Copper-transporting ATPase 1

Overview
NameCopper-transporting ATPase 1
Smed IDSMED30009791
Length (bp)4394
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Copper-transporting ATPase 1 (SMED30009791) t-SNE clustered cells

Violin plots show distribution of expression levels for Copper-transporting ATPase 1 (SMED30009791) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Copper-transporting ATPase 1 (SMED30009791) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Copper-transporting ATPase 1 (SMED30009791) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30009791

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymal cellSMED30009791h1SMcG0010691 dd_Smed_v4_7126_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Copper-transporting ATPase 1 vs. Ensembl Human
Match: ATP7B (ATPase copper transporting beta [Source:HGNC Symbol;Acc:HGNC:870])

HSP 1 Score: 902.508 bits (2331), Expect = 0.000e+0
Identity = 583/1357 (42.96%), Postives = 805/1357 (59.32%), Query Frame = 1
Query:  109 RMKVDGMTCMSCVRNIEENLMKFTGVCGIMVSLLHAEATVIFDADIATVEDISNKIDEMGFDVTVKSSEVSNVKDKVVRSRIKFESDINKSVEKSIETSLSSKLLLVRFCQENNYADIWHYSSIRSTEILSVIQQSEIYGVLVLEQCPTIRVIVRVNGMTCQSCVDNIESTVGKKQGIISIKVFLEKSEAHALVDASLAGP-DVEEMINDMGFNSEMILEIFNDSCAGKPNN----VSQKYEELKSNTIYPILSTTIV-IKALKSIFCIFKIENHMRALPGVDKCSVNLIEEIGMIDYDSGKWNVQKIREEIESLGY----------------------------------------LTELPKQNWNSTRQSSAVSLNEESRSKCYLRITGMTCSSCVNKVESHLLKVEGVKSVLVALLAMKCEIIYDSAYVMPFQLSNRVKELGFNAEVIENGNEGIGIVNVLIRGMTCSSCVNHIENHISKIKGIASINVSLSTSKGKVEYFISECGPRDVIDAINDMGFDASLCDHLESNHAAADHINQMIKQWRSSFFFSLICGIPXXXXXXXXXXXXXXXXHTIIHENGSNRTIM--KSTVPMVCSGLSADNLILFVLATPVQFYGARYFYIQAYLSLKHKTTNMDVLVVMATXXXXXXXXXXXXXXMAFRRNTSPKTFFETSPMLIVFLSLGRWLEHIAKGKTSEALTKLMSLQAVEATLYT--PEN---KERKIPINLVQRNDLIKILPGEKIPVDGKVVTGTSTCDESLITGESMPIEKTHGSDVIGGSINKSGMLIVKATHVGSDSALAQIVKLVEEAQTSKAPIQQLADRIAGMFVPSVLICAIITLIIWVIVGFSKPEILPKYV----NELSVTEITWEHAFQLAITVLSIACPCSLGLXXXXXXXXXXXXXXXNGILIKGGEPLENIHKLNVIVFDKTGTITNGSPSVTRFLVLIGNGVREHIDKLLKILAAAESASEHPIGKAIITFSKARISNENLPEVLESSAVSGCGLGCKLNLDPKTEVTKFVKNLINIESPSEETNILGQXXXXXXXXXXXXTYKDVIFPVRQHMAWTSDLCQTVTVIIGNRNWMLRNGILVDDEVDELMSEDENLGRTVILMAIDNELIAMISVADQVKREAALAVYTLKKMNIEVYLMTGDNSKTATAIARQVGIHYVFAEVLPSHKVAKVQQLQNTNRSLTSKRKMKVAMVGDGINDSPALAQSDVGIAIGTGTDVAVEAADVVLIRNSLLDVIAAIQLSKATVKRIRQNFIAATLYNLLGIPIAAGVLMPIGIEMMPWMXXXXXXXXXXXXXXXXXXXXXWKKPSEEKLITPEYINFIQSSGLSESQIIVRRGID 4008
            +++V+GMTC SCV +IE  + K  GV  + VSL + EA + +   +   ED+ + +++MGF+  +KS        KV    +    DI +    + +  LSS          NN   + H  S                 V+ L+        +R++GM C+SCV NIE  +G+  G+ SI+V LE   A    D S   P  ++  I  +   +  +     D   G   +     S        N +    STT++ I  +    C+  IE  +  L GV + SV+L E    + Y+    + +++R  IE +G+                                           LP  +       S  S    +  KC+L+I GMTC+SCV+ +E +L K  GV SVLVAL+A K EI YD   + P +++  +++LGF A V+E+     G + + I GMTC+SCV++IE+ +++  GI   +V+L+TSK  V++     GPRD+I  I ++GF ASL     + H   DH    IKQW+ SF  SL+ GIP M +M+          + +I  N  +++++   + +P    GLS  NLI F+L T VQ  G  YFY+QAY SL+H++ NMDVL+V+ATSI+Y+YS++++V+++A +   SP TFF+T PML VF++LGRWLEH+AK KTSEAL KLMSLQA EAT+ T   +N   +E ++P+ LVQR D++K++PG K PVDGKV+ G +  DESLITGE+MP+ K  GS VI GSIN  G +++KATHVG+D+ LAQIVKLVEEAQ SKAPIQQLADR +G FVP ++I + +TL++W+++GF    ++ +Y       +S TE+    AFQ +ITVL IACPCSLGLATPTAVMVGTGV A NGILIKGG+PLE  HK+  ++FDKTGTIT+G P V R L L+G+     + K+L ++  AE++SEHP+G A+  + K  +  E L    +  AV GCG+GCK            V N+  I + SE    L    +           KD +              QT +V+IGNR W+ RNG+ +  +V + M++ E  G+T IL+AID  L  MI++AD VK+EAALAV+TL+ M ++V L+TGDN KTA AIA QVGI+ VFAEVLPSHKVAKVQ+LQN  +        KVAMVGDG+NDSPALAQ+D+G+AIGTGTDVA+EAADVVLIRN LLDV+A+I LSK TV+RIR N + A +YNL+GIPIAAGV MPIGI + PWM SAAMAASSVSVV  SL LK +KKP  E+    E         L+ SQ+ V  G+D
Sbjct:  146 KLRVEGMTCQSCVSSIEGKVRKLQGVVRVKVSLSNQEAVITYQPYLIQPEDLRDHVNDMGFEAAIKS--------KVAPLSLG-PIDIERLQSTNPKRPLSSA-----NQNFNNSETLGHQGS----------------HVVTLQ--------LRIDGMHCKSCVLNIEENIGQLLGVQSIQVSLENKTAQVKYDPSCTSPVALQRAIEALPPGNFKVS--LPDGAEGSGTDHRSSSSHSPGSPPRNQVQGTCSTTLIAIAGMTCASCVHSIEGMISQLEGVQQISVSLAEGTATVLYNPSVISPEELRAAIEDMGFEASVVSESCSTNPLGNHSAGNSMVQTTDGTPTSVQEVAPHTGRLPANHAPDILAKSPQSTRAVAPQKCFLQIKGMTCASCVSNIERNLQKEAGVLSVLVALMAGKAEIKYDPEVIQPLEIAQFIQDLGFEAAVMEDYAGSDGNIELTITGMTCASCVHNIESKLTRTNGITYASVALATSKALVKFDPEIIGPRDIIKIIEEIGFHASLAQRNPNAHHL-DH-KMEIKQWKKSFLCSLVFGIPVMALMI----------YMLIPSNEPHQSMVLDHNIIP----GLSILNLIFFILCTFVQLLGGWYFYVQAYKSLRHRSANMDVLIVLATSIAYVYSLVILVVAVAEKAERSPVTFFDTPPMLFVFIALGRWLEHLAKSKTSEALAKLMSLQATEATVVTLGEDNLIIREEQVPMELVQRGDIVKVVPGGKFPVDGKVLEGNTMADESLITGEAMPVTKKPGSTVIAGSINAHGSVLIKATHVGNDTTLAQIVKLVEEAQMSKAPIQQLADRFSGYFVPFIIIMSTLTLVVWIVIGFIDFGVVQRYFPNPNKHISQTEVIIRFAFQTSITVLCIACPCSLGLATPTAVMVGTGVAAQNGILIKGGKPLEMAHKIKTVMFDKTGTITHGVPRVMRVL-LLGDVATLPLRKVLAVVGTAEASSEHPLGVAVTKYCKEELGTETLGYCTDFQAVPGCGIGCK------------VSNVEGILAHSERP--LSAPASHLNEAGSLPAEKDAV-------------PQTFSVLIGNREWLRRNGLTISSDVSDAMTDHEMKGQTAILVAIDGVLCGMIAIADAVKQEAALAVHTLQSMGVDVVLITGDNRKTARAIATQVGINKVFAEVLPSHKVAKVQELQNKGK--------KVAMVGDGVNDSPALAQADMGVAIGTGTDVAIEAADVVLIRNDLLDVVASIHLSKRTVRRIRINLVLALIYNLVGIPIAAGVFMPIGIVLQPWMGSAAMAASSVSVVLSSLQLKCYKKPDLERY---EAQAHGHMKPLTASQVSVHIGMD 1407          

HSP 2 Score: 124.02 bits (310), Expect = 1.245e-27
Identity = 106/392 (27.04%), Postives = 172/392 (43.88%), Query Frame = 1
Query:  568 VRVNGMTCQSCVDNIESTVGKKQGIISIKVFLEKSEAHA-LVDASLAGPDVEEMINDMGFNSEMILEIFNDSCAGKPNNVSQKYEELKSNTIYPILSTTIVIKALKSIFCIFKIENHMRALPGVDKCSVNLIEEIGMIDYDSGKWNVQKIREEIESLGYLTEL---------------------PKQNWNSTRQS--SAVSLNEESRS--KCYLRITGMTCSSCVNKVESHLLKVEGVKSVLVALLAMKCEIIYDSAYVMPFQLSNRVKEL--GFNAEVIENGNEGIGIVN------------------------VLIRGMTCSSCVNHIENHISKIKGIASINVSLSTSKGKVEYFISECGPRDVIDAINDMGFDASLCDHLESNHAAADH 1587
            VR+ GMTCQSCV +IE  +   +GIIS+KV LE+  A    V + +    V   I DMGF +     I     A  P+      E +            + ++ +    C+  IE  +R L GV +  V+L  +  +I Y       + +R+ +  +G+   +                     PK+  +S  Q+  ++ +L  +        LRI GM C SCV  +E ++ ++ GV+S+ V+L     ++ YD +   P  L   ++ L  G     + +G EG G  +                        + I GMTC+SCV+ IE  IS+++G+  I+VSL+     V Y  S   P ++  AI DMGF+AS+     S +   +H
Sbjct:   62 VRILGMTCQSCVKSIEDRISNLKGIISMKVSLEQGSATVKYVPSVVCLQQVCHQIGDMGFEAS----IAEGKAASWPSRSLPAQEAV----------VKLRVEGMTCQSCVSSIEGKVRKLQGVVRVKVSLSNQEAVITYQPYLIQPEDLRDHVNDMGFEAAIKSKVAPLSLGPIDIERLQSTNPKRPLSSANQNFNNSETLGHQGSHVVTLQLRIDGMHCKSCVLNIEENIGQLLGVQSIQVSLENKTAQVKYDPSCTSPVALQRAIEALPPGNFKVSLPDGAEGSGTDHRSSSSHSPGSPPRNQVQGTCSTTLIAIAGMTCASCVHSIEGMISQLEGVQQISVSLAEGTATVLYNPSVISPEELRAAIEDMGFEASVVSESCSTNPLGNH 439          

HSP 3 Score: 120.939 bits (302), Expect = 1.175e-26
Identity = 102/431 (23.67%), Postives = 183/431 (42.46%), Query Frame = 1
Query:  562 VIVRVNGMTCQSCVDNIESTVGKKQGIISIKVFLEKSEAHALVDASLAGP-DVEEMINDMGFNSEMI------------LEIFNDSCAGKP-NNVSQKY--EELKSNTIYPILSTTIVIKALKSIFCIFKIENHMRALPGVDKCSVNLIEEIGMIDYDSGKWNVQKIREEIESLGYLTELPKQNWNSTRQSSAVSLNEESR-------------------SKCYLRITGMTCSSCVNKVESHLLKVEGVKSVLVALLAMKCEIIYDSAYVMPFQLSNRVKELGFNAEVIEN-------GNEGIGIVNVLIR------------------------------------------------GMTCSSCVNHIENHISKIKGIASINVSLSTSKGKVEYFISECGPRDVIDAINDMGFDASLCDHLESNHAAAD 1584
            V +RV GMTCQSCV +IE  V K QG++ +KV L   EA       L  P D+ + +NDMGF + +             +E    +   +P ++ +Q +   E   +    +++  + I  +    C+  IE ++  L GV    V+L  +   + YD    +   ++  IE+      LP  N+  +    A     + R                   S   + I GMTC+SCV+ +E  + ++EGV+ + V+L      ++Y+ + + P +L   ++++GF A V+         GN   G  N +++                                                GMTC+SCV++IE ++ K  G+ S+ V+L   K +++Y      P ++   I D+GF+A++ +    ++A +D
Sbjct:  145 VKLRVEGMTCQSCVSSIEGKVRKLQGVVRVKVSLSNQEAVITYQPYLIQPEDLRDHVNDMGFEAAIKSKVAPLSLGPIDIERLQSTNPKRPLSSANQNFNNSETLGHQGSHVVTLQLRIDGMHCKSCVLNIEENIGQLLGVQSIQVSLENKTAQVKYDPSCTSPVALQRAIEA------LPPGNFKVSLPDGAEGSGTDHRSSSSHSPGSPPRNQVQGTCSTTLIAIAGMTCASCVHSIEGMISQLEGVQQISVSLAEGTATVLYNPSVISPEELRAAIEDMGFEASVVSESCSTNPLGNHSAG--NSMVQTTDGTPTSVQEVAPHTGRLPANHAPDILAKSPQSTRAVAPQKCFLQIKGMTCASCVSNIERNLQKEAGVLSVLVALMAGKAEIKYDPEVIQPLEIAQFIQDLGFEAAVME----DYAGSD 563          

HSP 4 Score: 52.373 bits (124), Expect = 9.111e-6
Identity = 26/68 (38.24%), Postives = 39/68 (57.35%), Query Frame = 1
Query:  100 GSARMKVDGMTCMSCVRNIEENLMKFTGVCGIMVSLLHAEATVIFDADIATVEDISNKIDEMGFDVTV 303
            G+  + + GMTC SCV NIE  L +  G+    V+L  ++A V FD +I    DI   I+E+GF  ++
Sbjct:  564 GNIELTITGMTCASCVHNIESKLTRTNGITYASVALATSKALVKFDPEIIGPRDIIKIIEEIGFHASL 631          
BLAST of Copper-transporting ATPase 1 vs. Ensembl Human
Match: ATP7A (ATPase copper transporting alpha [Source:HGNC Symbol;Acc:HGNC:869])

HSP 1 Score: 898.656 bits (2321), Expect = 0.000e+0
Identity = 558/1185 (47.09%), Postives = 761/1185 (64.22%), Query Frame = 1
Query:  574 VNGMTCQSCVDNIESTVGKKQGIISIKVFLEKSEAHALVDASLAGPDVEEMINDMGFNSEMILEIFNDSCAGKPNNVSQKYEELKSNTI-YPILSTTIV-IKALKSIFCIFKIENHMRALPGVDKCSVNLIEEIGMIDYDSGKWNVQKIREEIESLGY-----------------LTELP---KQNWNSTRQSSAVSLNEESR--SKCYLRITGMTCSSCVNKVESHLLKVEGVKSVLVALLAMKCEIIYDSAYVMPFQLSNRVKELGFNAEVIENGNEGIGIVNVLIRGMTCSSCVNHIENHISKIKGIASINVSLSTSKGKVEYFISECGPRDVIDAINDMGFDASLCDHLESNHAAADHINQMIKQWRSSFFFSLICGIPXXXXXXXXXXXXXXXXHTIIHENGSNRTIMKSTVPM-----VCSGLSADNLILFVLATPVQFYGARYFYIQAYLSLKHKTTNMDVLVVMATXXXXXXXXXXXXXXMAFRRNTSPKTFFETSPMLIVFLSLGRWLEHIAKGKTSEALTKLMSLQAVEATLYTPEN-----KERKIPINLVQRNDLIKILPGEKIPVDGKVVTGTSTCDESLITGESMPIEKTHGSDVIGGSINKSGMLIVKATHVGSDSALAQIVKLVEEAQTSKAPIQQLADRIAGMFVPSVLICAIITLIIWVIVGFSKPEI----LPKYVNELSVTEITWEHAFQLAITVLSIACPCSLGLXXXXXXXXXXXXXXXNGILIKGGEPLENIHKLNVIVFDKTGTITNGSPSVTRFLVLI-GNGVREHIDKLLKILAAAESASEHPIGKAIITFSKARISNENLPEVLESSAVSGCGLGCKLNLDPKTEVTKFV-KNLINIESPSEETNILGQXXXXXXXXXXXXTYKDVIFPVRQHMAWTSDLCQTVTVIIGNRNWMLRNGILVDDEVDELMSEDENLGRTVILMAIDNELIAMISVADQVKREAALAVYTLKKMNIEVYLMTGDNSKTATAIARQVGIHYVFAEVLPSHKVAKVQQLQNTNRSLTSKRKMKVAMVGDGINDSPALAQSDVGIAIGTGTDVAVEAADVVLIRNSLLDVIAAIQLSKATVKRIRQNFIAATLYNLLGIPIAAGVLMPIGIEMMPWMXXXXXXXXXXXXXXXXXXXXXWKKPSEEKLITPEYINFIQSSGLSESQIIVRRGID 4008
            ++GM C+SCV NIEST+   Q + SI V LE   A    +AS   P+      +        + I ++  +   +  S   +++  N +  P+   T++ I  +    C+  IE  +   PGV    V+L    G ++YD    + + +R  IE +G+                  +E+P     N   T+  + V   EE +  SKCY+++TGMTC+SCV  +E +L + EG+ S+LVAL+A K E+ Y+ A + P  ++  ++ELGF A VIEN +EG G++ +++RGMTC+SCV+ IE+ ++K +GI   +V+L+T+K  ++Y     GPRD+I  I  +GF+ASL    + + +  DH  + I+QWR SF  SL   IP M +M++ M           ++N S   ++     M     +  GLS  NL+ F+L  PVQF+G  YFYIQAY +LKHKT NMDVL+V+AT+I++ YS+I+++++M  R   +P TFF+T PML VF++LGRWLEHIAKGKTSEAL KL+SLQA EAT+ T ++      E ++ + LVQR D+IK++PG K PVDG+V+ G S  DESLITGE+MP+ K  GS VI GSIN++G L++ ATHVG+D+ L+QIVKLVEEAQTSKAPIQQ AD+++G FVP ++  +I TL++W+++GF   EI     P Y   +S TE     AFQ +ITVL IACPCSLGLATPTAVMVGTGVGA NGILIKGGEPLE  HK+ V+VFDKTGTIT+G+P V +  VL   N +  H  K+L I+  AES SEHP+G AI  + K  +  E L   ++   V GCG+ CK+     T +   + KN  NIE  + +   L Q    N       +   +I   +   A  +   Q   V+IGNR WM+RNG++++++V++ M+E E  GRT +L+A+D+EL  +I++AD VK EA LA++ LK M +EV LMTGDNSKTA +IA QVGI  VFAEVLPSHKVAKV+QLQ   +        +VAMVGDGINDSPALA ++VGIAIGTGTDVA+EAADVVLIRN LLDV+A+I LS+ TVKRIR NF+ A +YNL+GIPIAAGV MPIG+ + PWM SAAMAASSVSVV  SL LKL++KP+ E    P      Q    S S+I V  GID
Sbjct:  283 IDGMHCKSCVSNIESTLSALQYVSSIVVSLENRSAIVKYNASSVTPESLRKAIEAVSPGLYRVSITSEVESTSNSPSSSSLQKIPLNVVSQPLTQETVINIDGMTCNSCVQSIEGVISKKPGVKSIRVSLANSNGTVEYDPLLTSPETLRGAIEDMGFDATLSDTNEPLVVIAQPSSEMPLLTSTNEFYTKGMTPVQDKEEGKNSSKCYIQVTGMTCASCVANIERNLRREEGIYSILVALMAGKAEVRYNPAVIQPPMIAEFIRELGFGATVIENADEGDGVLELVVRGMTCASCVHKIESSLTKHRGILYCSVALATNKAHIKYDPEIIGPRDIIHTIESLGFEASLVKK-DRSASHLDH-KREIRQWRRSFLVSLFFCIPVMGLMIYMMVMDHHFATLHHNQNMSKEEMINLHSSMFLERQILPGLSVMNLLSFLLCVPVQFFGGWYFYIQAYKALKHKTANMDVLIVLATTIAFAYSLIILLVAMYERAKVNPITFFDTPPMLFVFIALGRWLEHIAKGKTSEALAKLISLQATEATIVTLDSDNILLSEEQVDVELVQRGDIIKVVPGGKFPVDGRVIEGHSMVDESLITGEAMPVAKKPGSTVIAGSINQNGSLLICATHVGADTTLSQIVKLVEEAQTSKAPIQQFADKLSGYFVPFIVFVSIATLLVWIVIGFLNFEIVETYFPGYNRSISRTETIIRFAFQASITVLCIACPCSLGLATPTAVMVGTGVGAQNGILIKGGEPLEMAHKVKVVVFDKTGTITHGTPVVNQVKVLTESNRISHH--KILAIVGTAESNSEHPLGTAITKYCKQELDTETLGTCIDFQVVPGCGISCKV-----TNIEGLLHKNNWNIEDNNIKNASLVQIDASNEQSSTSSS---MIIDAQISNALNA---QQYKVLIGNREWMIRNGLVINNDVNDFMTEHERKGRTAVLVAVDDELCGLIAIADTVKPEAELAIHILKSMGLEVVLMTGDNSKTARSIASQVGITKVFAEVLPSHKVAKVKQLQEEGK--------RVAMVGDGINDSPALAMANVGIAIGTGTDVAIEAADVVLIRNDLLDVVASIDLSRKTVKRIRINFVFALIYNLVGIPIAAGVFMPIGLVLQPWMGSAAMAASSVSVVLSSLFLKLYRKPTYESYELPARSQIGQK---SPSEISVHVGID 1441          

HSP 2 Score: 139.043 bits (349), Expect = 3.598e-32
Identity = 146/576 (25.35%), Postives = 249/576 (43.23%), Query Frame = 1
Query:   91 MKLGSARMKVDGMTCMSCVRNIEENLMKFTGVCGIMVSLLHAEATVIFDADIATVEDISNKIDEMGFDVTVKSSE----VSNVKDKVVRSRIKFESDINKSVEKSIETSLSSKLLLVRFCQENNYADIWHYSSIRS---TEILSVIQQSEI----------YGVL----------VLEQCPTIRVIVRVNGMTCQSCVDNIESTVGKKQGIISIKVFLEKSEAHALVDASLAGPDVEEM---INDMGFNSEM--------ILEIFNDSCAGKPNNVSQKYEELKSNTIYPILSTTIVIKALKSIFCIFKIENHMRALPGVDKCSVNLIEEIGMIDYDSGKWNVQKIREEIESLG---YLTELPKQ-----NWNSTRQSSAVSLNEESR---SKCYLRITGMTCSSCVNKVESHLLKVEGVKSVLVALLAMKCEIIYDSAYVMPFQLSNRVKELGFNAEVIENGNEGIGIVN------------------------------------VLIRGMTCSSCVNHIENHISKIKGIASINVSLSTSKGKVEYFISECGPRDVIDAINDMGFDASLCDHLE 1563
            M + S  + V+GMTC SCV  IE+ + K  GV  I VSL    AT+I+D  + T + +   ID+MGFD  + + +    +++     V + +    D            + S LL     +     DI  Y   R+   T I S++  ++I           G L           + Q   + + ++V GMTC SC   IE  +GK QG+  IKV L+  EA  +    L    VEEM   I  MGF + +        +  I  +     P   S+  ++ +S +     + T +I  +    C+  IE+ + AL  V    V+L     ++ Y++     + +R+ IE++    Y   +  +     N  S+     + LN  S+    +  + I GMTC+SCV  +E  + K  GVKS+ V+L      + YD     P  L   ++++GF+A  + + NE + ++                                     + + GMTC+SCV +IE ++ + +GI SI V+L   K +V Y  +   P  + + I ++GF A++ ++ +
Sbjct:    5 MGVNSVTISVEGMTCNSCVWTIEQQIGKVNGVHHIKVSLEEKNATIIYDPKLQTPKTLQEAIDDMGFDAVIHNPDPLPVLTDTLFLTVTASLTLPWD-----------HIQSTLL-----KTKGVTDIKIYPQKRTVAVTIIPSIVNANQIKELVPELSLDTGTLEKKSGACEDHSMAQAGEVVLKMKVEGMTCHSCTSTIEGKIGKLQGVQRIKVSLDNQEATIVYQPHLI--SVEEMKKQIEAMGFPAFVKKQPKYLKLGAIDVERLKNTPVKSSEGSQQ-RSPSYTNDSTATFIIDGMHCKSCVSNIESTLSALQYVSSIVVSLENRSAIVKYNASSVTPESLRKAIEAVSPGLYRVSITSEVESTSNSPSSSSLQKIPLNVVSQPLTQETVINIDGMTCNSCVQSIEGVISKKPGVKSIRVSLANSNGTVEYDPLLTSPETLRGAIEDMGFDA-TLSDTNEPLVVIAQPSSEMPLLTSTNEFYTKGMTPVQDKEEGKNSSKCYIQVTGMTCASCVANIERNLRREEGIYSILVALMAGKAEVRYNPAVIQPPMIAEFIRELGFGATVIENAD 560          

HSP 3 Score: 127.487 bits (319), Expect = 1.020e-28
Identity = 126/478 (26.36%), Postives = 203/478 (42.47%), Query Frame = 1
Query:  109 RMKVDGMTCMSCVRNIEENLMKFTGVCGIMVSLLHAEATVIFDADIATVEDISNKIDEMGFDVTVKSS---------EVSNVKDKVVRS----RIKFESDINKSVE---------KSIETSLSSKLLLVRFCQ------ENNYADI-WHYSSIRSTEILSVIQ--QSEIYGVLV---------------LEQCP--------TIRVIVRVNGMTCQSCVDNIESTVGKKQGIISIKVFLEKSEAHALVDASLAGPD-VEEMINDMGFN-----------------SEMILEIFNDSCAGKPNNVSQKYEELKSNTIYPILSTTIVIKALKSIFCIFKIENHMRALPGVDKCSVNLIEEIGMIDYDSGKWNVQKIREEIESLGYLTELPKQNWNSTRQSSAVSLNEESRSKCYLRITGMTCSSCVNKVESHLLKVEGVKSVLVALLAMKCEIIYDSAYVMPFQLSNRVKELGFNAEVIE 1326
            +MKV+GMTC SC   IE  + K  GV  I VSL + EAT+++   + +VE++  +I+ MGF   VK           +V  +K+  V+S    + +  S  N S           KS  +++ S L  +++        EN  A + ++ SS+    +   I+     +Y V +               L++ P        T   ++ ++GMTC SCV +IE  + KK G+ SI+V L  S      D  L  P+ +   I DMGF+                 SEM L    +    K     Q  EE K+++        I +  +    C+  IE ++R   G+    V L+     + Y+        I E I  LG+              ++ +   +E      L + GMTC+SCV+K+ES L K  G+    VAL   K  I YD   + P  + + ++ LGF A +++
Sbjct:  174 KMKVEGMTCHSCTSTIEGKIGKLQGVQRIKVSLDNQEATIVYQPHLISVEEMKKQIEAMGFPAFVKKQPKYLKLGAIDVERLKNTPVKSSEGSQQRSPSYTNDSTATFIIDGMHCKSCVSNIESTLSALQYVSSIVVSLENRSAIVKYNASSVTPESLRKAIEAVSPGLYRVSITSEVESTSNSPSSSSLQKIPLNVVSQPLTQETVINIDGMTCNSCVQSIEGVISKKPGVKSIRVSLANSNGTVEYDPLLTSPETLRGAIEDMGFDATLSDTNEPLVVIAQPSSEMPLLTSTNEFYTKGMTPVQDKEEGKNSS-----KCYIQVTGMTCASCVANIERNLRREEGIYSILVALMAGKAEVRYNPAVIQPPMIAEFIRELGF-------------GATVIENADEGDGVLELVVRGMTCASCVHKIESSLTKHRGILYCSVALATNKAHIKYDPEIIGPRDIIHTIESLGFEASLVK 633          
BLAST of Copper-transporting ATPase 1 vs. Ensembl Human
Match: ATP7B (ATPase copper transporting beta [Source:HGNC Symbol;Acc:HGNC:870])

HSP 1 Score: 875.93 bits (2262), Expect = 0.000e+0
Identity = 552/1213 (45.51%), Postives = 751/1213 (61.91%), Query Frame = 1
Query:  562 VIVRVNGMTCQSCVDNIESTVGKKQGIISIKVFLEKSEAHALVDASLAGP-DVEEMINDMGFNSEMILEIFNDSCAGKPNNVSQKYEELKS-NTIYPILST--------TIVIKALKSIFCIFKIENH---MRALPGVDKCSVNLIEEIGMIDYDSGKWNVQKIREEIESLGY----------------------------------------LTELPKQNWNSTRQSSAVSLNEESRSKCYLRITGMTCSSCVNKVESHLLKVEGVKSVLVALLAMKCEIIYDSAYVMPFQLSNRVKELGFNAEVIENGNEGIGIVNVLIRGMTCSSCVNHIENHISKIKGIASINVSLSTSKGKVEYFISECGPRDVIDAINDMGFDASLCDHLESNHAAADHINQMIKQWRSSFFFSLICGIPXXXXXXXXXXXXXXXXHTIIHENGSNRTIM--KSTVPMVCSGLSADNLILFVLATPVQFYGARYFYIQAYLSLKHKTTNMDVLVVMATXXXXXXXXXXXXXXMAFRRNTSPKTFFETSPMLIVFLSLGRWLEHIAKGKTSEALTKLMSLQAVEATLYT--PEN---KERKIPINLVQRNDLIKILPGEKIPVDGKVVTGTSTCDESLITGESMPIEKTHGSDVIGGSINKSGMLIVKATHVGSDSALAQIVKLVEEAQTSKAPIQQLADRIAGMFVPSVLICAIITLIIWVIVGFSKPEILPKYV----NELSVTEITWEHAFQLAITVLSIACPCSLGLXXXXXXXXXXXXXXXNGILIKGGEPLENIHKLNVIVFDKTGTITNGSPSVTRFLVLIGNGVREHIDKLLKILAAAESASEHPIGKAIITFSKARISNENLPEVLESSAVSGCGLGCKLNLDPKTEVTKFVKNLINIESPSEETNILGQXXXXXXXXXXXXTYKDVIFPVRQHMAWTSDLCQTVTVIIGNRNWMLRNGILVDDEVDELMSEDENLGRTVILMAIDNELIAMISVADQVKREAALAVYTLKKMNIEVYLMTGDNSKTATAIARQVGIHYVFAEVLPSHKVAKVQQLQNTNRSLTSKRKMKVAMVGDGINDSPALAQSDVGIAIGTGTDVAVEAADVVLIRNSLLDVIAAIQLSKATVKRIRQNFIAATLYNLLGIPIAAGVLMPIGIEMMPWMXXXXXXXXXXXXXXXXXXXXXWKKPSEEKLITPEYINFIQSSGLSESQIIVRRGID 4008
            V +RV GMTCQSCV +IE  V K QG++ +KV L   EA       L  P D+ + +NDMGF + +  ++   S    P ++    E L+S N   P+ S         T+  +    +    +I+     +  L GV + SV+L E    + Y+    + +++R  IE +G+                                           LP  +       S  S    +  KC+L+I GMTC+SCV+ +E +L K  GV SVLVAL+A K EI YD   + P +++  +++LGF A V+E+     G + + I GMTC+SCV++IE+ +++  GI   +V+L+TSK  V++     GPRD+I  I ++GF ASL     + H   DH    IKQW+ SF  SL+ GIP M +M+          + +I  N  +++++   + +P    GLS  NLI F+L T VQ  G  YFY+QAY SL+H++ NMDVL+V+ATSI+Y+YS++++V+++A +   SP TFF+T PML VF++LGRWLEH+AK KTSEAL KLMSLQA EAT+ T   +N   +E ++P+ LVQR D++K++PG K PVDGKV+ G +  DESLITGE+MP+ K  GS VI GSIN  G +++KATHVG+D+ LAQIVKLVEEAQ SKAPIQQLADR +G FVP ++I + +TL++W+++GF    ++ +Y       +S TE+    AFQ +ITVL IACPCSLGLATPTAVMVGTGV A NGILIKGG+PLE  HK+  ++FDKTGTIT+G P V R L L+G+     + K+L ++  AE++SEHP+G A+  + K  +  E L    +  AV GCG+GCK            V N+  I + SE    L    +           KD +              QT +V+IGNR W+ RNG+ +  +V + M++ E  G+T IL+AID  L  MI++AD VK+EAALAV+TL+ M ++V L+TGDN KTA AIA QVGI+ VFAEVLPSHKVAKVQ+LQN  +        KVAMVGDG+NDSPALAQ+D+G+AIGTGTDVA+EAADVVLIRN LLDV+A+I LSK TV+RIR N + A +YNL+GIPIAAGV MPIGI + PWM SAAMAASSVSVV  SL LK +KKP  E+    E         L+ SQ+ V  G+D
Sbjct:  145 VKLRVEGMTCQSCVSSIEGKVRKLQGVVRVKVSLSNQEAVITYQPYLIQPEDLRDHVNDMGFEAAIKSKVAPLSLG--PIDI----ERLQSTNPKRPLSSANQNFNNSETLGHQGSHVVTLQLRIDGMHCMISQLEGVQQISVSLAEGTATVLYNPSVISPEELRAAIEDMGFEASVVSESCSTNPLGNHSAGNSMVQTTDGTPTSVQEVAPHTGRLPANHAPDILAKSPQSTRAVAPQKCFLQIKGMTCASCVSNIERNLQKEAGVLSVLVALMAGKAEIKYDPEVIQPLEIAQFIQDLGFEAAVMEDYAGSDGNIELTITGMTCASCVHNIESKLTRTNGITYASVALATSKALVKFDPEIIGPRDIIKIIEEIGFHASLAQRNPNAHHL-DH-KMEIKQWKKSFLCSLVFGIPVMALMI----------YMLIPSNEPHQSMVLDHNIIP----GLSILNLIFFILCTFVQLLGGWYFYVQAYKSLRHRSANMDVLIVLATSIAYVYSLVILVVAVAEKAERSPVTFFDTPPMLFVFIALGRWLEHLAKSKTSEALAKLMSLQATEATVVTLGEDNLIIREEQVPMELVQRGDIVKVVPGGKFPVDGKVLEGNTMADESLITGEAMPVTKKPGSTVIAGSINAHGSVLIKATHVGNDTTLAQIVKLVEEAQMSKAPIQQLADRFSGYFVPFIIIMSTLTLVVWIVIGFIDFGVVQRYFPNPNKHISQTEVIIRFAFQTSITVLCIACPCSLGLATPTAVMVGTGVAAQNGILIKGGKPLEMAHKIKTVMFDKTGTITHGVPRVMRVL-LLGDVATLPLRKVLAVVGTAEASSEHPLGVAVTKYCKEELGTETLGYCTDFQAVPGCGIGCK------------VSNVEGILAHSERP--LSAPASHLNEAGSLPAEKDAV-------------PQTFSVLIGNREWLRRNGLTISSDVSDAMTDHEMKGQTAILVAIDGVLCGMIAIADAVKQEAALAVHTLQSMGVDVVLITGDNRKTARAIATQVGINKVFAEVLPSHKVAKVQELQNKGK--------KVAMVGDGVNDSPALAQADMGVAIGTGTDVAIEAADVVLIRNDLLDVVASIHLSKRTVRRIRINLVLALIYNLVGIPIAAGVFMPIGIVLQPWMGSAAMAASSVSVVLSSLQLKCYKKPDLERY---EAQAHGHMKPLTASQVSVHIGMD 1296          

HSP 2 Score: 100.908 bits (250), Expect = 1.190e-20
Identity = 106/437 (24.26%), Postives = 182/437 (41.65%), Query Frame = 1
Query:  109 RMKVDGMTCMSCVRNIEENLMKFTGVCGIMVSLLHAEATVIFDADIATVEDISNKIDEMGFDVTVKSSEVSNVKDKVVRSRIKFESDINKSVEKSIETSLSSKLLLVRFCQENNYADIWHYSSIRSTEILSVIQQSEIYGVLVLEQCPTIRVIVRVNGMTCQSCVDNIESTVGKKQGIISIKVFLEKSEAHALVDASLAGP-DVEEMINDMGFNSEMILE------IFNDSCA--------GKPNNVSQ---KYEELKSNTIYPILSTT-------------IVIKALKSIFCIFKIENHMRALPGVDKCSVNLIEEIGMIDYDSGKWNVQKIREEIESLGYLTELPKQNWNSTRQSSAVSLNEESRSKCYLRITGMTCSSCVNKVESHLLKVEGVKSVLVALLAMKCEIIYDSAYVMPFQLSNRVKELGFNAEVIE 1326
            +++V+GMTC SCV +IE  + K  GV  + VSL + EA + +   +   ED+ + +++MGF+  +KS        KV    +    DI +    + +  LSS          NN   + H  S                 V+ L+        +R++GM C          + + +G+  I V L +  A  L + S+  P ++   I DMGF + ++ E      + N S          G P +V +       L +N    IL+ +             + IK +    C+  IE +++   GV    V L+     I YD       +I + I+ LG+             +++ +     S     L ITGMTC+SCV+ +ES L +  G+    VAL   K  + +D   + P  +   ++E+GF+A + +
Sbjct:  146 KLRVEGMTCQSCVSSIEGKVRKLQGVVRVKVSLSNQEAVITYQPYLIQPEDLRDHVNDMGFEAAIKS--------KVAPLSLG-PIDIERLQSTNPKRPLSSA-----NQNFNNSETLGHQGS----------------HVVTLQ--------LRIDGMHCM---------ISQLEGVQQISVSLAEGTATVLYNPSVISPEELRAAIEDMGFEASVVSESCSTNPLGNHSAGNSMVQTTDGTPTSVQEVAPHTGRLPANHAPDILAKSPQSTRAVAPQKCFLQIKGMTCASCVSNIERNLQKEAGVLSVLVALMAGKAEIKYDPEVIQPLEIAQFIQDLGF-------------EAAVMEDYAGSDGNIELTITGMTCASCVHNIESKLTRTNGITYASVALATSKALVKFDPEIIGPRDIIKIIEEIGFHASLAQ 522          

HSP 3 Score: 98.2117 bits (243), Expect = 9.961e-20
Identity = 96/420 (22.86%), Postives = 172/420 (40.95%), Query Frame = 1
Query:  568 VRVNGMTCQSCVDNIESTVGKKQGIISIKVFLEKSEAHA-LVDASLAGPDVEEMINDMGFNSEMILEIFNDSCAGKPNNVSQKYEELKSNTIYPILSTTIVIKALKSIFCIFKIENHMRALPGVDKCSVNLIEEIGMIDYDSGKWNVQKIREEIESLGYLTEL---------------------PKQNWNSTRQ--SSAVSLNEESRS--KCYLRITGMTCSSCVNKVESHLLKVEGVKSVLVALLAMKCEIIYDSAYVMPFQLSNRVKELGFNAEVIEN-------GNEGIGIVNVLIR------------------------------------------------GMTCSSCVNHIENHISKIKGIASINVSLSTSKGKVEYFISECGPRDVIDAINDMGFDASLCDHLESNHAAAD 1584
            VR+ GMTCQSCV +IE  +   +GIIS+KV LE+  A    V + +    V   I DMGF +     I     A  P+      E +            + ++ +    C+  IE  +R L GV +  V+L  +  +I Y       + +R+ +  +G+   +                     PK+  +S  Q  +++ +L  +        LRI GM C          + ++EGV+ + V+L      ++Y+ + + P +L   ++++GF A V+         GN   G  N +++                                                GMTC+SCV++IE ++ K  G+ S+ V+L   K +++Y      P ++   I D+GF+A++ +    ++A +D
Sbjct:   62 VRILGMTCQSCVKSIEDRISNLKGIISMKVSLEQGSATVKYVPSVVCLQQVCHQIGDMGFEA----SIAEGKAASWPSRSLPAQEAV----------VKLRVEGMTCQSCVSSIEGKVRKLQGVVRVKVSLSNQEAVITYQPYLIQPEDLRDHVNDMGFEAAIKSKVAPLSLGPIDIERLQSTNPKRPLSSANQNFNNSETLGHQGSHVVTLQLRIDGMHC---------MISQLEGVQQISVSLAEGTATVLYNPSVISPEELRAAIEDMGFEASVVSESCSTNPLGNHSAG--NSMVQTTDGTPTSVQEVAPHTGRLPANHAPDILAKSPQSTRAVAPQKCFLQIKGMTCASCVSNIERNLQKEAGVLSVLVALMAGKAEIKYDPEVIQPLEIAQFIQDLGFEAAVME----DYAGSD 452          

HSP 4 Score: 78.1814 bits (191), Expect = 1.089e-13
Identity = 72/323 (22.29%), Postives = 136/323 (42.11%), Query Frame = 1
Query:  109 RMKVDGMTCMSCVRNIEENLMKFTGVCGIMVSLLHAEATVIFDADIATVEDISNKIDEMGFDVTVKSSEVSNVKDKVVRSRIKFESDINKSVEKSIETSLSSKLLLVRFCQENNYADIWHYSSIRSTEILSVIQQSEIYGVLVLEQCPTIRVIVRVNGMTCQSCVDNIESTVGKKQGIISIKVFLEKSEAHALVDASLAGP-DVEEMINDMGFNSEMILEIFNDSCAGKPNNVSQKYEELKSNTIYPILSTTIVIKALKSIFCIFKIENHMRALPGVDKCSVNLIEEIGMIDYDSGKWNVQKIREEIESLGYLTELPKQNWNS 1074
            ++++DGM CM         + +  GV  I VSL    ATV+++  + + E++   I++MGF+ +V S   S        + +   S  N  V+ +  T  S + +              H   + +     ++ +S      V  Q    +  +++ GMTC SCV NIE  + K+ G++S+ V L   +A    D  +  P ++ + I D+GF + ++     +  AG   N+                   + I  +    C+  IE+ +    G+   SV L     ++ +D      + I + IE +G+   L ++N N+
Sbjct:  260 QLRIDGMHCM---------ISQLEGVQQISVSLAEGTATVLYNPSVISPEELRAAIEDMGFEASVVSESCST-------NPLGNHSAGNSMVQTTDGTPTSVQEVAP------------HTGRLPANHAPDILAKSPQSTRAVAPQ----KCFLQIKGMTCASCVSNIERNLQKEAGVLSVLVALMAGKAEIKYDPEVIQPLEIAQFIQDLGFEAAVM-----EDYAGSDGNIE------------------LTITGMTCASCVHNIESKLTRTNGITYASVALATSKALVKFDPEIIGPRDIIKIIEEIGFHASLAQRNPNA 527          

HSP 5 Score: 62.003 bits (149), Expect = 8.998e-9
Identity = 37/93 (39.78%), Postives = 48/93 (51.61%), Query Frame = 1
Query: 1294 KELGFNAEVIENGNEGIG------IVNVLIRGMTCSSCVNHIENHISKIKGIASINVSLSTSKGKVEYFISECGPRDVIDAINDMGFDASLCD 1554
            K   F+    E G +G+G         V I GMTC SCV  IE+ IS +KGI S+ VSL      V+Y  S    + V   I DMGF+AS+ +
Sbjct:   35 KSFAFDNVGYEGGLDGLGPSSQVATSTVRILGMTCQSCVKSIEDRISNLKGIISMKVSLEQGSATVKYVPSVVCLQQVCHQIGDMGFEASIAE 127          

HSP 6 Score: 52.373 bits (124), Expect = 8.618e-6
Identity = 26/68 (38.24%), Postives = 39/68 (57.35%), Query Frame = 1
Query:  100 GSARMKVDGMTCMSCVRNIEENLMKFTGVCGIMVSLLHAEATVIFDADIATVEDISNKIDEMGFDVTV 303
            G+  + + GMTC SCV NIE  L +  G+    V+L  ++A V FD +I    DI   I+E+GF  ++
Sbjct:  453 GNIELTITGMTCASCVHNIESKLTRTNGITYASVALATSKALVKFDPEIIGPRDIIKIIEEIGFHASL 520          
BLAST of Copper-transporting ATPase 1 vs. Ensembl Human
Match: ATP7B (ATPase copper transporting beta [Source:HGNC Symbol;Acc:HGNC:870])

HSP 1 Score: 841.647 bits (2173), Expect = 0.000e+0
Identity = 558/1357 (41.12%), Postives = 766/1357 (56.45%), Query Frame = 1
Query:  109 RMKVDGMTCMSCVRNIEENLMKFTGVCGIMVSLLHAEATVIFDADIATVEDISNKIDEMGFDVTVKSSEVSNVKDKVVRSRIKFESDINKSVEKSIETSLSSKLLLVRFCQENNYADIWHYSSIRSTEILSVIQQSEIYGVLVLEQCPTIRVIVRVNGMTCQSCVDNIESTVGKKQGIISIKVFLEKSEAHALVDASLAGP-DVEEMINDMGFNSEMILEIFNDSCAGKPNN----VSQKYEELKSNTIYPILSTTIV-IKALKSIFCIFKIENHMRALPGVDKCSVNLIEEIGMIDYDSGKWNVQKIREEIESLGY----------------------------------------LTELPKQNWNSTRQSSAVSLNEESRSKCYLRITGMTCSSCVNKVESHLLKVEGVKSVLVALLAMKCEIIYDSAYVMPFQLSNRVKELGFNAEVIENGNEGIGIVNVLIRGMTCSSCVNHIENHISKIKGIASINVSLSTSKGKVEYFISECGPRDVIDAINDMGFDASLCDHLESNHAAADHINQMIKQWRSSFFFSLICGIPXXXXXXXXXXXXXXXXHTIIHENGSNRTIM--KSTVPMVCSGLSADNLILFVLATPVQFYGARYFYIQAYLSLKHKTTNMDVLVVMATXXXXXXXXXXXXXXMAFRRNTSPKTFFETSPMLIVFLSLGRWLEHIAKGKTSEALTKLMSLQAVEATLYT--PEN---KERKIPINLVQRNDLIKILPGEKIPVDGKVVTGTSTCDESLITGESMPIEKTHGSDVIGGSINKSGMLIVKATHVGSDSALAQIVKLVEEAQTSKAPIQQLADRIAGMFVPSVLICAIITLIIWVIVGFSKPEILPKYV----NELSVTEITWEHAFQLAITVLSIACPCSLGLXXXXXXXXXXXXXXXNGILIKGGEPLENIHKLNVIVFDKTGTITNGSPSVTRFLVLIGNGVREHIDKLLKILAAAESASEHPIGKAIITFSKARISNENLPEVLESSAVSGCGLGCKLNLDPKTEVTKFVKNLINIESPSEETNILGQXXXXXXXXXXXXTYKDVIFPVRQHMAWTSDLCQTVTVIIGNRNWMLRNGILVDDEVDELMSEDENLGRTVILMAIDNELIAMISVADQVKREAALAVYTLKKMNIEVYLMTGDNSKTATAIARQVGIHYVFAEVLPSHKVAKVQQLQNTNRSLTSKRKMKVAMVGDGINDSPALAQSDVGIAIGTGTDVAVEAADVVLIRNSLLDVIAAIQLSKATVKRIRQNFIAATLYNLLGIPIAAGVLMPIGIEMMPWMXXXXXXXXXXXXXXXXXXXXXWKKPSEEKLITPEYINFIQSSGLSESQIIVRRGID 4008
            +++V+GMTC SCV +IE  + K  GV  + VSL + EA + +   +   ED+ + +++MGF+  +KS        KV    +    DI +    + +  LSS          NN   + H  S                 V+ L+        +R++GM C+SCV NIE  +G+  G+ SI+V LE   A    D S   P  ++  I  +   +  +     D   G   +     S        N +    STT++ I  +    C+  IE  +  L GV + SV+L E    + Y+    + +++R  IE +G+                                           LP  +       S  S    +  KC+L+I GMTC+SCV+ +E +L K  GV SVLVAL+A K EI YD   + P +++  +++LGF A V+E+     G + + I GMTC+SCV++IE+ +++  GI   +V+L+TSK  V++     GPRD+I  I ++GF ASL     + H   DH    IKQW+ SF  SL+ GIP M +M+          + +I  N  +++++   + +P    GLS  NLI F+L T          ++QA                                        SP TFF+T PML VF++LGRWLEH+AK KTSEAL KLMSLQA EAT+ T   +N   +E ++P+ LVQR D++K++PG K PVDGKV+ G +  DESLITGE+MP+ K  GS VI GSIN  G +++KATHVG+D+ LAQIVKLVEEAQ SKAPIQQLADR +G FVP ++I + +TL++W+++GF    ++ +Y       +S TE+    AFQ +ITVL IACPCSLGLATPTAVMVGTGV A NGILIKGG+PLE  HK+  ++FDKTGTIT+G P V R L L+G+     + K+L ++  AE++SEHP+G A+  + K  +  E L    +  AV GCG+GCK            V N+  I + SE    L    +           KD +              QT +V+IGNR W+ RNG+ +  +V + M++ E  G+T IL+AID  L  MI++AD VK+EAALAV+TL+ M ++V L+TGDN KTA AIA QVGI+ VFAEVLPSHKVAKVQ+LQN  +        KVAMVGDG+NDSPALAQ+D+G+AIGTGTDVA+EAADVVLIRN LLDV+A+I LSK TV+RIR N + A +YNL+GIPIAAGV MPIGI + PWM SAAMAASSVSVV  SL LK +KKP  E+    E         L+ SQ+ V  G+D
Sbjct:  146 KLRVEGMTCQSCVSSIEGKVRKLQGVVRVKVSLSNQEAVITYQPYLIQPEDLRDHVNDMGFEAAIKS--------KVAPLSLG-PIDIERLQSTNPKRPLSSA-----NQNFNNSETLGHQGS----------------HVVTLQ--------LRIDGMHCKSCVLNIEENIGQLLGVQSIQVSLENKTAQVKYDPSCTSPVALQRAIEALPPGNFKVS--LPDGAEGSGTDHRSSSSHSPGSPPRNQVQGTCSTTLIAIAGMTCASCVHSIEGMISQLEGVQQISVSLAEGTATVLYNPSVISPEELRAAIEDMGFEASVVSESCSTNPLGNHSAGNSMVQTTDGTPTSVQEVAPHTGRLPANHAPDILAKSPQSTRAVAPQKCFLQIKGMTCASCVSNIERNLQKEAGVLSVLVALMAGKAEIKYDPEVIQPLEIAQFIQDLGFEAAVMEDYAGSDGNIELTITGMTCASCVHNIESKLTRTNGITYASVALATSKALVKFDPEIIGPRDIIKIIEEIGFHASLAQRNPNAHHL-DH-KMEIKQWKKSFLCSLVFGIPVMALMI----------YMLIPSNEPHQSMVLDHNIIP----GLSILNLIFFILCT----------FVQA--------------------------------------ERSPVTFFDTPPMLFVFIALGRWLEHLAKSKTSEALAKLMSLQATEATVVTLGEDNLIIREEQVPMELVQRGDIVKVVPGGKFPVDGKVLEGNTMADESLITGEAMPVTKKPGSTVIAGSINAHGSVLIKATHVGNDTTLAQIVKLVEEAQMSKAPIQQLADRFSGYFVPFIIIMSTLTLVVWIVIGFIDFGVVQRYFPNPNKHISQTEVIIRFAFQTSITVLCIACPCSLGLATPTAVMVGTGVAAQNGILIKGGKPLEMAHKIKTVMFDKTGTITHGVPRVMRVL-LLGDVATLPLRKVLAVVGTAEASSEHPLGVAVTKYCKEELGTETLGYCTDFQAVPGCGIGCK------------VSNVEGILAHSERP--LSAPASHLNEAGSLPAEKDAV-------------PQTFSVLIGNREWLRRNGLTISSDVSDAMTDHEMKGQTAILVAIDGVLCGMIAIADAVKQEAALAVHTLQSMGVDVVLITGDNRKTARAIATQVGINKVFAEVLPSHKVAKVQELQNKGK--------KVAMVGDGVNDSPALAQADMGVAIGTGTDVAIEAADVVLIRNDLLDVVASIHLSKRTVRRIRINLVLALIYNLVGIPIAAGVFMPIGIVLQPWMGSAAMAASSVSVVLSSLQLKCYKKPDLERY---EAQAHGHMKPLTASQVSVHIGMD 1359          

