGACTAGATAAATTTGTTCAAAATGAAATATCTAG
AATATTATTGGAAAACCTTAAACTCCAAGAAAGAAACGATCAAATCATTT
CAGAAACTATTGAACTTAAAAGGGGTTTGAAATATTTTGCATTTCGTTTG
CAGAAATACGAAGGTTCATTAGTTCCTAATCCAAATAAAGAAGAGGATCT
TTTACAATTGATCCAAAATGTCATCTATCATTCGAAAATGAAAACAATAG
GTAAAAGAGAATGCTATAGTGAAATCGGTCTTATAGATTTAAATATGTCG
GAATTGTCGATTTTTATAAAGAGTTTCATATTTGATTTATCTCCATCTAT
TTGCTTGCAATATGAGCCCTATCATCTTGTTCCTTATATCATTTTCATGG
TTACTAGGAAATTTGATTTCTATAAAGAGGAAGATCAAATGACAAATTTC
CTCTCAAAATTGATAGTGGCTTTGAAGAGAACAATAAGGAAAAGAAGAAA
TTACATTGAATATTTGGTGATGCTATTGTCAAATGTATTTTGTCTTGTCA
ATCTATTCCAGCAGTATAGTGGATCTCAGCAATTCAGCGGTTTGAATACT
GCTGAAGATATCCAGCATTATTTTGTCCATTATGATTTAAACGAGTTCAT
ACGACTCCTGAAGGAGTTGTGTGTGACATTATTTCAAATGATATTGAAGA
CAATTGTTGATAATTTACTACCTCAATCTCTTTGTATAGACGCAATATTA
GTTCACGAAGCAATAATAGATTTTTTAAGTAAAGATGGAACTAAATACAA
ATCTAATATCGAGACACAGCCGAAAAATACATCATTTAACGTCCTTACTA
AAAACCTACAATCTGTGCTAGAAATCCTGAAAAATCATAAAATTCCTCAA
TTGATAATTAATCAAATATTTGTGCACATTGCATATTTAATCAACGCCTA
CTGCCTCAATACATTGTTATTTAGAACTGATTTATGTTATTTTTCTAAAG
GACTTCAGATCAAATATAATTTATCGAGTTTTGAAACTTGGATTCGGTAT
CAAAAACTTATTGATTCTGGCGCCTTGCAATGCCTGCGGCCAATGACTGA
AGCAGTTCAATTATTACAGACTCTTATAGATTCAGATGAGGATGCCAAAT
TTGTATGTGATATGTGTGAATATCTCAATACAAGACAAGTTGTCAAAATC
CTCAACAACTTCAATCCTCGTGACGGTTACGGGTGCAGACTGTCAAGCGG
TTTGATTGCAAAGATAGAAACTCAAATGAAAATTAAGCGTGGAGATGAAC
CGAGTGAAAGCAAACTGGAAACGCCAACAGTAATAGAGATTCCAATCGAT
ATTCCATTTATCCACAATGGGGTATCCCTGTGCCGGACAATAATTCCAAA
GCCATTGTATTTGTCCTGTTTAACGGTGCTCAGTGAAAAAGACCTGCTGT
AGCAGTTCTTAAATACATTTGAATTTTTTTTTATTTAAAAAGTATCGATT
CGCATTCTTATTATGGGAGATTAATTTTTCTATTGTAAAATTTTTAAGCT
CCATTTATTAGAAAGAGTTTTTTGCAAAATTCCTAATTGAAAATTGTCAA
ATCAAAAATGTTATTTCATTGGGTAATGTATACAATTTTTCATTATTTGT
ATTTCACTGTTTTCTCTTCCATTTTTAATGACCATCGAGAGGGATCCTGG
ATTTTTGTTTTGGTAAGTCTGGCAA
back to top

protein sequence of SMED30009793-orf-1

>SMED30009793-orf-1 ID=SMED30009793-orf-1|Name=SMED30009793-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1852bp
MALYEMYSKGVKIWIPDEESVWIGATVLQFHKEKNVIKIITDNGISKELN
LSSKKCAPFLRNPDILIGQKDLTYLSYLNEPEVLYNLQIRFCERREIYTY
CGIVLVAINPYQELSIYGKEIINAYHSQNSVDLDPHIFAVAENAFRRMSS
FGENQSIIVSGESGAGKTVSAKYTMRYFALVGGSKTKQSFNLTETQIERK
VLLSNPILEAFGNAKTIRNDNSSRFGKYLEILFNPRNQVIGANMCTYLLE
KSRVVFQNLGERNYHIFYQIVTHCQSEDELLMNTGLVNNVEMYDYLRYGE
SLEIDGVDDSHEFLITKNSFLQLGIDLNKFKTICEILAAILHLGNIRFRF
HDATDSSIIENPELLKLIAGLLGCSIDQLKIWLCFRTISTFQETLHKPLS
KAEAQYFRDAFVKTLYSNLFDWIVKQANKVLSTDVSINIKKKLKKTIVVN
QEDKKKFIAVLDIYGFETFAENSFEQFCINFANEKLQLQFNLHVFKLEQE
EYMNEGLEWTFIDYYNNQPCIDLIESRLGLLDLLDEECKLLKGSDENWCC
KIYSHHLNKSANFNKPKLSNMVFIIEHFAGPVEYKCAGFIEKNRDSVLEE
QINLLKASDVQLIAELFRDSEIEIFDTNNSKPKVSIKSSTKSIMSIKQEN
TRKMKKTVGSQFRNSLKSLMDALNKTNPHYVRCIKPNDLKLPFTFCPERA
VQQLRACGVLETIRLSAAGFPSRWTYSDFYHRYYILMSNFNVKNHDFKAG
SQKIVETLITVPDAFRFGNTKLFFRPGQVALLEKLRGHKIESSVTLIQSI