HSP 2 Score: 124.405 bits (311), Expect = 1.004e-27
Identity = 106/392 (27.04%), Postives = 172/392 (43.88%), Query Frame = 1
Query:  568 VRVNGMTCQSCVDNIESTVGKKQGIISIKVFLEKSEAHA-LVDASLAGPDVEEMINDMGFNSEMILEIFNDSCAGKPNNVSQKYEELKSNTIYPILSTTIVIKALKSIFCIFKIENHMRALPGVDKCSVNLIEEIGMIDYDSGKWNVQKIREEIESLGYLTEL---------------------PKQNWNSTRQS--SAVSLNEESRS--KCYLRITGMTCSSCVNKVESHLLKVEGVKSVLVALLAMKCEIIYDSAYVMPFQLSNRVKEL--GFNAEVIENGNEGIGIVN------------------------VLIRGMTCSSCVNHIENHISKIKGIASINVSLSTSKGKVEYFISECGPRDVIDAINDMGFDASLCDHLESNHAAADH 1587
            VR+ GMTCQSCV +IE  +   +GIIS+KV LE+  A    V + +    V   I DMGF +     I     A  P+      E +            + ++ +    C+  IE  +R L GV +  V+L  +  +I Y       + +R+ +  +G+   +                     PK+  +S  Q+  ++ +L  +        LRI GM C SCV  +E ++ ++ GV+S+ V+L     ++ YD +   P  L   ++ L  G     + +G EG G  +                        + I GMTC+SCV+ IE  IS+++G+  I+VSL+     V Y  S   P ++  AI DMGF+AS+     S +   +H
Sbjct:   62 VRILGMTCQSCVKSIEDRISNLKGIISMKVSLEQGSATVKYVPSVVCLQQVCHQIGDMGFEAS----IAEGKAASWPSRSLPAQEAV----------VKLRVEGMTCQSCVSSIEGKVRKLQGVVRVKVSLSNQEAVITYQPYLIQPEDLRDHVNDMGFEAAIKSKVAPLSLGPIDIERLQSTNPKRPLSSANQNFNNSETLGHQGSHVVTLQLRIDGMHCKSCVLNIEENIGQLLGVQSIQVSLENKTAQVKYDPSCTSPVALQRAIEALPPGNFKVSLPDGAEGSGTDHRSSSSHSPGSPPRNQVQGTCSTTLIAIAGMTCASCVHSIEGMISQLEGVQQISVSLAEGTATVLYNPSVISPEELRAAIEDMGFEASVVSESCSTNPLGNH 439          

HSP 3 Score: 120.939 bits (302), Expect = 1.124e-26
Identity = 102/431 (23.67%), Postives = 183/431 (42.46%), Query Frame = 1
Query:  562 VIVRVNGMTCQSCVDNIESTVGKKQGIISIKVFLEKSEAHALVDASLAGP-DVEEMINDMGFNSEMI------------LEIFNDSCAGKP-NNVSQKY--EELKSNTIYPILSTTIVIKALKSIFCIFKIENHMRALPGVDKCSVNLIEEIGMIDYDSGKWNVQKIREEIESLGYLTELPKQNWNSTRQSSAVSLNEESR-------------------SKCYLRITGMTCSSCVNKVESHLLKVEGVKSVLVALLAMKCEIIYDSAYVMPFQLSNRVKELGFNAEVIEN-------GNEGIGIVNVLIR------------------------------------------------GMTCSSCVNHIENHISKIKGIASINVSLSTSKGKVEYFISECGPRDVIDAINDMGFDASLCDHLESNHAAAD 1584
            V +RV GMTCQSCV +IE  V K QG++ +KV L   EA       L  P D+ + +NDMGF + +             +E    +   +P ++ +Q +   E   +    +++  + I  +    C+  IE ++  L GV    V+L  +   + YD    +   ++  IE+      LP  N+  +    A     + R                   S   + I GMTC+SCV+ +E  + ++EGV+ + V+L      ++Y+ + + P +L   ++++GF A V+         GN   G  N +++                                                GMTC+SCV++IE ++ K  G+ S+ V+L   K +++Y      P ++   I D+GF+A++ +    ++A +D
Sbjct:  145 VKLRVEGMTCQSCVSSIEGKVRKLQGVVRVKVSLSNQEAVITYQPYLIQPEDLRDHVNDMGFEAAIKSKVAPLSLGPIDIERLQSTNPKRPLSSANQNFNNSETLGHQGSHVVTLQLRIDGMHCKSCVLNIEENIGQLLGVQSIQVSLENKTAQVKYDPSCTSPVALQRAIEA------LPPGNFKVSLPDGAEGSGTDHRSSSSHSPGSPPRNQVQGTCSTTLIAIAGMTCASCVHSIEGMISQLEGVQQISVSLAEGTATVLYNPSVISPEELRAAIEDMGFEASVVSESCSTNPLGNHSAG--NSMVQTTDGTPTSVQEVAPHTGRLPANHAPDILAKSPQSTRAVAPQKCFLQIKGMTCASCVSNIERNLQKEAGVLSVLVALMAGKAEIKYDPEVIQPLEIAQFIQDLGFEAAVME----DYAGSD 563          

HSP 4 Score: 52.373 bits (124), Expect = 9.138e-6
Identity = 26/68 (38.24%), Postives = 39/68 (57.35%), Query Frame = 1
Query:  100 GSARMKVDGMTCMSCVRNIEENLMKFTGVCGIMVSLLHAEATVIFDADIATVEDISNKIDEMGFDVTV 303
            G+  + + GMTC SCV NIE  L +  G+    V+L  ++A V FD +I    DI   I+E+GF  ++
Sbjct:  564 GNIELTITGMTCASCVHNIESKLTRTNGITYASVALATSKALVKFDPEIIGPRDIIKIIEEIGFHASL 631          
BLAST of Copper-transporting ATPase 1 vs. Ensembl Human
Match: ATP7B (ATPase copper transporting beta [Source:HGNC Symbol;Acc:HGNC:870])

HSP 1 Score: 686.026 bits (1769), Expect = 0.000e+0
Identity = 401/741 (54.12%), Postives = 520/741 (70.18%), Query Frame = 1
Query: 1813 VQFYGARYFYIQAYLSLKHKTTNMDVLVVMATXXXXXXXXXXXXXXMAFRRNTSPKTFFETSPMLIVFLSLGRWLEHIAKGKTSEALTKLMSLQAVEATLYT--PEN---KERKIPINLVQRNDLIKILPGEKIPVDGKVVTGTSTCDESLITGESMPIEKTHGSDVIGGSINKSGMLIVKATHVGSDSALAQIVKLVEEAQTSKAPIQQLADRIAGMFVPSVLICAIITLIIWVIVGFSKPEILPKYV----NELSVTEITWEHAFQLAITVLSIACPCSLGLXXXXXXXXXXXXXXXNGILIKGGEPLENIHKLNVIVFDKTGTITNGSPSVTRFLVLIGNGVREHIDKLLKILAAAESASEHPIGKAIITFSKARISNENLPEVLESSAVSGCGLGCKLNLDPKTEVTKFVKNLINIESPSEETNILGQXXXXXXXXXXXXTYKDVIFPVRQHMAWTSDLCQTVTVIIGNRNWMLRNGILVDDEVDELMSEDENLGRTVILMAIDNELIAMISVADQVKREAALAVYTLKKMNIEVYLMTGDNSKTATAIARQVGIHYVFAEVLPSHKVAKVQQLQNTNRSLTSKRKMKVAMVGDGINDSPALAQSDVGIAIGTGTDVAVEAADVVLIRNSLLDVIAAIQLSKATVKRIRQNFIAATLYNLLGIPIAAGVLMPIGIEMMPWMXXXXXXXXXXXXXXXXXXXXXWKKPSEEKLITPEYINFIQSSGLSESQIIVRRGID 4008
            ++  G  YFY+QAY SL+H++ NMDVL+V+ATSI+Y+YS++++V+++A +   SP TFF+T PML VF++LGRWLEH+AK KTSEAL KLMSLQA EAT+ T   +N   +E ++P+ LVQR D++K++PG K PVDGKV+ G +  DESLITGE+MP+ K  GS VI GSIN  G +++KATHVG+D+ LAQIVKLVEEAQ SKAPIQQLADR +G FVP ++I + +TL++W+++GF    ++ +Y       +S TE+    AFQ +ITVL IACPCSLGLATPTAVMVGTGV A NGILIKGG+PLE  HK+  ++FDKTGTIT+G P V R L L+G+     + K+L ++  AE++SEHP+G A+  + K  +  E L    +  AV GCG+GCK            V N+  I + SE    L    +           KD +              QT +V+IGNR W+ RNG+ +  +V + M++ E  G+T IL+AID  L  MI++AD VK+EAALAV+TL+ M ++V L+TGDN KTA AIA QVGI+ VFAEVLPSHKVAKVQ+LQN  +        KVAMVGDG+NDSPALAQ+D+G+AIGTGTDVA+EAADVVLIRN LLDV+A+I LSK TV+RIR N + A +YNL+GIPIAAGV MPIGI + PWM SAAMAASSVSVV  SL LK +KKP  E+    E         L+ SQ+ V  G+D
Sbjct:  622 IELLGGWYFYVQAYKSLRHRSANMDVLIVLATSIAYVYSLVILVVAVAEKAERSPVTFFDTPPMLFVFIALGRWLEHLAKSKTSEALAKLMSLQATEATVVTLGEDNLIIREEQVPMELVQRGDIVKVVPGGKFPVDGKVLEGNTMADESLITGEAMPVTKKPGSTVIAGSINAHGSVLIKATHVGNDTTLAQIVKLVEEAQMSKAPIQQLADRFSGYFVPFIIIMSTLTLVVWIVIGFIDFGVVQRYFPNPNKHISQTEVIIRFAFQTSITVLCIACPCSLGLATPTAVMVGTGVAAQNGILIKGGKPLEMAHKIKTVMFDKTGTITHGVPRVMRVL-LLGDVATLPLRKVLAVVGTAEASSEHPLGVAVTKYCKEELGTETLGYCTDFQAVPGCGIGCK------------VSNVEGILAHSERP--LSAPASHLNEAGSLPAEKDAV-------------PQTFSVLIGNREWLRRNGLTISSDVSDAMTDHEMKGQTAILVAIDGVLCGMIAIADAVKQEAALAVHTLQSMGVDVVLITGDNRKTARAIATQVGINKVFAEVLPSHKVAKVQELQNKGK--------KVAMVGDGVNDSPALAQADMGVAIGTGTDVAIEAADVVLIRNDLLDVVASIHLSKRTVRRIRINLVLALIYNLVGIPIAAGVFMPIGIVLQPWMGSAAMAASSVSVVLSSLQLKCYKKPDLERY---EAQAHGHMKPLTASQVSVHIGMD 1323          

HSP 2 Score: 189.504 bits (480), Expect = 8.222e-48
Identity = 147/521 (28.21%), Postives = 239/521 (45.87%), Query Frame = 1
Query:  109 RMKVDGMTCMSCVRNIEENLMKFTGVCGIMVSLLHAEATVIFDADIATVEDISNKIDEMGFDVTVKSSEVSNVKDKVVRSRIKFESDINKSVEKSIETSLSSKLLLVRFCQENNYADIWHYSSIRSTEILSVIQQSEIYGVLVLEQCPTIRVIVRVNGMTCQSCVDNIESTVGKKQGIISIKVFLEKSEAHALVDASLAGP-DVEEMINDMGFNSEMILEIFNDSCAGKPNN----VSQKYEELKSNTIYPILSTTIV-IKALKSIFCIFKIENHMRALPGVDKCSVNLIEEIGMIDYDSGKWNVQKIREEIESLGY----------------------------------------LTELPKQNWNSTRQSSAVSLNEESRSKCYLRITGMTCSSCVNKVESHLLKVEGVKSVLVALLAMKCEIIYDSAYVMPFQLSNRVKELGFNAEVIENGNEGIGIVNVLIRGMTCSSCVNHIENHISKIKGIASINVSLSTSKGKVEYFISECGPRDVIDAINDMG 1533
            +++V+GMTC SCV +IE  + K  GV  + VSL + EA + +   +   ED+ + +++MGF+  +KS +V+ +    +        DI +    + +  LSS          NN   + H  S                 V+ L+        +R++GM C+SCV NIE  +G+  G+ SI+V LE   A    D S   P  ++  I  +   +  +     D   G   +     S        N +    STT++ I  +    C+  IE  +  L GV + SV+L E    + Y+    + +++R  IE +G+                                           LP  +       S  S    +  KC+L+I GMTC+SCV+ +E +L K  GV SVLVAL+A K EI YD   + P +++  +++LGF A V+E+     G + + I GMTC+SCV++IE+ +++  GI   +V+L+TSK  V++     GPRD+I  I  +G
Sbjct:  146 KLRVEGMTCQSCVSSIEGKVRKLQGVVRVKVSLSNQEAVITYQPYLIQPEDLRDHVNDMGFEAAIKS-KVAPLSLGPI--------DIERLQSTNPKRPLSSA-----NQNFNNSETLGHQGS----------------HVVTLQ--------LRIDGMHCKSCVLNIEENIGQLLGVQSIQVSLENKTAQVKYDPSCTSPVALQRAIEALPPGNFKVS--LPDGAEGSGTDHRSSSSHSPGSPPRNQVQGTCSTTLIAIAGMTCASCVHSIEGMISQLEGVQQISVSLAEGTATVLYNPSVISPEELRAAIEDMGFEASVVSESCSTNPLGNHSAGNSMVQTTDGTPTSVQEVAPHTGRLPANHAPDILAKSPQSTRAVAPQKCFLQIKGMTCASCVSNIERNLQKEAGVLSVLVALMAGKAEIKYDPEVIQPLEIAQFIQDLGFEAAVMEDYAGSDGNIELTITGMTCASCVHNIESKLTRTNGITYASVALATSKALVKFDPEIIGPRDIIKIIELLG 626          

HSP 3 Score: 124.405 bits (311), Expect = 1.013e-27
Identity = 106/392 (27.04%), Postives = 172/392 (43.88%), Query Frame = 1
Query:  568 VRVNGMTCQSCVDNIESTVGKKQGIISIKVFLEKSEAHA-LVDASLAGPDVEEMINDMGFNSEMILEIFNDSCAGKPNNVSQKYEELKSNTIYPILSTTIVIKALKSIFCIFKIENHMRALPGVDKCSVNLIEEIGMIDYDSGKWNVQKIREEIESLGYLTEL---------------------PKQNWNSTRQS--SAVSLNEESRS--KCYLRITGMTCSSCVNKVESHLLKVEGVKSVLVALLAMKCEIIYDSAYVMPFQLSNRVKEL--GFNAEVIENGNEGIGIVN------------------------VLIRGMTCSSCVNHIENHISKIKGIASINVSLSTSKGKVEYFISECGPRDVIDAINDMGFDASLCDHLESNHAAADH 1587
            VR+ GMTCQSCV +IE  +   +GIIS+KV LE+  A    V + +    V   I DMGF +     I     A  P+      E +            + ++ +    C+  IE  +R L GV +  V+L  +  +I Y       + +R+ +  +G+   +                     PK+  +S  Q+  ++ +L  +        LRI GM C SCV  +E ++ ++ GV+S+ V+L     ++ YD +   P  L   ++ L  G     + +G EG G  +                        + I GMTC+SCV+ IE  IS+++G+  I+VSL+     V Y  S   P ++  AI DMGF+AS+     S +   +H
Sbjct:   62 VRILGMTCQSCVKSIEDRISNLKGIISMKVSLEQGSATVKYVPSVVCLQQVCHQIGDMGFEAS----IAEGKAASWPSRSLPAQEAV----------VKLRVEGMTCQSCVSSIEGKVRKLQGVVRVKVSLSNQEAVITYQPYLIQPEDLRDHVNDMGFEAAIKSKVAPLSLGPIDIERLQSTNPKRPLSSANQNFNNSETLGHQGSHVVTLQLRIDGMHCKSCVLNIEENIGQLLGVQSIQVSLENKTAQVKYDPSCTSPVALQRAIEALPPGNFKVSLPDGAEGSGTDHRSSSSHSPGSPPRNQVQGTCSTTLIAIAGMTCASCVHSIEGMISQLEGVQQISVSLAEGTATVLYNPSVISPEELRAAIEDMGFEASVVSESCSTNPLGNH 439          

HSP 4 Score: 121.324 bits (303), Expect = 8.505e-27
Identity = 102/431 (23.67%), Postives = 183/431 (42.46%), Query Frame = 1
Query:  562 VIVRVNGMTCQSCVDNIESTVGKKQGIISIKVFLEKSEAHALVDASLAGP-DVEEMINDMGFNSEMI------------LEIFNDSCAGKP-NNVSQKY--EELKSNTIYPILSTTIVIKALKSIFCIFKIENHMRALPGVDKCSVNLIEEIGMIDYDSGKWNVQKIREEIESLGYLTELPKQNWNSTRQSSAVSLNEESR-------------------SKCYLRITGMTCSSCVNKVESHLLKVEGVKSVLVALLAMKCEIIYDSAYVMPFQLSNRVKELGFNAEVIEN-------GNEGIGIVNVLIR------------------------------------------------GMTCSSCVNHIENHISKIKGIASINVSLSTSKGKVEYFISECGPRDVIDAINDMGFDASLCDHLESNHAAAD 1584
            V +RV GMTCQSCV +IE  V K QG++ +KV L   EA       L  P D+ + +NDMGF + +             +E    +   +P ++ +Q +   E   +    +++  + I  +    C+  IE ++  L GV    V+L  +   + YD    +   ++  IE+      LP  N+  +    A     + R                   S   + I GMTC+SCV+ +E  + ++EGV+ + V+L      ++Y+ + + P +L   ++++GF A V+         GN   G  N +++                                                GMTC+SCV++IE ++ K  G+ S+ V+L   K +++Y      P ++   I D+GF+A++ +    ++A +D
Sbjct:  145 VKLRVEGMTCQSCVSSIEGKVRKLQGVVRVKVSLSNQEAVITYQPYLIQPEDLRDHVNDMGFEAAIKSKVAPLSLGPIDIERLQSTNPKRPLSSANQNFNNSETLGHQGSHVVTLQLRIDGMHCKSCVLNIEENIGQLLGVQSIQVSLENKTAQVKYDPSCTSPVALQRAIEA------LPPGNFKVSLPDGAEGSGTDHRSSSSHSPGSPPRNQVQGTCSTTLIAIAGMTCASCVHSIEGMISQLEGVQQISVSLAEGTATVLYNPSVISPEELRAAIEDMGFEASVVSESCSTNPLGNHSAG--NSMVQTTDGTPTSVQEVAPHTGRLPANHAPDILAKSPQSTRAVAPQKCFLQIKGMTCASCVSNIERNLQKEAGVLSVLVALMAGKAEIKYDPEVIQPLEIAQFIQDLGFEAAVME----DYAGSD 563          
BLAST of Copper-transporting ATPase 1 vs. Ensembl Celegans
Match: cua-1 (CU (Copper) ATPase [Source:UniProtKB/TrEMBL;Acc:G5ED40])

HSP 1 Score: 754.977 bits (1948), Expect = 0.000e+0
Identity = 508/1206 (42.12%), Postives = 730/1206 (60.53%), Query Frame = 1
Query:  565 IVRVNGMTCQSCVDNIESTVGKKQGIISIKVFLEKSEAHALVDAS-LAGPDVEEMINDMGFNSEMILEIFNDSCAGKPNNVSQKYEELKSNTIYPILSTTIVIKALKSIFCIFKIENHMRALPGVDKCSVNLIEEIGMIDYDSGKWNVQKIREEIESLGY---------LTELPKQNWNSTR------------------QSSAVSLNEESRS----KCYLRITGMTCSSCVNKVESHLLKVEGVKSVLVALLAMKCEIIYDSAYVMPFQLSNRVK-ELGFNAEVIEN--GNEGIGIVNVLIRGMTCSSCVNHIENHISKIKGIASINVSLSTSKGKVEYFISECGPRDVIDAINDMGFDASLCDHLESNHAAADHINQMIKQWRSSFFFSLICGIPXXXXXXXXXXXXXXXXHTIIHENGSNRTIMK--STVPMVCSGLSADNLILFVLATPVQFYGARYFYIQAYLSLKHKTTNMDVLVVMATXXXXXXXXXXXXXXMAFRRNTSPKTFFETSPMLIVFLSLGRWLEHIAKGKTSEALTKLMSLQAVEATLYTPENK-----ERKIPINLVQRNDLIKILPGEKIPVDGKVVTGTSTCDESLITGESMPIEKTHGSDVIGGSINKSGMLIVKATHVGSDSALAQIVKLVEEAQTSKAPIQQLADRIAGMFVPSVLICAIITLIIWVIVGF--SKPEILPKYVNELSVTEITWEHAFQLAITVLSIACPCSLGLXXXXXXXXXXXXXXXNGILIKGGEPLENIHKLNVIVFDKTGTITNGSPSVTRFLVLIGNGVREHIDKLLKILAAA-ESASEHPIGKAIITFSKARISNENLPEVLESSAVSGCGLGCKLN----------LDPKTEVTKFVKNLINIESPSEETNILGQXXXXXXXXXXXXTYKDVIFPVRQHMAWTSDLCQTVTVIIGNRNWMLRNGILVDDEVDELMSEDENLGRTVILMAIDNELIAMISVADQVKREAALAVYTLKKMNIEVYLMTGDNSKTATAIARQVGIHYVFAEVLPSHKVAKVQQLQNTNRSLTSKRKMKVAMVGDGINDSPALAQSDVGIAIGTGTDVAVEAADVVLIRNSLLDVIAAIQLSKATVKRIRQNFIAATLYNLLGIPIAAGVLMPIGIEMMPWMXXXXXXXXXXXXXXXXXXXXXWKKPSEEKLITPEY---INFIQSSGLSESQIIVRRGID 4008
            ++ + GMTC SCV NI+  +G K GI SI+V L++  A    D +      V E ++DMGF+ +++ +      A KP                 I    + I+ +    C+  I++ + +  G+ K  V+L ++ G +DY+S KWN + + E I+ +G+         +  +  Q  ++T+                  Q + V  ++E  S    KC   + GMTC+SCV  +E ++ K+EGV S++VAL+A K E+IYD        +   +  ELG+ A ++++   N     + ++I  ++  S  N IE+H+    GI S NVS++TS   VE+     GPRD+I+ +  +GF A L    +      DH +  +K+WR++FF +LI G+P M +M+          H I+      RT M      P+    LS DN +L  L TPVQ +G RYFY+ ++ ++KH   NMDVL++++T+I+Y YS++V+++++ F+  +SP TFF+  PMLIVF++LGR LEH AKGKTSEAL+KLMSLQA EATL T +++     E+ I I LVQRNDLIK++PG K+PVDG VV G S+ DES ITGESMP+ K  GS VIGGS+N+ G+LIVKATHVG+DS L+QIV+LVEEAQT++APIQQLAD+IAG FVP V++ ++ TL +W+ + +  ++   LP  +      +I    AF+ AITVL+IACPCSLGLATPTAVMVGTGVGA NGILIKGGEPLE++HK+  IVFDKTGTIT G P V +    +         KL+  L+ A E+ SEHPIG A+  F+K  ++    P        +G G+ C+++          L   T     + +   I  P  E N+L            +++ K+V  P             T  ++IG    M R+GI V + V   +SE++  G   ++ AI+ E++A+IS+ADQVK+EA+LA+YTL++M + V L+TGDNSKTA + A+QVGI  VFAEVLP+ K  K++QL+          K KVAMVGDG+NDSPALA+++VGIAI  G+DVA+E+A +VL+RN L+DV+ AI+LSK T +RIR NF+ A +YN +GIPIAAGV  P G  + PWMA+AAMA SSVSVV+ SLLLK ++KP+   L T  +     F++S      Q+ V RG+D
Sbjct:   50 MLEIKGMTCNSCVKNIQDVIGAKPGIHSIQVNLKEENAKCSFDTTKWTAEKVAEAVDDMGFDCKVLKKEPPTQMAEKPK----------------IRRAIVSIEGMTCHACVNNIQDTVGSKDGIVKIVVSLEQKQGTVDYNSEKWNGESVAESIDDMGFDCKLITDQEIAAVEPQKASTTKLSISPLKTVDLSDGKVELQLNGVKYSKEGSSDHLEKCTFAVEGMTCASCVQYIERNISKIEGVHSIVVALIAAKAEVIYDGRVTSSDAIREHMTGELGYKATLLDSMGANPNYSKIRLIIGNLSTESDANRIESHVLSKSGIDSCNVSIATSMALVEFSPQVIGPRDIINVVESLGFTADLATR-DDQMKRLDHSDD-VKKWRNTFFIALIFGVPVMIIMIIF--------HWIL------RTPMHPDKQTPIFTPALSLDNFLLLCLCTPVQIFGGRYFYVASWKAIKHGNANMDVLIMLSTTIAYTYSIVVLLLAIIFKWPSSPMTFFDVPPMLIVFIALGRMLEHKAKGKTSEALSKLMSLQAKEATLVTMDSEGRLTSEKGINIELVQRNDLIKVVPGAKVPVDGVVVDGKSSVDESFITGESMPVVKKPGSTVIGGSVNQKGVLIVKATHVGNDSTLSQIVRLVEEAQTNRAPIQQLADKIAGYFVPFVIVLSLFTLGVWIYIEYNSARNANLPPGLRFEEALKI----AFEAAITVLAIACPCSLGLATPTAVMVGTGVGAANGILIKGGEPLESVHKVTTIVFDKTGTITEGRPRVVQIASFVNPSTMSL--KLITFLSGATEALSEHPIGNAVAAFAKQLLNEPTWPNTSRFHVSAGHGVTCRIDSIRQSFSSLALSGSTCEIPRLPDGQTITIPGTEVNLL------------QVSSKEVSQPNP----------DTANIVIGTERMMERHGIPVSEVVKMTLSEEQRKGHISVICAINAEVVAVISIADQVKKEASLAIYTLREMGLRVVLLTGDNSKTAESTAKQVGIDEVFAEVLPNQKQQKIKQLKG--------YKNKVAMVGDGVNDSPALAEANVGIAIAAGSDVAIESAGIVLVRNDLVDVVGAIKLSKMTTRRIRLNFLFAIIYNAIGIPIAAGVFRPFGFMLQPWMAAAAMALSSVSVVSSSLLLKNFRKPTIANLYTTSFKRHQKFLESGSF---QVQVHRGLD 1184          

HSP 2 Score: 93.2041 bits (230), Expect = 1.160e-18
Identity = 80/332 (24.10%), Postives = 153/332 (46.08%), Query Frame = 1
Query:   79 LAIRMKLGSARMKVDGMTCMSCVRNIEENLMKFTGVCGIMVSLLHAEATVIFDADIATVEDISNKIDEMGFDVT-VKSSEVSNVKDKVVRSRIKFESDINKSVEKSIETSLSSKLLLVRFCQENNYADIWHYSSIRSTEILSVIQQSEIYGVLVLEQCPTIRVIVRVNGMTCQSCVDNIESTVGKKQGIISIKVFLEKSEAHALVDASLAGPDV--EEMINDMGFNSEMILEIFNDSCAGKPNNVSQKYEELKSNTIYPILSTTIVIKALKSIFCIFKIENHMRALPGVDKCSVNLIEEIGMIDYDSGKWNVQKIREEIESLGYLTELPKQN 1065
            +A + K+  A + ++GMTC +CV NI++ +    G+  I+VSL   + TV ++++    E ++  ID+MGFD   +   E++ V+ +   S  K      K+V+ S +  +  +L  V++ +E +                             LE+C        V GMTC SCV  IE  + K +G+ SI V L  ++A  + D  +   D   E M  ++G+ + ++     DS    PN     Y +++           ++I  L +     +IE+H+ +  G+D C+V++   + ++++       + I   +ESLG+  +L  ++
Sbjct:  123 MAEKPKIRRAIVSIEGMTCHACVNNIQDTVGSKDGIVKIVVSLEQKQGTVDYNSEKWNGESVAESIDDMGFDCKLITDQEIAAVEPQKA-STTKLSISPLKTVDLS-DGKVELQLNGVKYSKEGSSDH--------------------------LEKC-----TFAVEGMTCASCVQYIERNISKIEGVHSIVVALIAAKAEVIYDGRVTSSDAIREHMTGELGYKATLL-----DSMGANPN-----YSKIR-----------LIIGNLSTESDANRIESHVLSKSGIDSCNVSIATSMALVEFSPQVIGPRDIINVVESLGFTADLATRD 400          

HSP 3 Score: 88.9669 bits (219), Expect = 1.996e-17
Identity = 67/288 (23.26%), Postives = 128/288 (44.44%), Query Frame = 1
Query:  856 TTIVIKALKSIFCIFKIENHMRALPGVDKCSVNLIEEIGMIDYDSGKWNVQKIREEIESLGYLTELPKQNWNSTRQSSAVSLNEESR-SKCYLRITGMTCSSCVNKVESHLLKVEGVKSVLVALLAMKCEIIYDSAYVMPFQLSNRVKELGFNAEVI--------------------------------------------ENGNEGIGIVNVLIRGMTCSSCVNHIENHISKIKGIASINVSLSTSKGKVEYFISECGPRDVIDAI-----NDMGFDASLCDHLESN 1569
            T + IK +    C+  I++ + A PG+    VNL EE     +D+ KW  +K+ E ++ +G+       +    ++     + E+ +  +  + I GMTC +CVN ++  +   +G+  ++V+L   +  + Y+S       ++  + ++GF+ ++I                                            E  ++ +      + GMTC+SCV +IE +ISKI+G+ SI V+L  +K +V Y     G     DAI      ++G+ A+L D + +N
Sbjct:   49 TMLEIKGMTCNSCVKNIQDVIGAKPGIHSIQVNLKEENAKCSFDTTKWTAEKVAEAVDDMGF-------DCKVLKKEPPTQMAEKPKIRRAIVSIEGMTCHACVNNIQDTVGSKDGIVKIVVSLEQKQGTVDYNSEKWNGESVAESIDDMGFDCKLITDQEIAAVEPQKASTTKLSISPLKTVDLSDGKVELQLNGVKYSKEGSSDHLEKCTFAVEGMTCASCVQYIERNISKIEGVHSIVVALIAAKAEVIY----DGRVTSSDAIREHMTGELGYKATLLDSMGAN 325          
BLAST of Copper-transporting ATPase 1 vs. Ensembl Celegans
Match: cua-1 (CU (Copper) ATPase [Source:UniProtKB/TrEMBL;Acc:G5ED40])

HSP 1 Score: 718.383 bits (1853), Expect = 0.000e+0
Identity = 478/1096 (43.61%), Postives = 681/1096 (62.14%), Query Frame = 1
Query:  892 CIFKIENHMRALPGVDKCSVNLIEEIGMIDYDSGKWNVQKIREEIESLGY---------LTELPKQNWNSTR------------------QSSAVSLNEESRS----KCYLRITGMTCSSCVNKVESHLLKVEGVKSVLVALLAMKCEIIYDSAYVMPFQLSNRVK-ELGFNAEVIEN--GNEGIGIVNVLIRGMTCSSCVNHIENHISKIKGIASINVSLSTSKGKVEYFISECGPRDVIDAINDMGFDASLCDHLESNHAAADHINQMIKQWRSSFFFSLICGIPXXXXXXXXXXXXXXXXHTIIHENGSNRTIMK--STVPMVCSGLSADNLILFVLATPVQFYGARYFYIQAYLSLKHKTTNMDVLVVMATXXXXXXXXXXXXXXMAFRRNTSPKTFFETSPMLIVFLSLGRWLEHIAKGKTSEALTKLMSLQAVEATLYTPENK-----ERKIPINLVQRNDLIKILPGEKIPVDGKVVTGTSTCDESLITGESMPIEKTHGSDVIGGSINKSGMLIVKATHVGSDSALAQIVKLVEEAQTSKAPIQQLADRIAGMFVPSVLICAIITLIIWVIVGF--SKPEILPKYVNELSVTEITWEHAFQLAITVLSIACPCSLGLXXXXXXXXXXXXXXXNGILIKGGEPLENIHKLNVIVFDKTGTITNGSPSVTRFLVLIGNGVREHIDKLLKILAAA-ESASEHPIGKAIITFSKARISNENLPEVLESSAVSGCGLGCKLN----------LDPKTEVTKFVKNLINIESPSEETNILGQXXXXXXXXXXXXTYKDVIFPVRQHMAWTSDLCQTVTVIIGNRNWMLRNGILVDDEVDELMSEDENLGRTVILMAIDNELIAMISVADQVKREAALAVYTLKKMNIEVYLMTGDNSKTATAIARQVGIHYVFAEVLPSHKVAKVQQLQNTNRSLTSKRKMKVAMVGDGINDSPALAQSDVGIAIGTGTDVAVEAADVVLIRNSLLDVIAAIQLSKATVKRIRQNFIAATLYNLLGIPIAAGVLMPIGIEMMPWMXXXXXXXXXXXXXXXXXXXXXWKKPSEEKLITPEY---INFIQSSGLSESQIIVRRGID 4008
            C+  I++ + +  G+ K  V+L ++ G +DY+S KWN + + E I+ +G+         +  +  Q  ++T+                  Q + V  ++E  S    KC   + GMTC+SCV  +E ++ K+EGV S++VAL+A K E+IYD        +   +  ELG+ A ++++   N     + ++I  ++  S  N IE+H+    GI S NVS++TS   VE+     GPRD+I+ +  +GF A L    +      DH +  +K+WR++FF +LI G+P M +M+          H I+      RT M      P+    LS DN +L  L TPVQ +G RYFY+ ++ ++KH   NMDVL++++T+I+Y YS++V+++++ F+  +SP TFF+  PMLIVF++LGR LEH AKGKTSEAL+KLMSLQA EATL T +++     E+ I I LVQRNDLIK++PG K+PVDG VV G S+ DES ITGESMP+ K  GS VIGGS+N+ G+LIVKATHVG+DS L+QIV+LVEEAQT++APIQQLAD+IAG FVP V++ ++ TL +W+ + +  ++   LP  +      +I    AF+ AITVL+IACPCSLGLATPTAVMVGTGVGA NGILIKGGEPLE++HK+  IVFDKTGTIT G P V +    +         KL+  L+ A E+ SEHPIG A+  F+K  ++    P        +G G+ C+++          L   T     + +   I  P  E N+L            +++ K+V  P             T  ++IG    M R+GI V + V   +SE++  G   ++ AI+ E++A+IS+ADQVK+EA+LA+YTL++M + V L+TGDNSKTA + A+QVGI  VFAEVLP+ K  K++QL+          K KVAMVGDG+NDSPALA+++VGIAI  G+DVA+E+A +VL+RN L+DV+ AI+LSK T +RIR NF+ A +YN +GIPIAAGV  P G  + PWMA+AAMA SSVSVV+ SLLLK ++KP+   L T  +     F++S      Q+ V RG+D
Sbjct:   22 CVNNIQDTVGSKDGIVKIVVSLEQKQGTVDYNSEKWNGESVAESIDDMGFDCKLITDQEIAAVEPQKASTTKLSISPLKTVDLSDGKVELQLNGVKYSKEGSSDHLEKCTFAVEGMTCASCVQYIERNISKIEGVHSIVVALIAAKAEVIYDGRVTSSDAIREHMTGELGYKATLLDSMGANPNYSKIRLIIGNLSTESDANRIESHVLSKSGIDSCNVSIATSMALVEFSPQVIGPRDIINVVESLGFTADLATR-DDQMKRLDHSDD-VKKWRNTFFIALIFGVPVMIIMIIF--------HWIL------RTPMHPDKQTPIFTPALSLDNFLLLCLCTPVQIFGGRYFYVASWKAIKHGNANMDVLIMLSTTIAYTYSIVVLLLAIIFKWPSSPMTFFDVPPMLIVFIALGRMLEHKAKGKTSEALSKLMSLQAKEATLVTMDSEGRLTSEKGINIELVQRNDLIKVVPGAKVPVDGVVVDGKSSVDESFITGESMPVVKKPGSTVIGGSVNQKGVLIVKATHVGNDSTLSQIVRLVEEAQTNRAPIQQLADKIAGYFVPFVIVLSLFTLGVWIYIEYNSARNANLPPGLRFEEALKI----AFEAAITVLAIACPCSLGLATPTAVMVGTGVGAANGILIKGGEPLESVHKVTTIVFDKTGTITEGRPRVVQIASFVNPSTMSL--KLITFLSGATEALSEHPIGNAVAAFAKQLLNEPTWPNTSRFHVSAGHGVTCRIDSIRQSFSSLALSGSTCEIPRLPDGQTITIPGTEVNLL------------QVSSKEVSQPNP----------DTANIVIGTERMMERHGIPVSEVVKMTLSEEQRKGHISVICAINAEVVAVISIADQVKKEASLAIYTLREMGLRVVLLTGDNSKTAESTAKQVGIDEVFAEVLPNQKQQKIKQLKG--------YKNKVAMVGDGVNDSPALAEANVGIAIAAGSDVAIESAGIVLVRNDLVDVVGAIKLSKMTTRRIRLNFLFAIIYNAIGIPIAAGVFRPFGFMLQPWMAAAAMALSSVSVVSSSLLLKNFRKPTIANLYTTSFKRHQKFLESGSF---QVQVHRGLD 1062          

HSP 2 Score: 93.2041 bits (230), Expect = 9.277e-19
Identity = 80/332 (24.10%), Postives = 153/332 (46.08%), Query Frame = 1
Query:   79 LAIRMKLGSARMKVDGMTCMSCVRNIEENLMKFTGVCGIMVSLLHAEATVIFDADIATVEDISNKIDEMGFDVT-VKSSEVSNVKDKVVRSRIKFESDINKSVEKSIETSLSSKLLLVRFCQENNYADIWHYSSIRSTEILSVIQQSEIYGVLVLEQCPTIRVIVRVNGMTCQSCVDNIESTVGKKQGIISIKVFLEKSEAHALVDASLAGPDV--EEMINDMGFNSEMILEIFNDSCAGKPNNVSQKYEELKSNTIYPILSTTIVIKALKSIFCIFKIENHMRALPGVDKCSVNLIEEIGMIDYDSGKWNVQKIREEIESLGYLTELPKQN 1065
            +A + K+  A + ++GMTC +CV NI++ +    G+  I+VSL   + TV ++++    E ++  ID+MGFD   +   E++ V+ +   S  K      K+V+ S +  +  +L  V++ +E +                             LE+C        V GMTC SCV  IE  + K +G+ SI V L  ++A  + D  +   D   E M  ++G+ + ++     DS    PN     Y +++           ++I  L +     +IE+H+ +  G+D C+V++   + ++++       + I   +ESLG+  +L  ++
Sbjct:    1 MAEKPKIRRAIVSIEGMTCHACVNNIQDTVGSKDGIVKIVVSLEQKQGTVDYNSEKWNGESVAESIDDMGFDCKLITDQEIAAVEPQKA-STTKLSISPLKTVDLS-DGKVELQLNGVKYSKEGSSDH--------------------------LEKC-----TFAVEGMTCASCVQYIERNISKIEGVHSIVVALIAAKAEVIYDGRVTSSDAIREHMTGELGYKATLL-----DSMGANPN-----YSKIR-----------LIIGNLSTESDANRIESHVLSKSGIDSCNVSIATSMALVEFSPQVIGPRDIINVVESLGFTADLATRD 278          

HSP 3 Score: 83.9593 bits (206), Expect = 7.451e-16
Identity = 76/279 (27.24%), Postives = 123/279 (44.09%), Query Frame = 1
Query:  559 RVIVRVNGMTCQSCVDNIESTVGKKQGIISIKVFLEKSEAHALVDA-SLAGPDVEEMINDMGFNSEMILEIFNDSCAGKPN---------------NVSQKYEELKSNTIY--------PILSTTIVIKALKSIFCIFKIENHMRALPGVDKCSVNLIEEIGMIDYDSGKWNVQKIREEIES-LGYLTELPKQNWNSTRQSSAVSLNEESRSKCYLRITGMTCSSCVNKVESHLLKVEGVKSVLVALLAMKCEIIYDSAYVMPFQLSNRVKELGFNAEV 1320
            R IV + GMTC +CV+NI+ TVG K GI+ I V LE+ +     ++    G  V E I+DMGF+ ++I +   +  A +P                ++S    EL+ N +          +   T  ++ +    C+  IE ++  + GV    V LI     + YD    +   IRE +   LGY   L          S   + N    SK  L I  ++  S  N++ESH+L   G+ S  V++      + +    + P  + N V+ LGF A++
Sbjct:    9 RAIVSIEGMTCHACVNNIQDTVGSKDGIVKIVVSLEQKQGTVDYNSEKWNGESVAESIDDMGFDCKLITD--QEIAAVEPQKASTTKLSISPLKTVDLSDGKVELQLNGVKYSKEGSSDHLEKCTFAVEGMTCASCVQYIERNISKIEGVHSIVVALIAAKAEVIYDGRVTSSDAIREHMTGELGYKATL--------LDSMGANPN---YSKIRLIIGNLSTESDANRIESHVLSKSGIDSCNVSIATSMALVEFSPQVIGPRDIINVVESLGFTADL 274          
BLAST of Copper-transporting ATPase 1 vs. Ensembl Celegans
Match: catp-3 (Cation transporting ATPase [Source:UniProtKB/TrEMBL;Acc:O16331])

HSP 1 Score: 87.8113 bits (216), Expect = 4.640e-17
Identity = 61/230 (26.52%), Postives = 107/230 (46.52%), Query Frame = 1
Query: 3298 MAIDN-ELIAMISVADQVKREAALAVYTLKKMNIEVYLMTGDNSKTATAIARQVGI-----------------------------------------------HYVFAEVLPSHKVAKVQQLQNTNRSLTSKRKMKVAMVGDGINDSPALAQSDVGIAIG-TGTDVAVEAADVVLIRNSLLDVIAAIQLSKATVKRIRQNFIAATLYNLLG--IPIAAGVLMPIGIEMMP 3834
            + +DN + + M ++ D  + +   A+   K+  I+VY++TGD+  TATAIARQ+G+                                               + VFA   P HK+  V + Q        KR   V + GDG+ND+PAL ++DVG+A+G  G+DVA +AAD++L+ ++   ++A I+  +     +R+  IA T+ ++    +P+         + + P
Sbjct:  616 IPMDNWDFLGMSAIMDPPRDDTPRAIKACKEAGIKVYMVTGDHKSTATAIARQIGMIDTEEVTNLDHNRQVIRRTNSQDWAVITGPELPGLSEKQWDALLEHRYIVFARTTPEHKLMIVTESQ--------KRGECVTVTGDGVNDAPALKKADVGVAMGLAGSDVAKQAADIILLDDNFSSIVAGIEEGRLLFDNLRKT-IAYTMTHMWPELVPVMLNFFFGFPLGLTP 836          
BLAST of Copper-transporting ATPase 1 vs. Ensembl Celegans
Match: catp-2 (Cation transporting ATPase [Source:UniProtKB/TrEMBL;Acc:A0A131MBN3])

HSP 1 Score: 87.4261 bits (215), Expect = 5.628e-17
Identity = 60/226 (26.55%), Postives = 103/226 (45.58%), Query Frame = 1
Query: 3307 DNELIAMISVADQVKREAALAVYTLKKMNIEVYLMTGDNSKTATAIARQVGI-----------------------------------------------HYVFAEVLPSHKVAKVQQLQNTNRSLTSKRKMKVAMVGDGINDSPALAQSDVGIAIG-TGTDVAVEAADVVLIRNSLLDVIAAIQLSKATVKRIRQNFIAATLYNLLG--IPIAAGVLMPIGIEMMP 3834
            D + + M ++ D  + +   A+   K   I+VY++TGD+  TATAIARQ+G+                                               + VFA   P HK+  V + Q        KR   V + GDG+ND+PAL ++DVG+A+G  G+DVA +AAD++L+ ++   ++A I+  +     +R+  IA T+ ++    +P+         + + P
Sbjct:  616 DWDFLGMSAIMDPPRDDTPKAIKACKAAGIKVYMVTGDHKSTATAIARQIGMIDTEEVSRVDHNQQIIRRSNSQDWAVITGSELPALTQKQWDELLQHRYIVFARTTPEHKLMIVTESQ--------KRGECVTVTGDGVNDAPALKKADVGVAMGLAGSDVAKQAADIILLDDNFSSIVAGIEEGRLLFDNLRKT-IAYTMAHMWPELVPVILNFFFGFPLGLTP 832          
BLAST of Copper-transporting ATPase 1 vs. Ensembl Celegans
Match: catp-2 (Cation transporting ATPase [Source:UniProtKB/TrEMBL;Acc:A0A131MBN3])

HSP 1 Score: 87.4261 bits (215), Expect = 6.007e-17
Identity = 60/226 (26.55%), Postives = 103/226 (45.58%), Query Frame = 1
Query: 3307 DNELIAMISVADQVKREAALAVYTLKKMNIEVYLMTGDNSKTATAIARQVGI-----------------------------------------------HYVFAEVLPSHKVAKVQQLQNTNRSLTSKRKMKVAMVGDGINDSPALAQSDVGIAIG-TGTDVAVEAADVVLIRNSLLDVIAAIQLSKATVKRIRQNFIAATLYNLLG--IPIAAGVLMPIGIEMMP 3834
            D + + M ++ D  + +   A+   K   I+VY++TGD+  TATAIARQ+G+                                               + VFA   P HK+  V + Q        KR   V + GDG+ND+PAL ++DVG+A+G  G+DVA +AAD++L+ ++   ++A I+  +     +R+  IA T+ ++    +P+         + + P
Sbjct:  611 DWDFLGMSAIMDPPRDDTPKAIKACKAAGIKVYMVTGDHKSTATAIARQIGMIDTEEVSRVDHNQQIIRRSNSQDWAVITGSELPALTQKQWDELLQHRYIVFARTTPEHKLMIVTESQ--------KRGECVTVTGDGVNDAPALKKADVGVAMGLAGSDVAKQAADIILLDDNFSSIVAGIEEGRLLFDNLRKT-IAYTMAHMWPELVPVILNFFFGFPLGLTP 827          
BLAST of Copper-transporting ATPase 1 vs. Ensembl Fly
Match: ATP7 (gene:FBgn0030343 transcript:FBtr0334454)

HSP 1 Score: 595.89 bits (1535), Expect = 0.000e+0
Identity = 351/844 (41.59%), Postives = 515/844 (61.02%), Query Frame = 1
Query:  580 GMTCQSCVDNIESTVGKKQGIISIKVFLEKSEAHALVDASLAGP-DVEEMINDMGFNSEMILEIFNDSCAGKPNNVSQKYEELKSNTIYPILSTTIVIKALKSIFCIFKIENHMRALPGVDKCSVNLIEEIGMIDYDSGKWNVQKIREEIESLGYLTEL--------------------------PKQNWNSTRQSSAVSLNEESRSKCYLRITGMTCSSCVNKVESHLLKVEGVKSVLVALLAMKCEIIYDSAYVMPFQLSNRVKELGFNAEVIENGNEGIGIVNVLIRGMTCSSCVNHIENHISKIKGIASINVSLSTSKGKVEYFISECGPRDVIDAINDMGFDASLC---DHLESNHAAADHINQMIKQWRSSFFFSLICGIPXXXXXXXXXXXXXXXXHTIIHENGSNRTIMKSTVPMVCSGLSADNLILFVLATPVQFYGARYFYIQAYLSLKHKTTNMDVLVVMATXXXXXXXXXXXXXXMAFRRNTSPKTFFETSPMLIVFLSLGRWLEHIAKGKTSEALTKLMSLQAVEATLY--TPEN---KERKIPINLVQRNDLIKILPGEKIPVDGKVVTGTSTCDESLITGESMPIEKTHGSDVIGGSINKSGMLIVKATHVGSDSALAQIVKLVEEAQTSKAPIQQLADRIAGMFVPSVLICAIITLIIWVIVGFSKPEILP---KYVNELSVTEITWEHAFQLAITVLSIACPCSLGLXXXXXXXXXXXXXXXNGILIKGGEPLENIHKLNVIVFDKTGTITNGSPSVTRFLVLIGNGVREHIDKLLKILAAAESASEHPIGKAIITFSKARISNENLPEV------LESSAVSGCGL 2979
            GMTCQSCV NI   +G+K GI+ ++V LE++  +   D     P  +   I+DMGF        +    A  P   +  +             T I +  +    C+  IE ++   PG+    V L  +   + YD  +++  +I E I+ +G+   +                          P  ++     + A+ + +E  +KC+L I GMTC+SCV  +E H  K+ G+ S+LVALLA K E+ +++  V    ++  + ELGF  E+I+  + G   V + I GMTC+SCVN IE+H+ KI+G+ + +V+L T +GK  Y   E GPR + +AI  +GF+A L    D +  N+   +H  + I++WR++F  SLI G P              + + ++  +      M   VP    GLS +NL++F+L+TPVQF+G  +FY+Q+Y ++KH TTNMDVL+ M T+ISY+YSV V++ ++   +N+SP TFF+T PML++F+SLGRWLEHIAKGKTSEAL+KL+SL+A +A L   +P+     E+ I ++ VQR D++K++PG K+PVDGKV+ G S+CDESLITGESMP+ K  GS VIGGSIN++G+L+V+ATH G ++ LAQIV+LVEEAQTSKAPIQQLADRIAG FVP V++ + ITLI W+I+GFS P ++P   ++   +    I   +AF+ A++VL+IACPC+LGLATPTAVMV TG GA+NG+L+KG   LEN HK+  +VFDKTGTIT+G+P  ++  + +   V   + + L I+ AAE  SEHPI  AI+ F+K  ++    P+           AV GCG+
Sbjct:   20 GMTCQSCVRNITEHIGQKSGILGVRVILEENAGYFDYDPRQTDPARIASDIDDMGFECS-----YPGDAADPPETPASAW-------------TNIRVVGMTCQSCVRNIEGNIGTKPGIHSIEVQLAAKNARVQYDPAQYDPAQIAELIDDMGFEASVQEPRSPSQSPSPAPASSPKKRATPTPPPPSYAQNGSAVAIPVEQELLTKCFLHIRGMTCASCVAAIEKHCKKIYGLDSILVALLAAKAEVKFNANVVTAENIAKSITELGFPTELIDEPDNGEAEVELEIMGMTCASCVNKIESHVLKIRGVTTASVTLLTKRGKFRYITEETGPRSICEAIEALGFEAKLMTGRDKMAHNY--LEH-KEEIRKWRNAFLVSLIFGGP----------CMVAMIYFMLEMSDKGHANMCCLVP----GLSMENLVMFLLSTPVQFFGGFHFYVQSYRAIKHGTTNMDVLISMVTTISYVYSVAVVIAAVLLEQNSSPLTFFDTPPMLLIFISLGRWLEHIAKGKTSEALSKLLSLKAADALLVEISPDFDIISEKVISVDYVQRGDILKVIPGAKVPVDGKVLYGHSSCDESLITGESMPVAKRKGSVVIGGSINQNGVLLVEATHTGENTTLAQIVRLVEEAQTSKAPIQQLADRIAGYFVPFVVVVSSITLIAWIIIGFSNPNLVPVAMEHKMHMDQNTIIVSYAFKCALSVLAIACPCALGLATPTAVMVATGTGAINGVLVKGATALENAHKVKTVVFDKTGTITHGTPMTSKVTLFVTAQVCS-LARALTIVGAAEQNSEHPIASAIVHFAKDMLNVGATPQAGSFGKSSHFQAVPGCGI 827          

HSP 2 Score: 271.552 bits (693), Expect = 5.848e-74
Identity = 152/280 (54.29%), Postives = 203/280 (72.50%), Query Frame = 1
Query: 3184 VTVIIGNRNWMLRNGILVDDEVDELMSEDENLGRTVILMAIDNELIAMISVADQVKREAALAVYTLKKMNIEVYLMTGDNSKTATAIARQVGIHYVFAEVLPSHKVAKVQQLQNTNRSLTSKRKMKVAMVGDGINDSPALAQSDVGIAIGTGTDVAVEAADVVLIRNSLLDVIAAIQLSKATVKRIRQNFIAATLYNLLGIPIAAGVLMPIGIEMMPWMXXXXXXXXXXXXXXXXXXXXXWKKPSEEKLITPEYINFIQSSGLSESQ-----IIVRRGID 4008
            + V+IGNR WM RN I V  E+ + M+ +E  G T +L A++ +L+ M +V+D VK EA LAVYTLK+M I+V L+TGDN  TA +IAR+VGI  V+AEVLPSHKVAK+Q++Q           ++VAMVGDG+NDSPALAQ+DVGI I  GTDVA EA+D+VL+RN LLDV+A + LS+ TV+RIR NF  A++YNLLGIP+A+G+  P G  ++PWMAS AMAASSVSVV  SLLLK+++KP+ + L T EY   + +   S S+     + + RG+D
Sbjct:  914 ILVLIGNREWMERNAIEVPLEISDCMTHEERKGHTAVLCALNGQLVCMFAVSDMVKPEAHLAVYTLKRMGIDVVLLTGDNKNTAASIAREVGIRTVYAEVLPSHKVAKIQRIQANG--------IRVAMVGDGVNDSPALAQADVGITIAAGTDVAAEASDIVLMRNDLLDVVACLDLSRCTVRRIRYNFFFASMYNLLGIPLASGLFAPYGFTLLPWMASVAMAASSVSVVCSSLLLKMYRKPTAKTLRTAEYEAQLAAERASGSEDELDKLSLHRGLD 1185          

HSP 3 Score: 114.775 bits (286), Expect = 4.091e-25
Identity = 77/269 (28.62%), Postives = 122/269 (45.35%), Query Frame = 1
Query:  568 VRVNGMTCQSCVDNIESTVGKKQGIISIKVFLEKSEAHALVDASLAGP-DVEEMINDMGFNSEM-----------ILEIFNDSCAGKPNNVSQKYEELKSNTIYPILSTTIV-----IKALKSIFCIFKIENHMRALPGVDKCSVNLIEEIGMIDYDSGKWNVQKIREEIESLGYLTELPKQNWNSTRQSSAVSLNEESRSKCYLRITGMTCSSCVNKVESHLLKVEGVKSVLVALLAMKCEIIYDSAYVMPFQLSNRVKELGFNAEVI 1323
            +RV GMTCQSCV NIE  +G K GI SI+V L    A    D +   P  + E+I+DMGF + +                +      P      Y +  S    P+    +      I+ +    C+  IE H + + G+D   V L+     + +++     + I + I  LG+ TEL             +   +   ++  L I GMTC+SCVNK+ESH+LK+ GV +  V LL  + +  Y +    P  +   ++ LGF A+++
Sbjct:   97 IRVVGMTCQSCVRNIEGNIGTKPGIHSIEVQLAAKNARVQYDPAQYDPAQIAELIDDMGFEASVQEPRSPSQSPSPAPASSPKKRATPTPPPPSYAQNGSAVAIPVEQELLTKCFLHIRGMTCASCVAAIEKHCKKIYGLDSILVALLAAKAEVKFNANVVTAENIAKSITELGFPTEL-------------IDEPDNGEAEVELEIMGMTCASCVNKIESHVLKIRGVTTASVTLLTKRGKFRYITEETGPRSICEAIEALGFEAKLM 352          

HSP 4 Score: 85.5001 bits (210), Expect = 3.067e-16
Identity = 48/153 (31.37%), Postives = 76/153 (49.67%), Query Frame = 1
Query: 1105 EESRSKCYLRITGMTCSSCVNKVESHLLKVEGVKSVLVALLAMKCEIIYDSAYVMPFQLSNRVKELGFNAEVIENGNE-----GIGIVNVLIRGMTCSSCVNHIENHISKIKGIASINVSLSTSKGKVEYFISECGPRDVIDAINDMGFDASL 1548
            E + S   L I GMTC SCV  +  H+ +  G+  V V L        YD     P ++++ + ++GF      +  +          N+ + GMTC SCV +IE +I    GI SI V L+    +V+Y  ++  P  + + I+DMGF+AS+
Sbjct:    8 EATMSTVRLPIVGMTCQSCVRNITEHIGQKSGILGVRVILEENAGYFDYDPRQTDPARIASDIDDMGFECSYPGDAADPPETPASAWTNIRVVGMTCQSCVRNIEGNIGTKPGIHSIEVQLAAKNARVQYDPAQYDPAQIAELIDDMGFEASV 160          

HSP 5 Score: 78.5666 bits (192), Expect = 4.329e-14
Identity = 81/315 (25.71%), Postives = 135/315 (42.86%), Query Frame = 1
Query:  112 MKVDGMTCMSCVRNIEENLMKFTGVCGIMVSLLHAEATVIFDADIATVEDISNKIDEMGFDVTVKSSEVSNVKDKVVRSRIKFESDINKSVEKSIETSLSSKLLLVRFCQENNYADIWHYSSIRSTEILSVIQQSEIYGVLVLEQCPTIRVIVRVNGMTCQSCVDNIESTVGKKQGIISIKVFLEKSEAHALVDAS-LAGPDVEEMINDMGFNSEMILEIFNDSCAGKPNNVSQKYEELKSNTIYPILSTTIVIKALKSIFCIFKIENHMRALPGVDKCSVNLIEEIGMIDYDSGKWNVQKIREEIESLGYLTEL 1053
            ++V GMTC SCVRNIE N+    G+  I V L    A V +D        I+  ID+MGF+        ++V++    S+    +  +   +++  T                      Y+   S   + V Q+       +L +C      + + GMTC SCV  IE    K  G+ SI V L  ++A    +A+ +   ++ + I ++GF +E+I E         P+N   + E              + I  +    C+ KIE+H+  + GV   SV L+ + G   Y + +   + I E IE+LG+  +L
Sbjct:   97 IRVVGMTCQSCVRNIEGNIGTKPGIHSIEVQLAAKNARVQYDPAQYDPAQIAELIDDMGFE--------ASVQEPRSPSQSPSPAPASSPKKRATPTPPPPS-----------------YAQNGSAVAIPVEQE-------LLTKC-----FLHIRGMTCASCVAAIEKHCKKIYGLDSILVALLAAKAEVKFNANVVTAENIAKSITELGFPTELIDE---------PDNGEAEVE--------------LEIMGMTCASCVNKIESHVLKIRGVTTASVTLLTKRGKFRYITEETGPRSICEAIEALGFEAKL 351          
BLAST of Copper-transporting ATPase 1 vs. Ensembl Fly
Match: ATP7 (gene:FBgn0030343 transcript:FBtr0273257)

HSP 1 Score: 595.89 bits (1535), Expect = 0.000e+0
Identity = 351/844 (41.59%), Postives = 515/844 (61.02%), Query Frame = 1
Query:  580 GMTCQSCVDNIESTVGKKQGIISIKVFLEKSEAHALVDASLAGP-DVEEMINDMGFNSEMILEIFNDSCAGKPNNVSQKYEELKSNTIYPILSTTIVIKALKSIFCIFKIENHMRALPGVDKCSVNLIEEIGMIDYDSGKWNVQKIREEIESLGYLTEL--------------------------PKQNWNSTRQSSAVSLNEESRSKCYLRITGMTCSSCVNKVESHLLKVEGVKSVLVALLAMKCEIIYDSAYVMPFQLSNRVKELGFNAEVIENGNEGIGIVNVLIRGMTCSSCVNHIENHISKIKGIASINVSLSTSKGKVEYFISECGPRDVIDAINDMGFDASLC---DHLESNHAAADHINQMIKQWRSSFFFSLICGIPXXXXXXXXXXXXXXXXHTIIHENGSNRTIMKSTVPMVCSGLSADNLILFVLATPVQFYGARYFYIQAYLSLKHKTTNMDVLVVMATXXXXXXXXXXXXXXMAFRRNTSPKTFFETSPMLIVFLSLGRWLEHIAKGKTSEALTKLMSLQAVEATLY--TPEN---KERKIPINLVQRNDLIKILPGEKIPVDGKVVTGTSTCDESLITGESMPIEKTHGSDVIGGSINKSGMLIVKATHVGSDSALAQIVKLVEEAQTSKAPIQQLADRIAGMFVPSVLICAIITLIIWVIVGFSKPEILP---KYVNELSVTEITWEHAFQLAITVLSIACPCSLGLXXXXXXXXXXXXXXXNGILIKGGEPLENIHKLNVIVFDKTGTITNGSPSVTRFLVLIGNGVREHIDKLLKILAAAESASEHPIGKAIITFSKARISNENLPEV------LESSAVSGCGL 2979
            GMTCQSCV NI   +G+K GI+ ++V LE++  +   D     P  +   I+DMGF        +    A  P   +  +             T I +  +    C+  IE ++   PG+    V L  +   + YD  +++  +I E I+ +G+   +                          P  ++     + A+ + +E  +KC+L I GMTC+SCV  +E H  K+ G+ S+LVALLA K E+ +++  V    ++  + ELGF  E+I+  + G   V + I GMTC+SCVN IE+H+ KI+G+ + +V+L T +GK  Y   E GPR + +AI  +GF+A L    D +  N+   +H  + I++WR++F  SLI G P              + + ++  +      M   VP    GLS +NL++F+L+TPVQF+G  +FY+Q+Y ++KH TTNMDVL+ M T+ISY+YSV V++ ++   +N+SP TFF+T PML++F+SLGRWLEHIAKGKTSEAL+KL+SL+A +A L   +P+     E+ I ++ VQR D++K++PG K+PVDGKV+ G S+CDESLITGESMP+ K  GS VIGGSIN++G+L+V+ATH G ++ LAQIV+LVEEAQTSKAPIQQLADRIAG FVP V++ + ITLI W+I+GFS P ++P   ++   +    I   +AF+ A++VL+IACPC+LGLATPTAVMV TG GA+NG+L+KG   LEN HK+  +VFDKTGTIT+G+P  ++  + +   V   + + L I+ AAE  SEHPI  AI+ F+K  ++    P+           AV GCG+
Sbjct:   20 GMTCQSCVRNITEHIGQKSGILGVRVILEENAGYFDYDPRQTDPARIASDIDDMGFECS-----YPGDAADPPETPASAW-------------TNIRVVGMTCQSCVRNIEGNIGTKPGIHSIEVQLAAKNARVQYDPAQYDPAQIAELIDDMGFEASVQEPRSPSQSPSPAPASSPKKRATPTPPPPSYAQNGSAVAIPVEQELLTKCFLHIRGMTCASCVAAIEKHCKKIYGLDSILVALLAAKAEVKFNANVVTAENIAKSITELGFPTELIDEPDNGEAEVELEIMGMTCASCVNKIESHVLKIRGVTTASVTLLTKRGKFRYITEETGPRSICEAIEALGFEAKLMTGRDKMAHNY--LEH-KEEIRKWRNAFLVSLIFGGP----------CMVAMIYFMLEMSDKGHANMCCLVP----GLSMENLVMFLLSTPVQFFGGFHFYVQSYRAIKHGTTNMDVLISMVTTISYVYSVAVVIAAVLLEQNSSPLTFFDTPPMLLIFISLGRWLEHIAKGKTSEALSKLLSLKAADALLVEISPDFDIISEKVISVDYVQRGDILKVIPGAKVPVDGKVLYGHSSCDESLITGESMPVAKRKGSVVIGGSINQNGVLLVEATHTGENTTLAQIVRLVEEAQTSKAPIQQLADRIAGYFVPFVVVVSSITLIAWIIIGFSNPNLVPVAMEHKMHMDQNTIIVSYAFKCALSVLAIACPCALGLATPTAVMVATGTGAINGVLVKGATALENAHKVKTVVFDKTGTITHGTPMTSKVTLFVTAQVCS-LARALTIVGAAEQNSEHPIASAIVHFAKDMLNVGATPQAGSFGKSSHFQAVPGCGI 827          

HSP 2 Score: 271.552 bits (693), Expect = 5.848e-74
Identity = 152/280 (54.29%), Postives = 203/280 (72.50%), Query Frame = 1
Query: 3184 VTVIIGNRNWMLRNGILVDDEVDELMSEDENLGRTVILMAIDNELIAMISVADQVKREAALAVYTLKKMNIEVYLMTGDNSKTATAIARQVGIHYVFAEVLPSHKVAKVQQLQNTNRSLTSKRKMKVAMVGDGINDSPALAQSDVGIAIGTGTDVAVEAADVVLIRNSLLDVIAAIQLSKATVKRIRQNFIAATLYNLLGIPIAAGVLMPIGIEMMPWMXXXXXXXXXXXXXXXXXXXXXWKKPSEEKLITPEYINFIQSSGLSESQ-----IIVRRGID 4008
            + V+IGNR WM RN I V  E+ + M+ +E  G T +L A++ +L+ M +V+D VK EA LAVYTLK+M I+V L+TGDN  TA +IAR+VGI  V+AEVLPSHKVAK+Q++Q           ++VAMVGDG+NDSPALAQ+DVGI I  GTDVA EA+D+VL+RN LLDV+A + LS+ TV+RIR NF  A++YNLLGIP+A+G+  P G  ++PWMAS AMAASSVSVV  SLLLK+++KP+ + L T EY   + +   S S+     + + RG+D
Sbjct:  914 ILVLIGNREWMERNAIEVPLEISDCMTHEERKGHTAVLCALNGQLVCMFAVSDMVKPEAHLAVYTLKRMGIDVVLLTGDNKNTAASIAREVGIRTVYAEVLPSHKVAKIQRIQANG--------IRVAMVGDGVNDSPALAQADVGITIAAGTDVAAEASDIVLMRNDLLDVVACLDLSRCTVRRIRYNFFFASMYNLLGIPLASGLFAPYGFTLLPWMASVAMAASSVSVVCSSLLLKMYRKPTAKTLRTAEYEAQLAAERASGSEDELDKLSLHRGLD 1185          

HSP 3 Score: 114.775 bits (286), Expect = 4.091e-25
Identity = 77/269 (28.62%), Postives = 122/269 (45.35%), Query Frame = 1
Query:  568 VRVNGMTCQSCVDNIESTVGKKQGIISIKVFLEKSEAHALVDASLAGP-DVEEMINDMGFNSEM-----------ILEIFNDSCAGKPNNVSQKYEELKSNTIYPILSTTIV-----IKALKSIFCIFKIENHMRALPGVDKCSVNLIEEIGMIDYDSGKWNVQKIREEIESLGYLTELPKQNWNSTRQSSAVSLNEESRSKCYLRITGMTCSSCVNKVESHLLKVEGVKSVLVALLAMKCEIIYDSAYVMPFQLSNRVKELGFNAEVI 1323
            +RV GMTCQSCV NIE  +G K GI SI+V L    A    D +   P  + E+I+DMGF + +                +      P      Y +  S    P+    +      I+ +    C+  IE H + + G+D   V L+     + +++     + I + I  LG+ TEL             +   +   ++  L I GMTC+SCVNK+ESH+LK+ GV +  V LL  + +  Y +    P  +   ++ LGF A+++
Sbjct:   97 IRVVGMTCQSCVRNIEGNIGTKPGIHSIEVQLAAKNARVQYDPAQYDPAQIAELIDDMGFEASVQEPRSPSQSPSPAPASSPKKRATPTPPPPSYAQNGSAVAIPVEQELLTKCFLHIRGMTCASCVAAIEKHCKKIYGLDSILVALLAAKAEVKFNANVVTAENIAKSITELGFPTEL-------------IDEPDNGEAEVELEIMGMTCASCVNKIESHVLKIRGVTTASVTLLTKRGKFRYITEETGPRSICEAIEALGFEAKLM 352          

HSP 4 Score: 85.5001 bits (210), Expect = 3.067e-16
Identity = 48/153 (31.37%), Postives = 76/153 (49.67%), Query Frame = 1
Query: 1105 EESRSKCYLRITGMTCSSCVNKVESHLLKVEGVKSVLVALLAMKCEIIYDSAYVMPFQLSNRVKELGFNAEVIENGNE-----GIGIVNVLIRGMTCSSCVNHIENHISKIKGIASINVSLSTSKGKVEYFISECGPRDVIDAINDMGFDASL 1548
            E + S   L I GMTC SCV  +  H+ +  G+  V V L        YD     P ++++ + ++GF      +  +          N+ + GMTC SCV +IE +I    GI SI V L+    +V+Y  ++  P  + + I+DMGF+AS+
Sbjct:    8 EATMSTVRLPIVGMTCQSCVRNITEHIGQKSGILGVRVILEENAGYFDYDPRQTDPARIASDIDDMGFECSYPGDAADPPETPASAWTNIRVVGMTCQSCVRNIEGNIGTKPGIHSIEVQLAAKNARVQYDPAQYDPAQIAELIDDMGFEASV 160          

HSP 5 Score: 78.5666 bits (192), Expect = 4.329e-14
Identity = 81/315 (25.71%), Postives = 135/315 (42.86%), Query Frame = 1
Query:  112 MKVDGMTCMSCVRNIEENLMKFTGVCGIMVSLLHAEATVIFDADIATVEDISNKIDEMGFDVTVKSSEVSNVKDKVVRSRIKFESDINKSVEKSIETSLSSKLLLVRFCQENNYADIWHYSSIRSTEILSVIQQSEIYGVLVLEQCPTIRVIVRVNGMTCQSCVDNIESTVGKKQGIISIKVFLEKSEAHALVDAS-LAGPDVEEMINDMGFNSEMILEIFNDSCAGKPNNVSQKYEELKSNTIYPILSTTIVIKALKSIFCIFKIENHMRALPGVDKCSVNLIEEIGMIDYDSGKWNVQKIREEIESLGYLTEL 1053
            ++V GMTC SCVRNIE N+    G+  I V L    A V +D        I+  ID+MGF+        ++V++    S+    +  +   +++  T                      Y+   S   + V Q+       +L +C      + + GMTC SCV  IE    K  G+ SI V L  ++A    +A+ +   ++ + I ++GF +E+I E         P+N   + E              + I  +    C+ KIE+H+  + GV   SV L+ + G   Y + +   + I E IE+LG+  +L
Sbjct:   97 IRVVGMTCQSCVRNIEGNIGTKPGIHSIEVQLAAKNARVQYDPAQYDPAQIAELIDDMGFE--------ASVQEPRSPSQSPSPAPASSPKKRATPTPPPPS-----------------YAQNGSAVAIPVEQE-------LLTKC-----FLHIRGMTCASCVAAIEKHCKKIYGLDSILVALLAAKAEVKFNANVVTAENIAKSITELGFPTELIDE---------PDNGEAEVE--------------LEIMGMTCASCVNKIESHVLKIRGVTTASVTLLTKRGKFRYITEETGPRSICEAIEALGFEAKL 351          
BLAST of Copper-transporting ATPase 1 vs. Ensembl Fly
Match: SERCA (gene:FBgn0263006 transcript:FBtr0343281)

HSP 1 Score: 82.0333 bits (201), Expect = 3.358e-15
Identity = 59/225 (26.22%), Postives = 108/225 (48.00%), Query Frame = 1
Query: 3250 DELMSEDE-NLGRTVILMAIDNEL--IAMISVADQVKREAALAVYTLKKMNIEVYLMTGDNSKTATAIARQVGIH-------------------------------YVFAEVLPSHKVAKVQQLQNTNRSLTSKRKMKVAMVGDGINDSPALAQSDVGIAIGTGTDVAVEAADVVLIRNSLLDVIAAIQLSKATVKRIRQ---NFIAATLYNLLGIPIAAGVLMP 3813
            D  M  DE +LG +      +  L  + ++ + D  ++E   ++   +   I V ++TGDN  TA AI R++G+                                 +F+ V P HK   V+ LQ+ N           AM GDG+ND+PAL ++++GIA+G+GT VA  AA++VL  ++   +++A++  +A    ++Q     I++ +  ++ I + A + +P
Sbjct:  568 DSPMKPDEMDLGDSTKFYQYEVNLTFVGVVGMLDPPRKEVFDSIVRCRAAGIRVIVITGDNKATAEAICRRIGVFAEDEDTTGKSYSGREFDDLSPTEQKAAVARSRLFSRVEPQHKSKIVEFLQSMNEI--------SAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSAAEMVLADDNFSSIVSAVEEGRAIYNNMKQFIRYLISSNIGEVVSIFLTAALGLP 784          
BLAST of Copper-transporting ATPase 1 vs. Ensembl Fly
Match: SERCA (gene:FBgn0263006 transcript:FBtr0072216)

HSP 1 Score: 82.0333 bits (201), Expect = 3.664e-15
Identity = 59/225 (26.22%), Postives = 108/225 (48.00%), Query Frame = 1
Query: 3250 DELMSEDE-NLGRTVILMAIDNEL--IAMISVADQVKREAALAVYTLKKMNIEVYLMTGDNSKTATAIARQVGIH-------------------------------YVFAEVLPSHKVAKVQQLQNTNRSLTSKRKMKVAMVGDGINDSPALAQSDVGIAIGTGTDVAVEAADVVLIRNSLLDVIAAIQLSKATVKRIRQ---NFIAATLYNLLGIPIAAGVLMP 3813
            D  M  DE +LG +      +  L  + ++ + D  ++E   ++   +   I V ++TGDN  TA AI R++G+                                 +F+ V P HK   V+ LQ+ N           AM GDG+ND+PAL ++++GIA+G+GT VA  AA++VL  ++   +++A++  +A    ++Q     I++ +  ++ I + A + +P
Sbjct:  568 DSPMKPDEMDLGDSTKFYQYEVNLTFVGVVGMLDPPRKEVFDSIVRCRAAGIRVIVITGDNKATAEAICRRIGVFAEDEDTTGKSYSGREFDDLSPTEQKAAVARSRLFSRVEPQHKSKIVEFLQSMNEI--------SAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSAAEMVLADDNFSSIVSAVEEGRAIYNNMKQFIRYLISSNIGEVVSIFLTAALGLP 784          
BLAST of Copper-transporting ATPase 1 vs. Ensembl Fly
Match: SERCA (gene:FBgn0263006 transcript:FBtr0072211)

HSP 1 Score: 82.0333 bits (201), Expect = 3.664e-15
Identity = 59/225 (26.22%), Postives = 108/225 (48.00%), Query Frame = 1
Query: 3250 DELMSEDE-NLGRTVILMAIDNEL--IAMISVADQVKREAALAVYTLKKMNIEVYLMTGDNSKTATAIARQVGIH-------------------------------YVFAEVLPSHKVAKVQQLQNTNRSLTSKRKMKVAMVGDGINDSPALAQSDVGIAIGTGTDVAVEAADVVLIRNSLLDVIAAIQLSKATVKRIRQ---NFIAATLYNLLGIPIAAGVLMP 3813
            D  M  DE +LG +      +  L  + ++ + D  ++E   ++   +   I V ++TGDN  TA AI R++G+                                 +F+ V P HK   V+ LQ+ N           AM GDG+ND+PAL ++++GIA+G+GT VA  AA++VL  ++   +++A++  +A    ++Q     I++ +  ++ I + A + +P
Sbjct:  568 DSPMKPDEMDLGDSTKFYQYEVNLTFVGVVGMLDPPRKEVFDSIVRCRAAGIRVIVITGDNKATAEAICRRIGVFAEDEDTTGKSYSGREFDDLSPTEQKAAVARSRLFSRVEPQHKSKIVEFLQSMNEI--------SAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSAAEMVLADDNFSSIVSAVEEGRAIYNNMKQFIRYLISSNIGEVVSIFLTAALGLP 784          
BLAST of Copper-transporting ATPase 1 vs. Ensembl Zebrafish
Match: atp7b (ATPase copper transporting beta [Source:ZFIN;Acc:ZDB-GENE-061220-5])

HSP 1 Score: 892.878 bits (2306), Expect = 0.000e+0
Identity = 529/1123 (47.11%), Postives = 722/1123 (64.29%), Query Frame = 1
Query:  562 VIVRVNGMTCQSCVDNIESTVGKKQGIISIKVFLEK--------SEAHALVDASLAGP---DVEEMINDM-GFNSEMI------LEIFNDSCAGKPNNVSQKYEELKSNTI-YPILSTTIVIKALKSIFCIFKIENHMRALPGVDKCSVNLIEEIGMIDYDSGKWNVQKIREEIESLGYLTELPKQNWN--STRQSSAVSLNEESRSKCYLRITGMTCSSCVNKVESHLLKVEGVKSVLVALLAMKCEIIYDSAYVMPFQLSNRVKELGFNAEVIENGNEGIGIVNVLIRGMTCSSCVNHIENHISKIKGIASINVSLSTSKGKVEYFISECGPRDVIDAINDMGFDASLCDHLESNHAAADHINQMIKQWRSSFFFSLICGIPXXXXXXXXXXXXXXXXHTIIHENGSNRTIMKSTVPMVCSGLSADNLILFVLATPVQFYGARYFYIQAYLSLKHKTTNMDVLVVMATXXXXXXXXXXXXXXMAFRRNTSPKTFFETSPMLIVFLSLGRWLEHIAKGKTSEALTKLMSLQAVEATLYT--PEN---KERKIPINLVQRNDLIKILPGEKIPVDGKVVTGTSTCDESLITGESMPIEKTHGSDVIGGSINKSGMLIVKATHVGSDSALAQIVKLVEEAQTSKAPIQQLADRIAGMFVPSVLICAIITLIIWVIVGFSKPEI----LPKYVNELSVTEITWEHAFQLAITVLSIACPCSLGLXXXXXXXXXXXXXXXNGILIKGGEPLENIHKLNVIVFDKTGTITNGSPSVTRFLVLIGNGVREHIDKLLKILAAAESASEHPIGKAIITFSKARISNENLPEVLESSAVSGCGLGCKLNLDPKTEVTKFVKNLINIESPSEETNILGQXXXXXXXXXXXXTYKDVIFPVRQHMAWTSDLCQTVTVIIGNRNWMLRNGILVDDEVDELMSEDENLGRTVILMAIDNELIAMISVADQVKREAALAVYTLKKMNIEVYLMTGDNSKTATAIARQVGIHYVFAEVLPSHKVAKVQQLQNTNRSLTSKRKMKVAMVGDGINDSPALAQSDVGIAIGTGTDVAVEAADVVLIRNSLLDVIAAIQLSKATVKRIRQNFIAATLYNLLGIPIAAGVLMPIGIEMMPWM 3840
            V ++V GMTCQSCV +IE  +G+ +G+I ++V L          SE    V+    G    ++ E ++ M G NS  +      +++  D        V    EE+  N+   P  S TI I+ +    C+  IE  M    GV    V L E+ G++ +DS     +++R EIE +G+   L +  +     +  +A    E    KC++ +TGMTC+SCV+ +E +L+K EG+KSVLVAL+A K E+ YD   + P Q+   +  LGF A V+E  +   G++++ + GMTC+SCV++IE+ + + KGI   +V+L+T+K  V++     G RD++  I  +GF  SL  + E  +   DH  + I+QW+ SF FSL+ GIP M +M++ M            E+G +    ++ +P    GLS  NL  F+L TPVQF G RYFYIQAY SL+H   NMDVL+V+AT+I+Y+YS  V++++M      SP TFF+T PML VF++LGRWLEH+AK KTSEAL KLMSLQA +AT+ +  P+N   +E ++ ++LVQR D++K+ PG K PVDGKV+ GTS  DESLITGE MP+ K  GS VI GSIN  G L+V+ATHVGS++ L+QIVKLVEEAQTSKAPIQQLAD+++G FVP +++ +I+T+  W+I+GF   ++     P Y   +S TE+    AFQ +ITVLSIACPCSLGLATPTAVMVGTGVGA NGILIKGGEPLE  HK+  ++FDKTGTITNG P VTR LVL  +  R  +  +L ++  AE++SEHP+G A+    K  +  E L    +  AV GCG+ CK++          V++L+     ++E++++    +                         SD   + +V+IGNR WMLRNG+ V  +VD  MS  E  G+T IL+AID  L AMI+VAD VK E+ALAV+TL  M IEVY++TGDN +TA AIA QVGI  VFAEVLPSHKVAKVQ+LQ        +R +KVAMVGDG+NDSPALA +D+GIAIGTGTDVA+EAAD+VLIRN LLDV+A+I+LSK TV+RIR NF+ A +YNLLGIP AAGV MP+G+ + PWM
Sbjct:   63 VKIQVEGMTCQSCVRSIEEQIGRLEGVIGVQVSLSDKEPLSTDWSEVTLGVEGMHCGSCVKNITETLSGMLGVNSVFVSLEKGSVDLRFDPSLLTLETVKGFLEEIPLNSASTPTQSVTIGIEGMTCNSCVQAIEGMMSQRAGVCSIKVYLQEKKGIVTFDSTVTCPEELRAEIEDMGFEAWLNQGRYLLIHNKYKNADGTGERELRKCFVHVTGMTCASCVSNIERNLVKHEGIKSVLVALMAGKAEVKYDPGLLDPAQIVQLISHLGFGASVMEEHSVQDGVLDLSVTGMTCASCVHNIESKLLRTKGIQEASVALATNKAHVKFDSDLVGSRDIVRIIEGLGFGVSLIKN-EGLNNTLDH-QEEIRQWKHSFLFSLVFGIPVMGLMIYMMVMDSQH-----KEHGGSMPADQNILP----GLSIINLAFFLLCTPVQFLGGRYFYIQAYRSLRHGVANMDVLIVLATTIAYVYSFTVLIVAMIEGAKQSPLTFFDTPPMLFVFIALGRWLEHVAKSKTSEALAKLMSLQATDATIVSLGPDNTIIREEQVSVDLVQRGDVVKVAPGGKFPVDGKVIEGTSMADESLITGEPMPVIKKAGSCVIAGSINAHGALLVEATHVGSETTLSQIVKLVEEAQTSKAPIQQLADKLSGYFVPFIVVISILTVTAWLIIGFLDFDVVSKNFPGYNQNISRTEVIVRFAFQASITVLSIACPCSLGLATPTAVMVGTGVGAQNGILIKGGEPLEMAHKVGAVMFDKTGTITNGVPQVTRVLVLW-DRARLPLRTVLAVVGTAEASSEHPLGMAVAKHCKEELGAETLGFCHDFQAVPGCGISCKVS---------SVEDLLQNRVTTDESSLVADTDSG------------------------SD-SPSYSVLIGNRQWMLRNGLEVTADVDNAMSSHETKGQTAILVAIDGVLCAMIAVADTVKAESALAVHTLSSMGIEVYMITGDNRRTARAIATQVGIRKVFAEVLPSHKVAKVQELQ--------ERGLKVAMVGDGVNDSPALAHADLGIAIGTGTDVAIEAADIVLIRNDLLDVVASIELSKKTVQRIRINFVFALIYNLLGIPFAAGVFMPLGLVLQPWM 1131          

HSP 2 Score: 114.775 bits (286), Expect = 4.869e-25
Identity = 105/413 (25.42%), Postives = 181/413 (43.83%), Query Frame = 1
Query:  100 GSARMKVDGMTCMSCVRNIEENLMKFTGVCGIMVSLLHAEATVIFDADIATVEDISNKIDEMGFDVTVKSSEVSNVKDKVVRSRIKFESDINKSVEKSIETSLSSKLLL--VRFCQENNYADIWHYSSIRSTEILSVIQQSEIYGVLVLEQCPTIRVIVRVNGMTCQSCVDNIESTVGKKQGIISIKVFLEKSEAHALVDASLAGP-DVEEMINDMGFNSEMILEIFNDSCAGKPNNVSQKYEELKSNTIYPILSTTIVIKALKSIFCIFKIENHMRALPGVDKCSVNLIEEIGMIDYDSGKWNVQKIREEIESLGYLTELPKQNWNSTRQSSAVSLNEESRSKCYLRITGMTCSSCVNKVESHLLKVEGVKSVLVALLAMKCEIIYDSAYVMPFQLSNRVKELGFNAEVIEN 1329
            G  +++V+GMTC SCVR+IEE + +  GV G+ VS             ++  E +S    E+   V                     E     S  K+I  +LS  L +  V    E    D+    S+ + E +    + EI   L     PT  V + + GMTC SCV  IE  + ++ G+ SIKV+L++ +     D+++  P ++   I DMGF + +          G+   +  KY+         +    + +  +    C+  IE ++    G+    V L+     + YD G  +  +I + I  LG+   + +++   + Q   + L+          +TGMTC+SCV+ +ES LL+ +G++   VAL   K  + +DS  V    +   ++ LGF   +I+N
Sbjct:   61 GMVKIQVEGMTCQSCVRSIEEQIGRLEGVIGVQVS-------------LSDKEPLSTDWSEVTLGV---------------------EGMHCGSCVKNITETLSGMLGVNSVFVSLEKGSVDLRFDPSLLTLETVKGFLE-EIP--LNSASTPTQSVTIGIEGMTCNSCVQAIEGMMSQRAGVCSIKVYLQEKKGIVTFDSTVTCPEELRAEIEDMGFEAWL--------NQGRYLLIHNKYKNADGTGERELRKCFVHVTGMTCASCVSNIERNLVKHEGIKSVLVALMAGKAEVKYDPGLLDPAQIVQLISHLGFGASVMEEH---SVQDGVLDLS----------VTGMTCASCVHNIESKLLRTKGIQEASVALATNKAHVKFDSDLVGSRDIVRIIEGLGFGVSLIKN 415          

HSP 3 Score: 52.7582 bits (125), Expect = 4.002e-6
Identity = 30/79 (37.97%), Postives = 45/79 (56.96%), Query Frame = 1
Query:  100 GSARMKVDGMTCMSCVRNIEENLMKFTGVCGIMVSLLHAEATVIFDADIATVEDISNKIDEMGFDVT-VKSSEVSNVKD 333
            G   + V GMTC SCV NIE  L++  G+    V+L   +A V FD+D+    DI   I+ +GF V+ +K+  ++N  D
Sbjct:  345 GVLDLSVTGMTCASCVHNIESKLLRTKGIQEASVALATNKAHVKFDSDLVGSRDIVRIIEGLGFGVSLIKNEGLNNTLD 423          
BLAST of Copper-transporting ATPase 1 vs. Ensembl Zebrafish
Match: atp7a (ATPase copper transporting alpha [Source:ZFIN;Acc:ZDB-GENE-060825-45])

HSP 1 Score: 890.567 bits (2300), Expect = 0.000e+0
Identity = 577/1321 (43.68%), Postives = 787/1321 (59.58%), Query Frame = 1
Query:  103 SARMKVDGMTCMSCVRNIEENLMKFTGVCGIMVSLLHAEATVIFDADIATVEDISNKIDEMGFDVTVKSSEVSNVKDKVVRSRIKFESDINKSVEKSIETSLSSKLLLVRFCQENNYADIWHYSSIRSTEILSVIQQSEIYGVLVLEQCP---TIRVIVRVNGMTCQSCVDNIESTVGKKQGIISIKVFLEKSEAHALVDA-SLAGPDVEEMINDMGFNSEMILEIFNDSCAGKPNNVSQKYEELKSNTIYPILSTT-IVIKALKSIFCIFKIENHMRALPGVDKCSVNLIEEIGMIDYDSGKWNVQKIREEIESLGYLTELPKQN----------------WNSTRQSSAVSLNEESR---------SKCYLRITGMTCSSCVNKVESHLLKVEGVKSVLVALLAMKCEIIYDSAYVMPFQLSNRVKELGFNAEVIENGNEGIGIVNVLIRGMTCSSCVNHIENHISKIKGIASINVSLSTSKGKVEYFISECGPRDVIDAINDMGFDASLCDHLESNHAAADHINQMIKQWRSSFFFSLICGIPXXXXXXXXXXXXXXXXHTIIHENGS--NRTIMKSTVPM---VCSGLSADNLILFVLATPVQFYGARYFYIQAYLSLKHKTTNMDVLVVMATXXXXXXXXXXXXXXMAFRRNTSPKTFFETSPMLIVFLSLGRWLEHIAKGKTSEALTKLMSLQAVEATLYTPEN-----KERKIPINLVQRNDLIKILPGEKIPVDGKVVTGTSTCDESLITGESMPIEKTHGSDVIGGSINKSGMLIVKATHVGSDSALAQIVKLVEEAQTSKAPIQQLADRIAGMFVPSVLICAIITLIIWVIVGFSKPEI----LPKYVNELSVTEITWEHAFQLAITVLSIACPCSLGLXXXXXXXXXXXXXXXNGILIKGGEPLENIHKLNVIVFDKTGTITNGSPSVTRFLVLIGNGVREHIDKLLKILAAAESASEHPIGKAIITFSKARISNENLPEVLESSAVSGCGLGCKLNLDPKTEVTKFVKNLINIESPSEETNILGQXXXXXXXXXXXXTYKDVIF-PVRQHMAWTSDLCQTVTVIIGNRNWMLRNGILVDDEVDELMSEDENLGRTVILMAIDNELIAMISVADQVKREAALAVYTLKKMNIEVYLMTGDNSKTATAIARQVGIHYVFAEVLPSHKVAKVQQLQNTNRSLTSKRKMKVAMVGDGINDSPALAQSDVGIAIGTGTDVAVEAADVVLIRNSLLDVIAAIQLSKATVKRIRQNFIAATLYNLLGIPIAAGVLMPIGIEMMPWMXXXXXXXXXXXXXXXXXXXXXWKKPSEEKL 3930
            + +M+++GM C+SC   IE  + K  GV  I VSL   EA V++   I TV++I  +I+  GF  TV                        KS  + ++ S S                           +LS  +Q+E      L + P   T+  + +V GM C SCV NI+  + K   + S+ V LE  +A    +   ++  ++++ I  +   +      F       P          +   + P++S   I I+ +    C+  IE  +    GV    V+L    G  +YD    + +++R  IE +G+   LP+ N                 + +   SAV  NE            SKC+++I GMTC+SCV  +E +L    G+ SVLVAL+A K E+ Y  + + P +++  ++ELGF A V++N +   G + +++RGMTC+SCV+ IE+++ K KGI   +V+LST+K  ++Y     GPRD+I  I +MGF ASL    +   +  DH ++ I+QW+ SF  SL   +P M +M++ +    M+     H N +  +R    ST+ +   +  GLS  NLI F+   PVQF G RYFY QAY ++KH+T NMDVL+V+AT+I++ YSV+V++++M  R   +P TFF+T PML VF+SLGRWLE IAK KTSEAL+KLMSLQA EAT+ T         E ++ + LVQR D++K++PG K PVDG+V+ G S  DESLITGE+MP+ K  GS VI GSIN++G L++KATHVG+D+ L+QIVKLVEEAQTSKAPIQQ AD+I+  FVP +++ +++TL+ W+I+GF    +     P Y   +S  E     AFQ +ITVL IACPCSLGLATPTAVMVGTGVGA NGILIKGGEPLE  HK+  +VFDKTGTIT G+P V + + ++  G R    KLL I+  AE++SEHP+G AI  + K  +  E+L    +  AV GCG+ C   L   TE      NL+  E    E N     +    +     T   +I  P    +  T+    + TV+IGNR WM RN + V  +VDE M+E E  G T +L+A+DNEL AM+++AD VK EA LAV+ L  M +EV LMTGDNSKTA AIA QVGI  VFAEVLPSHKVAKV+QLQ   +        +VAMVGDG+NDSPALA +DVGIAIGTGTDVA+EAADVVLIRN LLDV+ +I LSK TVKRIR NF+ A +YNL+GIPIAAGV MP+G+ + PWM SAAMA SSVSVV  SLLLK + KP+ EKL
Sbjct:  172 AVKMRIEGMVCLSCTTTIEGKIGKLKGVEKIKVSLESQEAAVVYLPYIITVDEIVKQIEVAGFKATV------------------------KSKPRQLKLSAS-----------------------EVERLLSAPKQTEEK----LSEPPADSTVTTLFQVTGMHCNSCVVNIQDNISKLPAVTSVVVSLENRQASIQHNPKQVSAVELQKAIEALPPGN------FKAIIPASP----------EPGFLQPLVSVAEIHIEGMTCGSCVQSIEGTLSQKKGVRSAQVSLANHKGTFEYDPLLTSPEELRAAIEDMGFDAFLPETNSLVPSVVKSPSLSVRSSSLSPVRSAVKENEAESDAEPSTNTISKCFIQIGGMTCASCVANIERNLKNEYGIHSVLVALMASKAEVRYSPSVIDPLRIAELIRELGFTATVMDNYDGSDGSLELVVRGMTCASCVHKIESNLMKQKGILYASVALSTNKAHIKYDPEVTGPRDIIRLIENMGFTASLVKK-DRPGSHLDH-SREIRQWKRSFQISLFFCVPVMGMMIYMIVVDHMIDKYHQHHNATAEDRAKYHSTMFLEKQLLPGLSIMNLISFLFCVPVQFIGGRYFYCQAYKAVKHRTANMDVLIVLATTIAFTYSVVVLLVAMVERAKVNPITFFDTPPMLFVFISLGRWLEQIAKSKTSEALSKLMSLQATEATVVTLNEDMSVLSEEQVDVELVQRGDVVKVVPGGKFPVDGRVIEGHSMADESLITGEAMPVTKKPGSTVIAGSINQNGSLLIKATHVGTDTTLSQIVKLVEEAQTSKAPIQQFADKISSYFVPFIVVISVLTLLAWIIIGFVNFSLVQTYFPGYDKSISEAEAVIRFAFQASITVLCIACPCSLGLATPTAVMVGTGVGAQNGILIKGGEPLEMAHKIQSVVFDKTGTITYGAPKVVQ-VKMLAEGNRLPRSKLLAIVGTAENSSEHPLGAAITKYCKQELGTESLGTCTDFQAVPGCGIRC---LVSNTE------NLLKREDSDSEENQHNAVLIQISDARAHSTEHPLIMDPQPLTVVQTA----SYTVLIGNREWMRRNALQVRADVDEAMTEHERRGCTAVLVAVDNELCAMVAIADTVKPEAELAVHVLSAMGLEVVLMTGDNSKTARAIAAQVGIRKVFAEVLPSHKVAKVEQLQQEGK--------RVAMVGDGVNDSPALAMADVGIAIGTGTDVAIEAADVVLIRNDLLDVVGSIDLSKKTVKRIRINFVFALMYNLVGIPIAAGVFMPVGLVLQPWMGSAAMALSSVSVVLSSLLLKCYTKPTVEKL 1401          

HSP 2 Score: 141.739 bits (356), Expect = 2.632e-33
Identity = 141/567 (24.87%), Postives = 238/567 (41.98%), Query Frame = 1
Query:   79 LAIRMKLGSARMKVDGMTCMSCVRNIEENLMKFTGVCGIMVSLLHAEATVIFDADIATVEDISNKIDEMGFDVTVKSSEVSNVKDKVVRSRIKFESDINKSVEKSIETSLSSKLLLVRFCQENNYADIWHYSSIRSTEILSVIQQSEIYGVLVLEQC--PTIR---------------VIVRVNGMTCQSCVDNIESTVGKKQGIISIKVFLEKSEAHALVDASLAGPDVEEMINDMGFNSEMILEIFNDSCAGKPNNV--------------SQKYEELKSNTIYPILSTTIVIKALKSIFCIFKIENHMRALPGVDKCSVNLIEEIGMIDYDSGKWNVQKIREEIESLGYLTELPKQNWNSTRQSSA-VSLNEESRSKCYLRITGMTCSSCVNKVESHLLKVEGVKSVLVALLAMKCEIIYDSAYVMPFQLSNRVKELGFNA------------------------------EVIENGNEG--------IGIVNVLIRGMTCSSCVNHIENHISKIKGIASINVSLSTSKGKVEYFISECGPRDVIDAINDMGFDASLCDHLESN 1569
            +A+   L    + V+GMTC SCV++IE  +    GV  I VSL    ATV +D    T + I++ I++MGF+     S ++N     V++  K  S    S + S++ +LS+   +    +    AD    +      ++S  Q  E+   L  +    P +                V +R+ GM C SC   IE  +GK +G+  IKV LE  EA  +    +    V+E++  +          F  +   KP  +               Q  E+L        ++T   +  +    C+  I++++  LP V    V+L      I ++  + +  ++++ IE+      LP  N+ +   +S      +   S   + I GMTC SCV  +E  L + +GV+S  V+L   K    YD     P +L   ++++GF+A                               V EN  E         I    + I GMTC+SCV +IE ++    GI S+ V+L  SK +V Y  S   P  + + I ++GF A++ D+ + +
Sbjct:    1 MALSTNLCRVTLGVEGMTCGSCVQSIEGRIGGLPGVIHIQVSLEQNNATVTYDHTQHTPQSIADAIEDMGFE-----SSLTNATSTPVQTETKVFSKAGCSAD-SVQQALSTLAQIKGVIETQESADNQGLAVTFVPSLVSEDQLGEVLKCLAPDTACRPPLSPKEGSTSRSFSGVEAVKMRIEGMVCLSCTTTIEGKIGKLKGVEKIKVSLESQEAAVVYLPYII--TVDEIVKQIEVAG------FKATVKSKPRQLKLSASEVERLLSAPKQTEEKLSEPPADSTVTTLFQVTGMHCNSCVVNIQDNISKLPAVTSVVVSLENRQASIQHNPKQVSAVELQKAIEA------LPPGNFKAIIPASPEPGFLQPLVSVAEIHIEGMTCGSCVQSIEGTLSQKKGVRSAQVSLANHKGTFEYDPLLTSPEELRAAIEDMGFDAFLPETNSLVPSVVKSPSLSVRSSSLSPVRSAVKENEAESDAEPSTNTISKCFIQIGGMTCASCVANIERNLKNEYGIHSVLVALMASKAEVRYSPSVIDPLRIAELIRELGFTATVMDNYDGS 547          

HSP 3 Score: 52.373 bits (124), Expect = 6.265e-6
Identity = 27/68 (39.71%), Postives = 38/68 (55.88%), Query Frame = 1
Query:  100 GSARMKVDGMTCMSCVRNIEENLMKFTGVCGIMVSLLHAEATVIFDADIATVEDISNKIDEMGFDVTV 303
            GS  + V GMTC SCV  IE NLMK  G+    V+L   +A + +D ++    DI   I+ MGF  ++
Sbjct:  549 GSLELVVRGMTCASCVHKIESNLMKQKGILYASVALSTNKAHIKYDPEVTGPRDIIRLIENMGFTASL 616          
BLAST of Copper-transporting ATPase 1 vs. Ensembl Zebrafish
Match: atp7b (ATPase copper transporting beta [Source:ZFIN;Acc:ZDB-GENE-061220-5])

HSP 1 Score: 881.708 bits (2277), Expect = 0.000e+0
Identity = 561/1196 (46.91%), Postives = 746/1196 (62.37%), Query Frame = 1
Query:  559 RVIVRVNGMTCQSCVDNIESTVGKKQGIISIKVFLEKSEAHALVDASLAGPDVEEMINDMGFNSEMILEIFNDSCAGKPNNVSQKYEELKSNTIYPILSTTIVIKALKSIFCIFKIENHMRALPGVDKCSVNLIEEIGMIDYDSGKWNVQKIREEIESLGY----------------------LTELPKQNWNSTRQSSAVS------LNEESRSKCYLRITGMTCSSCVNKVESHLLKVEGVKSVLVALLAMKCEIIYDSAYVMPFQLSNRVKELGFNAEVIENGNEGIGIVNVLIRGMTCSSCVNHIENHISKIKGIASINVSLSTSKGKVEYFISECGPRDVIDAINDMGFDASLCDHLESNHAAADHINQMIKQWRSSFFFSLICGIPXXXXXXXXXXXXXXXXHTIIHENGSNRTIMKSTVPMVCSGLSADNLILFVLATPVQFYGARYFYIQAYLSLKHKTTNMDVLVVMATXXXXXXXXXXXXXXMAFRRNTSPKTFFETSPMLIVFLSLGRWLEHIAKGKTSEALTKLMSLQAVEATLYT--PEN---KERKIPINLVQRNDLIKILPGEKIPVDGKVVTGTSTCDESLITGESMPIEKTHGSDVIGGSINKSGMLIVKATHVGSDSALAQIVKLVEEAQTSKAPIQQLADRIAGMFVPSVLICAIITLIIWVIVGFSKPEI----LPKYVNELSVTEITWEHAFQLAITVLSIACPCSLGLXXXXXXXXXXXXXXXNGILIKGGEPLENIHKLNVIVFDKTGTITNGSPSVTRFLVLIGNGVREHIDKLLKILAAAESASEHPIGKAIITFSKARISNENLPEVLESSAVSGCGLGCK-------LNLDPKTEVTKFVKNLINIESPSEETNILGQXXXXXXXXXXXXTYKDVIFPVRQHMAWTSDLCQTVTVIIGNRNWMLRNGILVDDEVDELMSEDENLGRTVILMAIDNELIAMISVADQVKREAALAVYTLKKMNIEVYLMTGDNSKTATAIARQVGIHYVFAEVLPSHKVAKVQQLQNTNRSLTSKRKMKVAMVGDGINDSPALAQSDVGIAIGTGTDVAVEAADVVLIRNSLLDVIAAIQLSKATVKRIRQNFIAATLYNLLGIPIAAGVLMPIGIEMMPWMXXXXXXXXXXXXXXXXXXXXXWKKPSEEKLITPEYINFIQSS--GLSESQIIVRRGID 4008
             V + V GM C SCV NI  T+    G+ S+ V LEK       D SL   +  +     GF  E+    F  S  G        +    ++   P  S TI I+ +    C+  IE  M    GV    V L E+ G++ +DS     +++R EIE +G+                      L  LP Q   S    S ++        E    KC++ +TGMTC+SCV+ +E +L+K EG+KSVLVAL+A K E+ YD   + P Q+   +  LGF A V+E  +   G++++ + GMTC+SCV++IE+ + + KGI   +V+L+T+K  V++     G RD++  I  +GF  SL  + E  +   DH  ++  +W+ SF FSL+ GIP M +M++ M            E+G +    ++ +P    GLS  NL  F+L TPVQF G RYFYIQAY SL+H   NMDVL+V+AT+I+Y+YS  V++++M      SP TFF+T PML VF++LGRWLEH+AK KTSEAL KLMSLQA +AT+ +  P+N   +E ++ ++LVQR D++K+ PG K PVDGKV+ GTS  DESLITGE MP+ K  GS VI GSIN  G L+V+ATHVGS++ L+QIVKLVEEAQTSKAPIQQLAD+++G FVP +++ +I+T+  W+I+GF   ++     P Y   +S TE+    AFQ +ITVLSIACPCSLGLATPTAVMVGTGVGA NGILIKGGEPLE  HK+  ++FDKTGTITNG P VTR LVL  +  R  +  +L ++  AE++SEHP+G A+    K  +  E L    +  AV GCG+ CK       L   PKT+ TK         S  ++T +L     +  ++   +   D           +     + +V+IGNR WMLRNG+ V  +VD  MS  E  G+T IL+AID  L AMI+VAD VK E+ALAV+TL  M IEVY++TGDN +TA AIA QVGI  VFAEVLPSHKVAKVQ+LQ        +R +KVAMVGDG+NDSPALA +D+GIAIGTGTDVA+EAAD+VLIRN LLDV+A+I+LSK TV+RIR NF+ A +YNLLGIP AAGV MP+G+ + PWM SAAMAASSVSVV  SLLL+L+KK S E     EY +  QS    LS SQ+    G++
Sbjct:  182 EVTLGVEGMHCGSCVKNITETLSGMLGVNSVFVSLEKGSVDLRFDPSLLTLETVK-----GFLEEIPPGNFRVSIPG--------WSSRLNSASTPTQSVTIGIEGMTCNSCVQAIEGMMSQRAGVCSIKVYLQEKKGIVTFDSTVTCPEELRAEIEDMGFEAWLNQDSEICEVSSVSQMPSGLKHLPSQRHPSKPSPSPITKENADGTGERELRKCFVHVTGMTCASCVSNIERNLVKHEGIKSVLVALMAGKAEVKYDPGLLDPAQIVQLISHLGFGASVMEEHSVQDGVLDLSVTGMTCASCVHNIESKLLRTKGIQEASVALATNKAHVKFDSDLVGSRDIVRIIEGLGFGVSLIKN-EGLNNTLDHQEEI--RWKHSFLFSLVFGIPVMGLMIYMMVMDSQH-----KEHGGSMPADQNILP----GLSIINLAFFLLCTPVQFLGGRYFYIQAYRSLRHGVANMDVLIVLATTIAYVYSFTVLIVAMIEGAKQSPLTFFDTPPMLFVFIALGRWLEHVAKSKTSEALAKLMSLQATDATIVSLGPDNTIIREEQVSVDLVQRGDVVKVAPGGKFPVDGKVIEGTSMADESLITGEPMPVIKKAGSCVIAGSINAHGALLVEATHVGSETTLSQIVKLVEEAQTSKAPIQQLADKLSGYFVPFIVVISILTVTAWLIIGFLDFDVVSKNFPGYNQNISRTEVIVRFAFQASITVLSIACPCSLGLATPTAVMVGTGVGAQNGILIKGGEPLEMAHKVGAVMFDKTGTITNGVPQVTRVLVLW-DRARLPLRTVLAVVGTAEASSEHPLGMAVAKHCKEELGAETLGFCHDFQAVPGCGISCKVSSVEDLLQNSPKTQETK--------ASAVKQTPLLVTLQGVTTDESSLVADTD-----------SGSDSPSYSVLIGNRQWMLRNGLEVTADVDNAMSSHETKGQTAILVAIDGVLCAMIAVADTVKAESALAVHTLSSMGIEVYMITGDNRRTARAIATQVGIRKVFAEVLPSHKVAKVQELQ--------ERGLKVAMVGDGVNDSPALAHADLGIAIGTGTDVAIEAADIVLIRNDLLDVVASIELSKKTVQRIRINFVFALIYNLLGIPFAAGVFMPLGLVLQPWMGSAAMAASSVSVVLSSLLLRLFKKTSVE-----EYESRAQSHKLSLSPSQVSTHVGLE 1319          

HSP 2 Score: 136.732 bits (343), Expect = 8.564e-32
Identity = 117/446 (26.23%), Postives = 205/446 (45.96%), Query Frame = 1
Query:  100 GSARMKVDGMTCMSCVRNIEENLMKFTGVCGIMVSLLHAEATVIFDADIATVEDISNKIDEMGFDVTVKS--SEVSNVKDKVVRSRIKFESDINKSVEKSIETSLSSKLLL--VRFCQENNYADIWHYSSIRSTEILSVIQQSEIYGVLVLE-----------QCPTIRVIVRVNGMTCQSCVDNIESTVGKKQGIISIKVFLEKSEAHALVDASLAGP-DVEEMINDMGFNSEM-----ILEIFNDS--CAGKPNNVSQKYEELKSNTIYPILSTT-------------IVIKALKSIFCIFKIENHMRALPGVDKCSVNLIEEIGMIDYDSGKWNVQKIREEIESLGYLTELPKQNWNSTRQSSAVSLNEESRSKCYLRITGMTCSSCVNKVESHLLKVEGVKSVLVALLAMKCEIIYDSAYVMPFQLSNRVKELGFNAEVIEN 1329
            G  +++V+GMTC SCVR+IEE + +  GV G+ VSL   EA + F+    T ED+  +I++MGFD  + +   ++  +        +  E     S  K+I  +LS  L +  V    E    D+    S+ + E +    +    G   +              PT  V + + GMTC SCV  IE  + ++ G+ SIKV+L++ +     D+++  P ++   I DMGF + +     I E+ + S   +G  +  SQ++    S +  PI                 + +  +    C+  IE ++    G+    V L+     + YD G  +  +I + I  LG+   + +++   + Q   + L+          +TGMTC+SCV+ +ES LL+ +G++   VAL   K  + +DS  V    +   ++ LGF   +I+N
Sbjct:   99 GMVKIQVEGMTCQSCVRSIEEQIGRLEGVIGVQVSLSDKEAILRFNPAKVTPEDMRKRIEDMGFDALILALQGQIQPLSTDWSEVTLGVEGMHCGSCVKNITETLSGMLGVNSVFVSLEKGSVDLRFDPSLLTLETVKGFLEEIPPGNFRVSIPGWSSRLNSASTPTQSVTIGIEGMTCNSCVQAIEGMMSQRAGVCSIKVYLQEKKGIVTFDSTVTCPEELRAEIEDMGFEAWLNQDSEICEVSSVSQMPSGLKHLPSQRHPSKPSPS--PITKENADGTGERELRKCFVHVTGMTCASCVSNIERNLVKHEGIKSVLVALMAGKAEVKYDPGLLDPAQIVQLISHLGFGASVMEEH---SVQDGVLDLS----------VTGMTCASCVHNIESKLLRTKGIQEASVALATNKAHVKFDSDLVGSRDIVRIIEGLGFGVSLIKN 529          