LRGSIERKKYLIIHKLTVQIQTYIRRKLAIEKATKLSQIRAVIIIQSFYR
MYLARKLFVKMKCAVLAIEKWRRKIITTRLKQAYKKENCVIICQAIVRRF
IQRRKFLKIQRGVILIQNHYRRRKAKETLKILKIEARSINHIKFVNKGLE
NKIIELTQKLDTKEKEMCLIQNQLIKEKKIEILNLKLNQAESAKIYQNTV
QDLQTEIIQLKKELNREIVEKNKIFADKELLEINYKKKINYLENLIEELK
SSPSVIEPNIICNGDEAQQSICQDEHQKFINEQMDHQKLVREYEKLEMKY
ENLYKEFLFVKSSNQKPSINYDNQTSNDSETESTFSKDDADVESLSDKVD
AKTTKEHVVKSSVVVKKLPNFISESISTAGDLAVVMQLQMNISSLSQENN
RLKETVQQFEDELLKYEQCAEDSKGLVIHNEYDNELLSIIKDIKGMDEHG
LKSRLIDEVANLKKKLKQSNEDYQKLRLHIFDGSMSKLTGNLDHESINSE
EEELKRAFESQKEANRKMLKEIEGIKANNVDLKKALFQIRKDKEQLQVQL
GKQHLMIRHGVEYLQNLKLTPKERLDKFVQNEISRILLENLKLQERNDQI
ISETIELKRGLKYFAFRLQKYEGSLVPNPNKEEDLLQLIQNVIYHSKMKT
IGKRECYSEIGLIDLNMSELSIFIKSFIFDLSPSICLQYEPYHLVPYIIF
MVTRKFDFYKEEDQMTNFLSKLIVALKRTIRKRRNYIEYLVMLLSNVFCL
VNLFQQYSGSQQFSGLNTAEDIQHYFVHYDLNEFIRLLKELCVTLFQMIL
KTIVDNLLPQSLCIDAILVHEAIIDFLSKDGTKYKSNIETQPKNTSFNVL
TKNLQSVLEILKNHKIPQLIINQIFVHIAYLINAYCLNTLLFRTDLCYFS
KGLQIKYNLSSFETWIRYQKLIDSGALQCLRPMTEAVQLLQTLIDSDEDA
KFVCDMCEYLNTRQVVKILNNFNPRDGYGCRLSSGLIAKIETQMKIKRGD
EPSESKLETPTVIEIPIDIPFIHNGVSLCRTIIPKPLYLSCLTVLSEKDL
L*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0051015actin filament binding
GO:0003774motor activity
GO:0005524ATP binding
GO:0005515protein binding
GO:0000146microfilament motor activity
GO:0000149SNARE binding
GO:0000166nucleotide binding
GO:0003779actin binding
GO:0005516calmodulin binding
GO:0017075syntaxin-1 binding
GO:0019901protein kinase binding
GO:0043008ATP-dependent protein binding
GO:0046982protein heterodimerization activity
GO:0046983protein dimerization activity
GO:0048306calcium-dependent protein binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000418head
PLANA:0002032epidermal cell
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR036961Kinesin_motor_dom_sf
IPR001609Myosin_head_motor_dom
IPR000048IQ_motif_EF-hand-BS
IPR002710Dilute_dom
IPR027417P-loop_NTPase
Vocabulary: cellular component
TermDefinition
GO:0016459myosin complex
GO:0005737cytoplasm
GO:0008021synaptic vesicle
GO:0030141secretory granule
GO:0030424axon
GO:0030425dendrite
GO:0030529intracellular ribonucleoprotein complex
GO:0032593insulin-responsive compartment
GO:0042642actomyosin, myosin complex part
GO:0043005neuron projection
GO:0043025neuronal cell body
GO:0055037recycling endosome
Vocabulary: biological process
TermDefinition
GO:0006810transport
GO:0015031protein transport
GO:0016192vesicle-mediated transport
GO:0017157regulation of exocytosis
GO:0030048actin filament-based movement
GO:0030050vesicle transport along actin filament
GO:0032252secretory granule localization
GO:0032869cellular response to insulin stimulus
GO:0043473pigmentation
GO:0072659protein localization to plasma membrane
GO:0099640axo-dendritic protein transport