HSP 3 Score: 120.553 bits (301), Expect = 9.549e-27
Identity = 102/389 (26.22%), Postives = 177/389 (45.50%), Query Frame = 1
Query:  562 VIVRVNGMTCQSCVDNIESTVGKKQGIISIKVFLEKSEAHALVDASLAGP-DVEEMINDMGFNSEMILEIFNDSCAGKPNNVSQKYEELKSNTIYPILSTTIVIKALKSIFCIFKIENHMRALPGVDKCSVNLIEEIGMID--YDSGKWNVQKIREEIESLGYLTELPKQNWNSTRQSSAVSLNEES--RSKCYLRITGMTCSSCVNKVESHLLKVEGVKSVLVALLAMKCEIIYDSAYVMPFQLSNRVKELGFNA------EVIE-----------------------------------NGNEGIGIVNVLIRGMTCSSCVNHIENHISKIKGIASINVSLSTSKGKVEYFISECGPRDVIDAINDMGFDASLCDHLESNHAAADHI 1590
            V ++V GMTCQSCV +IE  +G+ +G+I ++V L   EA    + +   P D+ + I DMGF++ +IL +      G+   +S  + E+           T+ ++ +    C+  I   +  + GV+   V+L  E G +D  +D     ++ ++      G+L E+P  N+  +    +  LN  S       + I GMTC+SCV  +E  + +  GV S+ V L   K  + +DS    P +L   ++++GF A      E+ E                                    G   +    V + GMTC+SCV++IE ++ K +GI S+ V+L   K +V+Y      P  ++  I+ +GF AS+ +     H+  D +
Sbjct:  101 VKIQVEGMTCQSCVRSIEEQIGRLEGVIGVQVSLSDKEAILRFNPAKVTPEDMRKRIEDMGFDA-LILAL-----QGQIQPLSTDWSEV-----------TLGVEGMHCGSCVKNITETLSGMLGVNSVFVSL--EKGSVDLRFDPSLLTLETVK------GFLEEIPPGNFRVSIPGWSSRLNSASTPTQSVTIGIEGMTCNSCVQAIEGMMSQRAGVCSIKVYLQEKKGIVTFDSTVTCPEELRAEIEDMGFEAWLNQDSEICEVSSVSQMPSGLKHLPSQRHPSKPSPSPITKENADGTGERELRKCFVHVTGMTCASCVSNIERNLVKHEGIKSVLVALMAGKAEVKYDPGLLDPAQIVQLISHLGFGASVME----EHSVQDGV 460          

HSP 4 Score: 59.3066 bits (142), Expect = 3.931e-8
Identity = 26/66 (39.39%), Postives = 40/66 (60.61%), Query Frame = 1
Query: 1345 GIVNVLIRGMTCSSCVNHIENHISKIKGIASINVSLSTSKGKVEYFISECGPRDVIDAINDMGFDA 1542
            G+V + + GMTC SCV  IE  I +++G+  + VSLS  +  + +  ++  P D+   I DMGFDA
Sbjct:   99 GMVKIQVEGMTCQSCVRSIEEQIGRLEGVIGVQVSLSDKEAILRFNPAKVTPEDMRKRIEDMGFDA 164          

HSP 5 Score: 53.1434 bits (126), Expect = 3.630e-6
Identity = 32/87 (36.78%), Postives = 47/87 (54.02%), Query Frame = 1
Query:  100 GSARMKVDGMTCMSCVRNIEENLMKFTGVCGIMVSLLHAEATVIFDADIATVEDISNKIDEMGFDVT-VKSSEVSNVKDKVVRSRIK 357
            G   + V GMTC SCV NIE  L++  G+    V+L   +A V FD+D+    DI   I+ +GF V+ +K+  ++N  D     R K
Sbjct:  459 GVLDLSVTGMTCASCVHNIESKLLRTKGIQEASVALATNKAHVKFDSDLVGSRDIVRIIEGLGFGVSLIKNEGLNNTLDHQEEIRWK 545          
BLAST of Copper-transporting ATPase 1 vs. Ensembl Zebrafish
Match: atp7a (ATPase copper transporting alpha [Source:ZFIN;Acc:ZDB-GENE-060825-45])

HSP 1 Score: 878.626 bits (2269), Expect = 0.000e+0
Identity = 577/1339 (43.09%), Postives = 787/1339 (58.78%), Query Frame = 1
Query:  103 SARMKVDGMTCMSCVRNIEENLMKFTGVCGIMVSLLHAEATVIFDADIATVEDISNKIDEMGFDVTVKSSEVSNVKDKVVRSRIKFESDINKSVEKSIETSLSSKLLLVRFCQENNYADIWHYSSIRSTEILSVIQQSEIYGVLVLEQCP---TIRVIVRVNGMTCQSCVDNIESTVGKKQGIISIKVFLEKSEAHALVDA-SLAGPDVEEMINDMGFNSEMILEIFNDSCAGKPNNVSQKYEELKSNTIYPILSTT-IVIKALKSIFCIFKIENHMRALPGVDKCSVNLIEEIGMIDYDSGKWNVQKIREEIESLGYLTELPKQN----------------WNSTRQSSAVSLNEESR---------SKCYLRITGMTCSSCVNKVESHLLKVEGVKSVLVALLAMKCEIIYDSAYVMPFQLSNRVKELGFNAEVIENGNEGIGIVNVLIRGMTCSSCVNHIENHISKIKGIASINVSLSTSKGKVEYFISECGPRDVIDAINDMGFDASLCDHLESNHAAADHINQMIKQWRSSFFFSLICGIPXXXXXXXXXXXXXXXXHTIIHENGS--NRTIMKSTVPM---VCSGLSADNLILFVLATPVQFYGARYFYIQAYLSLKHKTTNMDVLVVMATXXXXXXXXXXXXXXMAFRRNTSPKTFFETSPMLIVFLSLGRWLEHIAKGKTSEALTKLMSLQAVEATLYTPEN-----KERKIPINLVQRNDLIKILPGEKIPVDGKVVTGTSTCDESLITGESMPIEKTHGSDVIGGSINKSGMLIVKATHVGSDSALAQIVKLVEEAQTSKAPIQQLADRIAGMFVPSVLICAIITLIIWVIVGFSKPEI----LPKYVNELSVTEITWEHAFQLAITVLSIACPCSLGLXXXXXXXXXXXXXXXNGILIKGGEPLENIHKLNVIVFDKTGTITNGSPSVTRFLVLIGNGVREHIDKLLKILAAAESASEHPIGKAIITFSKARISNENLPEVLESSAVSGCGLGCKLNLDPKTEVTKFVKNLINIESPSEETNILGQXXXXXXXXXXXXTYKDVIF-PVRQHMAWTSDLCQTVTVIIGNRNWMLRNGILVDDEVDELMSEDENLGRTVILMAIDNELIAMISVADQVKREAALAVYTLKKMNIEVYLMTGDNSKTATAIA------------------RQVGIHYVFAEVLPSHKVAKVQQLQNTNRSLTSKRKMKVAMVGDGINDSPALAQSDVGIAIGTGTDVAVEAADVVLIRNSLLDVIAAIQLSKATVKRIRQNFIAATLYNLLGIPIAAGVLMPIGIEMMPWMXXXXXXXXXXXXXXXXXXXXXWKKPSEEKL 3930
            + +M+++GM C+SC   IE  + K  GV  I VSL   EA V++   I TV++I  +I+  GF  TV                        KS  + ++ S S                           +LS  +Q+E      L + P   T+  + +V GM C SCV NI+  + K   + S+ V LE  +A    +   ++  ++++ I  +   +      F       P          +   + P++S   I I+ +    C+  IE  +    GV    V+L    G  +YD    + +++R  IE +G+   LP+ N                 + +   SAV  NE            SKC+++I GMTC+SCV  +E +L    G+ SVLVAL+A K E+ Y  + + P +++  ++ELGF A V++N +   G + +++RGMTC+SCV+ IE+++ K KGI   +V+LST+K  ++Y     GPRD+I  I +MGF ASL    +   +  DH ++ I+QW+ SF  SL   +P M +M++ +    M+     H N +  +R    ST+ +   +  GLS  NLI F+   PVQF G RYFY QAY ++KH+T NMDVL+V+AT+I++ YSV+V++++M  R   +P TFF+T PML VF+SLGRWLE IAK KTSEAL+KLMSLQA EAT+ T         E ++ + LVQR D++K++PG K PVDG+V+ G S  DESLITGE+MP+ K  GS VI GSIN++G L++KATHVG+D+ L+QIVKLVEEAQTSKAPIQQ AD+I+  FVP +++ +++TL+ W+I+GF    +     P Y   +S  E     AFQ +ITVL IACPCSLGLATPTAVMVGTGVGA NGILIKGGEPLE  HK+  +VFDKTGTIT G+P V + + ++  G R    KLL I+  AE++SEHP+G AI  + K  +  E+L    +  AV GCG+ C   L   TE      NL+  E    E N     +    +     T   +I  P    +  T+    + TV+IGNR WM RN + V  +VDE M+E E  G T +L+A+DNEL AM+++AD VK EA LAV+ L  M +EV LMTGDNSKTA AIA                  R VGI  VFAEVLPSHKVAKV+QLQ   +        +VAMVGDG+NDSPALA +DVGIAIGTGTDVA+EAADVVLIRN LLDV+ +I LSK TVKRIR NF+ A +YNL+GIPIAAGV MP+G+ + PWM SAAMA SSVSVV  SLLLK + KP+ EKL
Sbjct:  172 AVKMRIEGMVCLSCTTTIEGKIGKLKGVEKIKVSLESQEAAVVYLPYIITVDEIVKQIEVAGFKATV------------------------KSKPRQLKLSAS-----------------------EVERLLSAPKQTEEK----LSEPPADSTVTTLFQVTGMHCNSCVVNIQDNISKLPAVTSVVVSLENRQASIQHNPKQVSAVELQKAIEALPPGN------FKAIIPASP----------EPGFLQPLVSVAEIHIEGMTCGSCVQSIEGTLSQKKGVRSAQVSLANHKGTFEYDPLLTSPEELRAAIEDMGFDAFLPETNSLVPSVVKSPSLSVRSSSLSPVRSAVKENEAESDAEPSTNTISKCFIQIGGMTCASCVANIERNLKNEYGIHSVLVALMASKAEVRYSPSVIDPLRIAELIRELGFTATVMDNYDGSDGSLELVVRGMTCASCVHKIESNLMKQKGILYASVALSTNKAHIKYDPEVTGPRDIIRLIENMGFTASLVKK-DRPGSHLDH-SREIRQWKRSFQISLFFCVPVMGMMIYMIVVDHMIDKYHQHHNATAEDRAKYHSTMFLEKQLLPGLSIMNLISFLFCVPVQFIGGRYFYCQAYKAVKHRTANMDVLIVLATTIAFTYSVVVLLVAMVERAKVNPITFFDTPPMLFVFISLGRWLEQIAKSKTSEALSKLMSLQATEATVVTLNEDMSVLSEEQVDVELVQRGDVVKVVPGGKFPVDGRVIEGHSMADESLITGEAMPVTKKPGSTVIAGSINQNGSLLIKATHVGTDTTLSQIVKLVEEAQTSKAPIQQFADKISSYFVPFIVVISVLTLLAWIIIGFVNFSLVQTYFPGYDKSISEAEAVIRFAFQASITVLCIACPCSLGLATPTAVMVGTGVGAQNGILIKGGEPLEMAHKIQSVVFDKTGTITYGAPKVVQ-VKMLAEGNRLPRSKLLAIVGTAENSSEHPLGAAITKYCKQELGTESLGTCTDFQAVPGCGIRC---LVSNTE------NLLKREDSDSEENQHNAVLIQISDARAHSTEHPLIMDPQPLTVVQTA----SYTVLIGNREWMRRNALQVRADVDEAMTEHERRGCTAVLVAVDNELCAMVAIADTVKPEAELAVHVLSAMGLEVVLMTGDNSKTARAIAAQVKNHLILPQNAPILLFRMVGIRKVFAEVLPSHKVAKVEQLQQEGK--------RVAMVGDGVNDSPALAMADVGIAIGTGTDVAIEAADVVLIRNDLLDVVGSIDLSKKTVKRIRINFVFALMYNLVGIPIAAGVFMPVGLVLQPWMGSAAMALSSVSVVLSSLLLKCYTKPTVEKL 1419          

HSP 2 Score: 141.739 bits (356), Expect = 3.016e-33
Identity = 141/567 (24.87%), Postives = 238/567 (41.98%), Query Frame = 1
Query:   79 LAIRMKLGSARMKVDGMTCMSCVRNIEENLMKFTGVCGIMVSLLHAEATVIFDADIATVEDISNKIDEMGFDVTVKSSEVSNVKDKVVRSRIKFESDINKSVEKSIETSLSSKLLLVRFCQENNYADIWHYSSIRSTEILSVIQQSEIYGVLVLEQC--PTIR---------------VIVRVNGMTCQSCVDNIESTVGKKQGIISIKVFLEKSEAHALVDASLAGPDVEEMINDMGFNSEMILEIFNDSCAGKPNNV--------------SQKYEELKSNTIYPILSTTIVIKALKSIFCIFKIENHMRALPGVDKCSVNLIEEIGMIDYDSGKWNVQKIREEIESLGYLTELPKQNWNSTRQSSA-VSLNEESRSKCYLRITGMTCSSCVNKVESHLLKVEGVKSVLVALLAMKCEIIYDSAYVMPFQLSNRVKELGFNA------------------------------EVIENGNEG--------IGIVNVLIRGMTCSSCVNHIENHISKIKGIASINVSLSTSKGKVEYFISECGPRDVIDAINDMGFDASLCDHLESN 1569
            +A+   L    + V+GMTC SCV++IE  +    GV  I VSL    ATV +D    T + I++ I++MGF+     S ++N     V++  K  S    S + S++ +LS+   +    +    AD    +      ++S  Q  E+   L  +    P +                V +R+ GM C SC   IE  +GK +G+  IKV LE  EA  +    +    V+E++  +          F  +   KP  +               Q  E+L        ++T   +  +    C+  I++++  LP V    V+L      I ++  + +  ++++ IE+      LP  N+ +   +S      +   S   + I GMTC SCV  +E  L + +GV+S  V+L   K    YD     P +L   ++++GF+A                               V EN  E         I    + I GMTC+SCV +IE ++    GI S+ V+L  SK +V Y  S   P  + + I ++GF A++ D+ + +
Sbjct:    1 MALSTNLCRVTLGVEGMTCGSCVQSIEGRIGGLPGVIHIQVSLEQNNATVTYDHTQHTPQSIADAIEDMGFE-----SSLTNATSTPVQTETKVFSKAGCSAD-SVQQALSTLAQIKGVIETQESADNQGLAVTFVPSLVSEDQLGEVLKCLAPDTACRPPLSPKEGSTSRSFSGVEAVKMRIEGMVCLSCTTTIEGKIGKLKGVEKIKVSLESQEAAVVYLPYII--TVDEIVKQIEVAG------FKATVKSKPRQLKLSASEVERLLSAPKQTEEKLSEPPADSTVTTLFQVTGMHCNSCVVNIQDNISKLPAVTSVVVSLENRQASIQHNPKQVSAVELQKAIEA------LPPGNFKAIIPASPEPGFLQPLVSVAEIHIEGMTCGSCVQSIEGTLSQKKGVRSAQVSLANHKGTFEYDPLLTSPEELRAAIEDMGFDAFLPETNSLVPSVVKSPSLSVRSSSLSPVRSAVKENEAESDAEPSTNTISKCFIQIGGMTCASCVANIERNLKNEYGIHSVLVALMASKAEVRYSPSVIDPLRIAELIRELGFTATVMDNYDGS 547          

HSP 3 Score: 52.373 bits (124), Expect = 6.225e-6
Identity = 27/68 (39.71%), Postives = 38/68 (55.88%), Query Frame = 1
Query:  100 GSARMKVDGMTCMSCVRNIEENLMKFTGVCGIMVSLLHAEATVIFDADIATVEDISNKIDEMGFDVTV 303
            GS  + V GMTC SCV  IE NLMK  G+    V+L   +A + +D ++    DI   I+ MGF  ++
Sbjct:  549 GSLELVVRGMTCASCVHKIESNLMKQKGILYASVALSTNKAHIKYDPEVTGPRDIIRLIENMGFTASL 616          
BLAST of Copper-transporting ATPase 1 vs. Ensembl Zebrafish
Match: atp7a (ATPase copper transporting alpha [Source:ZFIN;Acc:ZDB-GENE-060825-45])

HSP 1 Score: 830.091 bits (2143), Expect = 0.000e+0
Identity = 559/1317 (42.44%), Postives = 756/1317 (57.40%), Query Frame = 1
Query:  103 SARMKVDGMTCMSCVRNIEENLMKFTGVCGIMVSLLHAEATVIFDADIATVEDISNKIDEMGFDVTVKSSEVSNVKDKVVRSRIKFESDINKSVEKSIETSLSSKLLLVRFCQENNYADIWHYSSIRSTEILSVIQQSEIYGVLVLEQCP---TIRVIVRVNGMTCQSCVDNIESTVGKKQGIISIKVFLEKSEAHALVDA-SLAGPDVEEMINDMGFNSEMILEIFNDSCAGKPNNVSQKYEELKSNTIYPILSTT-IVIKALKSIFCIFKIENHMRALPGVDKCSVNLIEEIGMIDYDSGKWNVQKIREEIESLGYLTELPKQN----------------WNSTRQSSAVSLNEESR---------SKCYLRITGMTCSSCVNKVESHLLKVEGVKSVLVALLAMKCEIIYDSAYVMPFQLSNRVKELGFNAEVIENGNEGIGIVNVLIRGMTCSSCVNHIENHISKIKGIASINVSLSTSKGKVEYFISECGPRDVIDAINDMGFDASLCDHLESNHAAADHINQMIKQWRSSFFFSLICGIPXXXXXXXXXXXXXXXXHTIIHENGS--NRTIMKSTV---PMVCSGLSADNLILFVLATPVQFYGARYFYIQAYLSLKHKTTNMDVLVVMATXXXXXXXXXXXXXXMAFRRNTSPKTFFETSPMLIVFLSLGRWLEHIAKGKTSEALTKLMSLQAVEATLYTPEN-----KERKIPINLVQRNDLIKILPGEKIPVDGKVVTGTSTCDESLITGESMPIEKTHGSDVIGGSINKSGMLIVKATHVGSDSALAQIVKLVEEAQTSKAPIQQLADRIAGMFVPSVLICAIITLIIWVIVGFSKPEILPKYVNELSVTEITWEHAFQLAITVLSIACPCSLGLXXXXXXXXXXXXXXXNGILIKGGEPLENIHKLNVIVFDKTGTITNGSPSVTRFLVLIGNGVREHIDKLLKILAAAESASEHPIGKAIITFSKARISNENLPEVLESSAVSGCGLGCKLNLDPKTEVTKFVKNLINIESPSEETNILGQXXXXXXXXXXXXTYKDVIF-PVRQHMAWTSDLCQTVTVIIGNRNWMLRNGILVDDEVDELMSEDENLGRTVILMAIDNELIAMISVADQVKREAALAVYTLKKMNIEVYLMTGDNSKTATAIARQVGIHYVFAEVLPSHKVAKVQQLQNTNRSLTSKRKMKVAMVGDGINDSPALAQSDVGIAIGTGTDVAVEAADVVLIRNSLLDVIAAIQLSKATVKRIRQNFIAATLYNLLGIPIAAGVLMPIGIEMMPWMXXXXXXXXXXXXXXXXXXXXXWKKPSEEKL 3930
            + +M+++GM C+SC   IE  + K  GV  I VSL   EA V++   I TV++I  +I+  GF  TV                        KS  + ++ S S                           +LS  +Q+E      L + P   T+  + +V GM C SCV NI+  + K   + S+ V LE  +A    +   ++  ++++ I  +   +      F       P          +   + P++S   I I+ +    C+  IE  +    GV    V+L    G  +YD    + +++R  IE +G+   LP+ N                 + +   SAV  NE            SKC+++I GMTC+SCV  +E +L    G+ SVLVAL+A K E+ Y  + + P +++  ++ELGF A V++N +   G + +++RGMTC+SCV+ IE+++ K KGI   +V+LST+K  ++Y     GPRD+I  I +MGF ASL    +   +  DH ++ I+QW+ SF  SL   +P M +M++ +    M+     H N +  +R    ST+     +  GLS  NLI F+   PVQF G RYFY QAY ++KH+T NMDVL+V+AT+I++ YSV+V++++M  R   +P TFF+T PML VF+SLGRWLE IAK KTSEAL+KLMSLQA EAT+ T         E ++ + LVQR D++K++PG K PVDG+V+ G S  DESLITGE+MP+ K  GS VI GSIN++G L++KATHVG+D+ L+QIVKLVEEAQTSK                                          Y   +S  E     AFQ +ITVL IACPCSLGLATPTAVMVGTGVGA NGILIKGGEPLE  HK+  +VFDKTGTIT G+P V + + ++  G R    KLL I+  AE++SEHP+G AI  + K  +  E+L    +  AV GCG+ C   L   TE      NL+  E    E N     +    +     T   +I  P    +  T+    + TV+IGNR WM RN + V  +VDE M+E E  G T +L+A+DNEL AM+++AD VK EA LAV+ L  M +EV LMTGDNSKTA AIA QVGI  VFAEVLPSHKVAKV+QLQ   +        +VAMVGDG+NDSPALA +DVGIAIGTGTDVA+EAADVVLIRN LLDV+ +I LSK TVKRIR NF+ A +YNL+GIPIAAGV MP+G+ + PWM SAAMA SSVSVV  SLLLK + KP+ EKL
Sbjct:  172 AVKMRIEGMVCLSCTTTIEGKIGKLKGVEKIKVSLESQEAAVVYLPYIITVDEIVKQIEVAGFKATV------------------------KSKPRQLKLSAS-----------------------EVERLLSAPKQTEEK----LSEPPADSTVTTLFQVTGMHCNSCVVNIQDNISKLPAVTSVVVSLENRQASIQHNPKQVSAVELQKAIEALPPGN------FKAIIPASP----------EPGFLQPLVSVAEIHIEGMTCGSCVQSIEGTLSQKKGVRSAQVSLANHKGTFEYDPLLTSPEELRAAIEDMGFDAFLPETNSLVPSVVKSPSLSVRSSSLSPVRSAVKENEAESDAEPSTNTISKCFIQIGGMTCASCVANIERNLKNEYGIHSVLVALMASKAEVRYSPSVIDPLRIAELIRELGFTATVMDNYDGSDGSLELVVRGMTCASCVHKIESNLMKQKGILYASVALSTNKAHIKYDPEVTGPRDIIRLIENMGFTASLVKK-DRPGSHLDH-SREIRQWKRSFQISLFFCVPVMGMMIYMIVVDHMIDKYHQHHNATAEDRAKYHSTMFLEKQLLPGLSIMNLISFLFCVPVQFIGGRYFYCQAYKAVKHRTANMDVLIVLATTIAFTYSVVVLLVAMVERAKVNPITFFDTPPMLFVFISLGRWLEQIAKSKTSEALSKLMSLQATEATVVTLNEDMSVLSEEQVDVELVQRGDVVKVVPGGKFPVDGRVIEGHSMADESLITGEAMPVTKKPGSTVIAGSINQNGSLLIKATHVGTDTTLSQIVKLVEEAQTSKG-----------------------------------------YDKSISEAEAVIRFAFQASITVLCIACPCSLGLATPTAVMVGTGVGAQNGILIKGGEPLEMAHKIQSVVFDKTGTITYGAPKVVQ-VKMLAEGNRLPRSKLLAIVGTAENSSEHPLGAAITKYCKQELGTESLGTCTDFQAVPGCGIRC---LVSNTE------NLLKREDSDSEENQHNAVLIQISDARAHSTEHPLIMDPQPLTVVQTA----SYTVLIGNREWMRRNALQVRADVDEAMTEHERRGCTAVLVAVDNELCAMVAIADTVKPEAELAVHVLSAMGLEVVLMTGDNSKTARAIAAQVGIRKVFAEVLPSHKVAKVEQLQQEGK--------RVAMVGDGVNDSPALAMADVGIAIGTGTDVAIEAADVVLIRNDLLDVVGSIDLSKKTVKRIRINFVFALMYNLVGIPIAAGVFMPVGLVLQPWMGSAAMALSSVSVVLSSLLLKCYTKPTVEKL 1356          

HSP 2 Score: 141.354 bits (355), Expect = 4.388e-33
Identity = 141/567 (24.87%), Postives = 238/567 (41.98%), Query Frame = 1
Query:   79 LAIRMKLGSARMKVDGMTCMSCVRNIEENLMKFTGVCGIMVSLLHAEATVIFDADIATVEDISNKIDEMGFDVTVKSSEVSNVKDKVVRSRIKFESDINKSVEKSIETSLSSKLLLVRFCQENNYADIWHYSSIRSTEILSVIQQSEIYGVLVLEQC--PTIR---------------VIVRVNGMTCQSCVDNIESTVGKKQGIISIKVFLEKSEAHALVDASLAGPDVEEMINDMGFNSEMILEIFNDSCAGKPNNV--------------SQKYEELKSNTIYPILSTTIVIKALKSIFCIFKIENHMRALPGVDKCSVNLIEEIGMIDYDSGKWNVQKIREEIESLGYLTELPKQNWNSTRQSSA-VSLNEESRSKCYLRITGMTCSSCVNKVESHLLKVEGVKSVLVALLAMKCEIIYDSAYVMPFQLSNRVKELGFNA------------------------------EVIENGNEG--------IGIVNVLIRGMTCSSCVNHIENHISKIKGIASINVSLSTSKGKVEYFISECGPRDVIDAINDMGFDASLCDHLESN 1569
            +A+   L    + V+GMTC SCV++IE  +    GV  I VSL    ATV +D    T + I++ I++MGF+     S ++N     V++  K  S    S + S++ +LS+   +    +    AD    +      ++S  Q  E+   L  +    P +                V +R+ GM C SC   IE  +GK +G+  IKV LE  EA  +    +    V+E++  +          F  +   KP  +               Q  E+L        ++T   +  +    C+  I++++  LP V    V+L      I ++  + +  ++++ IE+      LP  N+ +   +S      +   S   + I GMTC SCV  +E  L + +GV+S  V+L   K    YD     P +L   ++++GF+A                               V EN  E         I    + I GMTC+SCV +IE ++    GI S+ V+L  SK +V Y  S   P  + + I ++GF A++ D+ + +
Sbjct:    1 MALSTNLCRVTLGVEGMTCGSCVQSIEGRIGGLPGVIHIQVSLEQNNATVTYDHTQHTPQSIADAIEDMGFE-----SSLTNATSTPVQTETKVFSKAGCSAD-SVQQALSTLAQIKGVIETQESADNQGLAVTFVPSLVSEDQLGEVLKCLAPDTACRPPLSPKEGSTSRSFSGVEAVKMRIEGMVCLSCTTTIEGKIGKLKGVEKIKVSLESQEAAVVYLPYII--TVDEIVKQIEVAG------FKATVKSKPRQLKLSASEVERLLSAPKQTEEKLSEPPADSTVTTLFQVTGMHCNSCVVNIQDNISKLPAVTSVVVSLENRQASIQHNPKQVSAVELQKAIEA------LPPGNFKAIIPASPEPGFLQPLVSVAEIHIEGMTCGSCVQSIEGTLSQKKGVRSAQVSLANHKGTFEYDPLLTSPEELRAAIEDMGFDAFLPETNSLVPSVVKSPSLSVRSSSLSPVRSAVKENEAESDAEPSTNTISKCFIQIGGMTCASCVANIERNLKNEYGIHSVLVALMASKAEVRYSPSVIDPLRIAELIRELGFTATVMDNYDGS 547          

HSP 3 Score: 51.9878 bits (123), Expect = 7.015e-6
Identity = 27/68 (39.71%), Postives = 38/68 (55.88%), Query Frame = 1
Query:  100 GSARMKVDGMTCMSCVRNIEENLMKFTGVCGIMVSLLHAEATVIFDADIATVEDISNKIDEMGFDVTV 303
            GS  + V GMTC SCV  IE NLMK  G+    V+L   +A + +D ++    DI   I+ MGF  ++
Sbjct:  549 GSLELVVRGMTCASCVHKIESNLMKQKGILYASVALSTNKAHIKYDPEVTGPRDIIRLIENMGFTASL 616          
BLAST of Copper-transporting ATPase 1 vs. Ensembl Xenopus
Match: dhx34 (DEAH-box helicase 34 [Source:Xenbase;Acc:XB-GENE-1009178])

HSP 1 Score: 920.613 bits (2378), Expect = 0.000e+0
Identity = 584/1305 (44.75%), Postives = 802/1305 (61.46%), Query Frame = 1
Query:  109 RMKVDGMTCMSCVRNIEENLMKFTGVCGIMVSLLHAEATVIFDADIATVEDISNKIDEMGFDVTVKSSEVSNVKDKVVRSRIKFESDINKSVEKSIETSLSSKLLLVRFCQENNYADIWHYSSIRSTEILSVIQQSEIYGVLVLEQCPTIRVIVRVNGMTCQSCVDNIESTVGKKQGIISIKVFLEKSEA----HALVDASLAGPDVEEMINDMGF-----NSEMILEIFNDSCAGKPNNVSQKYEELKSNTIYPILSTTIVIKALKSIFCIFKIENHMRALPGVDKCSVNLIEEIGMIDYDSGKWNVQKIREEIESLGYLTELPKQNWNSTRQSSAVSLNEESRS--KCYLRITGMTCSSCVNKVESHLLKVEGVKSVLVALLAMKCEIIYDSAYVMPFQLSNRVKELGFNAEVIENGNEGIGIVNVLIRGMTCSSCVNHIENHISKIKGIASINVSLSTSKGKVEYFISECGPRDVIDAINDMGFDASLCDHLESNHAAADHINQM--IKQWRSSFFFSLICGIPXXXXXXXXXXXXXXXXHTII--HENGSNRTIMKSTVPMVCS-----GLSADNLILFVLATPVQFYGARYFYIQAYLSLKHKTTNMDVLVVMATXXXXXXXXXXXXXXMAFRRNTSPKTFFETSPMLIVFLSLGRWLEHIAKGKTSEALTKLMSLQAVEAT--LYTPEN---KERKIPINLVQRNDLIKILPGEKIPVDGKVVTGTSTCDESLITGESMPIEKTHGSDVIGGSINKSGMLIVKATHVGSDSALAQIVKLVEEAQTSKAPIQQLADRIAGMFVPSVLICAIITLIIWVIVGFSKPEI----LPKYVNELSVTEITWEHAFQLAITVLSIACPCSLGLXXXXXXXXXXXXXXXNGILIKGGEPLENIHKLNVIVFDKTGTITNGSPSVTRFLVLIGNGVREHIDKLLKILAAAESASEHPIGKAIITFSKARISNENLPEVLESSAVSGCGLGCKL-NLDPKTEVTKFVKNLINIESPSEETNILGQXXXXXXXXXXXXTYKDVIFP-VRQHMAWTSDLCQTVTVIIGNRNWMLRNGILVDDEVDELMSEDENLGRTVILMAIDNELIAMISVADQVKREAALAVYTLKKMNIEVYLMTGDNSKTATAIARQVGIHYVFAEVLPSHKVAKVQQLQNTNRSLTSKRKMKVAMVGDGINDSPALAQSDVGIAIGTGTDVAVEAADVVLIRNSLLDVIAAIQLSKATVKRIRQNFIAATLYNLLGIPIAAGVLMPIGIEMMPWMXXXXXXXXXXXXXXXXXXXXXWKKPSEEKL 3930
            +MK++GMTC SC   IE  + K  GV  I VSL   EA +++   +   EDI  +I+E GF        ++ +K K  +     +      +E+   T            Q N+  D+         ++                    IR I ++ GM C+SCV NIES +G + G+ SI+V LE   A    ++ +  S A     E ++   F     N   + E F+     + +   + +    SN  +    T I I+ +  + C+  IE  +   PGV    V+L+   G + YD    + + IR  IE +G+   L       T + + V    E R+  KC+++ITGMTC+SCV  +E +L + EG+ SVLVAL+A K E+ Y+   + P  ++  ++ELGF A V+EN ++G GI+ +L+RGMTC+SCV+ IE+ + K KG+   +V+L+T+K  +++     GPRD++  IND+GF  SL     S    A H++    I++W+ SF  SLI  IP M +M+  MF      H ++  H N +   I      MV       GLS  NL+  +L  PVQF G  YFYIQAY +LKH+T NMDVL+V+ATS+++IYS+IV+++++  +   +P TFF+T PML VF++LGRWLEHIAK KTSEAL++L+SLQA EAT  +  P+N    E ++ + LVQR D++++ PG K PVDG+V+ G S  DESLITGE+MP+ K  GS VI GSIN++G L++ ATHVGSD+ L+QIVKLVE+AQTSKAPIQQ AD+++G FVP ++  +++TL +W+I+G+   EI     P Y   +S  E+    AFQ AITVL IACPCSLGLATPTAVMVGTGVGA NGILIKGGEPLE  HK+  +VFDKTGTIT G+P V +  VL+ +  R   +KLL I+  AES SEHP+G A+I + K  ++ E L    +  AV GCG+ CK+ N++P         N  N    +    I GQ             ++D I P +      +S   QT +V+IGNR WM RN + +  E D LM+E E  GRT +L+A+D  L  +I++AD VK EAALA+++L+ M +++ LMTGDNSKTA  IA QVGI  VFAEVLPSHKVAKV+QLQ        ++  +VAMVGDGINDSPALA +DVGI IG+GTDVA+EAADVVLIRN LLDV+A+I LS+ TVKRIR NF+ A +YNL+GIPIAAGV MP+G+ + PWM SAAMAASSVSVV  SLLLKL++KPS EKL
Sbjct:  168 KMKIEGMTCHSCTSTIEGKVGKLKGVQRIKVSLDSQEAQILYQPHLIKPEDIRTQIEEAGF--------IAQIKSKPPQKLGAID------IERLTNT------------QTNSNGDLPQKIPKHQNDL--------------------IRAIFQIEGMHCKSCVVNIESNIGSQHGVSSIEVSLENKLAVIHFYSNITTSDALIQAIEALSPGTFKVSLCNHPELAETFSMQKNSEASCAKEIFSS-PSNQDFCSKVTVINIEGMTCMSCVQSIEGLISKKPGVKSIQVSLVNNNGTVQYDPAVTSPEDIRAAIEDMGFDASL----LERTNKETPVHSKPEKRTVNKCFIQITGMTCASCVANIERNLRREEGIYSVLVALMAGKAEVRYNPEVLQPSGIAELIQELGFEASVLENYDDGTGILELLVRGMTCASCVHKIESRLMKTKGVLYSSVALATNKAHIKFDPEVIGPRDIMKIINDLGFSTSLVKKDRS----ASHLDHRVEIQRWKRSFLISLIFCIPVMGLMVHMMFMEN---HYLMPHHHNMTMEDIASYHPTMVLEYQIIPGLSIMNLVSLLLCIPVQFLGGWYFYIQAYKALKHRTANMDVLIVLATSVAFIYSLIVLIVAIFEKSKVNPITFFDTPPMLFVFIALGRWLEHIAKSKTSEALSRLISLQATEATVVILDPDNTVKSEEQVDVELVQRGDIVRVTPGGKFPVDGRVIEGQSMVDESLITGEAMPVSKKPGSSVIAGSINQNGSLLIAATHVGSDTTLSQIVKLVEDAQTSKAPIQQFADKLSGYFVPFIVAVSVLTLFVWIIIGYHNFEIVEKYFPGYNKSISKGEVIVRFAFQAAITVLCIACPCSLGLATPTAVMVGTGVGAQNGILIKGGEPLEMAHKVKTVVFDKTGTITKGTPVVMQVKVLVESN-RMPSNKLLAIVGTAESNSEHPLGSAVIKYCKEVLNAETLGTCYDFQAVPGCGISCKVNNIEPLLHAANGPDNKRN----AVLVQIDGQ-------------HEDSILPSITVSQNPSSSPPQTYSVLIGNREWMNRNFLTLTAETDSLMTEHEKKGRTAVLVAVDGVLCGLIAIADTVKPEAALAIHSLRSMGLDIVLMTGDNSKTAKTIAAQVGITKVFAEVLPSHKVAKVKQLQ--------EQGTRVAMVGDGINDSPALAMADVGITIGSGTDVAIEAADVVLIRNDLLDVVASIDLSRKTVKRIRINFVFALIYNLVGIPIAAGVFMPVGLILQPWMGSAAMAASSVSVVFSSLLLKLYRKPSREKL 1388          

HSP 2 Score: 160.999 bits (406), Expect = 4.723e-39
Identity = 140/537 (26.07%), Postives = 242/537 (45.07%), Query Frame = 1
Query:  106 ARMKVDGMTCMSCVRNIEENLMKFTGVCGIMVSLLHAEATVIFDADIATVEDISNKIDEMGFDVTVKSSEVSNVKDKVVRSRIKFES---DINKSVEK-----SIETSLSSKLLLVRFCQENNYADIWHYSSIRSTEILSVIQQSEIYGVLVLEQCPTIRVIV--RVNGMTCQSCVDNIESTVGKKQGIISIKVFLEKSEAHALVDASLAGP-DVEEMINDMGFNSEMI-----------LEIFNDSCAGKPNNVSQKYEELKSNTIYPILSTTIVIKALKSIFCIFKIENHMRALPGVDKCSVNLIEEIGMIDYDSGKWNVQKIREEIESLGYLTELPKQNWNSTRQSSAVSLNEESRSKC------------------YLRITGMTCSSCVNKVESHLLKVEGVKSVLVALLAMKCEIIYDSAYVMPFQLSNRVKELGFNAEVIENGNEGIGI--------VN---VLIRGMTCSSCVNHIENHISKIKGIASINVSLSTSKGKVEYFISECGPRDVIDAINDMGFDASLCDHLE 1563
            A + V+GMTC SCV+ IE+ +    GV  I VSL    A +I+DA + T + +   +++MGF+ T+  +    V       R+  E     I   + +      ++TSL  K+  V F        +     I    + S+  +    G +         V+V  ++ GMTC SC   IE  VGK +G+  IKV L+  EA  L    L  P D+   I + GF +++            +E   ++      ++ QK  + +++ I  I      I+ +    C+  IE+++ +  GV    V+L  ++ +I + S       + + IE+L   T       N    +   S+ + S + C                   + I GMTC SCV  +E  + K  GVKS+ V+L+     + YD A   P  +   ++++GF+A ++E  N+   +        VN   + I GMTC+SCV +IE ++ + +GI S+ V+L   K +V Y      P  + + I ++GF+AS+ ++ +
Sbjct:    6 AFIPVEGMTCNSCVQTIEQKIGSINGVHSIKVSLEGKNAAIIYDAKLQTPKALQEAVEDMGFESTLSYANPQPVPMDSTFLRLSAEQSAEQIRSGLSQFKGVLDVKTSLEGKVACVTFIPSVVNPGLL-IQKIPGLSLDSMASKKTTSGSVESRSSVASDVLVKMKIEGMTCHSCTSTIEGKVGKLKGVQRIKVSLDSQEAQILYQPHLIKPEDIRTQIEEAGFIAQIKSKPPQKLGAIDIERLTNTQTNSNGDLPQKIPKHQNDLIRAIFQ----IEGMHCKSCVVNIESNIGSQHGVSSIEVSLENKLAVIHFYSNITTSDALIQAIEALSPGT-FKVSLCNHPELAETFSMQKNSEASCAKEIFSSPSNQDFCSKVTVINIEGMTCMSCVQSIEGLISKKPGVKSIQVSLVNNNGTVQYDPAVTSPEDIRAAIEDMGFDASLLERTNKETPVHSKPEKRTVNKCFIQITGMTCASCVANIERNLRREEGIYSVLVALMAGKAEVRYNPEVLQPSGIAELIQELGFEASVLENYD 536          
BLAST of Copper-transporting ATPase 1 vs. Ensembl Xenopus
Match: dhx34 (DEAH-box helicase 34 [Source:Xenbase;Acc:XB-GENE-1009178])

HSP 1 Score: 919.072 bits (2374), Expect = 0.000e+0
Identity = 588/1325 (44.38%), Postives = 807/1325 (60.91%), Query Frame = 1
Query:  109 RMKVDGMTCMSCVRNIEENLMKFTGVCGIMVSLLHAEATVIFDADIATVEDISNKIDEMGFDVTVKSSEVSNVKDKVVRSRIKFESDINKSVEKSIETSLSSKLLLVRFCQENNYADIWHYSSIRSTEILSVIQQSEIYGVLVLEQCPTIRVIVRVNGMTCQSCVDNIESTVGKKQGIISIKVFLEKSEA----HALVDASLAGPDVEEMINDMGF-----NSEMILEIFNDSCAGKPNNVSQKYEELKSNTIYPILSTTIVIKALKSIFCIFKIENHMRALPGVDKCSVNLIEEIGMIDYDSGKWNVQKIREEIESLGYLTEL------------------PKQNWNSTRQSSAVSLNEESRS--KCYLRITGMTCSSCVNKVESHLLKVEGVKSVLVALLAMKCEIIYDSAYVMPFQLSNRVKELGFNAEVIENGNEGIGIVNVLIRGMTCSSCVNHIENHISKIKGIASINVSLSTSKGKVEYFISECGPRDVIDAINDMGFDASLCDHLESNHAAADHINQM--IKQWRSSFFFSLICGIPXXXXXXXXXXXXXXXXHTII--HENGSNRTIMKSTVPMVCS-----GLSADNLILFVLATPVQFYGARYFYIQAYLSLKHKTTNMDVLVVMATXXXXXXXXXXXXXXMAFRRNTSPKTFFETSPMLIVFLSLGRWLEHIAKGKTSEALTKLMSLQAVEAT--LYTPEN---KERKIPINLVQRNDLIKILPGEKIPVDGKVVTGTSTCDESLITGESMPIEKTHGSDVIGGSINKSGMLIVKATHVGSDSALAQIVKLVEEAQTSKAPIQQLADRIAGMFVPSVLICAIITLIIWVIVGFSKPEI----LPKYVNELSVTEITWEHAFQLAITVLSIACPCSLGLXXXXXXXXXXXXXXXNGILIKGGEPLENIHKLNVIVFDKTGTITNGSPSVTRFLVLIGNGVREHIDKLLKILAAAESASEHPIGKAIITFSKARISNENLPEVLESSAVSGCGLGCKL-NLDPKTEVTKFVKNLINIESPSEETNILGQXXXXXXXXXXXXTYKDVIFP---VRQHMAWTSDLCQTVTVIIGNRNWMLRNGILVDDEVDELMSEDENLGRTVILMAIDNELIAMISVADQVKREAALAVYTLKKMNIEVYLMTGDNSKTATAIARQVGIHYVFAEVLPSHKVAKVQQLQNTNRSLTSKRKMKVAMVGDGINDSPALAQSDVGIAIGTGTDVAVEAADVVLIRNSLLDVIAAIQLSKATVKRIRQNFIAATLYNLLGIPIAAGVLMPIGIEMMPWMXXXXXXXXXXXXXXXXXXXXXWKKPSEEKL 3930
            +MK++GMTC SC   IE  + K  GV  I VSL   EA +++   +   EDI  +I+E GF        ++ +K K  +     +      +E+   T            Q N+  D+         ++                    IR I ++ GM C+SCV NIES +G + G+ SI+V LE   A    ++ +  S A     E ++   F     N   + E F+     + +   + +    SN  +    T I I+ +  + C+  IE  +   PGV    V+L+   G + YD    + + IR  IE +G+   L                  PK+  N   + + V    E R+  KC+++ITGMTC+SCV  +E +L + EG+ SVLVAL+A K E+ Y+   + P  ++  ++ELGF A V+EN ++G GI+ +L+RGMTC+SCV+ IE+ + K KG+   +V+L+T+K  +++     GPRD++  IND+GF  SL     S    A H++    I++W+ SF  SLI  IP M +M+  MF      H ++  H N +   I      MV       GLS  NL+  +L  PVQF G  YFYIQAY +LKH+T NMDVL+V+ATS+++IYS+IV+++++  +   +P TFF+T PML VF++LGRWLEHIAK KTSEAL++L+SLQA EAT  +  P+N    E ++ + LVQR D++++ PG K PVDG+V+ G S  DESLITGE+MP+ K  GS VI GSIN++G L++ ATHVGSD+ L+QIVKLVE+AQTSKAPIQQ AD+++G FVP ++  +++TL +W+I+G+   EI     P Y   +S  E+    AFQ AITVL IACPCSLGLATPTAVMVGTGVGA NGILIKGGEPLE  HK+  +VFDKTGTIT G+P V +  VL+ +  R   +KLL I+  AES SEHP+G A+I + K  ++ E L    +  AV GCG+ CK+ N++P         N  N    +    I GQ             ++D I P   V Q+ +  S   QT +V+IGNR WM RN + +  E D LM+E E  GRT +L+A+D  L  +I++AD VK EAALA+++L+ M +++ LMTGDNSKTA  IA QVGI  VFAEVLPSHKVAKV+QLQ        ++  +VAMVGDGINDSPALA +DVGI IG+GTDVA+EAADVVLIRN LLDV+A+I LS+ TVKRIR NF+ A +YNL+GIPIAAGV MP+G+ + PWM SAAMAASSVSVV  SLLLKL++KPS EKL
Sbjct:  172 KMKIEGMTCHSCTSTIEGKVGKLKGVQRIKVSLDSQEAQILYQPHLIKPEDIRTQIEEAGF--------IAQIKSKPPQKLGAID------IERLTNT------------QTNSNGDLPQKIPKHQNDL--------------------IRAIFQIEGMHCKSCVVNIESNIGSQHGVSSIEVSLENKLAVIHFYSNITTSDALIQAIEALSPGTFKVSLCNHPELAETFSMQKNSEASCAKEIFSS-PSNQDFCSKVTVINIEGMTCMSCVQSIEGLISKKPGVKSIQVSLVNNNGTVQYDPAVTSPEDIRAAIEDMGFDASLLDAFTSEASQKPFLNSLLPKERTN---KETPVHSKPEKRTVNKCFIQITGMTCASCVANIERNLRREEGIYSVLVALMAGKAEVRYNPEVLQPSGIAELIQELGFEASVLENYDDGTGILELLVRGMTCASCVHKIESRLMKTKGVLYSSVALATNKAHIKFDPEVIGPRDIMKIINDLGFSTSLVKKDRS----ASHLDHRVEIQRWKRSFLISLIFCIPVMGLMVHMMFMEN---HYLMPHHHNMTMEDIASYHPTMVLEYQIIPGLSIMNLVSLLLCIPVQFLGGWYFYIQAYKALKHRTANMDVLIVLATSVAFIYSLIVLIVAIFEKSKVNPITFFDTPPMLFVFIALGRWLEHIAKSKTSEALSRLISLQATEATVVILDPDNTVKSEEQVDVELVQRGDIVRVTPGGKFPVDGRVIEGQSMVDESLITGEAMPVSKKPGSSVIAGSINQNGSLLIAATHVGSDTTLSQIVKLVEDAQTSKAPIQQFADKLSGYFVPFIVAVSVLTLFVWIIIGYHNFEIVEKYFPGYNKSISKGEVIVRFAFQAAITVLCIACPCSLGLATPTAVMVGTGVGAQNGILIKGGEPLEMAHKVKTVVFDKTGTITKGTPVVMQVKVLVESN-RMPSNKLLAIVGTAESNSEHPLGSAVIKYCKEVLNAETLGTCYDFQAVPGCGISCKVNNIEPLLHAANGPDNKRN----AVLVQIDGQ-------------HEDSILPSITVSQNPSNGSSPPQTYSVLIGNREWMNRNFLTLTAETDSLMTEHEKKGRTAVLVAVDGVLCGLIAIADTVKPEAALAIHSLRSMGLDIVLMTGDNSKTAKTIAAQVGITKVFAEVLPSHKVAKVKQLQ--------EQGTRVAMVGDGINDSPALAMADVGITIGSGTDVAIEAADVVLIRNDLLDVVASIDLSRKTVKRIRINFVFALIYNLVGIPIAAGVFMPVGLILQPWMGSAAMAASSVSVVFSSLLLKLYRKPSREKL 1413          

HSP 2 Score: 149.828 bits (377), Expect = 1.396e-35
Identity = 140/556 (25.18%), Postives = 242/556 (43.53%), Query Frame = 1
Query:  106 ARMKVDGMTCMSCVRNIEENLMKFTGVCGIMVSLLHAEATVIFDADIATVEDISNKIDEMGFDVTVKSSEVSNVKDKVVRSRIKFES---DINKSVEK-----SIETSLSSKLLLVRFCQENNYADIWHYSSIRSTEILSVIQQSEIYGVLVLEQCPTIRVIV--RVNGMTCQSCVDNIESTVGKKQGIISIKVFLEKSEAHALVDASLAGP-DVEEMINDMGFNSEMI-----------LEIFNDSCAGKPNNVSQKYEELKSNTIYPILSTTIVIKALKSIFCIFKIENHMRALPGVDKCSVNLIEEIGMIDYDSGKWNVQKIREEIESLGYLTELPKQNWNSTRQSSAVSLNEESRSKC------------------YLRITGMTCSSCVNKVESHLLKVEGVKSVLVALLAMKCEIIYDSAYVMPFQLSNRVKELGFNAEVI-------------------ENGNEGIGI--------VN---VLIRGMTCSSCVNHIENHISKIKGIASINVSLSTSKGKVEYFISECGPRDVIDAINDMGFDASLCDHLE 1563
            A + V+GMTC SCV+ IE+ +    GV  I VSL    A +I+DA + T + +   +++MGF+ T+  +    V       R+  E     I   + +      ++TSL  K+  V F        +     I    + S+  +    G +         V+V  ++ GMTC SC   IE  VGK +G+  IKV L+  EA  L    L  P D+   I + GF +++            +E   ++      ++ QK  + +++ I  I      I+ +    C+  IE+++ +  GV    V+L  ++ +I + S       + + IE+L   T       N    +   S+ + S + C                   + I GMTC SCV  +E  + K  GVKS+ V+L+     + YD A   P  +   ++++GF+A ++                   E  N+   +        VN   + I GMTC+SCV +IE ++ + +GI S+ V+L   K +V Y      P  + + I ++GF+AS+ ++ +
Sbjct:   10 AFIPVEGMTCNSCVQTIEQKIGSINGVHSIKVSLEGKNAAIIYDAKLQTPKALQEAVEDMGFESTLSYANPQPVPMDSTFLRLSAEQSAEQIRSGLSQFKGVLDVKTSLEGKVACVTFIPSVVNPGLL-IQKIPGLSLDSMASKKTTSGSVESRSSVASDVLVKMKIEGMTCHSCTSTIEGKVGKLKGVQRIKVSLDSQEAQILYQPHLIKPEDIRTQIEEAGFIAQIKSKPPQKLGAIDIERLTNTQTNSNGDLPQKIPKHQNDLIRAIFQ----IEGMHCKSCVVNIESNIGSQHGVSSIEVSLENKLAVIHFYSNITTSDALIQAIEALSPGT-FKVSLCNHPELAETFSMQKNSEASCAKEIFSSPSNQDFCSKVTVINIEGMTCMSCVQSIEGLISKKPGVKSIQVSLVNNNGTVQYDPAVTSPEDIRAAIEDMGFDASLLDAFTSEASQKPFLNSLLPKERTNKETPVHSKPEKRTVNKCFIQITGMTCASCVANIERNLRREEGIYSVLVALMAGKAEVRYNPEVLQPSGIAELIQELGFEASVLENYD 559          

HSP 3 Score: 52.7582 bits (125), Expect = 6.116e-6
Identity = 26/70 (37.14%), Postives = 39/70 (55.71%), Query Frame = 1
Query: 1339 GIGIVNVLIRGMTCSSCVNHIENHISKIKGIASINVSLSTSKGKVEYFISECGPRDVIDAINDMGFDASL 1548
            G  +  + + GMTC+SCV  IE  I  I G+ SI VSL      + Y      P+ + +A+ DMGF+++L
Sbjct:    6 GAFLAFIPVEGMTCNSCVQTIEQKIGSINGVHSIKVSLEGKNAAIIYDAKLQTPKALQEAVEDMGFESTL 75          
BLAST of Copper-transporting ATPase 1 vs. Ensembl Xenopus
Match: dhx34 (DEAH-box helicase 34 [Source:Xenbase;Acc:XB-GENE-1009178])

HSP 1 Score: 916.761 bits (2368), Expect = 0.000e+0
Identity = 588/1331 (44.18%), Postives = 807/1331 (60.63%), Query Frame = 1
Query:  109 RMKVDGMTCMSCVRNIEENLMKFTGVCGIMVSLLHAEATVIFDADIATVEDISNKIDEMGFDVTVKSSEVSNVKDKVVRSRIKFESDINKSVEKSIETSLSSKLLLVRFCQENNYADIWHYSSIRSTEILSVIQQSEIYGVLVLEQCPTIRVIVRVNGMTCQSCVDNIESTVGKKQGIISIKVFLEKSEA----HALVDASLAGPDVEEMINDMGF-----NSEMILEIFNDSCAGKPNNVSQKYEELKSNTIYPILSTTIVIKALKSIFCIFKIENHMRALPGVDKCSVNLIEEIGMIDYDSGKWNVQKIREEIESLGYLTEL------------------------PKQNWNSTRQSSAVSLNEESRS--KCYLRITGMTCSSCVNKVESHLLKVEGVKSVLVALLAMKCEIIYDSAYVMPFQLSNRVKELGFNAEVIENGNEGIGIVNVLIRGMTCSSCVNHIENHISKIKGIASINVSLSTSKGKVEYFISECGPRDVIDAINDMGFDASLCDHLESNHAAADHINQM--IKQWRSSFFFSLICGIPXXXXXXXXXXXXXXXXHTII--HENGSNRTIMKSTVPMVCS-----GLSADNLILFVLATPVQFYGARYFYIQAYLSLKHKTTNMDVLVVMATXXXXXXXXXXXXXXMAFRRNTSPKTFFETSPMLIVFLSLGRWLEHIAKGKTSEALTKLMSLQAVEAT--LYTPEN---KERKIPINLVQRNDLIKILPGEKIPVDGKVVTGTSTCDESLITGESMPIEKTHGSDVIGGSINKSGMLIVKATHVGSDSALAQIVKLVEEAQTSKAPIQQLADRIAGMFVPSVLICAIITLIIWVIVGFSKPEI----LPKYVNELSVTEITWEHAFQLAITVLSIACPCSLGLXXXXXXXXXXXXXXXNGILIKGGEPLENIHKLNVIVFDKTGTITNGSPSVTRFLVLIGNGVREHIDKLLKILAAAESASEHPIGKAIITFSKARISNENLPEVLESSAVSGCGLGCKL-NLDPKTEVTKFVKNLINIESPSEETNILGQXXXXXXXXXXXXTYKDVIFP---VRQHMAWTSDLCQTVTVIIGNRNWMLRNGILVDDEVDELMSEDENLGRTVILMAIDNELIAMISVADQVKREAALAVYTLKKMNIEVYLMTGDNSKTATAIARQVGIHYVFAEVLPSHKVAKVQQLQNTNRSLTSKRKMKVAMVGDGINDSPALAQSDVGIAIGTGTDVAVEAADVVLIRNSLLDVIAAIQLSKATVKRIRQNFIAATLYNLLGIPIAAGVLMPIGIEMMPWMXXXXXXXXXXXXXXXXXXXXXWKKPSEEKL 3930
            +MK++GMTC SC   IE  + K  GV  I VSL   EA +++   +   EDI  +I+E GF        ++ +K K  +     +      +E+   T            Q N+  D+         ++                    IR I ++ GM C+SCV NIES +G + G+ SI+V LE   A    ++ +  S A     E ++   F     N   + E F+     + +   + +    SN  +    T I I+ +  + C+  IE  +   PGV    V+L+   G + YD    + + IR  IE +G+   L                        PK+  N   + + V    E R+  KC+++ITGMTC+SCV  +E +L + EG+ SVLVAL+A K E+ Y+   + P  ++  ++ELGF A V+EN ++G GI+ +L+RGMTC+SCV+ IE+ + K KG+   +V+L+T+K  +++     GPRD++  IND+GF  SL     S    A H++    I++W+ SF  SLI  IP M +M+  MF      H ++  H N +   I      MV       GLS  NL+  +L  PVQF G  YFYIQAY +LKH+T NMDVL+V+ATS+++IYS+IV+++++  +   +P TFF+T PML VF++LGRWLEHIAK KTSEAL++L+SLQA EAT  +  P+N    E ++ + LVQR D++++ PG K PVDG+V+ G S  DESLITGE+MP+ K  GS VI GSIN++G L++ ATHVGSD+ L+QIVKLVE+AQTSKAPIQQ AD+++G FVP ++  +++TL +W+I+G+   EI     P Y   +S  E+    AFQ AITVL IACPCSLGLATPTAVMVGTGVGA NGILIKGGEPLE  HK+  +VFDKTGTIT G+P V +  VL+ +  R   +KLL I+  AES SEHP+G A+I + K  ++ E L    +  AV GCG+ CK+ N++P         N  N    +    I GQ             ++D I P   V Q+ +  S   QT +V+IGNR WM RN + +  E D LM+E E  GRT +L+A+D  L  +I++AD VK EAALA+++L+ M +++ LMTGDNSKTA  IA QVGI  VFAEVLPSHKVAKV+QLQ        ++  +VAMVGDGINDSPALA +DVGI IG+GTDVA+EAADVVLIRN LLDV+A+I LS+ TVKRIR NF+ A +YNL+GIPIAAGV MP+G+ + PWM SAAMAASSVSVV  SLLLKL++KPS EKL
Sbjct:  172 KMKIEGMTCHSCTSTIEGKVGKLKGVQRIKVSLDSQEAQILYQPHLIKPEDIRTQIEEAGF--------IAQIKSKPPQKLGAID------IERLTNT------------QTNSNGDLPQKIPKHQNDL--------------------IRAIFQIEGMHCKSCVVNIESNIGSQHGVSSIEVSLENKLAVIHFYSNITTSDALIQAIEALSPGTFKVSLCNHPELAETFSMQKNSEASCAKEIFSS-PSNQDFCSKVTVINIEGMTCMSCVQSIEGLISKKPGVKSIQVSLVNNNGTVQYDPAVTSPEDIRAAIEDMGFDASLLANTGQADAFTSEASQKPFLNSLLPKERTN---KETPVHSKPEKRTVNKCFIQITGMTCASCVANIERNLRREEGIYSVLVALMAGKAEVRYNPEVLQPSGIAELIQELGFEASVLENYDDGTGILELLVRGMTCASCVHKIESRLMKTKGVLYSSVALATNKAHIKFDPEVIGPRDIMKIINDLGFSTSLVKKDRS----ASHLDHRVEIQRWKRSFLISLIFCIPVMGLMVHMMFMEN---HYLMPHHHNMTMEDIASYHPTMVLEYQIIPGLSIMNLVSLLLCIPVQFLGGWYFYIQAYKALKHRTANMDVLIVLATSVAFIYSLIVLIVAIFEKSKVNPITFFDTPPMLFVFIALGRWLEHIAKSKTSEALSRLISLQATEATVVILDPDNTVKSEEQVDVELVQRGDIVRVTPGGKFPVDGRVIEGQSMVDESLITGEAMPVSKKPGSSVIAGSINQNGSLLIAATHVGSDTTLSQIVKLVEDAQTSKAPIQQFADKLSGYFVPFIVAVSVLTLFVWIIIGYHNFEIVEKYFPGYNKSISKGEVIVRFAFQAAITVLCIACPCSLGLATPTAVMVGTGVGAQNGILIKGGEPLEMAHKVKTVVFDKTGTITKGTPVVMQVKVLVESN-RMPSNKLLAIVGTAESNSEHPLGSAVIKYCKEVLNAETLGTCYDFQAVPGCGISCKVNNIEPLLHAANGPDNKRN----AVLVQIDGQ-------------HEDSILPSITVSQNPSNGSSPPQTYSVLIGNREWMNRNFLTLTAETDSLMTEHEKKGRTAVLVAVDGVLCGLIAIADTVKPEAALAIHSLRSMGLDIVLMTGDNSKTAKTIAAQVGITKVFAEVLPSHKVAKVKQLQ--------EQGTRVAMVGDGINDSPALAMADVGITIGSGTDVAIEAADVVLIRNDLLDVVASIDLSRKTVKRIRINFVFALIYNLVGIPIAAGVFMPVGLILQPWMGSAAMAASSVSVVFSSLLLKLYRKPSREKL 1419          

HSP 2 Score: 150.599 bits (379), Expect = 8.704e-36
Identity = 137/562 (24.38%), Postives = 239/562 (42.53%), Query Frame = 1
Query:  106 ARMKVDGMTCMSCVRNIEENLMKFTGVCGIMVSLLHAEATVIFDADIATVEDISNKIDEMGFDVTVKSSEVSNVKDKVVRSRIKFES---DINKSVEK-----SIETSLSSKLLLVRFCQENNYADIWHYSSIRSTEILSVIQQSEIYGVLVLEQCPTIRVIV--RVNGMTCQSCVDNIESTVGKKQGIISIKVFLEKSEAHALVDASLAGP-DVEEMINDMGFNSEMI-----------LEIFNDSCAGKPNNVSQKYEELKSNTIYPILSTTIVIKALKSIFCIFKIENHMRALPGVDKCSVNLIEEIGMIDYDSGKWNVQKIREEIESLGYLTELPKQNWNSTRQSSAVSLNEESRSKC------------------YLRITGMTCSSCVNKVESHLLKVEGVKSVLVALLAMKCEIIYDSAYVMPFQLSNRVKELGFNAEVIENGNEGIGIVN------------------------------------VLIRGMTCSSCVNHIENHISKIKGIASINVSLSTSKGKVEYFISECGPRDVIDAINDMGFDASLCDHLE 1563
            A + V+GMTC SCV+ IE+ +    GV  I VSL    A +I+DA + T + +   +++MGF+ T+  +    V       R+  E     I   + +      ++TSL  K+  V F        +     I    + S+  +    G +         V+V  ++ GMTC SC   IE  VGK +G+  IKV L+  EA  L    L  P D+   I + GF +++            +E   ++      ++ QK  + +++ I  I      I+ +    C+  IE+++ +  GV    V+L  ++ +I + S       + + IE+L   T       N    +   S+ + S + C                   + I GMTC SCV  +E  + K  GVKS+ V+L+     + YD A   P  +   ++++GF+A ++ N  +     +                                    + I GMTC+SCV +IE ++ + +GI S+ V+L   K +V Y      P  + + I ++GF+AS+ ++ +
Sbjct:   10 AFIPVEGMTCNSCVQTIEQKIGSINGVHSIKVSLEGKNAAIIYDAKLQTPKALQEAVEDMGFESTLSYANPQPVPMDSTFLRLSAEQSAEQIRSGLSQFKGVLDVKTSLEGKVACVTFIPSVVNPGLL-IQKIPGLSLDSMASKKTTSGSVESRSSVASDVLVKMKIEGMTCHSCTSTIEGKVGKLKGVQRIKVSLDSQEAQILYQPHLIKPEDIRTQIEEAGFIAQIKSKPPQKLGAIDIERLTNTQTNSNGDLPQKIPKHQNDLIRAIFQ----IEGMHCKSCVVNIESNIGSQHGVSSIEVSLENKLAVIHFYSNITTSDALIQAIEALSPGT-FKVSLCNHPELAETFSMQKNSEASCAKEIFSSPSNQDFCSKVTVINIEGMTCMSCVQSIEGLISKKPGVKSIQVSLVNNNGTVQYDPAVTSPEDIRAAIEDMGFDASLLANTGQADAFTSEASQKPFLNSLLPKERTNKETPVHSKPEKRTVNKCFIQITGMTCASCVANIERNLRREEGIYSVLVALMAGKAEVRYNPEVLQPSGIAELIQELGFEASVLENYD 565          
BLAST of Copper-transporting ATPase 1 vs. Ensembl Xenopus
Match: dhx34 (DEAH-box helicase 34 [Source:Xenbase;Acc:XB-GENE-1009178])

HSP 1 Score: 913.294 bits (2359), Expect = 0.000e+0
Identity = 585/1316 (44.45%), Postives = 803/1316 (61.02%), Query Frame = 1
Query:  109 RMKVDGMTCMSCVRNIEENLMKFTGVCGIMVSLLHAEATVIFDADIATVEDISNKIDEMGFDVTVKSSEVSNVKDKVVRSRIKFESDINKSVEKSIETSLSSKLLLVRFCQENNYADIWHYSSIRSTEILSVIQQSEIYGVLVLEQCPTIRVIVRVNGMTCQSCVDNIESTVGKKQGIISIKVFLEKSEA----HALVDASLAGPDVEEMINDMGF-----NSEMILEIFNDSCAGKPNNVSQKYEELKSNTIYPILSTTIVIKALKSIFCIFKIENHMRALPGVDKCSVNLIEEIGMIDYDSGKWNVQKIREEIESLGYLTEL------------PKQNWNSTRQSSAVSLNEESRS--KCYLRITGMTCSSCVNKVESHLLKVEGVKSVLVALLAMKCEIIYDSAYVMPFQLSNRVKELGFNAEVIENGNEGIGIVNVLIRGMTCSSCVNHIENHISKIKGIASINVSLSTSKGKVEYFISECGPRDVIDAINDMGFDASLCDHLESNHAAADHINQM--IKQWRSSFFFSLICGIPXXXXXXXXXXXXXXXXHTII--HENGSNRTIMKSTVPMVCS-----GLSADNLILFVLATPVQFYGARYFYIQAYLSLKHKTTNMDVLVVMATXXXXXXXXXXXXXXMAFRRNTSPKTFFETSPMLIVFLSLGRWLEHIAKGKTSEALTKLMSLQAVEAT--LYTPEN---KERKIPINLVQRNDLIKILPGEKIPVDGKVVTGTSTCDESLITGESMPIEKTHGSDVIGGSINKSGMLIVKATHVGSDSALAQIVKLVEEAQTSKAPIQQLADRIAGMFVPSVLICAIITLIIWVIVGFSKPEI----LPKYVNELSVTEITWEHAFQLAITVLSIACPCSLGLXXXXXXXXXXXXXXXNGILIKGGEPLENIHKLNVIVFDKTGTITNGSPSVTRFLVLIGNGVREHIDKLLKILAAAESASEHPIGKAIITFSKARISNENLPEVLESSAVSGCGLGCKL-NLDPKTEVTKFVKNLINIESPSEETNILGQXXXXXXXXXXXXTYKDVIFPVRQHMAWTSDLCQTVTVIIGNRNWMLRNGILVDDEVDELMSEDENLGRTVILMAIDNELIAMISVADQVKREAALAVYTLKKMNIEVYLMTGDNSKTATAIARQVGIHYVFAEVLPSHKVAKVQQLQNTNRSLTSKRKMKVAMVGDGINDSPALAQSDVGIAIGTGTDVAVEAADVVLIRNSLLDVIAAIQLSKATVKRIRQNFIAATLYNLLGIPIAAGVLMPIGIEMMPWMXXXXXXXXXXXXXXXXXXXXXWKKPSEEKL 3930
            +MK++GMTC SC   IE  + K  GV  I VSL   EA +++   +   EDI  +I+E GF        ++ +K K  +     +      +E+   T            Q N+  D+         ++                    IR I ++ GM C+SCV NIES +G + G+ SI+V LE   A    ++ +  S A     E ++   F     N   + E F+     + +   + +    SN  +    T I I+ +  + C+  IE  +   PGV    V+L+   G + YD    + + IR  IE +G+   L            PK+  N   + + V    E R+  KC+++ITGMTC+SCV  +E +L + EG+ SVLVAL+A K E+ Y+   + P  ++  ++ELGF A V+EN ++G GI+ +L+RGMTC+SCV+ IE+ + K KG+   +V+L+T+K  +++     GPRD++  IND+GF  SL     S    A H++    I++W+ SF  SLI  IP M +M+  MF      H ++  H N +   I      MV       GLS  NL+  +L  PVQF G  YFYIQAY +LKH+T NMDVL+V+ATS+++IYS+IV+++++  +   +P TFF+T PML VF++LGRWLEHIAK KTSEAL++L+SLQA EAT  +  P+N    E ++ + LVQR D++++ PG K PVDG+V+ G S  DESLITGE+MP+ K  GS VI GSIN++G L++ ATHVGSD+ L+QIVKLVE+AQTSKAPIQQ AD+++G FVP ++  +++TL +W+I+G+   EI     P Y   +S  E+    AFQ AITVL IACPCSLGLATPTAVMVGTGVGA NGILIKGGEPLE  HK+  +VFDKTGTIT G+P V +  VL+ +  R   +KLL I+  AES SEHP+G A+I + K  ++ E L    +  AV GCG+ CK+ N++P         N  N    +    I GQ                + F +  H+   S   QT +V+IGNR WM RN + +  E D LM+E E  GRT +L+A+D  L  +I++AD VK EAALA+++L+ M +++ LMTGDNSKTA  IA QVGI  VFAEVLPSHKVAKV+QLQ        ++  +VAMVGDGINDSPALA +DVGI IG+GTDVA+EAADVVLIRN LLDV+A+I LS+ TVKRIR NF+ A +YNL+GIPIAAGV MP+G+ + PWM SAAMAASSVSVV  SLLLKL++KPS EKL
Sbjct:  172 KMKIEGMTCHSCTSTIEGKVGKLKGVQRIKVSLDSQEAQILYQPHLIKPEDIRTQIEEAGF--------IAQIKSKPPQKLGAID------IERLTNT------------QTNSNGDLPQKIPKHQNDL--------------------IRAIFQIEGMHCKSCVVNIESNIGSQHGVSSIEVSLENKLAVIHFYSNITTSDALIQAIEALSPGTFKVSLCNHPELAETFSMQKNSEASCAKEIFSS-PSNQDFCSKVTVINIEGMTCMSCVQSIEGLISKKPGVKSIQVSLVNNNGTVQYDPAVTSPEDIRAAIEDMGFDASLLASQKPFLNSLLPKERTN---KETPVHSKPEKRTVNKCFIQITGMTCASCVANIERNLRREEGIYSVLVALMAGKAEVRYNPEVLQPSGIAELIQELGFEASVLENYDDGTGILELLVRGMTCASCVHKIESRLMKTKGVLYSSVALATNKAHIKFDPEVIGPRDIMKIINDLGFSTSLVKKDRS----ASHLDHRVEIQRWKRSFLISLIFCIPVMGLMVHMMFMEN---HYLMPHHHNMTMEDIASYHPTMVLEYQIIPGLSIMNLVSLLLCIPVQFLGGWYFYIQAYKALKHRTANMDVLIVLATSVAFIYSLIVLIVAIFEKSKVNPITFFDTPPMLFVFIALGRWLEHIAKSKTSEALSRLISLQATEATVVILDPDNTVKSEEQVDVELVQRGDIVRVTPGGKFPVDGRVIEGQSMVDESLITGEAMPVSKKPGSSVIAGSINQNGSLLIAATHVGSDTTLSQIVKLVEDAQTSKAPIQQFADKLSGYFVPFIVAVSVLTLFVWIIIGYHNFEIVEKYFPGYNKSISKGEVIVRFAFQAAITVLCIACPCSLGLATPTAVMVGTGVGAQNGILIKGGEPLEMAHKVKTVVFDKTGTITKGTPVVMQVKVLVESN-RMPSNKLLAIVGTAESNSEHPLGSAVIKYCKEVLNAETLGTCYDFQAVPGCGISCKVNNIEPLLHAANGPDNKRN----AVLVQIDGQLF--------------ISFDI--HLG--SSPPQTYSVLIGNREWMNRNFLTLTAETDSLMTEHEKKGRTAVLVAVDGVLCGLIAIADTVKPEAALAIHSLRSMGLDIVLMTGDNSKTAKTIAAQVGITKVFAEVLPSHKVAKVKQLQ--------EQGTRVAMVGDGINDSPALAMADVGITIGSGTDVAIEAADVVLIRNDLLDVVASIDLSRKTVKRIRINFVFALIYNLVGIPIAAGVFMPVGLILQPWMGSAAMAASSVSVVFSSLLLKLYRKPSREKL 1399          

HSP 2 Score: 152.14 bits (383), Expect = 3.161e-36
Identity = 140/550 (25.45%), Postives = 242/550 (44.00%), Query Frame = 1
Query:  106 ARMKVDGMTCMSCVRNIEENLMKFTGVCGIMVSLLHAEATVIFDADIATVEDISNKIDEMGFDVTVKSSEVSNVKDKVVRSRIKFES---DINKSVEK-----SIETSLSSKLLLVRFCQENNYADIWHYSSIRSTEILSVIQQSEIYGVLVLEQCPTIRVIV--RVNGMTCQSCVDNIESTVGKKQGIISIKVFLEKSEAHALVDASLAGP-DVEEMINDMGFNSEMI-----------LEIFNDSCAGKPNNVSQKYEELKSNTIYPILSTTIVIKALKSIFCIFKIENHMRALPGVDKCSVNLIEEIGMIDYDSGKWNVQKIREEIESLGYLTELPKQNWNSTRQSSAVSLNEESRSKC------------------YLRITGMTCSSCVNKVESHLLKVEGVKSVLVALLAMKCEIIYDSAYVMPFQLSNRVKELGFNAEVI-------------ENGNEGIGI--------VN---VLIRGMTCSSCVNHIENHISKIKGIASINVSLSTSKGKVEYFISECGPRDVIDAINDMGFDASLCDHLE 1563
            A + V+GMTC SCV+ IE+ +    GV  I VSL    A +I+DA + T + +   +++MGF+ T+  +    V       R+  E     I   + +      ++TSL  K+  V F        +     I    + S+  +    G +         V+V  ++ GMTC SC   IE  VGK +G+  IKV L+  EA  L    L  P D+   I + GF +++            +E   ++      ++ QK  + +++ I  I      I+ +    C+  IE+++ +  GV    V+L  ++ +I + S       + + IE+L   T       N    +   S+ + S + C                   + I GMTC SCV  +E  + K  GVKS+ V+L+     + YD A   P  +   ++++GF+A ++             E  N+   +        VN   + I GMTC+SCV +IE ++ + +GI S+ V+L   K +V Y      P  + + I ++GF+AS+ ++ +
Sbjct:   10 AFIPVEGMTCNSCVQTIEQKIGSINGVHSIKVSLEGKNAAIIYDAKLQTPKALQEAVEDMGFESTLSYANPQPVPMDSTFLRLSAEQSAEQIRSGLSQFKGVLDVKTSLEGKVACVTFIPSVVNPGLL-IQKIPGLSLDSMASKKTTSGSVESRSSVASDVLVKMKIEGMTCHSCTSTIEGKVGKLKGVQRIKVSLDSQEAQILYQPHLIKPEDIRTQIEEAGFIAQIKSKPPQKLGAIDIERLTNTQTNSNGDLPQKIPKHQNDLIRAIFQ----IEGMHCKSCVVNIESNIGSQHGVSSIEVSLENKLAVIHFYSNITTSDALIQAIEALSPGT-FKVSLCNHPELAETFSMQKNSEASCAKEIFSSPSNQDFCSKVTVINIEGMTCMSCVQSIEGLISKKPGVKSIQVSLVNNNGTVQYDPAVTSPEDIRAAIEDMGFDASLLASQKPFLNSLLPKERTNKETPVHSKPEKRTVNKCFIQITGMTCASCVANIERNLRREEGIYSVLVALMAGKAEVRYNPEVLQPSGIAELIQELGFEASVLENYD 553          
BLAST of Copper-transporting ATPase 1 vs. Ensembl Xenopus
Match: ATP7B (ATPase, Cu++ transporting, beta polypeptide [Source:NCBI gene;Acc:100497797])

HSP 1 Score: 912.524 bits (2357), Expect = 0.000e+0
Identity = 605/1375 (44.00%), Postives = 833/1375 (60.58%), Query Frame = 1
Query:   97 LGSARMKVDGMTCMSCVRNIEENLMKFTGVCGIMVSLLHAEATVIFDADIATVEDISNKIDEMGFDVTV--KSSEVSNVK-----DKVVRSRIK----------FESDINK--SVEKSIETSLSSKLLLVRFCQENNYA--------DIWHYSSIRSTE---ILSVIQQSEIYGVLVLEQCPTIR---VIVRVNGMTCQSCVDNIESTVGKKQGIISIKVFLE-KSEAHALVDASLAGPDVEEMINDM---GFNSEMILEI-FNDSCAGKPNNVSQKYEELKSNTIYPILSTTIVIKALKSIFCIFKIENHMRALPGVDKCSVNLIEEIGMIDYDSGKWNVQKIREEIESLGYLTELPKQNWNS------------TRQSSA-----VSLNEESRSKCYLRITGMTCSSCVNKVESHLLKVEGVKSVLVALLAMKCEIIYDSAYVMPFQLSNRVKELGFNAEVIENGNEGIGIVNVLIRGMTCSSCVNHIENHISKIKGIASINVSLSTSKGKVEYFISECGPRDVIDAINDMGFDASLCDHLESNHAAADHINQMIKQWRSSFFFSLICGIPXXXXXXXXXXXXXXXXHTIIHENGSNRTIMKSTVPMVCSGLSADNLILFVLATPVQFYGARYFYIQAYLSLKHKTTNMDVLVVMATXXXXXXXXXXXXXXMAFRRNTSPKTFFETSPMLIVFLSLGRWLEHIAKGKTSEALTKLMSLQAVEATLYTPEN-----KERKIPINLVQRNDLIKILPGEKIPVDGKVVTGTSTCDESLITGESMPIEKTHGSDVIGGSINKSGMLIVKATHVGSDSALAQIVKLVEEAQTSKAPIQQLADRIAGMFVPSVLICAIITLIIWVIVGFSKPEIL----PKYVNELSVTEITWEHAFQLAITVLSIACPCSLGLXXXXXXXXXXXXXXXNGILIKGGEPLENIHKLNVIVFDKTGTITNGSPSVTRFLVLIGNGVREHIDKLLKILAAAESASEHPIGKAIITFSKARISNENLPEVLESSAVSGCGLGCKLNLDPKTEVTKFVKNLINIESPSEETNILGQXXXXXXXXXXXXTYKDVIFPVRQHMAWTSDLCQTV-------TVIIGNRNWMLRNGILVDDEVDELMSEDENLGRTVILMAIDNELIAMISVADQVKREAALAVYTLKKMNIEVYLMTGDNSKTATAIARQVGIHYVFAEVLPSHKVAKVQQLQNTNRSLTSKRKMKVAMVGDGINDSPALAQSDVGIAIGTGTDVAVEAADVVLIRNSLLDVIAAIQLSKATVKRIRQNFIAATLYNLLGIPIAAGVLMPIGIEMMPWMXXXXXXXXXXXXXXXXXXXXXWKKPSEEKLITPEYINFIQSSGLSESQIIVRRGID 4008
            +GS  + + GMTC SCV++IE  + K +GV GI V L    A V +     T   I  +I++MGFD ++  +S   S+VK     D V++ R++           E  I K   V+K I+ SL+ +  ++ +      A        D+   +SI++      L  I    +   +            V + ++GM C+SCV NIE  V    GI SI+V L+ K+    L   S +   ++E I ++    F   + + +    S A    + S + + +  N         I I  +    C+  IEN +    GV    V+L E  G I Y+  + N +++R  IE +G+ + L    +NS            TRQ S      +   + +  KC+L+ITGMTC SCV+ +E +L K +G+ SVLVAL++ K E+ +    + P +++  V++LGF A V+E+     G V ++I GMTC+SCV++IE+ + +  GI   +V+L+T K +V++     GPRD+I  I  +GF ASL     + H   DH  + IKQWR+SF FSL+ GIP + +M++ +   K   +T++ +        ++ VP    GLS  NL+ F+L T VQ  G RYFY+QAY SLKHK TNMDVL+V+AT+I+YIYSV+++ ++M  + + SP+TFF+T PML +F++LGRWLEHIAK KTSEAL KL+SLQA EA + T        +E ++ + LVQR D++K++PG K PVDGKV+ GTS  DESLITGE MP+ K  GS VI GSIN  G ++V+ATHVGS++ LAQIVKLVEEAQ SKAPIQQLAD+I+G FVP ++I +++TL+ W+I+GF   +I+    P Y   +S TE+    AFQ +ITVLSIACPC+LGLATPTAVMVGTGV A NGILIKGGEPLE  HK+  ++FDKTGTIT+G P V R L L+G+ V+  + ++L ++  AE++SEHP+G A+  + K  +  E L    +  AV GCG+ CK+N               NIES                           + P+   +A  + LC T        TV+IGNR WM RNG+ +  +VDE MS  E  G+T +L+AID EL  MI++AD VK+EAALAV+TLK M I+V L+TGDN KTA AIA QVGI  VFAEVLPSHKVAKVQ LQ+ N+        +VAMVGDG+NDSPALA++DVGIAIGTGTDVA+EAAD+VLIRN LLDV+A+I LSK TV+RIR NF+ A +YNLLGIPIAAGV MP G+ + PWM SAAMAASSVSVV  SL LK ++KP  ++    E         L+ SQI V  G+D
Sbjct:   43 VGSVVVAIQGMTCQSCVQSIEGRISKVSGVVGINVCLEQNNAIVNYLQTEITPHKICEEIEDMGFDASLSEQSGMPSSVKSSYYGDNVIKIRVEGMTCQSCVNTIEGKIGKIQGVQK-IKVSLTGQEAVITYQSHIIQAEDLRKYIEDMGFEASIKNKPDPTKLGTIDIERLQNSIAENHSGHTNSNTVTLGIDGMHCKSCVHNIEGYVSGLAGIQSIRVSLKNKNAVVCLSQGSTSLLSLKESIENLPPGKFKVTLPVGVEKGQSLARNSTHSSHRDQSMGGNI------AIISIGGMTCQSCVSSIENMISQRKGVLHILVSLDEGNGNIFYNPCETNAEELRAAIEDMGFHSTLVCSEYNSKEEENKQTPPKATRQISGSRDYILDKYDTAPEKCFLQITGMTCISCVSNIERNLKKKDGIVSVLVALMSGKAEVKFYPDRIEPLEIAQLVEDLGFGASVMEDYTASDGNVELIITGMTCASCVHNIESRLMRTPGILQASVALATCKAQVKFDPEIVGPRDIIRIIEGIGFQASLAKRDPTAHKL-DH-KEEIKQWRNSFLFSLLFGIPVIILMIYMLAANKDHHNTMVLD--------RNIVP----GLSIINLVFFILCTFVQTLGGRYFYVQAYKSLKHKATNMDVLIVLATTIAYIYSVVILTVAMVEKADKSPETFFDTPPMLFMFIALGRWLEHIAKSKTSEALAKLISLQATEAAVVTFGANQIILREEQVAVELVQRGDIVKVVPGGKFPVDGKVIEGTSMADESLITGEPMPVRKKPGSMVIAGSINAHGTVLVEATHVGSETTLAQIVKLVEEAQMSKAPIQQLADKISGYFVPFIIIISVVTLVTWIIIGFVNFDIIIKYFPSYSKNISKTEVIIRVAFQTSITVLSIACPCALGLATPTAVMVGTGVAAQNGILIKGGEPLEMAHKIKAVMFDKTGTITHGVPKVMRVL-LLGDVVKMPLKRMLAVVGTAEASSEHPLGMAVTKYCKEELGTELLGYCTDFQAVPGCGISCKVN---------------NIES---------------------------VLPI--WLARLTYLCPTGAQAPLAHTVLIGNREWMRRNGLHISTDVDEAMSSHEMKGQTAVLVAIDGELCGMIAIADTVKQEAALAVHTLKSMGIDVVLITGDNRKTAKAIATQVGIKKVFAEVLPSHKVAKVQALQSDNK--------RVAMVGDGVNDSPALARADVGIAIGTGTDVAIEAADIVLIRNDLLDVVASIHLSKRTVRRIRLNFVFALIYNLLGIPIAAGVFMPAGLVLQPWMGSAAMAASSVSVVLSSLQLKCYRKPDSDRY---EARAQGHMKPLTPSQISVHIGMD 1340          

HSP 2 Score: 70.4774 bits (171), Expect = 2.722e-11
Identity = 34/74 (45.95%), Postives = 44/74 (59.46%), Query Frame = 1
Query: 1336 EGIGIVNVLIRGMTCSSCVNHIENHISKIKGIASINVSLSTSKGKVEYFISECGPRDVIDAINDMGFDASLCDH 1557
            + +G V V I+GMTC SCV  IE  ISK+ G+  INV L  +   V Y  +E  P  + + I DMGFDASL + 
Sbjct:   41 DDVGSVVVAIQGMTCQSCVQSIEGRISKVSGVVGINVCLEQNNAIVNYLQTEITPHKICEEIEDMGFDASLSEQ 114          
BLAST of Copper-transporting ATPase 1 vs. Ensembl Mouse
Match: Atp7b (ATPase, Cu++ transporting, beta polypeptide [Source:MGI Symbol;Acc:MGI:103297])

HSP 1 Score: 902.508 bits (2331), Expect = 0.000e+0
Identity = 567/1351 (41.97%), Postives = 810/1351 (59.96%), Query Frame = 1
Query:  109 RMKVDGMTCMSCVRNIEENLMKFTGVCGIMVSLLHAEATVIFDADIATVEDISNKIDEMGFDVTVKSSEVSNVKDKVVRSRIKFESDINKSVEKSIETSLSSKLLLVRFCQENNYADIWHYSSIRSTEILSVIQQSEIYGVLVLEQCPTIRVIVRVNGMTCQSCVDNIESTVGKKQGIISIKVFLEKSEAHALVDASLAGPDVEEMINDMGFNSEMILEIFNDSCAGKPNN-VSQKYEELKSNTIYPILSTTIVIKALKSIFCIFKIENHMRALPGVDKCSVNLIEEIGMIDYDSGKWNVQKIREEIESLGY--------LTELPKQNW---NSTRQS------SAVSLNEESRS-----------------------KCYLRITGMTCSSCVNKVESHLLKVEGVKSVLVALLAMKCEIIYDSAYVMPFQLSNRVKELGFNAEVIENGNEGIGIVNVLIRGMTCSSCVNHIENHISKIKGIASINVSLSTSKGKVEYFISECGPRDVIDAINDMGFDASLCDHLESNHAAADHINQMIKQWRSSFFFSLICGIPXXXXXXXXXXXXXXXXHTIIHENGSNRTIMKSTVPMVCSGLSADNLILFVLATPVQFYGARYFYIQAYLSLKHKTTNMDVLVVMATXXXXXXXXXXXXXXMAFRRNTSPKTFFETSPMLIVFLSLGRWLEHIAKGKTSEALTKLMSLQAVEATLYT--PEN---KERKIPINLVQRNDLIKILPGEKIPVDGKVVTGTSTCDESLITGESMPIEKTHGSDVIGGSINKSGMLIVKATHVGSDSALAQIVKLVEEAQTSKAPIQQLADRIAGMFVPSVLICAIITLIIWVIVGFSKPEILPKYV----NELSVTEITWEHAFQLAITVLSIACPCSLGLXXXXXXXXXXXXXXXNGILIKGGEPLENIHKLNVIVFDKTGTITNGSPSVTRFLVLIGNGVREHIDKLLKILAAAESASEHPIGKAIITFSKARISNENLPEVLESSAVSGCGLGCKL-NLDPKTEVTKFVKNLINIESPSEETNILGQXXXXXXXXXXXXTYKDVIFPVRQHMAWTSDLCQTVTVIIGNRNWMLRNGILVDDEVDELMSEDENLGRTVILMAIDNELIAMISVADQVKREAALAVYTLKKMNIEVYLMTGDNSKTATAIARQVGIHYVFAEVLPSHKVAKVQQLQNTNRSLTSKRKMKVAMVGDGINDSPALAQSDVGIAIGTGTDVAVEAADVVLIRNSLLDVIAAIQLSKATVKRIRQNFIAATLYNLLGIPIAAGVLMPIGIEMMPWMXXXXXXXXXXXXXXXXXXXXXWKKPSEEKLITPEYINFIQSSGLSESQIIVRRGID 4008
            +++V+GMTC SCV +IE  + K  GV  I VSL + EA + +   +   ED+ + I +MGF+        + +K++    R+    D+NK    +++    S + +      N++  + H  S  +T                        + +R++GM C+SCV NIE  +G+  G+ +I V LE   A    D S   P   +   +        + + +     +P +  SQ+++E       P  +  + I  +     +  IE+ +    GV + S++L E  G + YD    ++ ++R  +E +G+         T  P +N+   NS  Q+      S   +  ++R                        KC+++I GMTC+SCV+ +E  L +  G+ SVLVAL++ K E+ YD   +   +++  +++LGF A V+E+     G + ++I GMTC+SCV++IE+ +++  GI   +V+L+TSK  V++     GPRD+I  I ++GF ASL     + H   DH  + IKQW+ SF  SL+ GIP M +M++ +      + T++ ++             +  GLS  NLI F+L T VQF G  YFY+QAY SL+H++ NMDVL+V+AT+I+Y YS++++V+++A +   SP TFF+T PML VF++LGRWLEH+AK KTSEAL KLMSLQA EAT+ T   +N   +E ++P+ LVQR D+IK++PG K PVDGKV+ G +  DESLITGE+MP+ K  GS VI GSIN  G +++KATHVG+D+ LAQIVKLVEEAQ SKAPIQQLADR +G FVP ++I + +TL++W+++GF    ++ KY       +S TE+    AFQ +ITVL IACPCSLGLATPTAVMVGTGV A NG+LIKGG+PLE  HK+  ++FDKTGTIT+G P V RFL L+ +     + K+L ++  AE++SEHP+G A+  + K  +  E L    +  AV GCG+ CK+ N++     +    + + + +P                            P  +         QT +V+IGNR WM RNG+ +  ++ + M++ E  G+T IL+AID  L  MI++AD VK EAALA+YTLK M ++V L+TGDN KTA AIA QVGI+ VFAEVLPSHKVAKVQ+LQN  +        KVAMVGDG+NDSPALAQ+DVGIAIGTGTDVA+EAADVVLIRN LLDV+A+I LSK TV+RIR N + A +YN++GIPIAAGV MPIGI + PWM SAAMAASSVSVV  SL LK ++KP  E+    E     +   LS SQ+ V  G+D
Sbjct:  156 KLRVEGMTCQSCVSSIEGKIRKLQGVVRIKVSLSNQEAVITYQPYLIQPEDLRDHICDMGFE--------AAIKNRTAPLRLG-PIDVNKLESTNLKKETVSPVQI-----SNHFETLGHQGSYLAT------------------------LPLRIDGMHCKSCVLNIEGNIGQLPGVQNIHVSLENKTAQIQYDPSCVTPMFLQTAIEALPPGHFKVSLPDGVEENEPQSGSSQRHQEQG-----PGRTAVLTISGITCASSVQPIEDMLSQRKGVQQTSISLAEGTGAVLYDPSIVSLDELRTAVEDMGFEVSVNSETFTINPVRNFKSGNSVPQTMGDIAGSVQKMAPDTRGLPTHQGPGHSSETPSSPGATASQKCFVQIKGMTCASCVSNIERSLQRHAGILSVLVALMSGKAEVKYDPEIIQSPRIAQLIQDLGFEASVMEDNTVSEGDIELIITGMTCASCVHNIESKLTRTNGITYASVALATSKAHVKFDPEIVGPRDIIKIIEEIGFHASLAQRNPNAHHL-DHKTE-IKQWKKSFLCSLVFGIPVMGLMVYMLIPSSTPQETMVLDHN------------IIPGLSVLNLIFFILCTFVQFLGGWYFYVQAYKSLRHRSANMDVLIVLATTIAYAYSLVILVVAVAEKAEKSPVTFFDTPPMLFVFIALGRWLEHVAKSKTSEALAKLMSLQATEATVVTLGEDNLILREEQVPMELVQRGDVIKVVPGGKFPVDGKVLEGNTMADESLITGEAMPVTKKPGSIVIAGSINAHGSVLLKATHVGNDTTLAQIVKLVEEAQMSKAPIQQLADRFSGYFVPFIIIISTLTLVVWIVIGFVDFGVVQKYFPSPSKHISQTEVIIRFAFQTSITVLCIACPCSLGLATPTAVMVGTGVAAQNGVLIKGGKPLEMAHKIKTVMFDKTGTITHGVPRVMRFL-LLADVATLPLRKVLAVVGTAEASSEHPLGVAVTKYCKEELGTETLGYSTDFQAVPGCGISCKVSNVEGILARSDLTAHPVGVGNP----------------------------PTGEGAG-----PQTFSVLIGNREWMRRNGLTISSDISDAMTDHEMKGQTAILVAIDGVLCGMIAIADAVKPEAALAIYTLKSMGVDVALITGDNRKTARAIATQVGINKVFAEVLPSHKVAKVQELQNEGK--------KVAMVGDGVNDSPALAQADVGIAIGTGTDVAIEAADVVLIRNDLLDVVASIHLSKRTVRRIRVNLVLALIYNMVGIPIAAGVFMPIGIVLQPWMGSAAMAASSVSVVLSSLQLKCYRKPDLERY---EAQAHGRMKPLSASQVSVHIGMD 1404          

HSP 2 Score: 117.087 bits (292), Expect = 1.232e-25
Identity = 108/406 (26.60%), Postives = 172/406 (42.36%), Query Frame = 1
Query:  562 VIVRVNGMTCQSCVDNIESTVGKKQGIISIKVFLEKSEAHALVDASLAGP-DVEEMINDMGFNSEM---------------ILEIFN-DSCAGKPNNVSQKYEELKSNTIYPILSTTIVIKALKSIFCIFKIENHMRALPGVDKCSVNLIEEIGMIDYDSGKWNVQKIREEIESLG---YLTELPKQNWNSTRQSSAVSLNEESRS--KCYLRITGMTCSSCVNKVESHLLKVEGVKSVLVALLAMKCEIIYDSAYVMPFQLSNRVKELGFNAEV------------IENGN--------------------------EGIGIVN---------------VLIRGMTCSSCVNHIENHISKIKGIASINVSLSTSKGKVEYFISECGPRDVIDAINDMGFDASLCD 1554
            V +RV GMTCQSCV +IE  + K QG++ IKV L   EA       L  P D+ + I DMGF + +                LE  N       P  +S  +E L     Y + +  + I  +    C+  IE ++  LPGV    V+L  +   I YD        ++  IE+L    +   LP     +  QS +   ++E        L I+G+TC+S V  +E  L + +GV+   ++L      ++YD + V   +L   V+++GF   V             ++GN                          +G G  +               V I+GMTC+SCV++IE  + +  GI S+ V+L + K +V+Y         +   I D+GF+AS+ +
Sbjct:  155 VKLRVEGMTCQSCVSSIEGKIRKLQGVVRIKVSLSNQEAVITYQPYLIQPEDLRDHICDMGFEAAIKNRTAPLRLGPIDVNKLESTNLKKETVSPVQISNHFETLGHQGSY-LATLPLRIDGMHCKSCVLNIEGNIGQLPGVQNIHVSLENKTAQIQYDPSCVTPMFLQTAIEALPPGHFKVSLPDGVEENEPQSGSSQRHQEQGPGRTAVLTISGITCASSVQPIEDMLSQRKGVQQTSISLAEGTGAVLYDPSIVSLDELRTAVEDMGFEVSVNSETFTINPVRNFKSGNSVPQTMGDIAGSVQKMAPDTRGLPTHQGPGHSSETPSSPGATASQKCFVQIKGMTCASCVSNIERSLQRHAGILSVLVALMSGKAEVKYDPEIIQSPRIAQLIQDLGFEASVME 559          

HSP 3 Score: 103.219 bits (256), Expect = 2.131e-21
Identity = 98/379 (25.86%), Postives = 165/379 (43.54%), Query Frame = 1
Query:  550 PTIRVIVRVNGMTCQSCVDNIESTVGKKQGIISIKVFLEKSEAHA-LVDASLAGPDVEEMINDMGFNSEMILEIFNDSCAGKPNNVSQKYEELKSNTIYPILSTTIVIKALKSIFCIFKIENHMRALPGVDKCSVNLIEEIGMIDYDSGKWNVQKIREEIESLGYLTELPKQNWNSTRQSSAVSLN--------EESRSKCY-------------------LRITGMTCSSCVNKVESHLLKVEGVKSVLVALLAMKCEIIYDSAYVMPFQLSNRVKEL-----------GFNAEVIENGN------EGIGIVNVL-IRGMTCSSCVNHIENHISKIKGIASINVSLSTSKGKVEYFISECGPRDVIDAINDMGFDASL 1548
            P    +V + GMTC SCV +IE  +   +GI++IKV LE+  A    V + +    +   I DMGF +           A  P+  S   E +            + ++ +    C+  IE  +R L GV +  V+L  +  +I Y       + +R+ I  +G+  E   +N  +  +   + +N        +E+ S                      LRI GM C SCV  +E ++ ++ GV+++ V+L     +I YD + V P  L   ++ L           G      ++G+      +G G   VL I G+TC+S V  IE+ +S+ KG+   ++SL+   G V Y  S     ++  A+ DMGF+ S+
Sbjct:   66 PAATDVVNILGMTCHSCVKSIEDRISSLKGIVNIKVSLEQGSATVRYVPSVMNLQQICLQIEDMGFEASAA----EGKAASWPSRSSPAQEAV----------VKLRVEGMTCQSCVSSIEGKIRKLQGVVRIKVSLSNQEAVITYQPYLIQPEDLRDHICDMGF--EAAIKNRTAPLRLGPIDVNKLESTNLKKETVSPVQISNHFETLGHQGSYLATLPLRIDGMHCKSCVLNIEGNIGQLPGVQNIHVSLENKTAQIQYDPSCVTPMFLQTAIEALPPGHFKVSLPDGVEENEPQSGSSQRHQEQGPGRTAVLTISGITCASSVQPIEDMLSQRKGVQQTSISLAEGTGAVLYDPSIVSLDELRTAVEDMGFEVSV 428          

HSP 4 Score: 82.8037 bits (203), Expect = 3.304e-15
Identity = 56/186 (30.11%), Postives = 90/186 (48.39%), Query Frame = 1
Query: 1051 LPKQNW-NSTRQSSAV-------SLNEESRSKC---YLRITGMTCSSCVNKVESHLLKVEGVKSVLVALLAMKCEIIYDSAYVMPFQLSNRVKELGFNAEVIENGNEGI---------GIVNVLIRGMTCSSCVNHIENHISKIKGIASINVSLSTSKGKVEYFISECGPRDVIDAINDMGFDASL 1548
            LP + W  S +QS A         L+  S S      + I GMTC SCV  +E  +  ++G+ ++ V+L      + Y  + +   Q+  +++++GF A   E                +V + + GMTC SCV+ IE  I K++G+  I VSLS  +  + Y      P D+ D I DMGF+A++
Sbjct:   35 LPGRPWEQSMKQSFAFDNVGYEGGLDSTSSSPAATDVVNILGMTCHSCVKSIEDRISSLKGIVNIKVSLEQGSATVRYVPSVMNLQQICLQIEDMGFEASAAEGKAASWPSRSSPAQEAVVKLRVEGMTCQSCVSSIEGKIRKLQGVVRIKVSLSNQEAVITYQPYLIQPEDLRDHICDMGFEAAI 220          

HSP 5 Score: 56.9954 bits (136), Expect = 2.664e-7
Identity = 31/69 (44.93%), Postives = 40/69 (57.97%), Query Frame = 1
Query: 1348 IVNVLIRGMTCSSCVNHIENHISKIKGIASINVSLSTSKGKVEYFISECGPRDVIDAINDMGFDASLCD 1554
            +VN+L  GMTC SCV  IE+ IS +KGI +I VSL      V Y  S    + +   I DMGF+AS  +
Sbjct:   71 VVNIL--GMTCHSCVKSIEDRISSLKGIVNIKVSLEQGSATVRYVPSVMNLQQICLQIEDMGFEASAAE 137          
BLAST of Copper-transporting ATPase 1 vs. Ensembl Mouse
Match: Atp7a (ATPase, Cu++ transporting, alpha polypeptide [Source:MGI Symbol;Acc:MGI:99400])

HSP 1 Score: 891.723 bits (2303), Expect = 0.000e+0
Identity = 561/1177 (47.66%), Postives = 756/1177 (64.23%), Query Frame = 1
Query:  574 VNGMTCQSCVDNIESTVGKKQGIISIKVFLEKSEAHALVDASLAGPDVEEMINDMGFNSEMILEIFNDSCAGKPNNVSQKYEELKSNTIYPILSTTIVIK--ALKSIFCIFKIENHMRALPGVDKCSVNLIEEIGMIDYDSGKWNVQKIREEIESLGYLTELP---KQNWNSTRQSSA-----VSLNE------ESRSKCYLRITGMTCSSCVNKVESHLLKVEGVKSVLVALLAMKCEIIYDSAYVMPFQLSNRVKELGFNAEVIENGNEGIGIVNVLIRGMTCSSCVNHIENHISKIKGIASINVSLSTSKGKVEYFISECGPRDVIDAINDMGFDASLCDHLES-NHAAADHINQMIKQWRSSFFFSLICGIPXXXXXXXXXXXXXXXXHTIIHENGSNRTIMKSTVPM-----VCSGLSADNLILFVLATPVQFYGARYFYIQAYLSLKHKTTNMDVLVVMATXXXXXXXXXXXXXXMAFRRNTSPKTFFETSPMLIVFLSLGRWLEHIAKGKTSEALTKLMSLQAVEATLYT--PEN---KERKIPINLVQRNDLIKILPGEKIPVDGKVVTGTSTCDESLITGESMPIEKTHGSDVIGGSINKSGMLIVKATHVGSDSALAQIVKLVEEAQTSKAPIQQLADRIAGMFVPSVLICAIITLIIWVIVGFSKPEI----LPKYVNELSVTEITWEHAFQLAITVLSIACPCSLGLXXXXXXXXXXXXXXXNGILIKGGEPLENIHKLNVIVFDKTGTITNGSPSVTRFLVLI-GNGVREHIDKLLKILAAAESASEHPIGKAIITFSKARISNENLPEVLESSAVSGCGLGCKLNLDPKTEVTKFVKNLINIESPSEETNILGQXXXXXXXXXXXXTYKDVIFPVRQHMAWTSDLCQTVTVIIGNRNWMLRNGILVDDEVDELMSEDENLGRTVILMAIDNELIAMISVADQVKREAALAVYTLKKMNIEVYLMTGDNSKTATAIARQVGIHYVFAEVLPSHKVAKVQQLQNTNRSLTSKRKMKVAMVGDGINDSPALAQSDVGIAIGTGTDVAVEAADVVLIRNSLLDVIAAIQLSKATVKRIRQNFIAATLYNLLGIPIAAGVLMPIGIEMMPWMXXXXXXXXXXXXXXXXXXXXXWKKPSEEKLITPEYINFIQSSGLSESQIIVRRGID 4008
            + GM C+SCV NIES +   Q + SI V LE   A    +ASL  P++     +     +  + I ++  +   +  S   +++  N +   L+   VI    +    C+  IE  +   PGV    V+L    G I++D    + + +RE IE +G+   LP   K+      Q S       S NE        ++KCY++++GMTC+SCV  +E +L + EG+ SVLVAL+A K E+ Y+ A + P  ++  ++ELGF A V+EN  EG GI+ +++RGMTC+SCV+ IE+ ++K KGI   +V+L+T+K  ++Y     GPRD+I  I  +GF+ASL     S NH   DH  + IKQWR SF  SL   IP M +M++ M     +     ++N SN  ++     M     +  GLS  NL+  +L  PVQF G  YFYIQAY +LKHKT NMDVL+V+AT+I++ YS+++++++M  R   +P TFF+T PML VF++LGRWLEHIAKGKTSEAL KL+SLQA EAT+ T   EN    E ++ + LVQR D+IK++PG K PVDG+V+ G S  DESLITGE+MP+ K  GS VI GSIN++G L+++ATHVG+D+ L+QIVKLVEEAQTSKAPIQQ AD+++G FVP +++ +I+TL++W+I+GF   EI     P Y   +S TE     AFQ +ITVL IACPCSLGLATPTAVMVGTGVGA NGILIKGGEPLE  HK+ V+VFDKTGTIT+G+P V +  VL+  N +    +K+L I+  AES SEHP+G A+  + K  +  E L    +   V GCG+ CK        VT     L       EE NI   ++      + + +    +  +  H++   +  Q   V+IGNR WM+RNG+++ ++VDE M E E  GRT +L+ ID+EL  +I++AD VK EA LAV+ LK M +EV LMTGDNSKTA +IA QVGI  VFAEVLPSHKVAKV+QLQ   +        +VAMVGDGINDSPALA ++VGIAIGTGTDVA+EAADVVLIRN LLDV+A+I LS+ TVKRIR NF+ A +YNL+GIPIAAGV +PIG+ + PWM SAAMAASSVSVV  SL LKL++KP+ +     E      +   S S+I V  GID
Sbjct:  283 IEGMHCKSCVSNIESALSTLQYVSSIVVSLENRSAIVKYNASLVTPEMLRKAIEAISPGQYRVSIASEVESTASSPSSSSLQKMPLNIVSQPLTQEAVININGMTCNSCVQSIEGVISKKPGVKSIHVSLANSTGTIEFDPLLTSPETLREAIEDMGFDAALPADMKEPLVVIAQPSLETPLLPSSNELENVMTSVQNKCYIQVSGMTCASCVANIERNLRREEGIYSVLVALMAGKAEVRYNPAVIQPRVIAEFIRELGFGAMVMENAGEGNGILELVVRGMTCASCVHKIESTLTKHKGIFYCSVALATNKAHIKYDPEIIGPRDIIHTIGSLGFEASLVKKDRSANHL--DH-KREIKQWRGSFLVSLFFCIPVMGLMVYMMVMDHHLATLHHNQNMSNEEMINMHSAMFLERQILPGLSIMNLLSLLLCLPVQFCGGWYFYIQAYKALKHKTANMDVLIVLATTIAFAYSLVILLVAMFERAKVNPITFFDTPPMLFVFIALGRWLEHIAKGKTSEALAKLISLQATEATIVTLNSENLLLSEEQVDVELVQRGDIIKVVPGGKFPVDGRVIEGHSMVDESLITGEAMPVAKKPGSTVIAGSINQNGSLLIRATHVGADTTLSQIVKLVEEAQTSKAPIQQFADKLSGYFVPFIVLVSIVTLLVWIIIGFQNFEIVETYFPGYNRSISRTETIIRFAFQASITVLCIACPCSLGLATPTAVMVGTGVGAQNGILIKGGEPLEMAHKVKVVVFDKTGTITHGTPVVNQVKVLVESNKISR--NKILAIVGTAESNSEHPLGAAVTKYCKKELDTETLGTCTDFQVVPGCGISCK--------VTNIEGLLHKSNLKIEENNIKNASLVQIDAINEQSSTSSSMI-IDAHLSNAVN-TQQYKVLIGNREWMIRNGLVISNDVDESMIEHERRGRTAVLVTIDDELCGLIAIADTVKPEAELAVHILKSMGLEVVLMTGDNSKTARSIASQVGITKVFAEVLPSHKVAKVKQLQEEGK--------RVAMVGDGINDSPALAMANVGIAIGTGTDVAIEAADVVLIRNDLLDVVASIDLSRKTVKRIRINFVFALIYNLVGIPIAAGVFLPIGLVLQPWMGSAAMAASSVSVVLSSLFLKLYRKPTYDNY---ELHPRSHTGQRSPSEISVHVGID 1433          