GO:1900078positive regulation of cellular response to insulin stimulus
GO:1903078positive regulation of protein localization to plasma membrane
GO:1904754positive regulation of vascular associated smooth muscle cell migration
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 1009..1036
NoneNo IPR availableCOILSCoilCoilcoord: 942..976
NoneNo IPR availableCOILSCoilCoilcoord: 843..863
NoneNo IPR availableCOILSCoilCoilcoord: 1054..1092
NoneNo IPR availableCOILSCoilCoilcoord: 703..723
NoneNo IPR availableCOILSCoilCoilcoord: 750..777
NoneNo IPR availableGENE3DG3DSA:1.10.10.820coord: 14..82
e-value: 3.2E-141
score: 473.7
NoneNo IPR availableGENE3DG3DSA:3.30.70.3240coord: 476..545
e-value: 1.1E-20
score: 75.6
NoneNo IPR availableGENE3DG3DSA:1.20.58.530coord: 223..432
e-value: 3.2E-141
score: 473.7
NoneNo IPR availableGENE3DG3DSA:1.20.120.720coord: 83..189
e-value: 3.2E-141
score: 473.7
NoneNo IPR availableGENE3DG3DSA:1.20.5.190coord: 598..642
e-value: 4.3E-5
score: 25.1
coord: 643..694
e-value: 1.5E-5
score: 26.5
coord: 546..597
e-value: 8.0E-7
score: 30.6
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 876..906
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 889..906
NoneNo IPR availablePANTHERPTHR13140MYOSINcoord: 1..884
coord: 1121..1556
NoneNo IPR availablePANTHERPTHR13140:SF356UNCONVENTIONAL MYOSIN-VBcoord: 1..884
coord: 1121..1556
IPR001609Myosin head, motor domainPRINTSPR00193MYOSINHEAVYcoord: 267..295
score: 36.66
coord: 214..242
score: 71.74
IPR001609Myosin head, motor domainSMARTSM00242MYSc_2acoord: 1..545
e-value: 1.6E-149
score: 512.8
IPR001609Myosin head, motor domainPFAMPF00063Myosin_headcoord: 3..532
e-value: 5.0E-162
score: 540.6
IPR001609Myosin head, motor domainPROSITEPS51456MYOSIN_MOTORcoord: 1..544
score: 167.002
IPR002710Dilute domainSMARTSM01132DIL_2coord: 1430..1535
e-value: 2.5E-29
score: 113.5
IPR002710Dilute domainPFAMPF01843DILcoord: 1430..1532
e-value: 2.6E-21
score: 75.9
IPR002710Dilute domainPROSITEPS51126DILUTEcoord: 1277..1553
score: 35.134
IPR000048IQ motif, EF-hand binding siteSMARTSM00015iq_5coord: 569..591
e-value: 210.0
score: 2.8
coord: 642..664
e-value: 0.056
score: 22.6
coord: 546..568
e-value: 0.38
score: 19.8
coord: 665..687
e-value: 16.0
score: 12.1
coord: 594..616
e-value: 3.4E-4
score: 30.0
IPR000048IQ motif, EF-hand binding sitePFAMPF00612IQcoord: 597..615
e-value: 1.3E-5
score: 24.6
coord: 645..663
e-value: 0.14
score: 12.0
IPR000048IQ motif, EF-hand binding sitePROSITEPS50096IQcoord: 547..576
score: 6.925
IPR000048IQ motif, EF-hand binding sitePROSITEPS50096IQcoord: 595..624
score: 7.986
IPR036961Kinesin motor domain superfamilyGENE3DG3DSA:3.40.850.10coord: 3..471
e-value: 3.2E-141
score: 473.7
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 2..625