HSP 2 Score: 145.591 bits (366), Expect = 2.165e-34
Identity = 144/545 (26.42%), Postives = 252/545 (46.24%), Query Frame = 1
Query:  103 SARMKVDGMTCMSCVRNIEENLMKFTGVCGIMVSLLHAEATVIFDADIATVEDISNKIDEMGFDVTVKSSE----VSNVKDKVVRSRIKFESDINKSVEKSIETSLSSKLLL-VRFCQENNYADIWHYSSIRS-TEILSVIQ--------QSEIYGVLVLEQCPT---IRVIVRVNGMTCQSCVDNIESTVGKKQGIISIKVFLEKSEAHALVDASL-AGPDVEEMINDMGFNSEM--------ILEIFNDSCAGKPNNVSQKYEELKSNTIYPILSTTI-VIKALKSIFCIFKIENHMRALPGVDKCSVNLIEEIGMIDYDSGKWNVQKIREEIESLG---YLTELPKQNWNSTRQSSAVSL--------NEESRSKCYLRITGMTCSSCVNKVESHLLKVEGVKSVLVALLAMKCEIIYDSAYVMPFQLSNRVKELGFNAEVIENGNEGIGIV-----------------NVL----------IRGMTCSSCVNHIENHISKIKGIASINVSLSTSKGKVEYFISECGPRDVIDAINDMGFDA 1542
            S  + V+GMTC+SCVR IE+ + K  GV  I VSL    AT+I+D  + T + +   ID+MGFD  + ++     ++N     V + +    D  +S      T L +K +  V+   +   A +    S+ S ++I+ ++         Q +  G       P    + + ++V GMTC SC   IE  VGK QG+  IKV L+  EA  +    L    ++++ I  +GF + +        +  I  +     P   S+  ++ KS + YP  STT+  I+ +    C+  IE+ +  L  V    V+L     ++ Y++     + +R+ IE++    Y   +  +  ++    S+ SL        ++    +  + I GMTC+SCV  +E  + K  GVKS+ V+L      I +D     P  L   ++++GF+A +  +  E + ++                 NV+          + GMTC+SCV +IE ++ + +GI S+ V+L   K +V Y  +   PR + + I ++GF A
Sbjct:    9 SITITVEGMTCISCVRTIEQQIGKVNGVHHIKVSLEEKSATIIYDPKLQTPKTLQEAIDDMGFDALLHNANPLPVLTNTVFLTVTAPLTLPWDHIQS------TLLKTKGVTGVKISPQQRSAVVTIIPSVVSASQIVELVPDLSLDMGTQEKKSGACEEHSTPQAGEVMLKMKVEGMTCHSCTSTIEGKVGKLQGVQRIKVSLDNQEATIVFQPHLITAEEIKKQIEAVGFPAFIKKQPKYLKLGAIDVERLKNTPVKSSEGSQQ-KSPS-YPSDSTTMFTIEGMHCKSCVSNIESALSTLQYVSSIVVSLENRSAIVKYNASLVTPEMLRKAIEAISPGQYRVSIASEVESTASSPSSSSLQKMPLNIVSQPLTQEAVININGMTCNSCVQSIEGVISKKPGVKSIHVSLANSTGTIEFDPLLTSPETLREAIEDMGFDAALPADMKEPLVVIAQPSLETPLLPSSNELENVMTSVQNKCYIQVSGMTCASCVANIERNLRREEGIYSVLVALMAGKAEVRYNPAVIQPRVIAEFIRELGFGA 545          

HSP 3 Score: 127.872 bits (320), Expect = 5.235e-29
Identity = 125/471 (26.54%), Postives = 203/471 (43.10%), Query Frame = 1
Query:  109 RMKVDGMTCMSCVRNIEENLMKFTGVCGIMVSLLHAEATVIFDADIATVEDISNKIDEMGFDVTVKSS---------EVSNVKDKVVRSR-------IKFESDIN----------KSVEKSIETSLSSKLLL--VRFCQENNYADIWHYSSIRSTEIL--------------SVIQQSEIYGVL------------VLEQCPTIRVIVRVNGMTCQSCVDNIESTVGKKQGIISIKVFLEKSEAHALVDASLAGPD-VEEMINDMGFNSEMILEIFNDSCAGKPNNVSQKYEEL----KSNTIYPILSTT-----IVIKALKSIFCIFKIENHMRALPGVDKCSVNLIEEIGMIDYDSGKWNVQKIREEIESLGYLTELPKQNWNSTRQSSAVSLNE-ESRSKCYLRITGMTCSSCVNKVESHLLKVEGVKSVLVALLAMKCEIIYDSAYVMPFQLSNRVKELGFNAEVIE 1326
            +MKV+GMTC SC   IE  + K  GV  I VSL + EAT++F   + T E+I  +I+ +GF   +K           +V  +K+  V+S          + SD            KS   +IE++LS+   +  +    EN  A + + +S+ + E+L              S+  + E                 ++ Q  T   ++ +NGMTC SCV +IE  + KK G+ SI V L  S      D  L  P+ + E I DMGF++ +  ++           ++Q   E      SN +  ++++      I +  +    C+  IE ++R   G+    V L+     + Y+      + I E I  LG+               + V  N  E      L + GMTC+SCV+K+ES L K +G+    VAL   K  I YD   + P  + + +  LGF A +++
Sbjct:  174 KMKVEGMTCHSCTSTIEGKVGKLQGVQRIKVSLDNQEATIVFQPHLITAEEIKKQIEAVGFPAFIKKQPKYLKLGAIDVERLKNTPVKSSEGSQQKSPSYPSDSTTMFTIEGMHCKSCVSNIESALSTLQYVSSIVVSLENRSAIVKYNASLVTPEMLRKAIEAISPGQYRVSIASEVESTASSPSSSSLQKMPLNIVSQPLTQEAVININGMTCNSCVQSIEGVISKKPGVKSIHVSLANSTGTIEFDPLLTSPETLREAIEDMGFDAALPADMKEPLVV-----IAQPSLETPLLPSSNELENVMTSVQNKCYIQVSGMTCASCVANIERNLRREEGIYSVLVALMAGKAEVRYNPAVIQPRVIAEFIRELGF--------------GAMVMENAGEGNGILELVVRGMTCASCVHKIESTLTKHKGIFYCSVALATNKAHIKYDPEIIGPRDIIHTIGSLGFEASLVK 625          

HSP 4 Score: 89.7373 bits (221), Expect = 2.809e-17
Identity = 82/324 (25.31%), Postives = 141/324 (43.52%), Query Frame = 1
Query:  106 ARMKVDGMTCMSCVRNIEENLMKFTGVCGIMVSLLHAEATVIFDADIATVEDISNKIDEMGFDVTVKSSEVSNVKDKVVRSRIKFESDINKSVEKSIETSLSSKLLLVRFCQENNYADIWHYSSIRSTEILSVIQQSEIYGVLVLEQCPTIRVIVRVNGMTCQSCVDNIESTVGKKQGIISIKVFLEKSEAHALVDASLAGPDV-EEMINDMGFNSEMILEIFNDSCAGKPNNVSQKYEELKSNTIYPILSTTIVIKALKSIFCIFKIENHMRALPGVDKCSVNLIEEIGMIDYDSGKWNVQKIREEIESLGYLTELPKQNWNS 1074
            A + ++GMTC SCV++IE  + K  GV  I VSL ++  T+ FD  + + E +   I++MGFD                       +D+ + +    + SL + LL                SS     +++ +Q                +  ++V+GMTC SCV NIE  + +++GI S+ V L   +A    + ++  P V  E I ++GF + M++E      AG+ N + +                 +V++ +    C+ KIE+ +    G+  CSV L      I YD      + I   I SLG+   L K++ ++
Sbjct:  379 AVININGMTCNSCVQSIEGVISKKPGVKSIHVSLANSTGTIEFDPLLTSPETLREAIEDMGFDAA-------------------LPADMKEPLVVIAQPSLETPLL---------------PSSNELENVMTSVQN---------------KCYIQVSGMTCASCVANIERNLRREEGIYSVLVALMAGKAEVRYNPAVIQPRVIAEFIRELGFGA-MVME-----NAGEGNGILE-----------------LVVRGMTCASCVHKIESTLTKHKGIFYCSVALATNKAHIKYDPEIIGPRDIIHTIGSLGFEASLVKKDRSA 630          

HSP 5 Score: 55.8398 bits (133), Expect = 5.762e-7
Identity = 27/66 (40.91%), Postives = 37/66 (56.06%), Query Frame = 1
Query: 1351 VNVLIRGMTCSSCVNHIENHISKIKGIASINVSLSTSKGKVEYFISECGPRDVIDAINDMGFDASL 1548
            + + + GMTC SCV  IE  I K+ G+  I VSL      + Y      P+ + +AI+DMGFDA L
Sbjct:   10 ITITVEGMTCISCVRTIEQQIGKVNGVHHIKVSLEEKSATIIYDPKLQTPKTLQEAIDDMGFDALL 75          
BLAST of Copper-transporting ATPase 1 vs. Ensembl Mouse
Match: Atp7a (ATPase, Cu++ transporting, alpha polypeptide [Source:MGI Symbol;Acc:MGI:99400])

HSP 1 Score: 891.338 bits (2302), Expect = 0.000e+0
Identity = 561/1176 (47.70%), Postives = 756/1176 (64.29%), Query Frame = 1
Query:  574 VNGMTCQSCVDNIESTVGKKQGIISIKVFLEKSEAHALVDASLAGPDVEEMINDMGFNSEMILEIFNDSCAGKPNNVSQKYEELKSNTIYPILSTTIVIK--ALKSIFCIFKIENHMRALPGVDKCSVNLIEEIGMIDYDSGKWNVQKIREEIESLGYLTELP--KQNWNSTRQSSA-----VSLNE------ESRSKCYLRITGMTCSSCVNKVESHLLKVEGVKSVLVALLAMKCEIIYDSAYVMPFQLSNRVKELGFNAEVIENGNEGIGIVNVLIRGMTCSSCVNHIENHISKIKGIASINVSLSTSKGKVEYFISECGPRDVIDAINDMGFDASLCDHLES-NHAAADHINQMIKQWRSSFFFSLICGIPXXXXXXXXXXXXXXXXHTIIHENGSNRTIMKSTVPM-----VCSGLSADNLILFVLATPVQFYGARYFYIQAYLSLKHKTTNMDVLVVMATXXXXXXXXXXXXXXMAFRRNTSPKTFFETSPMLIVFLSLGRWLEHIAKGKTSEALTKLMSLQAVEATLYT--PEN---KERKIPINLVQRNDLIKILPGEKIPVDGKVVTGTSTCDESLITGESMPIEKTHGSDVIGGSINKSGMLIVKATHVGSDSALAQIVKLVEEAQTSKAPIQQLADRIAGMFVPSVLICAIITLIIWVIVGFSKPEI----LPKYVNELSVTEITWEHAFQLAITVLSIACPCSLGLXXXXXXXXXXXXXXXNGILIKGGEPLENIHKLNVIVFDKTGTITNGSPSVTRFLVLI-GNGVREHIDKLLKILAAAESASEHPIGKAIITFSKARISNENLPEVLESSAVSGCGLGCKLNLDPKTEVTKFVKNLINIESPSEETNILGQXXXXXXXXXXXXTYKDVIFPVRQHMAWTSDLCQTVTVIIGNRNWMLRNGILVDDEVDELMSEDENLGRTVILMAIDNELIAMISVADQVKREAALAVYTLKKMNIEVYLMTGDNSKTATAIARQVGIHYVFAEVLPSHKVAKVQQLQNTNRSLTSKRKMKVAMVGDGINDSPALAQSDVGIAIGTGTDVAVEAADVVLIRNSLLDVIAAIQLSKATVKRIRQNFIAATLYNLLGIPIAAGVLMPIGIEMMPWMXXXXXXXXXXXXXXXXXXXXXWKKPSEEKLITPEYINFIQSSGLSESQIIVRRGID 4008
            + GM C+SCV NIES +   Q + SI V LE   A    +ASL  P++     +     +  + I ++  +   +  S   +++  N +   L+   VI    +    C+  IE  +   PGV    V+L    G I++D    + + +RE IE +G+   LP  K+      Q S       S NE        ++KCY++++GMTC+SCV  +E +L + EG+ SVLVAL+A K E+ Y+ A + P  ++  ++ELGF A V+EN  EG GI+ +++RGMTC+SCV+ IE+ ++K KGI   +V+L+T+K  ++Y     GPRD+I  I  +GF+ASL     S NH   DH  + IKQWR SF  SL   IP M +M++ M     +     ++N SN  ++     M     +  GLS  NL+  +L  PVQF G  YFYIQAY +LKHKT NMDVL+V+AT+I++ YS+++++++M  R   +P TFF+T PML VF++LGRWLEHIAKGKTSEAL KL+SLQA EAT+ T   EN    E ++ + LVQR D+IK++PG K PVDG+V+ G S  DESLITGE+MP+ K  GS VI GSIN++G L+++ATHVG+D+ L+QIVKLVEEAQTSKAPIQQ AD+++G FVP +++ +I+TL++W+I+GF   EI     P Y   +S TE     AFQ +ITVL IACPCSLGLATPTAVMVGTGVGA NGILIKGGEPLE  HK+ V+VFDKTGTIT+G+P V +  VL+  N +    +K+L I+  AES SEHP+G A+  + K  +  E L    +   V GCG+ CK        VT     L       EE NI   ++      + + +    +  +  H++   +  Q   V+IGNR WM+RNG+++ ++VDE M E E  GRT +L+ ID+EL  +I++AD VK EA LAV+ LK M +EV LMTGDNSKTA +IA QVGI  VFAEVLPSHKVAKV+QLQ   +        +VAMVGDGINDSPALA ++VGIAIGTGTDVA+EAADVVLIRN LLDV+A+I LS+ TVKRIR NF+ A +YNL+GIPIAAGV +PIG+ + PWM SAAMAASSVSVV  SL LKL++KP+ +     E      +   S S+I V  GID
Sbjct:  283 IEGMHCKSCVSNIESALSTLQYVSSIVVSLENRSAIVKYNASLVTPEMLRKAIEAISPGQYRVSIASEVESTASSPSSSSLQKMPLNIVSQPLTQEAVININGMTCNSCVQSIEGVISKKPGVKSIHVSLANSTGTIEFDPLLTSPETLREAIEDMGFDAALPDMKEPLVVIAQPSLETPLLPSSNELENVMTSVQNKCYIQVSGMTCASCVANIERNLRREEGIYSVLVALMAGKAEVRYNPAVIQPRVIAEFIRELGFGAMVMENAGEGNGILELVVRGMTCASCVHKIESTLTKHKGIFYCSVALATNKAHIKYDPEIIGPRDIIHTIGSLGFEASLVKKDRSANHL--DH-KREIKQWRGSFLVSLFFCIPVMGLMVYMMVMDHHLATLHHNQNMSNEEMINMHSAMFLERQILPGLSIMNLLSLLLCLPVQFCGGWYFYIQAYKALKHKTANMDVLIVLATTIAFAYSLVILLVAMFERAKVNPITFFDTPPMLFVFIALGRWLEHIAKGKTSEALAKLISLQATEATIVTLNSENLLLSEEQVDVELVQRGDIIKVVPGGKFPVDGRVIEGHSMVDESLITGEAMPVAKKPGSTVIAGSINQNGSLLIRATHVGADTTLSQIVKLVEEAQTSKAPIQQFADKLSGYFVPFIVLVSIVTLLVWIIIGFQNFEIVETYFPGYNRSISRTETIIRFAFQASITVLCIACPCSLGLATPTAVMVGTGVGAQNGILIKGGEPLEMAHKVKVVVFDKTGTITHGTPVVNQVKVLVESNKISR--NKILAIVGTAESNSEHPLGAAVTKYCKKELDTETLGTCTDFQVVPGCGISCK--------VTNIEGLLHKSNLKIEENNIKNASLVQIDAINEQSSTSSSMI-IDAHLSNAVN-TQQYKVLIGNREWMIRNGLVISNDVDESMIEHERRGRTAVLVTIDDELCGLIAIADTVKPEAELAVHILKSMGLEVVLMTGDNSKTARSIASQVGITKVFAEVLPSHKVAKVKQLQEEGK--------RVAMVGDGINDSPALAMANVGIAIGTGTDVAIEAADVVLIRNDLLDVVASIDLSRKTVKRIRINFVFALIYNLVGIPIAAGVFLPIGLVLQPWMGSAAMAASSVSVVLSSLFLKLYRKPTYDNY---ELHPRSHTGQRSPSEISVHVGID 1432          

HSP 2 Score: 143.28 bits (360), Expect = 9.882e-34
Identity = 143/544 (26.29%), Postives = 251/544 (46.14%), Query Frame = 1
Query:  103 SARMKVDGMTCMSCVRNIEENLMKFTGVCGIMVSLLHAEATVIFDADIATVEDISNKIDEMGFDVTVKSSE----VSNVKDKVVRSRIKFESDINKSVEKSIETSLSSKLLL-VRFCQENNYADIWHYSSIRS-TEILSVIQ--------QSEIYGVLVLEQCPT---IRVIVRVNGMTCQSCVDNIESTVGKKQGIISIKVFLEKSEAHALVDASL-AGPDVEEMINDMGFNSEM--------ILEIFNDSCAGKPNNVSQKYEELKSNTIYPILSTTI-VIKALKSIFCIFKIENHMRALPGVDKCSVNLIEEIGMIDYDSGKWNVQKIREEIESLG---YLTELPKQNWNSTRQSSAVSL--------NEESRSKCYLRITGMTCSSCVNKVESHLLKVEGVKSVLVALLAMKCEIIYDSAYVMPFQLSNRVKELGFNA-------------------EVIENGNEGIGIVN-------VLIRGMTCSSCVNHIENHISKIKGIASINVSLSTSKGKVEYFISECGPRDVIDAINDMGFDA 1542
            S  + V+GMTC+SCVR IE+ + K  GV  I VSL    AT+I+D  + T + +   ID+MGFD  + ++     ++N     V + +    D  +S      T L +K +  V+   +   A +    S+ S ++I+ ++         Q +  G       P    + + ++V GMTC SC   IE  VGK QG+  IKV L+  EA  +    L    ++++ I  +GF + +        +  I  +     P   S+  ++ KS + YP  STT+  I+ +    C+  IE+ +  L  V    V+L     ++ Y++     + +R+ IE++    Y   +  +  ++    S+ SL        ++    +  + I GMTC+SCV  +E  + K  GVKS+ V+L      I +D     P  L   ++++GF+A                    ++ + NE   ++        + + GMTC+SCV +IE ++ + +GI S+ V+L   K +V Y  +   PR + + I ++GF A
Sbjct:    9 SITITVEGMTCISCVRTIEQQIGKVNGVHHIKVSLEEKSATIIYDPKLQTPKTLQEAIDDMGFDALLHNANPLPVLTNTVFLTVTAPLTLPWDHIQS------TLLKTKGVTGVKISPQQRSAVVTIIPSVVSASQIVELVPDLSLDMGTQEKKSGACEEHSTPQAGEVMLKMKVEGMTCHSCTSTIEGKVGKLQGVQRIKVSLDNQEATIVFQPHLITAEEIKKQIEAVGFPAFIKKQPKYLKLGAIDVERLKNTPVKSSEGSQQ-KSPS-YPSDSTTMFTIEGMHCKSCVSNIESALSTLQYVSSIVVSLENRSAIVKYNASLVTPEMLRKAIEAISPGQYRVSIASEVESTASSPSSSSLQKMPLNIVSQPLTQEAVININGMTCNSCVQSIEGVISKKPGVKSIHVSLANSTGTIEFDPLLTSPETLREAIEDMGFDAALPDMKEPLVVIAQPSLETPLLPSSNELENVMTSVQNKCYIQVSGMTCASCVANIERNLRREEGIYSVLVALMAGKAEVRYNPAVIQPRVIAEFIRELGFGA 544          

HSP 3 Score: 128.257 bits (321), Expect = 4.687e-29
Identity = 128/471 (27.18%), Postives = 201/471 (42.68%), Query Frame = 1
Query:  109 RMKVDGMTCMSCVRNIEENLMKFTGVCGIMVSLLHAEATVIFDADIATVEDISNKIDEMGFDVTVKSS---------EVSNVKDKVVRSR-------IKFESDIN----------KSVEKSIETSLSSKLLL--VRFCQENNYADIWHYSSIRSTEIL--------------SVIQQSEIYGVL------------VLEQCPTIRVIVRVNGMTCQSCVDNIESTVGKKQGIISIKVFLEKSEAHALVDASLAGPD-VEEMINDMGFNS------EMILEIFNDSCAGKPNNVSQKYEELKS---NTIYPILSTTIVIKALKSIFCIFKIENHMRALPGVDKCSVNLIEEIGMIDYDSGKWNVQKIREEIESLGYLTELPKQNWNSTRQSSAVSLNE-ESRSKCYLRITGMTCSSCVNKVESHLLKVEGVKSVLVALLAMKCEIIYDSAYVMPFQLSNRVKELGFNAEVIE 1326
            +MKV+GMTC SC   IE  + K  GV  I VSL + EAT++F   + T E+I  +I+ +GF   +K           +V  +K+  V+S          + SD            KS   +IE++LS+   +  +    EN  A + + +S+ + E+L              S+  + E                 ++ Q  T   ++ +NGMTC SCV +IE  + KK G+ SI V L  S      D  L  P+ + E I DMGF++      E ++ I   S        S + E + +   N  Y      I +  +    C+  IE ++R   G+    V L+     + Y+      + I E I  LG+               + V  N  E      L + GMTC+SCV+K+ES L K +G+    VAL   K  I YD   + P  + + +  LGF A +++
Sbjct:  174 KMKVEGMTCHSCTSTIEGKVGKLQGVQRIKVSLDNQEATIVFQPHLITAEEIKKQIEAVGFPAFIKKQPKYLKLGAIDVERLKNTPVKSSEGSQQKSPSYPSDSTTMFTIEGMHCKSCVSNIESALSTLQYVSSIVVSLENRSAIVKYNASLVTPEMLRKAIEAISPGQYRVSIASEVESTASSPSSSSLQKMPLNIVSQPLTQEAVININGMTCNSCVQSIEGVISKKPGVKSIHVSLANSTGTIEFDPLLTSPETLREAIEDMGFDAALPDMKEPLVVIAQPSLETPLLPSSNELENVMTSVQNKCY------IQVSGMTCASCVANIERNLRREEGIYSVLVALMAGKAEVRYNPAVIQPRVIAEFIRELGF--------------GAMVMENAGEGNGILELVVRGMTCASCVHKIESTLTKHKGIFYCSVALATNKAHIKYDPEIIGPRDIIHTIGSLGFEASLVK 624          

HSP 4 Score: 88.5817 bits (218), Expect = 5.337e-17
Identity = 82/324 (25.31%), Postives = 141/324 (43.52%), Query Frame = 1
Query:  106 ARMKVDGMTCMSCVRNIEENLMKFTGVCGIMVSLLHAEATVIFDADIATVEDISNKIDEMGFDVTVKSSEVSNVKDKVVRSRIKFESDINKSVEKSIETSLSSKLLLVRFCQENNYADIWHYSSIRSTEILSVIQQSEIYGVLVLEQCPTIRVIVRVNGMTCQSCVDNIESTVGKKQGIISIKVFLEKSEAHALVDASLAGPDV-EEMINDMGFNSEMILEIFNDSCAGKPNNVSQKYEELKSNTIYPILSTTIVIKALKSIFCIFKIENHMRALPGVDKCSVNLIEEIGMIDYDSGKWNVQKIREEIESLGYLTELPKQNWNS 1074
            A + ++GMTC SCV++IE  + K  GV  I VSL ++  T+ FD  + + E +   I++MGFD  +                     D+ + +    + SL + LL                SS     +++ +Q                +  ++V+GMTC SCV NIE  + +++GI S+ V L   +A    + ++  P V  E I ++GF + M++E      AG+ N + +                 +V++ +    C+ KIE+ +    G+  CSV L      I YD      + I   I SLG+   L K++ ++
Sbjct:  379 AVININGMTCNSCVQSIEGVISKKPGVKSIHVSLANSTGTIEFDPLLTSPETLREAIEDMGFDAAL--------------------PDMKEPLVVIAQPSLETPLL---------------PSSNELENVMTSVQN---------------KCYIQVSGMTCASCVANIERNLRREEGIYSVLVALMAGKAEVRYNPAVIQPRVIAEFIRELGFGA-MVME-----NAGEGNGILE-----------------LVVRGMTCASCVHKIESTLTKHKGIFYCSVALATNKAHIKYDPEIIGPRDIIHTIGSLGFEASLVKKDRSA 629          

HSP 5 Score: 55.8398 bits (133), Expect = 5.959e-7
Identity = 27/66 (40.91%), Postives = 37/66 (56.06%), Query Frame = 1
Query: 1351 VNVLIRGMTCSSCVNHIENHISKIKGIASINVSLSTSKGKVEYFISECGPRDVIDAINDMGFDASL 1548
            + + + GMTC SCV  IE  I K+ G+  I VSL      + Y      P+ + +AI+DMGFDA L
Sbjct:   10 ITITVEGMTCISCVRTIEQQIGKVNGVHHIKVSLEEKSATIIYDPKLQTPKTLQEAIDDMGFDALL 75          
BLAST of Copper-transporting ATPase 1 vs. Ensembl Mouse
Match: Atp7b (ATPase, Cu++ transporting, beta polypeptide [Source:MGI Symbol;Acc:MGI:103297])

HSP 1 Score: 874.004 bits (2257), Expect = 0.000e+0
Identity = 545/1210 (45.04%), Postives = 755/1210 (62.40%), Query Frame = 1
Query:  562 VIVRVNGMTCQSCVDNIESTVGKKQGIISIKVFLEKSEAHALVDASLAGP-DVEEMINDMGFNSEMILEIFNDSCAGK--PNNVSQ-KYEELKSNTIYPI-LSTTIVIKALKSIFCI---FKIENHMRALP---GVDKCSVNLIEEIGMIDYDSGKWNVQKIREEIESLGY--------LTELPKQNW---NSTRQS------SAVSLNEESRS-----------------------KCYLRITGMTCSSCVNKVESHLLKVEGVKSVLVALLAMKCEIIYDSAYVMPFQLSNRVKELGFNAEVIENGNEGIGIVNVLIRGMTCSSCVNHIENHISKIKGIASINVSLSTSKGKVEYFISECGPRDVIDAINDMGFDASLCDHLESNHAAADHINQMIKQWRSSFFFSLICGIPXXXXXXXXXXXXXXXXHTIIHENGSNRTIMKSTVPMVCSGLSADNLILFVLATPVQFYGARYFYIQAYLSLKHKTTNMDVLVVMATXXXXXXXXXXXXXXMAFRRNTSPKTFFETSPMLIVFLSLGRWLEHIAKGKTSEALTKLMSLQAVEATLYT--PEN---KERKIPINLVQRNDLIKILPGEKIPVDGKVVTGTSTCDESLITGESMPIEKTHGSDVIGGSINKSGMLIVKATHVGSDSALAQIVKLVEEAQTSKAPIQQLADRIAGMFVPSVLICAIITLIIWVIVGFSKPEILPKYV----NELSVTEITWEHAFQLAITVLSIACPCSLGLXXXXXXXXXXXXXXXNGILIKGGEPLENIHKLNVIVFDKTGTITNGSPSVTRFLVLIGNGVREHIDKLLKILAAAESASEHPIGKAIITFSKARISNENLPEVLESSAVSGCGLGCKL-NLDPKTEVTKFVKNLINIESPSEETNILGQXXXXXXXXXXXXTYKDVIFPVRQHMAWTSDLCQTVTVIIGNRNWMLRNGILVDDEVDELMSEDENLGRTVILMAIDNELIAMISVADQVKREAALAVYTLKKMNIEVYLMTGDNSKTATAIARQVGIHYVFAEVLPSHKVAKVQQLQNTNRSLTSKRKMKVAMVGDGINDSPALAQSDVGIAIGTGTDVAVEAADVVLIRNSLLDVIAAIQLSKATVKRIRQNFIAATLYNLLGIPIAAGVLMPIGIEMMPWMXXXXXXXXXXXXXXXXXXXXXWKKPSEEKLITPEYINFIQSSGLSESQIIVRRGID 4008
            V +RV GMTCQSCV +IE  + K QG++ IKV L   EA       L  P D+ + I DMGF +     I N +   +  P +V++ +   LK  T+ P+ +S        +  +      +I+     L    GV + S++L E  G + YD    ++ ++R  +E +G+         T  P +N+   NS  Q+      S   +  ++R                        KC+++I GMTC+SCV+ +E  L +  G+ SVLVAL++ K E+ YD   +   +++  +++LGF A V+E+     G + ++I GMTC+SCV++IE+ +++  GI   +V+L+TSK  V++     GPRD+I  I ++GF ASL     + H   DH  + IKQW+ SF  SL+ GIP M +M++ +      + T++ ++             +  GLS  NLI F+L T VQF G  YFY+QAY SL+H++ NMDVL+V+AT+I+Y YS++++V+++A +   SP TFF+T PML VF++LGRWLEH+AK KTSEAL KLMSLQA EAT+ T   +N   +E ++P+ LVQR D+IK++PG K PVDGKV+ G +  DESLITGE+MP+ K  GS VI GSIN  G +++KATHVG+D+ LAQIVKLVEEAQ SKAPIQQLADR +G FVP ++I + +TL++W+++GF    ++ KY       +S TE+    AFQ +ITVL IACPCSLGLATPTAVMVGTGV A NG+LIKGG+PLE  HK+  ++FDKTGTIT+G P V RFL L+ +     + K+L ++  AE++SEHP+G A+  + K  +  E L    +  AV GCG+ CK+ N++     +    + + + +P                            P  +         QT +V+IGNR WM RNG+ +  ++ + M++ E  G+T IL+AID  L  MI++AD VK EAALA+YTLK M ++V L+TGDN KTA AIA QVGI+ VFAEVLPSHKVAKVQ+LQN  +        KVAMVGDG+NDSPALAQ+DVGIAIGTGTDVA+EAADVVLIRN LLDV+A+I LSK TV+RIR N + A +YN++GIPIAAGV MPIGI + PWM SAAMAASSVSVV  SL LK ++KP  E+    E     +   LS SQ+ V  G+D
Sbjct:  143 VKLRVEGMTCQSCVSSIEGKIRKLQGVVRIKVSLSNQEAVITYQPYLIQPEDLRDHICDMGFEAA----IKNRTAPLRLGPIDVNKLESTNLKKETVSPVQISNHFETLGHQGSYLATLPLRIDGMHYMLSQRKGVQQTSISLAEGTGAVLYDPSIVSLDELRTAVEDMGFEVSVNSETFTINPVRNFKSGNSVPQTMGDIAGSVQKMAPDTRGLPTHQGPGHSSETPSSPGATASQKCFVQIKGMTCASCVSNIERSLQRHAGILSVLVALMSGKAEVKYDPEIIQSPRIAQLIQDLGFEASVMEDNTVSEGDIELIITGMTCASCVHNIESKLTRTNGITYASVALATSKAHVKFDPEIVGPRDIIKIIEEIGFHASLAQRNPNAHHL-DHKTE-IKQWKKSFLCSLVFGIPVMGLMVYMLIPSSTPQETMVLDHN------------IIPGLSVLNLIFFILCTFVQFLGGWYFYVQAYKSLRHRSANMDVLIVLATTIAYAYSLVILVVAVAEKAEKSPVTFFDTPPMLFVFIALGRWLEHVAKSKTSEALAKLMSLQATEATVVTLGEDNLILREEQVPMELVQRGDVIKVVPGGKFPVDGKVLEGNTMADESLITGEAMPVTKKPGSIVIAGSINAHGSVLLKATHVGNDTTLAQIVKLVEEAQMSKAPIQQLADRFSGYFVPFIIIISTLTLVVWIVIGFVDFGVVQKYFPSPSKHISQTEVIIRFAFQTSITVLCIACPCSLGLATPTAVMVGTGVAAQNGVLIKGGKPLEMAHKIKTVMFDKTGTITHGVPRVMRFL-LLADVATLPLRKVLAVVGTAEASSEHPLGVAVTKYCKEELGTETLGYSTDFQAVPGCGISCKVSNVEGILARSDLTAHPVGVGNP----------------------------PTGEGAG-----PQTFSVLIGNREWMRRNGLTISSDISDAMTDHEMKGQTAILVAIDGVLCGMIAIADAVKPEAALAIYTLKSMGVDVALITGDNRKTARAIATQVGINKVFAEVLPSHKVAKVQELQNEGK--------KVAMVGDGVNDSPALAQADVGIAIGTGTDVAIEAADVVLIRNDLLDVVASIHLSKRTVRRIRVNLVLALIYNMVGIPIAAGVFMPIGIVLQPWMGSAAMAASSVSVVLSSLQLKCYRKPDLERY---EAQAHGRMKPLSASQVSVHIGMD 1289          

HSP 2 Score: 95.1301 bits (235), Expect = 5.379e-19
Identity = 95/438 (21.69%), Postives = 178/438 (40.64%), Query Frame = 1
Query:  109 RMKVDGMTCMSCVRNIEENLMKFTGVCGIMVSLLHAEATVIFDADIATVEDISNKIDEMGFDVTVKSSEVSNVKDKVVRSRIKFESDINKSVEKSIETSLSSKLLLVRFCQENNYADIWHYSSIRSTEILSVIQQSEIYGVLVLEQCPTIRVIVRVNGMTCQSCVDNIESTVGKKQGIISIKVFLEKSEAHALVDASLAGPD-VEEMINDMGFNSEMILEIF----------NDSCAGKPNNVSQKYEELKSNT----------------IYPILSTT----IVIKALKSIFCIFKIENHMRALPGVDKCSVNLIEEIGMIDYDSGKWNVQKIREEIESLGYLTELPKQNWNSTRQSSAVSLNEESRSKCYLRITGMTCSSCVNKVESHLLKVEGVKSVLVALLAMKCEIIYDSAYVMPFQLSNRVKELGFNAEVIEN 1329
            +++V+GMTC SCV +IE  + K  GV  I VSL + EA + +   +   ED+ + I +MGF+        + +K++    R+    D+NK    +++    S + +      N++  + H  S  +T                        + +R++GM            + +++G+    + L +     L D S+   D +   + DMGF   +  E F           +S      +++   +++  +T                  P  + +    + IK +    C+  IE  ++   G+    V L+     + YD       +I + I+ LG+             ++S +  N  S     L ITGMTC+SCV+ +ES L +  G+    VAL   K  + +D   V P  +   ++E+GF+A + + 
Sbjct:  144 KLRVEGMTCQSCVSSIEGKIRKLQGVVRIKVSLSNQEAVITYQPYLIQPEDLRDHICDMGFE--------AAIKNRTAPLRLG-PIDVNKLESTNLKKETVSPVQI-----SNHFETLGHQGSYLAT------------------------LPLRIDGM---------HYMLSQRKGVQQTSISLAEGTGAVLYDPSIVSLDELRTAVEDMGFEVSVNSETFTINPVRNFKSGNSVPQTMGDIAGSVQKMAPDTRGLPTHQGPGHSSETPSSPGATASQKCFVQIKGMTCASCVSNIERSLQRHAGILSVLVALMSGKAEVKYDPEIIQSPRIAQLIQDLGF-------------EASVMEDNTVSEGDIELIITGMTCASCVHNIESKLTRTNGITYASVALATSKAHVKFDPEIVGPRDIIKIIEEIGFHASLAQR 521          

HSP 3 Score: 82.8037 bits (203), Expect = 2.761e-15
Identity = 56/186 (30.11%), Postives = 90/186 (48.39%), Query Frame = 1
Query: 1051 LPKQNW-NSTRQSSAV-------SLNEESRSKC---YLRITGMTCSSCVNKVESHLLKVEGVKSVLVALLAMKCEIIYDSAYVMPFQLSNRVKELGFNAEVIENGNEGI---------GIVNVLIRGMTCSSCVNHIENHISKIKGIASINVSLSTSKGKVEYFISECGPRDVIDAINDMGFDASL 1548
            LP + W  S +QS A         L+  S S      + I GMTC SCV  +E  +  ++G+ ++ V+L      + Y  + +   Q+  +++++GF A   E                +V + + GMTC SCV+ IE  I K++G+  I VSLS  +  + Y      P D+ D I DMGF+A++
Sbjct:   23 LPGRPWEQSMKQSFAFDNVGYEGGLDSTSSSPAATDVVNILGMTCHSCVKSIEDRISSLKGIVNIKVSLEQGSATVRYVPSVMNLQQICLQIEDMGFEASAAEGKAASWPSRSSPAQEAVVKLRVEGMTCQSCVSSIEGKIRKLQGVVRIKVSLSNQEAVITYQPYLIQPEDLRDHICDMGFEAAI 208          

HSP 4 Score: 76.2554 bits (186), Expect = 3.447e-13
Identity = 91/407 (22.36%), Postives = 163/407 (40.05%), Query Frame = 1
Query:  550 PTIRVIVRVNGMTCQSCVDNIESTVGKKQGIISIKVFLEKSEAHA-LVDASLAGPDVEEMINDMGFNSEMILEIFNDSCAGKPNNVSQKYEELKSNTIYPILSTTIVIKALKSIFCIFKIENHMRALPGVDKCSVNLIEEIGMIDYDSGKWNVQKIREEIESLGYLTELPKQNWNSTRQSSAVSLN--------EESRSKC----YLRITGMTCSSC------VNKVESHLLKVEGVKSVLVALLAMKCEIIYDSAYVMPFQLSNRVKELGFNAEV------------IENGN--------------------------EGIGIVN---------------VLIRGMTCSSCVNHIENHISKIKGIASINVSLSTSKGKVEYFISECGPRDVIDAINDMGFDASLCD 1554
            P    +V + GMTC SCV +IE  +   +GI++IKV LE+  A    V + +    +   I DMGF +           A  P+  S   E +            + ++ +    C+  IE  +R L GV +  V+L  +  +I Y       + +R+ I  +G+  E   +N  +  +   + +N        +E+ S      +    G   S        ++ +   L + +GV+   ++L      ++YD + V   +L   V+++GF   V             ++GN                          +G G  +               V I+GMTC+SCV++IE  + +  GI S+ V+L + K +V+Y         +   I D+GF+AS+ +
Sbjct:   54 PAATDVVNILGMTCHSCVKSIEDRISSLKGIVNIKVSLEQGSATVRYVPSVMNLQQICLQIEDMGFEASAA----EGKAASWPSRSSPAQEAV----------VKLRVEGMTCQSCVSSIEGKIRKLQGVVRIKVSLSNQEAVITYQPYLIQPEDLRDHICDMGF--EAAIKNRTAPLRLGPIDVNKLESTNLKKETVSPVQISNHFETLGHQGSYLATLPLRIDGMHYMLSQRKGVQQTSISLAEGTGAVLYDPSIVSLDELRTAVEDMGFEVSVNSETFTINPVRNFKSGNSVPQTMGDIAGSVQKMAPDTRGLPTHQGPGHSSETPSSPGATASQKCFVQIKGMTCASCVSNIERSLQRHAGILSVLVALMSGKAEVKYDPEIIQSPRIAQLIQDLGFEASVME 444          

HSP 5 Score: 75.8702 bits (185), Expect = 4.223e-13
Identity = 78/332 (23.49%), Postives = 136/332 (40.96%), Query Frame = 1
Query:   97 LGSARMKVDGMTCMSCVRNIEENLMKFTGVCGIMVSLLHAEATVIFDADIATVEDISNKIDEMGFDVTVKS-----SEVSNVKDKVVRSRIKFESDINKSVEKSIETSLSSKLLLVRFCQENNYADIWHYSSIRSTEILSVIQQSEIYGVLVLEQCPTIRVIVRVNGMTCQSCVDNIESTVGKKQGIISIKVFLEKSEAHALVDAS-LAGPDVEEMINDMGFNSEMILEIFNDSCAGKPNNVSQKYEELKSNTIYPILSTTIVIKALKSIFCIFKIENHMRALPGVDKCSVNLIEEIGMIDYDSGKWNVQKIREEIESLGYLTELPKQNWNS 1074
            L +  +++DGM  M         L +  GV    +SL      V++D  I +++++   +++MGF+V+V S     + V N K     S  +   DI  SV+K                  +      H     S+E  S        G    ++C      V++ GMTC SCV NIE ++ +  GI+S+ V L   +A    D   +  P + ++I D+GF + ++ +          N VS+   EL             +I  +    C+  IE+ +    G+   SV L      + +D      + I + IE +G+   L ++N N+
Sbjct:  254 LATLPLRIDGMHYM---------LSQRKGVQQTSISLAEGTGAVLYDPSIVSLDELRTAVEDMGFEVSVNSETFTINPVRNFKSG--NSVPQTMGDIAGSVQK---------------MAPDTRGLPTHQGPGHSSETPSS------PGATASQKC-----FVQIKGMTCASCVSNIERSLQRHAGILSVLVALMSGKAEVKYDPEIIQSPRIAQLIQDLGFEASVMED----------NTVSEGDIEL-------------IITGMTCASCVHNIESKLTRTNGITYASVALATSKAHVKFDPEIVGPRDIIKIIEEIGFHASLAQRNPNA 525          
BLAST of Copper-transporting ATPase 1 vs. Ensembl Mouse
Match: Atp2a3 (ATPase, Ca++ transporting, ubiquitous [Source:MGI Symbol;Acc:MGI:1194503])

HSP 1 Score: 86.6557 bits (213), Expect = 1.942e-16
Identity = 60/212 (28.30%), Postives = 97/212 (45.75%), Query Frame = 1
Query: 3307 DNELIAMISVADQVKREAALAVYTLKKMNIEVYLMTGDNSKTATAIARQVGIH-------------------------------YVFAEVLPSHKVAKVQQLQNTNRSLTSKRKMKVAMVGDGINDSPALAQSDVGIAIGTGTDVAVEAADVVLIRNSLLDVIAAIQLSKATVKRIRQ-----------NFIAATLYNLLGIPIAAGVLMPI 3816
            D   +  + + D  + E A  +    +  I V ++TGDN  TA AI R++GI                                  FA V P+HK   V+ LQ+ N           AM GDG+ND+PAL ++++GIA+G+GT VA  AA++VL  ++   ++AA++  +A    ++Q             +   L  +LG+P A   L+P+
Sbjct:  590 DLTFVGCVGMLDPPRPEVAACITRCSRAGIRVVMITGDNKGTAVAICRRLGIFGDTEDVLGKAYTGREFDDLSPEQQRQACRTARCFARVEPAHKSRIVENLQSFNEI--------TAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSAAEMVLSDDNFASIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVCIFLTAILGLPEA---LIPV 790          
BLAST of Copper-transporting ATPase 1 vs. UniProt/SwissProt
Match: sp|Q64446|ATP7B_MOUSE (Copper-transporting ATPase 2 OS=Mus musculus OX=10090 GN=Atp7b PE=1 SV=2)

HSP 1 Score: 902.508 bits (2331), Expect = 0.000e+0
Identity = 567/1351 (41.97%), Postives = 810/1351 (59.96%), Query Frame = 1
Query:  109 RMKVDGMTCMSCVRNIEENLMKFTGVCGIMVSLLHAEATVIFDADIATVEDISNKIDEMGFDVTVKSSEVSNVKDKVVRSRIKFESDINKSVEKSIETSLSSKLLLVRFCQENNYADIWHYSSIRSTEILSVIQQSEIYGVLVLEQCPTIRVIVRVNGMTCQSCVDNIESTVGKKQGIISIKVFLEKSEAHALVDASLAGPDVEEMINDMGFNSEMILEIFNDSCAGKPNN-VSQKYEELKSNTIYPILSTTIVIKALKSIFCIFKIENHMRALPGVDKCSVNLIEEIGMIDYDSGKWNVQKIREEIESLGY--------LTELPKQNW---NSTRQS------SAVSLNEESRS-----------------------KCYLRITGMTCSSCVNKVESHLLKVEGVKSVLVALLAMKCEIIYDSAYVMPFQLSNRVKELGFNAEVIENGNEGIGIVNVLIRGMTCSSCVNHIENHISKIKGIASINVSLSTSKGKVEYFISECGPRDVIDAINDMGFDASLCDHLESNHAAADHINQMIKQWRSSFFFSLICGIPXXXXXXXXXXXXXXXXHTIIHENGSNRTIMKSTVPMVCSGLSADNLILFVLATPVQFYGARYFYIQAYLSLKHKTTNMDVLVVMATXXXXXXXXXXXXXXMAFRRNTSPKTFFETSPMLIVFLSLGRWLEHIAKGKTSEALTKLMSLQAVEATLYT--PEN---KERKIPINLVQRNDLIKILPGEKIPVDGKVVTGTSTCDESLITGESMPIEKTHGSDVIGGSINKSGMLIVKATHVGSDSALAQIVKLVEEAQTSKAPIQQLADRIAGMFVPSVLICAIITLIIWVIVGFSKPEILPKYV----NELSVTEITWEHAFQLAITVLSIACPCSLGLXXXXXXXXXXXXXXXNGILIKGGEPLENIHKLNVIVFDKTGTITNGSPSVTRFLVLIGNGVREHIDKLLKILAAAESASEHPIGKAIITFSKARISNENLPEVLESSAVSGCGLGCKL-NLDPKTEVTKFVKNLINIESPSEETNILGQXXXXXXXXXXXXTYKDVIFPVRQHMAWTSDLCQTVTVIIGNRNWMLRNGILVDDEVDELMSEDENLGRTVILMAIDNELIAMISVADQVKREAALAVYTLKKMNIEVYLMTGDNSKTATAIARQVGIHYVFAEVLPSHKVAKVQQLQNTNRSLTSKRKMKVAMVGDGINDSPALAQSDVGIAIGTGTDVAVEAADVVLIRNSLLDVIAAIQLSKATVKRIRQNFIAATLYNLLGIPIAAGVLMPIGIEMMPWMXXXXXXXXXXXXXXXXXXXXXWKKPSEEKLITPEYINFIQSSGLSESQIIVRRGID 4008
            +++V+GMTC SCV +IE  + K  GV  I VSL + EA + +   +   ED+ + I +MGF+        + +K++    R+    D+NK    +++    S + +      N++  + H  S  +T                        + +R++GM C+SCV NIE  +G+  G+ +I V LE   A    D S   P   +   +        + + +     +P +  SQ+++E       P  +  + I  +     +  IE+ +    GV + S++L E  G + YD    ++ ++R  +E +G+         T  P +N+   NS  Q+      S   +  ++R                        KC+++I GMTC+SCV+ +E  L +  G+ SVLVAL++ K E+ YD   +   +++  +++LGF A V+E+     G + ++I GMTC+SCV++IE+ +++  GI   +V+L+TSK  V++     GPRD+I  I ++GF ASL     + H   DH  + IKQW+ SF  SL+ GIP M +M++ +      + T++ ++             +  GLS  NLI F+L T VQF G  YFY+QAY SL+H++ NMDVL+V+AT+I+Y YS++++V+++A +   SP TFF+T PML VF++LGRWLEH+AK KTSEAL KLMSLQA EAT+ T   +N   +E ++P+ LVQR D+IK++PG K PVDGKV+ G +  DESLITGE+MP+ K  GS VI GSIN  G +++KATHVG+D+ LAQIVKLVEEAQ SKAPIQQLADR +G FVP ++I + +TL++W+++GF    ++ KY       +S TE+    AFQ +ITVL IACPCSLGLATPTAVMVGTGV A NG+LIKGG+PLE  HK+  ++FDKTGTIT+G P V RFL L+ +     + K+L ++  AE++SEHP+G A+  + K  +  E L    +  AV GCG+ CK+ N++     +    + + + +P                            P  +         QT +V+IGNR WM RNG+ +  ++ + M++ E  G+T IL+AID  L  MI++AD VK EAALA+YTLK M ++V L+TGDN KTA AIA QVGI+ VFAEVLPSHKVAKVQ+LQN  +        KVAMVGDG+NDSPALAQ+DVGIAIGTGTDVA+EAADVVLIRN LLDV+A+I LSK TV+RIR N + A +YN++GIPIAAGV MPIGI + PWM SAAMAASSVSVV  SL LK ++KP  E+    E     +   LS SQ+ V  G+D
Sbjct:  156 KLRVEGMTCQSCVSSIEGKIRKLQGVVRIKVSLSNQEAVITYQPYLIQPEDLRDHICDMGFE--------AAIKNRTAPLRLG-PIDVNKLESTNLKKETVSPVQI-----SNHFETLGHQGSYLAT------------------------LPLRIDGMHCKSCVLNIEGNIGQLPGVQNIHVSLENKTAQIQYDPSCVTPMFLQTAIEALPPGHFKVSLPDGVEENEPQSGSSQRHQEQG-----PGRTAVLTISGITCASSVQPIEDMLSQRKGVQQTSISLAEGTGAVLYDPSIVSLDELRTAVEDMGFEVSVNSETFTINPVRNFKSGNSVPQTMGDIAGSVQKMAPDTRGLPTHQGPGHSSETPSSPGATASQKCFVQIKGMTCASCVSNIERSLQRHAGILSVLVALMSGKAEVKYDPEIIQSPRIAQLIQDLGFEASVMEDNTVSEGDIELIITGMTCASCVHNIESKLTRTNGITYASVALATSKAHVKFDPEIVGPRDIIKIIEEIGFHASLAQRNPNAHHL-DHKTE-IKQWKKSFLCSLVFGIPVMGLMVYMLIPSSTPQETMVLDHN------------IIPGLSVLNLIFFILCTFVQFLGGWYFYVQAYKSLRHRSANMDVLIVLATTIAYAYSLVILVVAVAEKAEKSPVTFFDTPPMLFVFIALGRWLEHVAKSKTSEALAKLMSLQATEATVVTLGEDNLILREEQVPMELVQRGDVIKVVPGGKFPVDGKVLEGNTMADESLITGEAMPVTKKPGSIVIAGSINAHGSVLLKATHVGNDTTLAQIVKLVEEAQMSKAPIQQLADRFSGYFVPFIIIISTLTLVVWIVIGFVDFGVVQKYFPSPSKHISQTEVIIRFAFQTSITVLCIACPCSLGLATPTAVMVGTGVAAQNGVLIKGGKPLEMAHKIKTVMFDKTGTITHGVPRVMRFL-LLADVATLPLRKVLAVVGTAEASSEHPLGVAVTKYCKEELGTETLGYSTDFQAVPGCGISCKVSNVEGILARSDLTAHPVGVGNP----------------------------PTGEGAG-----PQTFSVLIGNREWMRRNGLTISSDISDAMTDHEMKGQTAILVAIDGVLCGMIAIADAVKPEAALAIYTLKSMGVDVALITGDNRKTARAIATQVGINKVFAEVLPSHKVAKVQELQNEGK--------KVAMVGDGVNDSPALAQADVGIAIGTGTDVAIEAADVVLIRNDLLDVVASIHLSKRTVRRIRVNLVLALIYNMVGIPIAAGVFMPIGIVLQPWMGSAAMAASSVSVVLSSLQLKCYRKPDLERY---EAQAHGRMKPLSASQVSVHIGMD 1404          

HSP 2 Score: 117.087 bits (292), Expect = 8.619e-25
Identity = 108/406 (26.60%), Postives = 172/406 (42.36%), Query Frame = 1
Query:  562 VIVRVNGMTCQSCVDNIESTVGKKQGIISIKVFLEKSEAHALVDASLAGP-DVEEMINDMGFNSEM---------------ILEIFN-DSCAGKPNNVSQKYEELKSNTIYPILSTTIVIKALKSIFCIFKIENHMRALPGVDKCSVNLIEEIGMIDYDSGKWNVQKIREEIESLG---YLTELPKQNWNSTRQSSAVSLNEESRS--KCYLRITGMTCSSCVNKVESHLLKVEGVKSVLVALLAMKCEIIYDSAYVMPFQLSNRVKELGFNAEV------------IENGN--------------------------EGIGIVN---------------VLIRGMTCSSCVNHIENHISKIKGIASINVSLSTSKGKVEYFISECGPRDVIDAINDMGFDASLCD 1554
            V +RV GMTCQSCV +IE  + K QG++ IKV L   EA       L  P D+ + I DMGF + +                LE  N       P  +S  +E L     Y + +  + I  +    C+  IE ++  LPGV    V+L  +   I YD        ++  IE+L    +   LP     +  QS +   ++E        L I+G+TC+S V  +E  L + +GV+   ++L      ++YD + V   +L   V+++GF   V             ++GN                          +G G  +               V I+GMTC+SCV++IE  + +  GI S+ V+L + K +V+Y         +   I D+GF+AS+ +
Sbjct:  155 VKLRVEGMTCQSCVSSIEGKIRKLQGVVRIKVSLSNQEAVITYQPYLIQPEDLRDHICDMGFEAAIKNRTAPLRLGPIDVNKLESTNLKKETVSPVQISNHFETLGHQGSY-LATLPLRIDGMHCKSCVLNIEGNIGQLPGVQNIHVSLENKTAQIQYDPSCVTPMFLQTAIEALPPGHFKVSLPDGVEENEPQSGSSQRHQEQGPGRTAVLTISGITCASSVQPIEDMLSQRKGVQQTSISLAEGTGAVLYDPSIVSLDELRTAVEDMGFEVSVNSETFTINPVRNFKSGNSVPQTMGDIAGSVQKMAPDTRGLPTHQGPGHSSETPSSPGATASQKCFVQIKGMTCASCVSNIERSLQRHAGILSVLVALMSGKAEVKYDPEIIQSPRIAQLIQDLGFEASVME 559          

HSP 3 Score: 103.219 bits (256), Expect = 1.491e-20
Identity = 98/379 (25.86%), Postives = 165/379 (43.54%), Query Frame = 1
Query:  550 PTIRVIVRVNGMTCQSCVDNIESTVGKKQGIISIKVFLEKSEAHA-LVDASLAGPDVEEMINDMGFNSEMILEIFNDSCAGKPNNVSQKYEELKSNTIYPILSTTIVIKALKSIFCIFKIENHMRALPGVDKCSVNLIEEIGMIDYDSGKWNVQKIREEIESLGYLTELPKQNWNSTRQSSAVSLN--------EESRSKCY-------------------LRITGMTCSSCVNKVESHLLKVEGVKSVLVALLAMKCEIIYDSAYVMPFQLSNRVKEL-----------GFNAEVIENGN------EGIGIVNVL-IRGMTCSSCVNHIENHISKIKGIASINVSLSTSKGKVEYFISECGPRDVIDAINDMGFDASL 1548
            P    +V + GMTC SCV +IE  +   +GI++IKV LE+  A    V + +    +   I DMGF +           A  P+  S   E +            + ++ +    C+  IE  +R L GV +  V+L  +  +I Y       + +R+ I  +G+  E   +N  +  +   + +N        +E+ S                      LRI GM C SCV  +E ++ ++ GV+++ V+L     +I YD + V P  L   ++ L           G      ++G+      +G G   VL I G+TC+S V  IE+ +S+ KG+   ++SL+   G V Y  S     ++  A+ DMGF+ S+
Sbjct:   66 PAATDVVNILGMTCHSCVKSIEDRISSLKGIVNIKVSLEQGSATVRYVPSVMNLQQICLQIEDMGFEASAA----EGKAASWPSRSSPAQEAV----------VKLRVEGMTCQSCVSSIEGKIRKLQGVVRIKVSLSNQEAVITYQPYLIQPEDLRDHICDMGF--EAAIKNRTAPLRLGPIDVNKLESTNLKKETVSPVQISNHFETLGHQGSYLATLPLRIDGMHCKSCVLNIEGNIGQLPGVQNIHVSLENKTAQIQYDPSCVTPMFLQTAIEALPPGHFKVSLPDGVEENEPQSGSSQRHQEQGPGRTAVLTISGITCASSVQPIEDMLSQRKGVQQTSISLAEGTGAVLYDPSIVSLDELRTAVEDMGFEVSV 428          

HSP 4 Score: 82.8037 bits (203), Expect = 2.311e-14
Identity = 56/186 (30.11%), Postives = 90/186 (48.39%), Query Frame = 1
Query: 1051 LPKQNW-NSTRQSSAV-------SLNEESRSKC---YLRITGMTCSSCVNKVESHLLKVEGVKSVLVALLAMKCEIIYDSAYVMPFQLSNRVKELGFNAEVIENGNEGI---------GIVNVLIRGMTCSSCVNHIENHISKIKGIASINVSLSTSKGKVEYFISECGPRDVIDAINDMGFDASL 1548
            LP + W  S +QS A         L+  S S      + I GMTC SCV  +E  +  ++G+ ++ V+L      + Y  + +   Q+  +++++GF A   E                +V + + GMTC SCV+ IE  I K++G+  I VSLS  +  + Y      P D+ D I DMGF+A++
Sbjct:   35 LPGRPWEQSMKQSFAFDNVGYEGGLDSTSSSPAATDVVNILGMTCHSCVKSIEDRISSLKGIVNIKVSLEQGSATVRYVPSVMNLQQICLQIEDMGFEASAAEGKAASWPSRSSPAQEAVVKLRVEGMTCQSCVSSIEGKIRKLQGVVRIKVSLSNQEAVITYQPYLIQPEDLRDHICDMGFEAAI 220          

HSP 5 Score: 56.9954 bits (136), Expect = 1.863e-6
Identity = 31/69 (44.93%), Postives = 40/69 (57.97%), Query Frame = 1
Query: 1348 IVNVLIRGMTCSSCVNHIENHISKIKGIASINVSLSTSKGKVEYFISECGPRDVIDAINDMGFDASLCD 1554
            +VN+L  GMTC SCV  IE+ IS +KGI +I VSL      V Y  S    + +   I DMGF+AS  +
Sbjct:   71 VVNIL--GMTCHSCVKSIEDRISSLKGIVNIKVSLEQGSATVRYVPSVMNLQQICLQIEDMGFEASAAE 137          
BLAST of Copper-transporting ATPase 1 vs. UniProt/SwissProt
Match: sp|P35670|ATP7B_HUMAN (Copper-transporting ATPase 2 OS=Homo sapiens OX=9606 GN=ATP7B PE=1 SV=4)

HSP 1 Score: 902.508 bits (2331), Expect = 0.000e+0
Identity = 583/1357 (42.96%), Postives = 805/1357 (59.32%), Query Frame = 1
Query:  109 RMKVDGMTCMSCVRNIEENLMKFTGVCGIMVSLLHAEATVIFDADIATVEDISNKIDEMGFDVTVKSSEVSNVKDKVVRSRIKFESDINKSVEKSIETSLSSKLLLVRFCQENNYADIWHYSSIRSTEILSVIQQSEIYGVLVLEQCPTIRVIVRVNGMTCQSCVDNIESTVGKKQGIISIKVFLEKSEAHALVDASLAGP-DVEEMINDMGFNSEMILEIFNDSCAGKPNN----VSQKYEELKSNTIYPILSTTIV-IKALKSIFCIFKIENHMRALPGVDKCSVNLIEEIGMIDYDSGKWNVQKIREEIESLGY----------------------------------------LTELPKQNWNSTRQSSAVSLNEESRSKCYLRITGMTCSSCVNKVESHLLKVEGVKSVLVALLAMKCEIIYDSAYVMPFQLSNRVKELGFNAEVIENGNEGIGIVNVLIRGMTCSSCVNHIENHISKIKGIASINVSLSTSKGKVEYFISECGPRDVIDAINDMGFDASLCDHLESNHAAADHINQMIKQWRSSFFFSLICGIPXXXXXXXXXXXXXXXXHTIIHENGSNRTIM--KSTVPMVCSGLSADNLILFVLATPVQFYGARYFYIQAYLSLKHKTTNMDVLVVMATXXXXXXXXXXXXXXMAFRRNTSPKTFFETSPMLIVFLSLGRWLEHIAKGKTSEALTKLMSLQAVEATLYT--PEN---KERKIPINLVQRNDLIKILPGEKIPVDGKVVTGTSTCDESLITGESMPIEKTHGSDVIGGSINKSGMLIVKATHVGSDSALAQIVKLVEEAQTSKAPIQQLADRIAGMFVPSVLICAIITLIIWVIVGFSKPEILPKYV----NELSVTEITWEHAFQLAITVLSIACPCSLGLXXXXXXXXXXXXXXXNGILIKGGEPLENIHKLNVIVFDKTGTITNGSPSVTRFLVLIGNGVREHIDKLLKILAAAESASEHPIGKAIITFSKARISNENLPEVLESSAVSGCGLGCKLNLDPKTEVTKFVKNLINIESPSEETNILGQXXXXXXXXXXXXTYKDVIFPVRQHMAWTSDLCQTVTVIIGNRNWMLRNGILVDDEVDELMSEDENLGRTVILMAIDNELIAMISVADQVKREAALAVYTLKKMNIEVYLMTGDNSKTATAIARQVGIHYVFAEVLPSHKVAKVQQLQNTNRSLTSKRKMKVAMVGDGINDSPALAQSDVGIAIGTGTDVAVEAADVVLIRNSLLDVIAAIQLSKATVKRIRQNFIAATLYNLLGIPIAAGVLMPIGIEMMPWMXXXXXXXXXXXXXXXXXXXXXWKKPSEEKLITPEYINFIQSSGLSESQIIVRRGID 4008
            +++V+GMTC SCV +IE  + K  GV  + VSL + EA + +   +   ED+ + +++MGF+  +KS        KV    +    DI +    + +  LSS          NN   + H  S                 V+ L+        +R++GM C+SCV NIE  +G+  G+ SI+V LE   A    D S   P  ++  I  +   +  +     D   G   +     S        N +    STT++ I  +    C+  IE  +  L GV + SV+L E    + Y+    + +++R  IE +G+                                           LP  +       S  S    +  KC+L+I GMTC+SCV+ +E +L K  GV SVLVAL+A K EI YD   + P +++  +++LGF A V+E+     G + + I GMTC+SCV++IE+ +++  GI   +V+L+TSK  V++     GPRD+I  I ++GF ASL     + H   DH    IKQW+ SF  SL+ GIP M +M+          + +I  N  +++++   + +P    GLS  NLI F+L T VQ  G  YFY+QAY SL+H++ NMDVL+V+ATSI+Y+YS++++V+++A +   SP TFF+T PML VF++LGRWLEH+AK KTSEAL KLMSLQA EAT+ T   +N   +E ++P+ LVQR D++K++PG K PVDGKV+ G +  DESLITGE+MP+ K  GS VI GSIN  G +++KATHVG+D+ LAQIVKLVEEAQ SKAPIQQLADR +G FVP ++I + +TL++W+++GF    ++ +Y       +S TE+    AFQ +ITVL IACPCSLGLATPTAVMVGTGV A NGILIKGG+PLE  HK+  ++FDKTGTIT+G P V R L L+G+     + K+L ++  AE++SEHP+G A+  + K  +  E L    +  AV GCG+GCK            V N+  I + SE    L    +           KD +              QT +V+IGNR W+ RNG+ +  +V + M++ E  G+T IL+AID  L  MI++AD VK+EAALAV+TL+ M ++V L+TGDN KTA AIA QVGI+ VFAEVLPSHKVAKVQ+LQN  +        KVAMVGDG+NDSPALAQ+D+G+AIGTGTDVA+EAADVVLIRN LLDV+A+I LSK TV+RIR N + A +YNL+GIPIAAGV MPIGI + PWM SAAMAASSVSVV  SL LK +KKP  E+    E         L+ SQ+ V  G+D
Sbjct:  146 KLRVEGMTCQSCVSSIEGKVRKLQGVVRVKVSLSNQEAVITYQPYLIQPEDLRDHVNDMGFEAAIKS--------KVAPLSLG-PIDIERLQSTNPKRPLSSA-----NQNFNNSETLGHQGS----------------HVVTLQ--------LRIDGMHCKSCVLNIEENIGQLLGVQSIQVSLENKTAQVKYDPSCTSPVALQRAIEALPPGNFKVS--LPDGAEGSGTDHRSSSSHSPGSPPRNQVQGTCSTTLIAIAGMTCASCVHSIEGMISQLEGVQQISVSLAEGTATVLYNPSVISPEELRAAIEDMGFEASVVSESCSTNPLGNHSAGNSMVQTTDGTPTSVQEVAPHTGRLPANHAPDILAKSPQSTRAVAPQKCFLQIKGMTCASCVSNIERNLQKEAGVLSVLVALMAGKAEIKYDPEVIQPLEIAQFIQDLGFEAAVMEDYAGSDGNIELTITGMTCASCVHNIESKLTRTNGITYASVALATSKALVKFDPEIIGPRDIIKIIEEIGFHASLAQRNPNAHHL-DH-KMEIKQWKKSFLCSLVFGIPVMALMI----------YMLIPSNEPHQSMVLDHNIIP----GLSILNLIFFILCTFVQLLGGWYFYVQAYKSLRHRSANMDVLIVLATSIAYVYSLVILVVAVAEKAERSPVTFFDTPPMLFVFIALGRWLEHLAKSKTSEALAKLMSLQATEATVVTLGEDNLIIREEQVPMELVQRGDIVKVVPGGKFPVDGKVLEGNTMADESLITGEAMPVTKKPGSTVIAGSINAHGSVLIKATHVGNDTTLAQIVKLVEEAQMSKAPIQQLADRFSGYFVPFIIIMSTLTLVVWIVIGFIDFGVVQRYFPNPNKHISQTEVIIRFAFQTSITVLCIACPCSLGLATPTAVMVGTGVAAQNGILIKGGKPLEMAHKIKTVMFDKTGTITHGVPRVMRVL-LLGDVATLPLRKVLAVVGTAEASSEHPLGVAVTKYCKEELGTETLGYCTDFQAVPGCGIGCK------------VSNVEGILAHSERP--LSAPASHLNEAGSLPAEKDAV-------------PQTFSVLIGNREWLRRNGLTISSDVSDAMTDHEMKGQTAILVAIDGVLCGMIAIADAVKQEAALAVHTLQSMGVDVVLITGDNRKTARAIATQVGINKVFAEVLPSHKVAKVQELQNKGK--------KVAMVGDGVNDSPALAQADMGVAIGTGTDVAIEAADVVLIRNDLLDVVASIHLSKRTVRRIRINLVLALIYNLVGIPIAAGVFMPIGIVLQPWMGSAAMAASSVSVVLSSLQLKCYKKPDLERY---EAQAHGHMKPLTASQVSVHIGMD 1407          

HSP 2 Score: 124.02 bits (310), Expect = 5.981e-27
Identity = 106/392 (27.04%), Postives = 172/392 (43.88%), Query Frame = 1
Query:  568 VRVNGMTCQSCVDNIESTVGKKQGIISIKVFLEKSEAHA-LVDASLAGPDVEEMINDMGFNSEMILEIFNDSCAGKPNNVSQKYEELKSNTIYPILSTTIVIKALKSIFCIFKIENHMRALPGVDKCSVNLIEEIGMIDYDSGKWNVQKIREEIESLGYLTEL---------------------PKQNWNSTRQS--SAVSLNEESRS--KCYLRITGMTCSSCVNKVESHLLKVEGVKSVLVALLAMKCEIIYDSAYVMPFQLSNRVKEL--GFNAEVIENGNEGIGIVN------------------------VLIRGMTCSSCVNHIENHISKIKGIASINVSLSTSKGKVEYFISECGPRDVIDAINDMGFDASLCDHLESNHAAADH 1587
            VR+ GMTCQSCV +IE  +   +GIIS+KV LE+  A    V + +    V   I DMGF +     I     A  P+      E +            + ++ +    C+  IE  +R L GV +  V+L  +  +I Y       + +R+ +  +G+   +                     PK+  +S  Q+  ++ +L  +        LRI GM C SCV  +E ++ ++ GV+S+ V+L     ++ YD +   P  L   ++ L  G     + +G EG G  +                        + I GMTC+SCV+ IE  IS+++G+  I+VSL+     V Y  S   P ++  AI DMGF+AS+     S +   +H
Sbjct:   62 VRILGMTCQSCVKSIEDRISNLKGIISMKVSLEQGSATVKYVPSVVCLQQVCHQIGDMGFEAS----IAEGKAASWPSRSLPAQEAV----------VKLRVEGMTCQSCVSSIEGKVRKLQGVVRVKVSLSNQEAVITYQPYLIQPEDLRDHVNDMGFEAAIKSKVAPLSLGPIDIERLQSTNPKRPLSSANQNFNNSETLGHQGSHVVTLQLRIDGMHCKSCVLNIEENIGQLLGVQSIQVSLENKTAQVKYDPSCTSPVALQRAIEALPPGNFKVSLPDGAEGSGTDHRSSSSHSPGSPPRNQVQGTCSTTLIAIAGMTCASCVHSIEGMISQLEGVQQISVSLAEGTATVLYNPSVISPEELRAAIEDMGFEASVVSESCSTNPLGNH 439          

HSP 3 Score: 120.939 bits (302), Expect = 5.645e-26
Identity = 102/431 (23.67%), Postives = 183/431 (42.46%), Query Frame = 1
Query:  562 VIVRVNGMTCQSCVDNIESTVGKKQGIISIKVFLEKSEAHALVDASLAGP-DVEEMINDMGFNSEMI------------LEIFNDSCAGKP-NNVSQKY--EELKSNTIYPILSTTIVIKALKSIFCIFKIENHMRALPGVDKCSVNLIEEIGMIDYDSGKWNVQKIREEIESLGYLTELPKQNWNSTRQSSAVSLNEESR-------------------SKCYLRITGMTCSSCVNKVESHLLKVEGVKSVLVALLAMKCEIIYDSAYVMPFQLSNRVKELGFNAEVIEN-------GNEGIGIVNVLIR------------------------------------------------GMTCSSCVNHIENHISKIKGIASINVSLSTSKGKVEYFISECGPRDVIDAINDMGFDASLCDHLESNHAAAD 1584
            V +RV GMTCQSCV +IE  V K QG++ +KV L   EA       L  P D+ + +NDMGF + +             +E    +   +P ++ +Q +   E   +    +++  + I  +    C+  IE ++  L GV    V+L  +   + YD    +   ++  IE+      LP  N+  +    A     + R                   S   + I GMTC+SCV+ +E  + ++EGV+ + V+L      ++Y+ + + P +L   ++++GF A V+         GN   G  N +++                                                GMTC+SCV++IE ++ K  G+ S+ V+L   K +++Y      P ++   I D+GF+A++ +    ++A +D
Sbjct:  145 VKLRVEGMTCQSCVSSIEGKVRKLQGVVRVKVSLSNQEAVITYQPYLIQPEDLRDHVNDMGFEAAIKSKVAPLSLGPIDIERLQSTNPKRPLSSANQNFNNSETLGHQGSHVVTLQLRIDGMHCKSCVLNIEENIGQLLGVQSIQVSLENKTAQVKYDPSCTSPVALQRAIEA------LPPGNFKVSLPDGAEGSGTDHRSSSSHSPGSPPRNQVQGTCSTTLIAIAGMTCASCVHSIEGMISQLEGVQQISVSLAEGTATVLYNPSVISPEELRAAIEDMGFEASVVSESCSTNPLGNHSAG--NSMVQTTDGTPTSVQEVAPHTGRLPANHAPDILAKSPQSTRAVAPQKCFLQIKGMTCASCVSNIERNLQKEAGVLSVLVALMAGKAEIKYDPEVIQPLEIAQFIQDLGFEAAVME----DYAGSD 563          
BLAST of Copper-transporting ATPase 1 vs. UniProt/SwissProt
Match: sp|Q04656|ATP7A_HUMAN (Copper-transporting ATPase 1 OS=Homo sapiens OX=9606 GN=ATP7A PE=1 SV=4)

HSP 1 Score: 898.656 bits (2321), Expect = 0.000e+0
Identity = 558/1185 (47.09%), Postives = 761/1185 (64.22%), Query Frame = 1
Query:  574 VNGMTCQSCVDNIESTVGKKQGIISIKVFLEKSEAHALVDASLAGPDVEEMINDMGFNSEMILEIFNDSCAGKPNNVSQKYEELKSNTI-YPILSTTIV-IKALKSIFCIFKIENHMRALPGVDKCSVNLIEEIGMIDYDSGKWNVQKIREEIESLGY-----------------LTELP---KQNWNSTRQSSAVSLNEESR--SKCYLRITGMTCSSCVNKVESHLLKVEGVKSVLVALLAMKCEIIYDSAYVMPFQLSNRVKELGFNAEVIENGNEGIGIVNVLIRGMTCSSCVNHIENHISKIKGIASINVSLSTSKGKVEYFISECGPRDVIDAINDMGFDASLCDHLESNHAAADHINQMIKQWRSSFFFSLICGIPXXXXXXXXXXXXXXXXHTIIHENGSNRTIMKSTVPM-----VCSGLSADNLILFVLATPVQFYGARYFYIQAYLSLKHKTTNMDVLVVMATXXXXXXXXXXXXXXMAFRRNTSPKTFFETSPMLIVFLSLGRWLEHIAKGKTSEALTKLMSLQAVEATLYTPEN-----KERKIPINLVQRNDLIKILPGEKIPVDGKVVTGTSTCDESLITGESMPIEKTHGSDVIGGSINKSGMLIVKATHVGSDSALAQIVKLVEEAQTSKAPIQQLADRIAGMFVPSVLICAIITLIIWVIVGFSKPEI----LPKYVNELSVTEITWEHAFQLAITVLSIACPCSLGLXXXXXXXXXXXXXXXNGILIKGGEPLENIHKLNVIVFDKTGTITNGSPSVTRFLVLI-GNGVREHIDKLLKILAAAESASEHPIGKAIITFSKARISNENLPEVLESSAVSGCGLGCKLNLDPKTEVTKFV-KNLINIESPSEETNILGQXXXXXXXXXXXXTYKDVIFPVRQHMAWTSDLCQTVTVIIGNRNWMLRNGILVDDEVDELMSEDENLGRTVILMAIDNELIAMISVADQVKREAALAVYTLKKMNIEVYLMTGDNSKTATAIARQVGIHYVFAEVLPSHKVAKVQQLQNTNRSLTSKRKMKVAMVGDGINDSPALAQSDVGIAIGTGTDVAVEAADVVLIRNSLLDVIAAIQLSKATVKRIRQNFIAATLYNLLGIPIAAGVLMPIGIEMMPWMXXXXXXXXXXXXXXXXXXXXXWKKPSEEKLITPEYINFIQSSGLSESQIIVRRGID 4008
            ++GM C+SCV NIEST+   Q + SI V LE   A    +AS   P+      +        + I ++  +   +  S   +++  N +  P+   T++ I  +    C+  IE  +   PGV    V+L    G ++YD    + + +R  IE +G+                  +E+P     N   T+  + V   EE +  SKCY+++TGMTC+SCV  +E +L + EG+ S+LVAL+A K E+ Y+ A + P  ++  ++ELGF A VIEN +EG G++ +++RGMTC+SCV+ IE+ ++K +GI   +V+L+T+K  ++Y     GPRD+I  I  +GF+ASL    + + +  DH  + I+QWR SF  SL   IP M +M++ M           ++N S   ++     M     +  GLS  NL+ F+L  PVQF+G  YFYIQAY +LKHKT NMDVL+V+AT+I++ YS+I+++++M  R   +P TFF+T PML VF++LGRWLEHIAKGKTSEAL KL+SLQA EAT+ T ++      E ++ + LVQR D+IK++PG K PVDG+V+ G S  DESLITGE+MP+ K  GS VI GSIN++G L++ ATHVG+D+ L+QIVKLVEEAQTSKAPIQQ AD+++G FVP ++  +I TL++W+++GF   EI     P Y   +S TE     AFQ +ITVL IACPCSLGLATPTAVMVGTGVGA NGILIKGGEPLE  HK+ V+VFDKTGTIT+G+P V +  VL   N +  H  K+L I+  AES SEHP+G AI  + K  +  E L   ++   V GCG+ CK+     T +   + KN  NIE  + +   L Q    N       +   +I   +   A  +   Q   V+IGNR WM+RNG++++++V++ M+E E  GRT +L+A+D+EL  +I++AD VK EA LA++ LK M +EV LMTGDNSKTA +IA QVGI  VFAEVLPSHKVAKV+QLQ   +        +VAMVGDGINDSPALA ++VGIAIGTGTDVA+EAADVVLIRN LLDV+A+I LS+ TVKRIR NF+ A +YNL+GIPIAAGV MPIG+ + PWM SAAMAASSVSVV  SL LKL++KP+ E    P      Q    S S+I V  GID
Sbjct:  283 IDGMHCKSCVSNIESTLSALQYVSSIVVSLENRSAIVKYNASSVTPESLRKAIEAVSPGLYRVSITSEVESTSNSPSSSSLQKIPLNVVSQPLTQETVINIDGMTCNSCVQSIEGVISKKPGVKSIRVSLANSNGTVEYDPLLTSPETLRGAIEDMGFDATLSDTNEPLVVIAQPSSEMPLLTSTNEFYTKGMTPVQDKEEGKNSSKCYIQVTGMTCASCVANIERNLRREEGIYSILVALMAGKAEVRYNPAVIQPPMIAEFIRELGFGATVIENADEGDGVLELVVRGMTCASCVHKIESSLTKHRGILYCSVALATNKAHIKYDPEIIGPRDIIHTIESLGFEASLVKK-DRSASHLDH-KREIRQWRRSFLVSLFFCIPVMGLMIYMMVMDHHFATLHHNQNMSKEEMINLHSSMFLERQILPGLSVMNLLSFLLCVPVQFFGGWYFYIQAYKALKHKTANMDVLIVLATTIAFAYSLIILLVAMYERAKVNPITFFDTPPMLFVFIALGRWLEHIAKGKTSEALAKLISLQATEATIVTLDSDNILLSEEQVDVELVQRGDIIKVVPGGKFPVDGRVIEGHSMVDESLITGEAMPVAKKPGSTVIAGSINQNGSLLICATHVGADTTLSQIVKLVEEAQTSKAPIQQFADKLSGYFVPFIVFVSIATLLVWIVIGFLNFEIVETYFPGYNRSISRTETIIRFAFQASITVLCIACPCSLGLATPTAVMVGTGVGAQNGILIKGGEPLEMAHKVKVVVFDKTGTITHGTPVVNQVKVLTESNRISHH--KILAIVGTAESNSEHPLGTAITKYCKQELDTETLGTCIDFQVVPGCGISCKV-----TNIEGLLHKNNWNIEDNNIKNASLVQIDASNEQSSTSSS---MIIDAQISNALNA---QQYKVLIGNREWMIRNGLVINNDVNDFMTEHERKGRTAVLVAVDDELCGLIAIADTVKPEAELAIHILKSMGLEVVLMTGDNSKTARSIASQVGITKVFAEVLPSHKVAKVKQLQEEGK--------RVAMVGDGINDSPALAMANVGIAIGTGTDVAIEAADVVLIRNDLLDVVASIDLSRKTVKRIRINFVFALIYNLVGIPIAAGVFMPIGLVLQPWMGSAAMAASSVSVVLSSLFLKLYRKPTYESYELPARSQIGQK---SPSEISVHVGID 1441          

HSP 2 Score: 139.043 bits (349), Expect = 1.728e-31
Identity = 146/576 (25.35%), Postives = 249/576 (43.23%), Query Frame = 1
Query:   91 MKLGSARMKVDGMTCMSCVRNIEENLMKFTGVCGIMVSLLHAEATVIFDADIATVEDISNKIDEMGFDVTVKSSE----VSNVKDKVVRSRIKFESDINKSVEKSIETSLSSKLLLVRFCQENNYADIWHYSSIRS---TEILSVIQQSEI----------YGVL----------VLEQCPTIRVIVRVNGMTCQSCVDNIESTVGKKQGIISIKVFLEKSEAHALVDASLAGPDVEEM---INDMGFNSEM--------ILEIFNDSCAGKPNNVSQKYEELKSNTIYPILSTTIVIKALKSIFCIFKIENHMRALPGVDKCSVNLIEEIGMIDYDSGKWNVQKIREEIESLG---YLTELPKQ-----NWNSTRQSSAVSLNEESR---SKCYLRITGMTCSSCVNKVESHLLKVEGVKSVLVALLAMKCEIIYDSAYVMPFQLSNRVKELGFNAEVIENGNEGIGIVN------------------------------------VLIRGMTCSSCVNHIENHISKIKGIASINVSLSTSKGKVEYFISECGPRDVIDAINDMGFDASLCDHLE 1563
            M + S  + V+GMTC SCV  IE+ + K  GV  I VSL    AT+I+D  + T + +   ID+MGFD  + + +    +++     V + +    D            + S LL     +     DI  Y   R+   T I S++  ++I           G L           + Q   + + ++V GMTC SC   IE  +GK QG+  IKV L+  EA  +    L    VEEM   I  MGF + +        +  I  +     P   S+  ++ +S +     + T +I  +    C+  IE+ + AL  V    V+L     ++ Y++     + +R+ IE++    Y   +  +     N  S+     + LN  S+    +  + I GMTC+SCV  +E  + K  GVKS+ V+L      + YD     P  L   ++++GF+A  + + NE + ++                                     + + GMTC+SCV +IE ++ + +GI SI V+L   K +V Y  +   P  + + I ++GF A++ ++ +
Sbjct:    5 MGVNSVTISVEGMTCNSCVWTIEQQIGKVNGVHHIKVSLEEKNATIIYDPKLQTPKTLQEAIDDMGFDAVIHNPDPLPVLTDTLFLTVTASLTLPWD-----------HIQSTLL-----KTKGVTDIKIYPQKRTVAVTIIPSIVNANQIKELVPELSLDTGTLEKKSGACEDHSMAQAGEVVLKMKVEGMTCHSCTSTIEGKIGKLQGVQRIKVSLDNQEATIVYQPHLI--SVEEMKKQIEAMGFPAFVKKQPKYLKLGAIDVERLKNTPVKSSEGSQQ-RSPSYTNDSTATFIIDGMHCKSCVSNIESTLSALQYVSSIVVSLENRSAIVKYNASSVTPESLRKAIEAVSPGLYRVSITSEVESTSNSPSSSSLQKIPLNVVSQPLTQETVINIDGMTCNSCVQSIEGVISKKPGVKSIRVSLANSNGTVEYDPLLTSPETLRGAIEDMGFDA-TLSDTNEPLVVIAQPSSEMPLLTSTNEFYTKGMTPVQDKEEGKNSSKCYIQVTGMTCASCVANIERNLRREEGIYSILVALMAGKAEVRYNPAVIQPPMIAEFIRELGFGATVIENAD 560          

HSP 3 Score: 127.487 bits (319), Expect = 4.900e-28
Identity = 126/478 (26.36%), Postives = 203/478 (42.47%), Query Frame = 1
Query:  109 RMKVDGMTCMSCVRNIEENLMKFTGVCGIMVSLLHAEATVIFDADIATVEDISNKIDEMGFDVTVKSS---------EVSNVKDKVVRS----RIKFESDINKSVE---------KSIETSLSSKLLLVRFCQ------ENNYADI-WHYSSIRSTEILSVIQ--QSEIYGVLV---------------LEQCP--------TIRVIVRVNGMTCQSCVDNIESTVGKKQGIISIKVFLEKSEAHALVDASLAGPD-VEEMINDMGFN-----------------SEMILEIFNDSCAGKPNNVSQKYEELKSNTIYPILSTTIVIKALKSIFCIFKIENHMRALPGVDKCSVNLIEEIGMIDYDSGKWNVQKIREEIESLGYLTELPKQNWNSTRQSSAVSLNEESRSKCYLRITGMTCSSCVNKVESHLLKVEGVKSVLVALLAMKCEIIYDSAYVMPFQLSNRVKELGFNAEVIE 1326
            +MKV+GMTC SC   IE  + K  GV  I VSL + EAT+++   + +VE++  +I+ MGF   VK           +V  +K+  V+S    + +  S  N S           KS  +++ S L  +++        EN  A + ++ SS+    +   I+     +Y V +               L++ P        T   ++ ++GMTC SCV +IE  + KK G+ SI+V L  S      D  L  P+ +   I DMGF+                 SEM L    +    K     Q  EE K+++        I +  +    C+  IE ++R   G+    V L+     + Y+        I E I  LG+              ++ +   +E      L + GMTC+SCV+K+ES L K  G+    VAL   K  I YD   + P  + + ++ LGF A +++
Sbjct:  174 KMKVEGMTCHSCTSTIEGKIGKLQGVQRIKVSLDNQEATIVYQPHLISVEEMKKQIEAMGFPAFVKKQPKYLKLGAIDVERLKNTPVKSSEGSQQRSPSYTNDSTATFIIDGMHCKSCVSNIESTLSALQYVSSIVVSLENRSAIVKYNASSVTPESLRKAIEAVSPGLYRVSITSEVESTSNSPSSSSLQKIPLNVVSQPLTQETVINIDGMTCNSCVQSIEGVISKKPGVKSIRVSLANSNGTVEYDPLLTSPETLRGAIEDMGFDATLSDTNEPLVVIAQPSSEMPLLTSTNEFYTKGMTPVQDKEEGKNSS-----KCYIQVTGMTCASCVANIERNLRREEGIYSILVALMAGKAEVRYNPAVIQPPMIAEFIRELGF-------------GATVIENADEGDGVLELVVRGMTCASCVHKIESSLTKHRGILYCSVALATNKAHIKYDPEIIGPRDIIHTIESLGFEASLVK 633          
BLAST of Copper-transporting ATPase 1 vs. UniProt/SwissProt
Match: sp|P49015|ATP7A_CRIGR (Copper-transporting ATPase 1 (Fragment) OS=Cricetulus griseus OX=10029 GN=ATP7A PE=2 SV=1)

HSP 1 Score: 896.73 bits (2316), Expect = 0.000e+0
Identity = 590/1343 (43.93%), Postives = 807/1343 (60.09%), Query Frame = 1
Query:  109 RMKVDGMTCMSCVRNIEENLMKFTGVCGIMVSLLHAEATVIFDADIATVEDISNKIDEMGFDVTVKSSEVSNVKDKVVR-SRIKFESDINKSVEKSIETSLSSKLLLVRFCQENNYADIWHYSSIRSTEILSVIQQSEIYGVLVLEQCPTIRVIVRVNGMTCQSCVDNIESTVGKKQGIISIKVFLEKSEAHALVDASLAGPDVEEMINDMGFNSEMILEIFNDSCAGKPNNVSQKYEELKSNTI-YPILSTTIV-IKALKSIFCIFKIENHMRALPGVDKCSVNLIEEIGMIDYDSGKWNVQKIREEIESLGYLTELPKQN-------WNSTRQSSAVSLNEES------RSKCYLRITGMTCSSCVNKVESHLLKVEGVKSVLVALLAMKCEIIYDSAYVMPFQLSNRVKELGFNAEVIENGNEGIGIVNVLIRGMTCSSCVNHIENHISKIKGIASINVSLSTSKGKVEYFISECGPRDVIDAINDMGFDASLCDHLESNHAAADHINQMIKQWRSSFFFSLICGIPXXXXXXXXXXXXXXXXHTIIHENGS--NRTIMKSTVPM-----VCSGLSADNLILFVLATPVQFYGARYFYIQAYLSLKHKTTNMDVLVVMATXXXXXXXXXXXXXXMAFRRNTSPKTFFETSPMLIVFLSLGRWLEHIAKGKTSEALTKLMSLQAVEATLYTPEN-----KERKIPINLVQRNDLIKILPGEKIPVDGKVVTGTSTCDESLITGESMPIEKTHGSDVIGGSINKSGMLIVKATHVGSDSALAQIVKLVEEAQTSKAPIQQLADRIAGMFVPSVLICAIITLIIWVIVGFSKPEI----LPKYVNELSVTEITWEHAFQLAITVLSIACPCSLGLXXXXXXXXXXXXXXXNGILIKGGEPLENIHKLNVIVFDKTGTITNGSPSVTRFLVLI-GNGVREHIDKLLKILAAAESASEHPIGKAIITFSKARISNENLPEVLESSAVSGCGLGCKL----------NLDPKTEVTKFVKNLINIESPSEETNILGQXXXXXXXXXXXXTYKDVIFPVRQHMAWTSDLCQTVTVIIGNRNWMLRNGILVDDEVDELMSEDENLGRTVILMAIDNELIAMISVADQVKREAALAVYTLKKMNIEVYLMTGDNSKTATAIARQVGIHYVFAEVLPSHKVAKVQQLQNTNRSLTSKRKMKVAMVGDGINDSPALAQSDVGIAIGTGTDVAVEAADVVLIRNSLLDVIAAIQLSKATVKRIRQNFIAATLYNLLGIPIAAGVLMPIGIEMMPWMXXXXXXXXXXXXXXXXXXXXXWKKPSEEKLITPEYINFIQSSGLSESQIIVRRGID 4008
            ++KV+GMTC SC    E  + K  GV  I VSL + EAT+++   + +VE+I  +I+ MGF   VK       + K ++   I  E   N  V KS+E S           Q  +Y                    S+     ++E            GM C+SCV NIES +   Q + SI V LE   A    +AS   P++     +     +  + I N+  +   +  S   +++  N +  P+   T++ I  +    C+  IE  +   PGV    V+L    G ++YD      + +RE I  +G+   LP  +         S       S N++        SKCY++++GMTC+SCV  +E +L + EG+ SVLVAL+A K E+ Y+ A + P  ++  ++ELGF A V+EN +EG GI+ +++RGMTC+SCV+ IE+ ++K KGI   +V+L+T+K  ++Y     GPRD+I  I  +GF+ASL    + + +  DH  + IKQWRSSF  SL    P M +MM+ M          IH N S  N  ++K+   M     +  GLS  NL+  +L  PVQF+G  YFYIQAY +LKHKT NMDVL+V+AT+I++ YS+I+++++M  R   +P T F+T PML VF++LGRWLEHIAKGKTSEAL KL+SLQA EAT+ T ++      E ++ + LVQR D+IK++PG K PVDG+V+ G S  DESLITGE+MP+ K  GS VI GSIN++G L++ ATHVG+D+ L+QIVKLVEEAQTSKAPIQQ AD++ G FVP +++ +I TL++W+I+GF    I     P Y   +S TE     AFQ +ITVL IACPCSLGLATPTAVMVGTGVGA NGILIKGGEPLE  HK+ V+VFDKTGTIT+G+P V +  VL+  N +     K+L I+  AES SEHP+G A+  + K  +  E L    +   V GCG+ CK+          NL  +   TK   +L+ I++ +E+++     +      +   T                   Q   V+IGNR WM+RNG+++ ++VD+ M +    GR  +L+ ID+EL  +I++AD VK EA LAV+ LK M +EV LMTGDNSKTA +IA QVGI  VFAEVLPSHKVAKV+QLQ   +        +VAMVGDGINDSPALA ++VGIAIGTGTDV +EAADVV IRN LLDV+A+I LS+ TVKRIR NF+   +YNL+GIPIAAGV +PIG+   PWM SAAMAASSVSVV  SL LKL++KP+ +     E      +   S S+I V  GID
Sbjct:  174 KIKVEGMTCHSCTSTTEGKIGKLQGVQRIKVSLDNQEATIVYQPHLISVEEIKKQIEAMGFPAFVKK------QPKYLKLGAIDVERLKNTPV-KSLEGSQ----------QRPSYP-------------------SDSTATFIIE------------GMHCKSCVSNIESALPTLQYVSSIAVSLENRSAIVKYNASSVTPEMLIKAIEAVSPGQYRVSIANEVESTSSSPSSSSLQKMPLNVVSQPLTQETVINISGMTCNSCVQSIEGVVSKKPGVKSIHVSLANSFGTVEYDPLLTAPETLREVIVDMGFDAVLPDMSEPLVVIAQPSLETPLLPSTNDQDNMMTAVHSKCYIQVSGMTCASCVANIERNLRREEGIYSVLVALMAGKAEVRYNPAVIQPPVIAEFIRELGFGATVMENADEGDGILKLVVRGMTCASCVHKIESTLTKHKGIFYCSVALATNKAHIKYDPEIIGPRDIIHTIGSLGFEASLVKK-DRSASHLDH-KREIKQWRSSFLVSLFFCTPVMGLMMYMMAMEHH--FATIHHNQSMSNEEMIKNHSSMFLERQILPGLSIMNLLSLLLCLPVQFFGGWYFYIQAYKALKHKTANMDVLIVLATTIAFAYSLIILLVAMYERAKVNPITSFDTPPMLFVFIALGRWLEHIAKGKTSEALAKLISLQATEATIVTLDSDNILLSEEQVDVELVQRGDIIKVVPGGKFPVDGRVIEGHSMVDESLITGEAMPVAKKPGSTVIAGSINQNGSLLICATHVGADTTLSQIVKLVEEAQTSKAPIQQFADKLGGYFVPFIVLVSIATLLVWIIIGFQNFTIVETYFPGYSRSISRTETIIRFAFQASITVLCIACPCSLGLATPTAVMVGTGVGAQNGILIKGGEPLEMAHKVKVVVFDKTGTITHGTPVVNQVKVLVESNKIPR--SKILAIVGTAESNSEHPLGAAVTKYCKQELDTETLGTCTDFQVVPGCGISCKVTNIEGLLHKSNLKIEENNTKNA-SLVQIDAINEQSSTSSSMIIDAPLSNAVDT-------------------QQYKVLIGNREWMIRNGLVISNDVDDSMIDHGRKGRPAVLVTIDDELCGLIAIADTVKPEAELAVHILKSMGLEVVLMTGDNSKTARSIASQVGITKVFAEVLPSHKVAKVKQLQEEGK--------RVAMVGDGINDSPALAMANVGIAIGTGTDVTIEAADVVFIRNDLLDVVASIDLSRKTVKRIRINFLFPLIYNLVGIPIAAGVFLPIGLVFQPWMGSAAMAASSVSVVLSSLFLKLYRKPTYDNY---ELRTRSHTGQRSPSEISVHVGID 1431          

HSP 2 Score: 141.739 bits (356), Expect = 2.534e-32
Identity = 135/551 (24.50%), Postives = 250/551 (45.37%), Query Frame = 1
Query:   91 MKLGSARMKVDGMTCMSCVRNIEENLMKFTGVCGIMVSLLHAEATVIFDADIATVEDISNKIDEMGFDVTVKSSE----VSNVKDKVVRSRIKFESDINKSVEKSIETSLSSKLLLVRFCQENNYADIWHYSSIRSTEILSVIQQSEI-YGVL----------VLEQCPTIRVIVRVNGMTCQSCVDNIESTVGKKQGIISIKVFLEKSEAHALVDASLAG-PDVEEMINDMGFNS-----EMILEIFNDSCAGKPNNVSQKYEELKSNTIYPILST-TIVIKALKSIFCIFKIENHMRALPGVDKCSVNLIEEIGMIDYDSGKWNVQKIREEIESLG---YLTELPKQNWNSTRQSSAVSL--------NEESRSKCYLRITGMTCSSCVNKVESHLLKVEGVKSVLVALLAMKCEIIYDSAYVMPFQLSNRVKELGFNAEVIENGNEGIGIVN---------------------------VLIRGMTCSSCVNHIENHISKIKGIASINVSLSTSKGKVEYFISECGPRDVIDAINDMGFDASLCDHLE 1563
            M + S  + V+GMTC+SCVR IE+ + K  G+  I VSL    AT+I+D  + T + +   ID+MGFD  + ++     +++     V + +    D  +S     +     K+    F Q+   A     S + + +I  ++ +  +  G L           + Q   + + ++V GMTC SC    E  +GK QG+  IKV L+  EA  +    L    ++++ I  MGF +        L++         N   +  E  +    YP  ST T +I+ +    C+  IE+ +  L  V   +V+L     ++ Y++     + + + IE++    Y   +  +  +++   S+ SL        ++    +  + I+GMTC+SCV  +E  + K  GVKS+ V+L      + YD     P  L   + ++GF+A V+ + +E + ++                            + + GMTC+SCV +IE ++ + +GI S+ V+L   K +V Y  +   P  + + I ++GF A++ ++ +
Sbjct:    5 MDVNSVTISVEGMTCISCVRTIEQKIGKENGIHHIKVSLEEKSATIIYDPKLQTPKTLQEAIDDMGFDALLHNANPLPVLTDTLFLTVTASLTLPWDHIQSTLLKTKGVTDIKI----FPQKRTLAVTIIPSIVNANQIKELVPELSLETGTLEKRSGACEDHSMAQAGEVVLKIKVEGMTCHSCTSTTEGKIGKLQGVQRIKVSLDNQEATIVYQPHLISVEEIKKQIEAMGFPAFVKKQPKYLKLGAIDVERLKNTPVKSLEGSQQRPSYPSDSTATFIIEGMHCKSCVSNIESALPTLQYVSSIAVSLENRSAIVKYNASSVTPEMLIKAIEAVSPGQYRVSIANEVESTSSSPSSSSLQKMPLNVVSQPLTQETVINISGMTCNSCVQSIEGVVSKKPGVKSIHVSLANSFGTVEYDPLLTAPETLREVIVDMGFDA-VLPDMSEPLVVIAQPSLETPLLPSTNDQDNMMTAVHSKCYIQVSGMTCASCVANIERNLRREEGIYSVLVALMAGKAEVRYNPAVIQPPVIAEFIRELGFGATVMENAD 550          
BLAST of Copper-transporting ATPase 1 vs. UniProt/SwissProt
Match: sp|P70705|ATP7A_RAT (Copper-transporting ATPase 1 OS=Rattus norvegicus OX=10116 GN=Atp7a PE=1 SV=1)

HSP 1 Score: 892.493 bits (2305), Expect = 0.000e+0
Identity = 557/1177 (47.32%), Postives = 758/1177 (64.40%), Query Frame = 1
Query:  574 VNGMTCQSCVDNIESTVGKKQGIISIKVFLEKSEAHALVDASLAGPDVEEMINDMGFNSEMILEIFNDSCAGKPNNVSQKYEELKSNTIYPILSTTIVIK--ALKSIFCIFKIENHMRALPGVDKCSVNLIEEIGMIDYDSGKWNVQKIREEIESLGYLTELP---KQNWNSTRQSSA-----VSLNEES------RSKCYLRITGMTCSSCVNKVESHLLKVEGVKSVLVALLAMKCEIIYDSAYVMPFQLSNRVKELGFNAEVIENGNEGIGIVNVLIRGMTCSSCVNHIENHISKIKGIASINVSLSTSKGKVEYFISECGPRDVIDAINDMGFDASLCDHLES-NHAAADHINQMIKQWRSSFFFSLICGIPXXXXXXXXXXXXXXXXHTIIHENGSNRTIMKSTVPM-----VCSGLSADNLILFVLATPVQFYGARYFYIQAYLSLKHKTTNMDVLVVMATXXXXXXXXXXXXXXMAFRRNTSPKTFFETSPMLIVFLSLGRWLEHIAKGKTSEALTKLMSLQAVEATLYT--PEN---KERKIPINLVQRNDLIKILPGEKIPVDGKVVTGTSTCDESLITGESMPIEKTHGSDVIGGSINKSGMLIVKATHVGSDSALAQIVKLVEEAQTSKAPIQQLADRIAGMFVPSVLICAIITLIIWVIVGFSKPEI----LPKYVNELSVTEITWEHAFQLAITVLSIACPCSLGLXXXXXXXXXXXXXXXNGILIKGGEPLENIHKLNVIVFDKTGTITNGSPSVTRFLVLI-GNGVREHIDKLLKILAAAESASEHPIGKAIITFSKARISNENLPEVLESSAVSGCGLGCKLNLDPKTEVTKFVKNLINIESPSEETNILGQXXXXXXXXXXXXTYKDVIFPVRQHMAWTSDLCQTVTVIIGNRNWMLRNGILVDDEVDELMSEDENLGRTVILMAIDNELIAMISVADQVKREAALAVYTLKKMNIEVYLMTGDNSKTATAIARQVGIHYVFAEVLPSHKVAKVQQLQNTNRSLTSKRKMKVAMVGDGINDSPALAQSDVGIAIGTGTDVAVEAADVVLIRNSLLDVIAAIQLSKATVKRIRQNFIAATLYNLLGIPIAAGVLMPIGIEMMPWMXXXXXXXXXXXXXXXXXXXXXWKKPSEEKLITPEYINFIQSSGLSESQIIVRRGID 4008
            ++GM C+SCV NIES +   Q + SI V LE   A    +ASL  P++     +     +  + I ++  +   +  S   +++  N +   L+  +VI    +    C+  IE  +   PGV    V+L    G I+YD    + + +RE IE +G+   LP   K+      Q S       S  E        ++KCY++++GMTC+SCV  +E +L + EG+ SVLVAL+A K E+ Y+ A + P  ++  ++ELGF A V+EN  EG GI+ +++RGMTC+SCV+ IE+ ++K KGI   +V+L+T+K  ++Y     GPRD+I  I ++GF+ASL     S NH   DH  + IKQWR SF  SL   IP M +M++ M     +     ++N SN  ++     M     +  GLS  NL+  +L  PVQF G  YFYIQAY +L+HKT NMDVL+V+AT+I++ YS+++++++M  R   +P TFF+T PML VF++LGRWLEHIAKGKTSEAL KL+SLQA EAT+ T   EN    E ++ + LVQR D+IK++PG K PVDG+V+ G S  DESLITGE+MP+ K  GS VI GSIN++G L+++ATHVG+D+ L+QIVKLVEEAQTSKAPIQQ AD+++G FVP +++ +I+TL++W+I+GF   EI     P Y   +S TE     AFQ +ITVL IACPCSLGLATPTAVMVGTGVGA NGILIKGGEPLE  HK+ V+VFDKTGTIT+G+P V +  VL+  N +    +K+L I+  AES SEHP+G A+  + K  +  E L    +   V GCG+ CK+           ++ L++  +   E N +     + I+     +       +  H++   +  Q   V+IGNR WM+RNG+++ ++VDE M E E  GRT +L+ ID+EL  +I++AD VK EA LAV+ LK M +EV LMTGDNSKTA +IA QVGI  VFAEVLPSHKVAKV+QLQ   +        +VAMVGDGINDSPALA + VGIAIGTGTDVA+EAADVVLIRN LLDV+A+I LS+ TVKRIR NF+ A +YNL+GIPIAAGV +PIG+ + PWM SAAMAASSVSVV  SL LKL++KP+ +     E      +   S S+I V  GID
Sbjct:  283 IDGMHCKSCVSNIESALSTLQYVSSIVVSLENRSAIVKYNASLVTPEILRKAIEAVSPGQYRVSISSEVESPTSSPSSSSLQKMPLNLVSQPLTQEVVININGMTCNSCVQSIEGVISKKPGVKSIHVSLTNSTGTIEYDPLLTSPEPLREAIEDMGFDAVLPADMKEPLVVIAQPSLETPLLPSTTEPENVMTPVQNKCYIQVSGMTCASCVANIERNLRREEGIYSVLVALMAGKAEVRYNPAVIQPRVIAELIRELGFGAVVMENAGEGNGILELVVRGMTCASCVHKIESTLTKHKGIFYCSVALATNKAHIKYDPEIIGPRDIIHTIGNLGFEASLVKKDRSANHL--DH-KREIKQWRGSFLVSLFFCIPVMGLMIYMMVMDHHLATLNHNQNMSNEEMINMHSSMFLERQILPGLSIMNLLSLLLCLPVQFCGGWYFYIQAYKALRHKTANMDVLIVLATTIAFAYSLVILLVAMYERAKVNPITFFDTPPMLFVFIALGRWLEHIAKGKTSEALAKLISLQATEATIVTLNSENLLLSEEQVDVELVQRGDIIKVVPGGKFPVDGRVIEGHSMVDESLITGEAMPVAKKPGSTVIAGSINQNGSLLIRATHVGADTTLSQIVKLVEEAQTSKAPIQQFADKLSGYFVPFIVLVSIVTLLVWIIIGFQNFEIVEAYFPGYNRSISRTETIIRFAFQASITVLCIACPCSLGLATPTAVMVGTGVGAQNGILIKGGEPLEMAHKVKVVVFDKTGTITHGTPVVNQVKVLVESNKISR--NKILAIVGTAESNSEHPLGAAVTKYCKQELDTETLGTCTDFQVVPGCGISCKVT---------NIEGLLHKSNLKIEENNIKNASLVQIDAINEQSSPSSSMIIDAHLSNAVN-TQQYKVLIGNREWMIRNGLVISNDVDESMIEHERRGRTAVLVTIDDELCGLIAIADTVKPEAELAVHILKSMGLEVVLMTGDNSKTARSIASQVGITKVFAEVLPSHKVAKVKQLQEEGK--------RVAMVGDGINDSPALAMASVGIAIGTGTDVAIEAADVVLIRNDLLDVVASIDLSRKTVKRIRINFVFALIYNLIGIPIAAGVFLPIGLVLQPWMGSAAMAASSVSVVLSSLFLKLYRKPTYDNY---ELRPRSHTGQRSPSEISVHVGID 1433          

HSP 2 Score: 142.51 bits (358), Expect = 1.190e-32
Identity = 145/549 (26.41%), Postives = 247/549 (44.99%), Query Frame = 1
Query:   91 MKLGSARMKVDGMTCMSCVRNIEENLMKFTGVCGIMVSLLHAEATVIFDADIATVEDISNKIDEMGFDVTVKSSE----VSNVKDKVVRSRIKFESDINKSVEKSIETSLSSKLLL-VRFCQENNYADIWHYSSIRST-EILSVIQ--------QSEIYGVLVLEQCPT---IRVIVRVNGMTCQSCVDNIESTVGKKQGIISIKVFLEKSEAHALVDASL-AGPDVEEMINDMGFNSEM--------ILEIFNDSCAGKPNNVSQKYEELKSNTIYPILST-TIVIKALKSIFCIFKIENHMRALPGVDKCSVNLIEEIGMIDYDSGKWNVQKIREEIESLG---YLTELPKQNWNSTRQSSAVSL--------NEESRSKCYLRITGMTCSSCVNKVESHLLKVEGVKSVLVALLAMKCEIIYDSAYVMPFQLSNRVKELGFNAEVIENGNEGIGIV-----------------NVL----------IRGMTCSSCVNHIENHISKIKGIASINVSLSTSKGKVEYFISECGPRDVIDAINDMGFDA 1542
            M   S  + V+GMTC+SCVR IE+ + K  GV  I VSL    ATVI++  + T + +   ID+MGFD  + ++     ++N     V + +    D  +S      T L +K +  V+   +   A +    S+ S  +I+ ++         Q +  G       P    + + +RV GMTC SC   IE  VGK QG+  IKV L+  EA  +    L    ++++ I  +GF + +        +  I  +     P   S+  ++   +  YP  S  T  I  +    C+  IE+ +  L  V    V+L     ++ Y++     + +R+ IE++    Y   +  +  + T   S+ SL        ++    +  + I GMTC+SCV  +E  + K  GVKS+ V+L      I YD     P  L   ++++GF+A +  +  E + ++                 NV+          + GMTC+SCV +IE ++ + +GI S+ V+L   K +V Y  +   PR + + I ++GF A
Sbjct:    5 MDANSITITVEGMTCISCVRTIEQQIGKVNGVHHIKVSLEEKSATVIYNPKLQTPKTLQEAIDDMGFDALLHNANPLPVLTNTVFLTVTAPLALPWDHIQS------TLLKTKGVTGVKISPQQRSAVVTIIPSVVSANQIVELVPDLSLDMGTQEKKSGTSEEHSTPQAGEVLLKMRVEGMTCHSCTSTIEGKVGKLQGVQRIKVSLDNQEATIVYQPHLITAEEIKKQIEAVGFPAFIKKQPKYLKLGAIDVERLKSTPVKSSEGSQQ--KSPAYPSDSAITFTIDGMHCKSCVSNIESALSTLQYVSSIVVSLENRSAIVKYNASLVTPEILRKAIEAVSPGQYRVSISSEVESPTSSPSSSSLQKMPLNLVSQPLTQEVVININGMTCNSCVQSIEGVISKKPGVKSIHVSLTNSTGTIEYDPLLTSPEPLREAIEDMGFDAVLPADMKEPLVVIAQPSLETPLLPSTTEPENVMTPVQNKCYIQVSGMTCASCVANIERNLRREEGIYSVLVALMAGKAEVRYNPAVIQPRVIAELIRELGFGA 545          

HSP 3 Score: 129.798 bits (325), Expect = 9.932e-29
Identity = 135/477 (28.30%), Postives = 202/477 (42.35%), Query Frame = 1
Query:  109 RMKVDGMTCMSCVRNIEENLMKFTGVCGIMVSLLHAEATVIFDADIATVEDISNKIDEMGF----------------DV------TVKSSEVSNVKDKVVRSRIKFESDIN----KSVEKSIETSLSSKLLL--VRFCQENNYADIWHYSSIRSTEILS------------VIQQSEI------YGVLVLEQCP--------TIRVIVRVNGMTCQSCVDNIESTVGKKQGIISIKVFLEKSEAHALVDASLAGPD-VEEMINDMGFNS-------EMILEIFNDS-------CAGKPNNVSQKYEELKSNTIYPILSTTIVIKALKSIFCIFKIENHMRALPGVDKCSVNLIEEIGMIDYDSGKWNVQKIREEIESLGYLTELPKQNWNSTRQSSAVSLNE--ESRSKCYLRITGMTCSSCVNKVESHLLKVEGVKSVLVALLAMKCEIIYDSAYVMPFQLSNRVKELGFNAEVIE 1326
            +M+V+GMTC SC   IE  + K  GV  I VSL + EAT+++   + T E+I  +I+ +GF                DV       VKSSE S  K     S       I+    KS   +IE++LS+   +  +    EN  A + + +S+ + EIL             V   SE+           L++ P        T  V++ +NGMTC SCV +IE  + KK G+ SI V L  S      D  L  P+ + E I DMGF++       E ++ I   S          +P NV    +    N  Y      I +  +    C+  IE ++R   G+    V L+     + Y+      + I E I  LG+                AV +    E      L + GMTC+SCV+K+ES L K +G+    VAL   K  I YD   + P  + + +  LGF A +++
Sbjct:  174 KMRVEGMTCHSCTSTIEGKVGKLQGVQRIKVSLDNQEATIVYQPHLITAEEIKKQIEAVGFPAFIKKQPKYLKLGAIDVERLKSTPVKSSEGSQQKSPAYPSDSAITFTIDGMHCKSCVSNIESALSTLQYVSSIVVSLENRSAIVKYNASLVTPEILRKAIEAVSPGQYRVSISSEVESPTSSPSSSSLQKMPLNLVSQPLTQEVVININGMTCNSCVQSIEGVISKKPGVKSIHVSLTNSTGTIEYDPLLTSPEPLREAIEDMGFDAVLPADMKEPLVVIAQPSLETPLLPSTTEPENVMTPVQ----NKCY------IQVSGMTCASCVANIERNLRREEGIYSVLVALMAGKAEVRYNPAVIQPRVIAELIRELGF---------------GAVVMENAGEGNGILELVVRGMTCASCVHKIESTLTKHKGIFYCSVALATNKAHIKYDPEIIGPRDIIHTIGNLGFEASLVK 625          

HSP 4 Score: 56.225 bits (134), Expect = 2.492e-6
Identity = 28/66 (42.42%), Postives = 37/66 (56.06%), Query Frame = 1
Query: 1351 VNVLIRGMTCSSCVNHIENHISKIKGIASINVSLSTSKGKVEYFISECGPRDVIDAINDMGFDASL 1548
            + + + GMTC SCV  IE  I K+ G+  I VSL      V Y      P+ + +AI+DMGFDA L
Sbjct:   10 ITITVEGMTCISCVRTIEQQIGKVNGVHHIKVSLEEKSATVIYNPKLQTPKTLQEAIDDMGFDALL 75          
BLAST of Copper-transporting ATPase 1 vs. TrEMBL
Match: A0A1S3JU27 (copper-transporting ATPase 1-like isoform X4 OS=Lingula unguis OX=7574 GN=LOC106175926 PE=3 SV=1)

HSP 1 Score: 1082.01 bits (2797), Expect = 0.000e+0
Identity = 677/1415 (47.84%), Postives = 903/1415 (63.82%), Query Frame = 1
Query:  109 RMKVDGMTCMSCVRNIEENLMKFTGVCGIMVSLLHAEATVIFDADIATVEDISNKIDEMGFDVTVKSSEVSNVKDKV-----VRS-------RIKFESDINKSVEKSIETSLSS--KLLLVRFCQENNYADIWHYSSIRSTEILS-----------VIQQSEIYGVLVLEQCPT--------IRVIVRVNGMTCQSCVDNIESTVGKKQGIISIKVFLEKSEAHALVDASLAGP-DVEEMINDMGFNSEMILEIFNDSCAGK-PNNVSQKYEELKSNTIYPILSTTIVIKALKSIFCIFKIENHMRALPGVDKCSVNLIEEIGMIDYDSGKWNVQKIREEIESLGY---LTE---------------------------LPKQNWNSTRQSSAVSLNEESRSKCYLRITGMTCSSCVNKVESHLLKVEGVKSVLVALLAMKCEIIYDSAYVMPFQLSNRVKELGFNAEVIENGNEGIGIVNVLIRGMTCSSCVNHIENHISKIKGIASINVSLSTSKGKVEYFISECGPRDVIDAINDMGFDASLCDHLESNHAAADHINQMIKQWRSSFFFSLICGIPXXXXXXXXXXXXXXXXHTIIHENGSNRTIMKST-VPMVCSGLSADNLILFVLATPVQFYGARYFYIQAYLSLKHKTTNMDVLVVMATXXXXXXXXXXXXXXMAFRRNTSPKTFFETSPMLIVFLSLGRWLEHIAKGKTSEALTKLMSLQAVEATLYTPEN-----KERKIPINLVQRNDLIKILPGEKIPVDGKVVTGTSTCDESLITGESMPIEKTHGSDVIGGSINKSGMLIVKATHVGSDSALAQIVKLVEEAQTSKAPIQQLADRIAGMFVPSVLICAIITLIIWVIVGFS---KPEILPKYVNELSVTEITWEHAFQLAITVLSIACPCSLGLXXXXXXXXXXXXXXXNGILIKGGEPLENIHKLNVIVFDKTGTITNGSPSVTRFLVLIGNGVREHIDKLLKILAAAESASEHPIGKAIITFSKARISNENLPEVLESSAVSGCGLGCKLNLDPKTEVTKFVKNLINIESPSEETNILGQXXXXXXXXXXXXTYKDVIFPVRQHMAWTSDLCQTVTVIIGNRNWMLRNGILVDDEVDELMSEDENLGRTVILMAIDNELIAMISVADQVKREAALAVYTLKKMNIEVYLMTGDNSKTATAIARQVGIHYVFAEVLPSHKVAKVQQLQNTNRSLTSKRKMKVAMVGDGINDSPALAQSDVGIAIGTGTDVAVEAADVVLIRNSLLDVIAAIQLSKATVKRIRQNFIAATLYNLLGIPIAAGVLMPIGIEMMPWMXXXXXXXXXXXXXXXXXXXXXWKKPSEEKLITPEYINFIQSSG---LSESQIIVRRGIDL-MTPQIETTSSLKGSVKSVLGKLNFSNKSK-HKSDKL 4116
            ++ V+GMTC SCV+NIE N+    GV  I VSL   EA + +D  + T + + ++I++MGF+ T+ S+  S   D+       RS       R+  E    +S  K+IE  +     +  ++   E   AD+   SSI + + ++           V  Q + +  +     PT         + +V + GMTC SCV NIE T+  ++GI  + V LE+       D +L  P  V E I+DMG++S     + + +   K P+ +S               +T I IK +    C+  I+  +   PGV    V+L EE G+I YD    + Q++R+ I+ +G+   +T+                           LPK N     Q    ++ E+   KC+L ++GMTC+SCV  +E +LLKV G+ SVLVAL+A K E+ YD AY+MP Q++  V ELG+ A +IEN   G G + + I GMTCSSCV+ IE+H+ K  GI S  VSL+T++G+ E+     GPRD+++ I DMG++ASL      N AA +H  +  +QWR+SF FSLI G+P M VMM+ MF +  +    +   GSN T   S  VPMV +GLS +NLILF+LATPVQF G RYFYIQAY +LKH++TNMDVL+VMAT+ISY+YSVIV+ ++M  + +TSP+TFFET+PML+VF+SLGRWLEHIAKGKTSEALTKLMSLQA EA L   +      KE++I ++LV R D++K+LPGEKIPVDGKV  G S CDESLITGESMP+EK  GS VIGGSIN++G L+V+ATHVG+DSALAQIV+LVEEAQTSKAP+Q +AD IAG FVP V   +++T ++WVIVG++   + +I  K  + +   EI ++HAF+ AITVL+IACPC+LGLATPTAVMVGTGVGA NGILIKGGEPLE  HK+  IVFDKTGTIT G   +TR L L   G+ +H+  ++ +   AE++SEHP+  AI+ ++K  +  E L +VL+  AV GCGL C++     T V   V ++   +   E TNI    +    +      Y+                     V+IGNR WM RN + V + +D+ MS  EN G T +L AI+ E++AM++VAD VK EA LAVYTLKKM + V+L+TGDN KTA AIA+QVGI  VFAEVLPSHKVAK++QLQ        K   +VAMVGDG+NDSPALAQ+D+GIAIGTGTDVAVEAA VVLIRN LLDV+AA++LSK TV+RIR NF+AAT+YN++GIP+AAG L PIGIE+MPWMASAAMAASSVSVV  SLLLKL+KKP+ E L+T EY     SSG     E  I V  G+D    P I   +SLKGS+KS++ KLN +N+ K H+ + L
Sbjct:   92 KIGVEGMTCQSCVKNIEGNMSSKPGVRHIQVSLERKEANITYDPSVVTAQMLRDQINDMGFEATLPSNGSSTSFDEFHELAKTRSHADFGKCRLHIEGMTCQSCIKNIEGVIGEFPGVKTIKVTLETKSADVTFDSSIVTAQAVADRISDMGFDCNVADQQDEFDEIASRSAPTKSPPDGTLAKCMVDIEGMTCMSCVKNIEGTLSDEKGIAQVSVSLEEKRGTVQYDPALWSPTTVAERISDMGYDS-----VVHAAAIPKVPSTIS---------------TTVISIKGMTCNSCVKTIQEVISEKPGVRSIKVSLQEEQGVIQYDPDVTSPQQLRDAIDDMGFDACITDETKFPPETTVIMNGSAGPVKSTPSRGHLPKTNHGMVLQRKVDTVEEDDLEKCHLHVSGMTCASCVANIERNLLKVPGISSVLVALMAQKAEVKYDPAYMMPSQIATLVTELGYPAMLIENEGTGDGHLEIQIGGMTCSSCVHRIESHMVKQPGIKSAIVSLATNRGRFEFDPENTGPRDIMNEIRDMGYEASLVTDNSKNSAAHEH-RKTTRQWRNSFLFSLILGVPCMVVMMYFMFAYMHMPGHQMAAGGSNDTADSSPGVPMVTAGLSVENLILFLLATPVQFIGGRYFYIQAYKALKHRSTNMDVLIVMATTISYVYSVIVVAVAMVMQESTSPRTFFETTPMLMVFISLGRWLEHIAKGKTSEALTKLMSLQASEALLLECDKNGQVIKEQRISVDLVHRGDILKVLPGEKIPVDGKVTEGHSMCDESLITGESMPVEKKKGSSVIGGSINQNGTLLVEATHVGADSALAQIVRLVEEAQTSKAPLQAVADTIAGYFVPGVCTISLLTAVVWVIVGYATYNQLDIHWKSESGMGKNEIIFQHAFKFAITVLAIACPCALGLATPTAVMVGTGVGATNGILIKGGEPLEIAHKVQSIVFDKTGTITRGIAELTR-LTLFNTGLSKHL--VIAVTGTAETSSEHPVAAAIVKYAKQALGAETLGKVLDFQAVPGCGLKCRV-----TNVDHLVSSMETKDILKEHTNIDRDEIQDLQDAPSSSGYE---------------------VLIGNREWMSRNMLTVTEAMDQEMSYHENKGETAVLCAINGEIVAMLAVADTVKEEAHLAVYTLKKMGLNVFLLTGDNLKTAKAIAKQVGISKVFAEVLPSHKVAKIKQLQ--------KDGHRVAMVGDGVNDSPALAQADLGIAIGTGTDVAVEAAGVVLIRNDLLDVVAAMRLSKKTVRRIRFNFLAATIYNIVGIPVAAGALFPIGIELMPWMASAAMAASSVSVVCSSLLLKLFKKPNREDLLTQEYFQKF-SSGRDEYGEDDISVHCGMDADFDPDIYGKTSLKGSIKSIVSKLNIANRPKGHEYNSL 1447          

HSP 2 Score: 164.081 bits (414), Expect = 1.017e-36
Identity = 130/443 (29.35%), Postives = 204/443 (46.05%), Query Frame = 1
Query:  283 MGFDVTVKSSEVSN------VKDKVVRSRIK-FESDIN-KSVEKSIETSLSSKLLLVRF--CQENNYADIWHYSSIRSTEILSVIQQSEIYGVLVLEQCPTIRVIVRVNGMTCQSCVDNIESTVGKKQGIISIKVFLEKSEAHALVDASLAGPD-VEEMINDMGFNSEMILEIFNDSCAGKPNNVSQKYEELKSNTIYPILSTTIVIKALKSIFCIFKIENHMRALPGVDKCSVNLIEEIGMIDYDSGKWNVQKIREEIESLGYLTELPKQNWN----STRQSSAVSLNEESRSKCYLRITGMTCSSCVNKVESHLLKVEGVKSVLVALLAMKCEIIYDSAYVMPFQLSNRVKELGFN----AEVIENGNEGIGIVNVLIRGMTCSSCVNHIENHISKIKGIASINVSLSTSKGKVEYFISECGPRDVIDAINDMGFDASLCD 1554
            MGF+  VKS   S       ++    +S +K  E  I+ +S  K I+ SLS K   +R+   Q N      H   +     L   +Q             T+ V + V GMTCQSCV NIE  +  K G+  I+V LE+ EA+   D S+     + + INDMGF + +          G   +  + +E  K+ +        + I+ +    CI  IE  +   PGV    V L  +   + +DS     Q + + I  +G+   +  Q       ++R +   S  + + +KC + I GMTC SCV  +E  L   +G+  V V+L   +  + YD A   P  ++ R+ ++G++    A  I      I    + I+GMTC+SCV  I+  IS+  G+ SI VSL   +G ++Y      P+ + DAI+DMGFDA + D
Sbjct:    1 MGFEAKVKSPGSSPQEVTIYIEGMTCQSCVKNIEGAISMRSGVKQIKVSLSQKQASIRYDPSQTNPRTLREHIDDMGFEAFLEKPKQ-------------TVNVKIGVEGMTCQSCVKNIEGNMSSKPGVRHIQVSLERKEANITYDPSVVTAQMLRDQINDMGFEATL-------PSNGSSTSFDEFHELAKTRSHADFGKCRLHIEGMTCQSCIKNIEGVIGEFPGVKTIKVTLETKSADVTFDSSIVTAQAVADRISDMGFDCNVADQQDEFDEIASRSAPTKSPPDGTLAKCMVDIEGMTCMSCVKNIEGTLSDEKGIAQVSVSLEEKRGTVQYDPALWSPTTVAERISDMGYDSVVHAAAIPKVPSTISTTVISIKGMTCNSCVKTIQEVISEKPGVRSIKVSLQEEQGVIQYDPDVTSPQQLRDAIDDMGFDACITD 423          

HSP 3 Score: 144.436 bits (363), Expect = 1.023e-30
Identity = 112/458 (24.45%), Postives = 208/458 (45.41%), Query Frame = 1
Query:   97 LGSARMKVDGMTCMSCVRNIEENLMKFTGVCGIMVSLLHAEATVIFDADIATVEDISNKIDEMGFDVTV------------KSSEVSNVKD-KVVRSRIKFESDINKSVEKSIETSLSSK--LLLVRFCQENNYADIWH----YSSIRSTEILSVIQQSEIYGVLVLEQCPTI--RVIVRVNGMTCQSCVDNIESTVGKKQGIISIKVFLEKSEAHALVDASLAGP-DVEEMINDMGFNSEMILE---------IFNDSCAGKPNNVSQKY---------EELKSNTIYP--ILSTTIVIKALKSIFCIFKIENHMRALPGVDKCSVNLIEEIGMIDYDSGKWNVQKIREEIESLGYLTELPKQNWNSTRQSSAVSLNEESRSKCYL--RITGMTCSSCVNKVESHLLKVEGVKSVLVALLAMKCEIIYDSAYVMPFQLSNRVKELGFNAEVIENGNE 1338
             G  R+ ++GMTC SC++NIE  + +F GV  I V+L    A V FD+ I T + ++++I +MGFD  V            +S+   +  D  + +  +  E     S  K+IE +LS +  +  V    E     + +    +S     E +S +    +     + + P+     ++ + GMTC SCV  I+  + +K G+ SIKV L++ +     D  +  P  + + I+DMGF++ +  E         I N S     +  S+ +          + K +T+    +    + +  +    C+  IE ++  +PG+    V L+ +   + YD       +I   +  LGY                A+ +  E     +L  +I GMTCSSCV+++ESH++K  G+KS +V+L   +    +D     P  + N ++++G+ A ++ + ++
Sbjct:  180 FGKCRLHIEGMTCQSCIKNIEGVIGEFPGVKTIKVTLETKSADVTFDSSIVTAQAVADRISDMGFDCNVADQQDEFDEIASRSAPTKSPPDGTLAKCMVDIEGMTCMSCVKNIEGTLSDEKGIAQVSVSLEEKRGTVQYDPALWSPTTVAERISDMGYDSVVHAAAIPKVPSTISTTVISIKGMTCNSCVKTIQEVISEKPGVRSIKVSLQEEQGVIQYDPDVTSPQQLRDAIDDMGFDACITDETKFPPETTVIMNGSAGPVKSTPSRGHLPKTNHGMVLQRKVDTVEEDDLEKCHLHVSGMTCASCVANIERNLLKVPGISSVLVALMAQKAEVKYDPAYMMPSQIATLVTELGY---------------PAMLIENEGTGDGHLEIQIGGMTCSSCVHRIESHMVKQPGIKSAIVSLATNRGRFEFDPENTGPRDIMNEIRDMGYEASLVTDNSK 622          
BLAST of Copper-transporting ATPase 1 vs. TrEMBL
Match: A0A1S3JU05 (copper-transporting ATPase 1-like isoform X2 OS=Lingula unguis OX=7574 GN=LOC106175926 PE=3 SV=1)

HSP 1 Score: 1081.63 bits (2796), Expect = 0.000e+0
Identity = 677/1415 (47.84%), Postives = 903/1415 (63.82%), Query Frame = 1
Query:  109 RMKVDGMTCMSCVRNIEENLMKFTGVCGIMVSLLHAEATVIFDADIATVEDISNKIDEMGFDVTVKSSEVSNVKDKV-----VRS-------RIKFESDINKSVEKSIETSLSS--KLLLVRFCQENNYADIWHYSSIRSTEILS-----------VIQQSEIYGVLVLEQCPT--------IRVIVRVNGMTCQSCVDNIESTVGKKQGIISIKVFLEKSEAHALVDASLAGPD-VEEMINDMGFNSEMILEIFNDSCAGK-PNNVSQKYEELKSNTIYPILSTTIVIKALKSIFCIFKIENHMRALPGVDKCSVNLIEEIGMIDYDSGKWNVQKIREEIESLGY---LTE---------------------------LPKQNWNSTRQSSAVSLNEESRSKCYLRITGMTCSSCVNKVESHLLKVEGVKSVLVALLAMKCEIIYDSAYVMPFQLSNRVKELGFNAEVIENGNEGIGIVNVLIRGMTCSSCVNHIENHISKIKGIASINVSLSTSKGKVEYFISECGPRDVIDAINDMGFDASLCDHLESNHAAADHINQMIKQWRSSFFFSLICGIPXXXXXXXXXXXXXXXXHTIIHENGSNRTIMKST-VPMVCSGLSADNLILFVLATPVQFYGARYFYIQAYLSLKHKTTNMDVLVVMATXXXXXXXXXXXXXXMAFRRNTSPKTFFETSPMLIVFLSLGRWLEHIAKGKTSEALTKLMSLQAVEATLYTPEN-----KERKIPINLVQRNDLIKILPGEKIPVDGKVVTGTSTCDESLITGESMPIEKTHGSDVIGGSINKSGMLIVKATHVGSDSALAQIVKLVEEAQTSKAPIQQLADRIAGMFVPSVLICAIITLIIWVIVGFS---KPEILPKYVNELSVTEITWEHAFQLAITVLSIACPCSLGLXXXXXXXXXXXXXXXNGILIKGGEPLENIHKLNVIVFDKTGTITNGSPSVTRFLVLIGNGVREHIDKLLKILAAAESASEHPIGKAIITFSKARISNENLPEVLESSAVSGCGLGCKLNLDPKTEVTKFVKNLINIESPSEETNILGQXXXXXXXXXXXXTYKDVIFPVRQHMAWTSDLCQTVTVIIGNRNWMLRNGILVDDEVDELMSEDENLGRTVILMAIDNELIAMISVADQVKREAALAVYTLKKMNIEVYLMTGDNSKTATAIARQVGIHYVFAEVLPSHKVAKVQQLQNTNRSLTSKRKMKVAMVGDGINDSPALAQSDVGIAIGTGTDVAVEAADVVLIRNSLLDVIAAIQLSKATVKRIRQNFIAATLYNLLGIPIAAGVLMPIGIEMMPWMXXXXXXXXXXXXXXXXXXXXXWKKPSEEKLITPEYINFIQSSG---LSESQIIVRRGIDL-MTPQIETTSSLKGSVKSVLGKLNFSNKSK-HKSDKL 4116
            ++ V+GMTC SCV+NIE N+    GV  I VSL   EA + +D  + T + + ++I++MGF+ T+ S+  S   D+       RS       R+  E    +S  K+IE  +     +  ++   E   AD+   SSI + + ++           V  Q + +  +     PT         + +V + GMTC SCV NIE T+  ++GI  + V LE+       D +L  P  V E I+DMG++S     + + +   K P+ +S               +T I IK +    C+  I+  +   PGV    V+L EE G+I YD    + Q++R+ I+ +G+   +T+                           LPK N     Q    ++ E+   KC+L ++GMTC+SCV  +E +LLKV G+ SVLVAL+A K E+ YD AY+MP Q++  V ELG+ A +IEN   G G + + I GMTCSSCV+ IE+H+ K  GI S  VSL+T++G+ E+     GPRD+++ I DMG++ASL      N AA +H  +  +QWR+SF FSLI G+P M VMM+ MF +  +    +   GSN T   S  VPMV +GLS +NLILF+LATPVQF G RYFYIQAY +LKH++TNMDVL+VMAT+ISY+YSVIV+ ++M  + +TSP+TFFET+PML+VF+SLGRWLEHIAKGKTSEALTKLMSLQA EA L   +      KE++I ++LV R D++K+LPGEKIPVDGKV  G S CDESLITGESMP+EK  GS VIGGSIN++G L+V+ATHVG+DSALAQIV+LVEEAQTSKAP+Q +AD IAG FVP V   +++T ++WVIVG++   + +I  K  + +   EI ++HAF+ AITVL+IACPC+LGLATPTAVMVGTGVGA NGILIKGGEPLE  HK+  IVFDKTGTIT G   +TR L L   G+ +H+  ++ +   AE++SEHP+  AI+ ++K  +  E L +VL+  AV GCGL C++     T V   V ++   +   E TNI    +    +      Y+                     V+IGNR WM RN + V + +D+ MS  EN G T +L AI+ E++AM++VAD VK EA LAVYTLKKM + V+L+TGDN KTA AIA+QVGI  VFAEVLPSHKVAK++QLQ        K   +VAMVGDG+NDSPALAQ+D+GIAIGTGTDVAVEAA VVLIRN LLDV+AA++LSK TV+RIR NF+AAT+YN++GIP+AAG L PIGIE+MPWMASAAMAASSVSVV  SLLLKL+KKP+ E L+T EY     SSG     E  I V  G+D    P I   +SLKGS+KS++ KLN +N+ K H+ + L
Sbjct:  155 KIGVEGMTCQSCVKNIEGNMSSKPGVRHIQVSLERKEANITYDPSVVTAQMLRDQINDMGFEATLPSNGSSTSFDEFHELAKTRSHADFGKCRLHIEGMTCQSCIKNIEGVIGEFPGVKTIKVTLETKSADVTFDSSIVTAQAVADRISDMGFDCNVADQQDEFDEIASRSAPTKSPPDGTLAKCMVDIEGMTCMSCVKNIEGTLSDEKGIAQVSVSLEEKRGTVQYDPALWSPTTVAERISDMGYDS-----VVHAAAIPKVPSTIS---------------TTVISIKGMTCNSCVKTIQEVISEKPGVRSIKVSLQEEQGVIQYDPDVTSPQQLRDAIDDMGFDACITDETKFPPETTVIMNGSAGPVKSTPSRGHLPKTNHGMVLQRKVDTVEEDDLEKCHLHVSGMTCASCVANIERNLLKVPGISSVLVALMAQKAEVKYDPAYMMPSQIATLVTELGYPAMLIENEGTGDGHLEIQIGGMTCSSCVHRIESHMVKQPGIKSAIVSLATNRGRFEFDPENTGPRDIMNEIRDMGYEASLVTDNSKNSAAHEH-RKTTRQWRNSFLFSLILGVPCMVVMMYFMFAYMHMPGHQMAAGGSNDTADSSPGVPMVTAGLSVENLILFLLATPVQFIGGRYFYIQAYKALKHRSTNMDVLIVMATTISYVYSVIVVAVAMVMQESTSPRTFFETTPMLMVFISLGRWLEHIAKGKTSEALTKLMSLQASEALLLECDKNGQVIKEQRISVDLVHRGDILKVLPGEKIPVDGKVTEGHSMCDESLITGESMPVEKKKGSSVIGGSINQNGTLLVEATHVGADSALAQIVRLVEEAQTSKAPLQAVADTIAGYFVPGVCTISLLTAVVWVIVGYATYNQLDIHWKSESGMGKNEIIFQHAFKFAITVLAIACPCALGLATPTAVMVGTGVGATNGILIKGGEPLEIAHKVQSIVFDKTGTITRGIAELTR-LTLFNTGLSKHL--VIAVTGTAETSSEHPVAAAIVKYAKQALGAETLGKVLDFQAVPGCGLKCRV-----TNVDHLVSSMETKDILKEHTNIDRDEIQDLQDVSSSSGYE---------------------VLIGNREWMSRNMLTVTEAMDQEMSYHENKGETAVLCAINGEIVAMLAVADTVKEEAHLAVYTLKKMGLNVFLLTGDNLKTAKAIAKQVGISKVFAEVLPSHKVAKIKQLQ--------KDGHRVAMVGDGVNDSPALAQADLGIAIGTGTDVAVEAAGVVLIRNDLLDVVAAMRLSKKTVRRIRFNFLAATIYNIVGIPVAAGALFPIGIELMPWMASAAMAASSVSVVCSSLLLKLFKKPNREDLLTQEYFQKF-SSGRDEYGEDDISVHCGMDADFDPDIYGKTSLKGSIKSIVSKLNIANRPKGHEYNSL 1510          

HSP 2 Score: 216.083 bits (549), Expect = 1.125e-52
Identity = 157/505 (31.09%), Postives = 241/505 (47.72%), Query Frame = 1
Query:   97 LGSARMKVDGMTCMSCVRNIEENLMKFTGVCGIMVSLLHAEATVIFDADIATVEDISNKIDEMGFDVTVKSSEVSN------VKDKVVRSRIK-FESDIN-KSVEKSIETSLSSKLLLVRF--CQENNYADIWHYSSIRSTEILSVIQQSEIYGVLVLEQCPTIRVIVRVNGMTCQSCVDNIESTVGKKQGIISIKVFLEKSEAHALVDASLAGPD-VEEMINDMGFNSEMILEIFNDSCAGKPNNVSQKYEELKSNTIYPILSTTIVIKALKSIFCIFKIENHMRALPGVDKCSVNLIEEIGMIDYDSGKWNVQKIREEIESLGYLTELPKQNWN----STRQSSAVSLNEESRSKCYLRITGMTCSSCVNKVESHLLKVEGVKSVLVALLAMKCEIIYDSAYVMPFQLSNRVKELGFN----AEVIENGNEGIGIVNVLIRGMTCSSCVNHIENHISKIKGIASINVSLSTSKGKVEYFISECGPRDVIDAINDMGFDASLCD 1554
            +  A + + GMTC SCV+NIE N+  F G+  I VSL + E  V FD  + T E I+  ID+MGF+  VKS   S       ++    +S +K  E  I+ +S  K I+ SLS K   +R+   Q N      H   +     L   +Q             T+ V + V GMTCQSCV NIE  +  K G+  I+V LE+ EA+   D S+     + + INDMGF + +          G   +  + +E  K+ +        + I+ +    CI  IE  +   PGV    V L  +   + +DS     Q + + I  +G+   +  Q       ++R +   S  + + +KC + I GMTC SCV  +E  L   +G+  V V+L   +  + YD A   P  ++ R+ ++G++    A  I      I    + I+GMTC+SCV  I+  IS+  G+ SI VSL   +G ++Y      P+ + DAI+DMGFDA + D
Sbjct:    2 MSEAVISIQGMTCQSCVKNIEVNMAAFPGISTIEVSLENQEGVVSFDPTVTTAEKIAEGIDDMGFEAKVKSPGSSPQEVTIYIEGMTCQSCVKNIEGAISMRSGVKQIKVSLSQKQASIRYDPSQTNPRTLREHIDDMGFEAFLEKPKQ-------------TVNVKIGVEGMTCQSCVKNIEGNMSSKPGVRHIQVSLERKEANITYDPSVVTAQMLRDQINDMGFEATL-------PSNGSSTSFDEFHELAKTRSHADFGKCRLHIEGMTCQSCIKNIEGVIGEFPGVKTIKVTLETKSADVTFDSSIVTAQAVADRISDMGFDCNVADQQDEFDEIASRSAPTKSPPDGTLAKCMVDIEGMTCMSCVKNIEGTLSDEKGIAQVSVSLEEKRGTVQYDPALWSPTTVAERISDMGYDSVVHAAAIPKVPSTISTTVISIKGMTCNSCVKTIQEVISEKPGVRSIKVSLQEEQGVIQYDPDVTSPQQLRDAIDDMGFDACITD 486          
BLAST of Copper-transporting ATPase 1 vs. TrEMBL
Match: A0A1S3JT41 (copper-transporting ATPase 1-like isoform X1 OS=Lingula unguis OX=7574 GN=LOC106175926 PE=3 SV=1)

HSP 1 Score: 1081.24 bits (2795), Expect = 0.000e+0
Identity = 677/1415 (47.84%), Postives = 903/1415 (63.82%), Query Frame = 1
Query:  109 RMKVDGMTCMSCVRNIEENLMKFTGVCGIMVSLLHAEATVIFDADIATVEDISNKIDEMGFDVTVKSSEVSNVKDKV-----VRS-------RIKFESDINKSVEKSIETSLSS--KLLLVRFCQENNYADIWHYSSIRSTEILS-----------VIQQSEIYGVLVLEQCPT--------IRVIVRVNGMTCQSCVDNIESTVGKKQGIISIKVFLEKSEAHALVDASLAGPD-VEEMINDMGFNSEMILEIFNDSCAGK-PNNVSQKYEELKSNTIYPILSTTIVIKALKSIFCIFKIENHMRALPGVDKCSVNLIEEIGMIDYDSGKWNVQKIREEIESLGY---LTE---------------------------LPKQNWNSTRQSSAVSLNEESRSKCYLRITGMTCSSCVNKVESHLLKVEGVKSVLVALLAMKCEIIYDSAYVMPFQLSNRVKELGFNAEVIENGNEGIGIVNVLIRGMTCSSCVNHIENHISKIKGIASINVSLSTSKGKVEYFISECGPRDVIDAINDMGFDASLCDHLESNHAAADHINQMIKQWRSSFFFSLICGIPXXXXXXXXXXXXXXXXHTIIHENGSNRTIMKST-VPMVCSGLSADNLILFVLATPVQFYGARYFYIQAYLSLKHKTTNMDVLVVMATXXXXXXXXXXXXXXMAFRRNTSPKTFFETSPMLIVFLSLGRWLEHIAKGKTSEALTKLMSLQAVEATLYTPEN-----KERKIPINLVQRNDLIKILPGEKIPVDGKVVTGTSTCDESLITGESMPIEKTHGSDVIGGSINKSGMLIVKATHVGSDSALAQIVKLVEEAQTSKAPIQQLADRIAGMFVPSVLICAIITLIIWVIVGFS---KPEILPKYVNELSVTEITWEHAFQLAITVLSIACPCSLGLXXXXXXXXXXXXXXXNGILIKGGEPLENIHKLNVIVFDKTGTITNGSPSVTRFLVLIGNGVREHIDKLLKILAAAESASEHPIGKAIITFSKARISNENLPEVLESSAVSGCGLGCKLNLDPKTEVTKFVKNLINIESPSEETNILGQXXXXXXXXXXXXTYKDVIFPVRQHMAWTSDLCQTVTVIIGNRNWMLRNGILVDDEVDELMSEDENLGRTVILMAIDNELIAMISVADQVKREAALAVYTLKKMNIEVYLMTGDNSKTATAIARQVGIHYVFAEVLPSHKVAKVQQLQNTNRSLTSKRKMKVAMVGDGINDSPALAQSDVGIAIGTGTDVAVEAADVVLIRNSLLDVIAAIQLSKATVKRIRQNFIAATLYNLLGIPIAAGVLMPIGIEMMPWMXXXXXXXXXXXXXXXXXXXXXWKKPSEEKLITPEYINFIQSSG---LSESQIIVRRGIDL-MTPQIETTSSLKGSVKSVLGKLNFSNKSK-HKSDKL 4116
            ++ V+GMTC SCV+NIE N+    GV  I VSL   EA + +D  + T + + ++I++MGF+ T+ S+  S   D+       RS       R+  E    +S  K+IE  +     +  ++   E   AD+   SSI + + ++           V  Q + +  +     PT         + +V + GMTC SCV NIE T+  ++GI  + V LE+       D +L  P  V E I+DMG++S     + + +   K P+ +S               +T I IK +    C+  I+  +   PGV    V+L EE G+I YD    + Q++R+ I+ +G+   +T+                           LPK N     Q    ++ E+   KC+L ++GMTC+SCV  +E +LLKV G+ SVLVAL+A K E+ YD AY+MP Q++  V ELG+ A +IEN   G G + + I GMTCSSCV+ IE+H+ K  GI S  VSL+T++G+ E+     GPRD+++ I DMG++ASL      N AA +H  +  +QWR+SF FSLI G+P M VMM+ MF +  +    +   GSN T   S  VPMV +GLS +NLILF+LATPVQF G RYFYIQAY +LKH++TNMDVL+VMAT+ISY+YSVIV+ ++M  + +TSP+TFFET+PML+VF+SLGRWLEHIAKGKTSEALTKLMSLQA EA L   +      KE++I ++LV R D++K+LPGEKIPVDGKV  G S CDESLITGESMP+EK  GS VIGGSIN++G L+V+ATHVG+DSALAQIV+LVEEAQTSKAP+Q +AD IAG FVP V   +++T ++WVIVG++   + +I  K  + +   EI ++HAF+ AITVL+IACPC+LGLATPTAVMVGTGVGA NGILIKGGEPLE  HK+  IVFDKTGTIT G   +TR L L   G+ +H+  ++ +   AE++SEHP+  AI+ ++K  +  E L +VL+  AV GCGL C++     T V   V ++   +   E TNI    +    +      Y+                     V+IGNR WM RN + V + +D+ MS  EN G T +L AI+ E++AM++VAD VK EA LAVYTLKKM + V+L+TGDN KTA AIA+QVGI  VFAEVLPSHKVAK++QLQ        K   +VAMVGDG+NDSPALAQ+D+GIAIGTGTDVAVEAA VVLIRN LLDV+AA++LSK TV+RIR NF+AAT+YN++GIP+AAG L PIGIE+MPWMASAAMAASSVSVV  SLLLKL+KKP+ E L+T EY     SSG     E  I V  G+D    P I   +SLKGS+KS++ KLN +N+ K H+ + L
Sbjct:  155 KIGVEGMTCQSCVKNIEGNMSSKPGVRHIQVSLERKEANITYDPSVVTAQMLRDQINDMGFEATLPSNGSSTSFDEFHELAKTRSHADFGKCRLHIEGMTCQSCIKNIEGVIGEFPGVKTIKVTLETKSADVTFDSSIVTAQAVADRISDMGFDCNVADQQDEFDEIASRSAPTKSPPDGTLAKCMVDIEGMTCMSCVKNIEGTLSDEKGIAQVSVSLEEKRGTVQYDPALWSPTTVAERISDMGYDS-----VVHAAAIPKVPSTIS---------------TTVISIKGMTCNSCVKTIQEVISEKPGVRSIKVSLQEEQGVIQYDPDVTSPQQLRDAIDDMGFDACITDETKFPPETTVIMNGSAGPVKSTPSRGHLPKTNHGMVLQRKVDTVEEDDLEKCHLHVSGMTCASCVANIERNLLKVPGISSVLVALMAQKAEVKYDPAYMMPSQIATLVTELGYPAMLIENEGTGDGHLEIQIGGMTCSSCVHRIESHMVKQPGIKSAIVSLATNRGRFEFDPENTGPRDIMNEIRDMGYEASLVTDNSKNSAAHEH-RKTTRQWRNSFLFSLILGVPCMVVMMYFMFAYMHMPGHQMAAGGSNDTADSSPGVPMVTAGLSVENLILFLLATPVQFIGGRYFYIQAYKALKHRSTNMDVLIVMATTISYVYSVIVVAVAMVMQESTSPRTFFETTPMLMVFISLGRWLEHIAKGKTSEALTKLMSLQASEALLLECDKNGQVIKEQRISVDLVHRGDILKVLPGEKIPVDGKVTEGHSMCDESLITGESMPVEKKKGSSVIGGSINQNGTLLVEATHVGADSALAQIVRLVEEAQTSKAPLQAVADTIAGYFVPGVCTISLLTAVVWVIVGYATYNQLDIHWKSESGMGKNEIIFQHAFKFAITVLAIACPCALGLATPTAVMVGTGVGATNGILIKGGEPLEIAHKVQSIVFDKTGTITRGIAELTR-LTLFNTGLSKHL--VIAVTGTAETSSEHPVAAAIVKYAKQALGAETLGKVLDFQAVPGCGLKCRV-----TNVDHLVSSMETKDILKEHTNIDRDEIQDLQDAPSSSGYE---------------------VLIGNREWMSRNMLTVTEAMDQEMSYHENKGETAVLCAINGEIVAMLAVADTVKEEAHLAVYTLKKMGLNVFLLTGDNLKTAKAIAKQVGISKVFAEVLPSHKVAKIKQLQ--------KDGHRVAMVGDGVNDSPALAQADLGIAIGTGTDVAVEAAGVVLIRNDLLDVVAAMRLSKKTVRRIRFNFLAATIYNIVGIPVAAGALFPIGIELMPWMASAAMAASSVSVVCSSLLLKLFKKPNREDLLTQEYFQKF-SSGRDEYGEDDISVHCGMDADFDPDIYGKTSLKGSIKSIVSKLNIANRPKGHEYNSL 1510          

HSP 2 Score: 216.083 bits (549), Expect = 1.125e-52
Identity = 157/505 (31.09%), Postives = 241/505 (47.72%), Query Frame = 1
Query:   97 LGSARMKVDGMTCMSCVRNIEENLMKFTGVCGIMVSLLHAEATVIFDADIATVEDISNKIDEMGFDVTVKSSEVSN------VKDKVVRSRIK-FESDIN-KSVEKSIETSLSSKLLLVRF--CQENNYADIWHYSSIRSTEILSVIQQSEIYGVLVLEQCPTIRVIVRVNGMTCQSCVDNIESTVGKKQGIISIKVFLEKSEAHALVDASLAGPD-VEEMINDMGFNSEMILEIFNDSCAGKPNNVSQKYEELKSNTIYPILSTTIVIKALKSIFCIFKIENHMRALPGVDKCSVNLIEEIGMIDYDSGKWNVQKIREEIESLGYLTELPKQNWN----STRQSSAVSLNEESRSKCYLRITGMTCSSCVNKVESHLLKVEGVKSVLVALLAMKCEIIYDSAYVMPFQLSNRVKELGFN----AEVIENGNEGIGIVNVLIRGMTCSSCVNHIENHISKIKGIASINVSLSTSKGKVEYFISECGPRDVIDAINDMGFDASLCD 1554
            +  A + + GMTC SCV+NIE N+  F G+  I VSL + E  V FD  + T E I+  ID+MGF+  VKS   S       ++    +S +K  E  I+ +S  K I+ SLS K   +R+   Q N      H   +     L   +Q             T+ V + V GMTCQSCV NIE  +  K G+  I+V LE+ EA+   D S+     + + INDMGF + +          G   +  + +E  K+ +        + I+ +    CI  IE  +   PGV    V L  +   + +DS     Q + + I  +G+   +  Q       ++R +   S  + + +KC + I GMTC SCV  +E  L   +G+  V V+L   +  + YD A   P  ++ R+ ++G++    A  I      I    + I+GMTC+SCV  I+  IS+  G+ SI VSL   +G ++Y      P+ + DAI+DMGFDA + D
Sbjct:    2 MSEAVISIQGMTCQSCVKNIEVNMAAFPGISTIEVSLENQEGVVSFDPTVTTAEKIAEGIDDMGFEAKVKSPGSSPQEVTIYIEGMTCQSCVKNIEGAISMRSGVKQIKVSLSQKQASIRYDPSQTNPRTLREHIDDMGFEAFLEKPKQ-------------TVNVKIGVEGMTCQSCVKNIEGNMSSKPGVRHIQVSLERKEANITYDPSVVTAQMLRDQINDMGFEATL-------PSNGSSTSFDEFHELAKTRSHADFGKCRLHIEGMTCQSCIKNIEGVIGEFPGVKTIKVTLETKSADVTFDSSIVTAQAVADRISDMGFDCNVADQQDEFDEIASRSAPTKSPPDGTLAKCMVDIEGMTCMSCVKNIEGTLSDEKGIAQVSVSLEEKRGTVQYDPALWSPTTVAERISDMGYDSVVHAAAIPKVPSTISTTVISIKGMTCNSCVKTIQEVISEKPGVRSIKVSLQEEQGVIQYDPDVTSPQQLRDAIDDMGFDACITD 486          
BLAST of Copper-transporting ATPase 1 vs. TrEMBL
Match: A0A1S3JD93 (copper-transporting ATPase 1 OS=Lingula unguis OX=7574 GN=LOC106172284 PE=3 SV=1)

HSP 1 Score: 1073.15 bits (2774), Expect = 0.000e+0
Identity = 675/1407 (47.97%), Postives = 899/1407 (63.89%), Query Frame = 1
Query:  118 VDGMTCMSCVRNIEENLMKFTGVCGIMVSLLHAEATVIFDADIATVEDISNKIDEMGFDVTV-KSSEVSNVKDKVVRSRIKFESDINKSVEKSIETSLSSK--LLLVRFCQENNYADIWHYSSIRSTEILS---------------------VIQQSEIYGVLVLEQCPT----IRVIVRVNGMTCQSCVDNIESTVGKKQGIISIKVFLEKSEAHALVDASLAGP-DVEEMINDMGFNSEMILEIFNDSCAGK-PNNVSQKYEELKSNTIYPILSTTIVIKALKSIFCIFKIENHMRALPGVDKCSVNLIEEIGMIDYDSGKWNVQKIREEIESLGY---LTE---------------------------LPKQNWNSTRQSSAVSLNEESRSKCYLRITGMTCSSCVNKVESHLLKVEGVKSVLVALLAMKCEIIYDSAYVMPFQLSNRVKELGFNAEVIENGNEGIGIVNVLIRGMTCSSCVNHIENHISKIKGIASINVSLSTSKGKVEYFISECGPRDVIDAINDMGFDASLCDHLESNHAAADHINQMIKQWRSSFFFSLICGIPXXXXXXXXXXXXXXXXHTIIHENGSNRTIMKST-VPMVCSGLSADNLILFVLATPVQFYGARYFYIQAYLSLKHKTTNMDVLVVMATXXXXXXXXXXXXXXMAFRRNTSPKTFFETSPMLIVFLSLGRWLEHIAKGKTSEALTKLMSLQAVEATLYTPEN-----KERKIPINLVQRNDLIKILPGEKIPVDGKVVTGTSTCDESLITGESMPIEKTHGSDVIGGSINKSGMLIVKATHVGSDSALAQIVKLVEEAQTSKAPIQQLADRIAGMFVPSVLICAIITLIIWVIVGFS---KPEILPKYVNELSVTEITWEHAFQLAITVLSIACPCSLGLXXXXXXXXXXXXXXXNGILIKGGEPLENIHKLNVIVFDKTGTITNGSPSVTRFLVLIGNGVREHIDKLLKILAAAESASEHPIGKAIITFSKARISNENLPEVLESSAVSGCGLGCKLNLDPKTEVTKFVKNLINIESPSEETNILGQXXXXXXXXXXXXTYKDVIFPVRQHMAWTSDLCQTVTVIIGNRNWMLRNGILVDDEVDELMSEDENLGRTVILMAIDNELIAMISVADQVKREAALAVYTLKKMNIEVYLMTGDNSKTATAIARQVGIHYVFAEVLPSHKVAKVQQLQNTNRSLTSKRKMKVAMVGDGINDSPALAQSDVGIAIGTGTDVAVEAADVVLIRNSLLDVIAAIQLSKATVKRIRQNFIAATLYNLLGIPIAAGVLMPIGIEMMPWMXXXXXXXXXXXXXXXXXXXXXWKKPSEEKLITPEYINFIQSSG---LSESQIIVRRGIDL-MTPQIETTSSLKGSVKSVLGKLNFSNKSK-HKSDKL 4116
            ++GMTC SCV+NIE  +   +GV  I VSL   +A++ +D        +   ID+MGF+  + K  + +NVK       I  E    +S  K+IE ++SSK  +  ++   E   A+I +  S+ + ++L                        +  EI G     + P+     + +V + GMTC SCV NIE T+  ++GI  + V LE+       D +L  P  V E I+DMG++S     + + S   K P+ +S               +T I IK +    C+  I+  +   PGV    V+L EE G+I YD    + Q++R+ I+ +G+   +T+                           LPK N     Q    ++ E+   KC+L ++GMTC+SCV  +E +LLKV G+ SVLVAL+A K E+ YD AY+MP Q++  V ELG+ A +IEN   G G + + I GMTCSSCV+ IE+H+ K  GI S  VSL+T++G+ E+     GPRD+++ I DMG++ASL      N AA +H  +  +QWR+SF FSLI G+P M VMM+ MF +  +    +   GSN T   S  VPMV +GLS +NLILF+LATPVQF G RYFYIQAY +LKH++TNMDVL+VMAT+ISY+YSVIV+ ++M  + +TSP+TFFET+PML+VF+SLGRWLEHIAKGKTSEALTKLMSLQA EA L   +      KE++I ++LV R D++K+LPGEKIPVDGKV  G S CDESLITGESMP+EK  GS VIGGSIN++G L+V+ATHVG+DSALAQIV+LVEEAQTSKAP+Q +AD IAG FVP V   +++T ++WVIVG++   + +I  K  + +   EI ++HAF+ AITVL+IACPC+LGLATPTAVMVGTGVGA NGILIKGGEPLE  HK+  IVFDKTGTIT G   +TR L L   G+ +H+  ++ +   AE++SEHP+  AI+ ++K  +  E L +VL+  AV GCGL C++     T V   V ++   +   E TNI    +    +      Y+                     V+IGNR WM RN + V +++D+ MS  EN G T +L AI+ E++AM++VAD VK EA LAVYTLKKM + V+L+TGDN KTA AIA+QVGI  VFAEVLPSHKVAK++QLQ        K   +VAMVGDG+NDSPALAQ+D+GIAIGTGTDVAVEAA VVLIRN LLDV+AA++LSK TV+RIR NF+AAT+YN++GIP+AAG L PIGIE+MPWMASAAMAASSVSVV  SLLLKL+KKP+ E L+T EY     SSG     E  I V  G+D    P I   +SLKGS+KS++ KLN +N+ K H+ + L
Sbjct:   84 IEGMTCQSCVKNIEGAISMRSGVKQIKVSLSQKQASIRYDPSQTNPRTLREHIDDMGFEAFLEKPKQTANVK-------IGVEGMTCQSCVKNIEGNMSSKPGVRHIQVSLERKEANITYDPSVVTAQMLRDQIDDMGFEATLPSHGSSTSLEDEFDEIAGRSAPTKSPSDGTLAKCMVDIEGMTCMSCVKNIEGTLSDEKGIAQVSVSLEEKRGTVQYDPALWSPATVAERISDMGYDS-----VVHASAIPKVPSTIS---------------TTVISIKGMTCNSCVKTIQEVISEKPGVRSIKVSLQEEQGVIQYDPDVTSPQQLRDAIDDMGFDACITDETKFPPETTVIMNGSAGPVKSTPSRGHLPKTNHGVVIQRKVDTVEEDDLEKCHLHVSGMTCASCVANIERNLLKVPGISSVLVALMAQKAEVKYDPAYMMPSQIATMVTELGYPAMLIENEGTGDGHLEIQIGGMTCSSCVHRIESHMVKQPGIKSAIVSLATNRGRFEFDPENTGPRDIMNEIRDMGYEASLVTDNSKNSAAHEH-RKTTRQWRNSFLFSLILGVPCMVVMMYFMFAYMHMPGHQMAAGGSNDTADSSPGVPMVTAGLSVENLILFLLATPVQFIGGRYFYIQAYKALKHRSTNMDVLIVMATTISYVYSVIVVAVAMVMQESTSPRTFFETTPMLMVFISLGRWLEHIAKGKTSEALTKLMSLQASEALLLECDKNGQVIKEQRISVDLVHRGDILKVLPGEKIPVDGKVTEGHSMCDESLITGESMPVEKKKGSSVIGGSINQNGTLLVEATHVGADSALAQIVRLVEEAQTSKAPLQAVADTIAGYFVPGVCTISLLTAVVWVIVGYATYNQLDIHWKSESGMGKNEIIFQHAFKFAITVLAIACPCALGLATPTAVMVGTGVGATNGILIKGGEPLEIAHKVQSIVFDKTGTITRGIAELTR-LTLFNTGLSKHL--VIAVTGTAETSSEHPVAAAIVKYAKQALGAETLGKVLDFQAVPGCGLKCRV-----TNVDHLVSSMETKDILKEHTNIDRDEIQDLQDAPCSSGYE---------------------VLIGNREWMSRNMLTVTEDMDQEMSYHENKGETAVLCAINGEIVAMLAVADTVKEEAHLAVYTLKKMGLNVFLLTGDNLKTAKAIAKQVGISKVFAEVLPSHKVAKIKQLQ--------KDGHRVAMVGDGVNDSPALAQADLGIAIGTGTDVAVEAAGVVLIRNDLLDVVAAMRLSKKTVRRIRFNFLAATIYNIVGIPVAAGALFPIGIELMPWMASAAMAASSVSVVCSSLLLKLFKKPNREDLLTQEYFQKF-SSGRDEYGEDDISVHCGMDADFDPDIYGKTSLKGSIKSIVSKLNIANRPKGHEYNSL 1424          

HSP 2 Score: 199.134 bits (505), Expect = 1.495e-47
Identity = 155/541 (28.65%), Postives = 253/541 (46.77%), Query Frame = 1
Query:   97 LGSARMKVDGMTCMSCVRNIEENLMKFTGVCGIMVSLLHAEATVIFDADIATVEDISNKIDEMGFDVTVKSSEVSN------VKDKVVRSRIK-FESDIN-KSVEKSIETSLSSKLLLVRF--CQENNYADIWHYSSIRSTEILSVIQQSEIYGVLVLEQCPTIRVIVRVNGMTCQSCVDNIESTVGKKQGIISIKVFLEKSEAHALVDASLAGPD-VEEMINDMGFNSEMILEIFNDSCAGKPNNVSQKYEELKSNTIYPILSTTIVIKALKSIFCIFKIENHMRALPGVDKCSVNLIEEIGMIDYDSGKWNVQKIREEIESLGYLTELPKQNWNSTRQSSAVSLNEESRSKCYLRITGMTCSSCVNKVESHLLKVEGVKSVLVALLAMKCEIIYDSAYVMPFQLSNRVKELGFNA------------EVIENGNEGI---------------GIV----------------NVLIRGMTCSSCVNHIENHISKIKGIASINVSLSTSKGKVEYFISECGPRDVIDAINDMGFDASLCDH 1557
            +  A + + GMTC SCV+NIE N+  F G+  I VSL + E  V FD  + T E I+  ID+MGF+  VKS   S       ++    +S +K  E  I+ +S  K I+ SLS K   +R+   Q N      H   +     L   +Q             T  V + V GMTCQSCV NIE  +  K G+  I+V LE+ EA+   D S+     + + I+DMGF + +     + S   + + ++ +    KS +   +    + I+ +  + C+  IE  +    G+ + SV+L E+ G + YD   W+   + E I  +GY         +S   +SA+     + S   + I GMTC+SCV  ++  + +  GV+S+ V+L   +  I YD     P QL + + ++GF+A             VI NG+ G                G+V                ++ + GMTC+SCV +IE ++ K+ GI+S+ V+L   K +V+Y  +   P  +   + ++G+ A L ++
Sbjct:    2 MSEAVISIQGMTCQSCVKNIEVNMAAFPGISTIEVSLENQEGVVSFDPTVTTAEKIAEGIDDMGFEAKVKSPGSSPQEVTIYIEGMTCQSCVKNIEGAISMRSGVKQIKVSLSQKQASIRYDPSQTNPRTLREHIDDMGFEAFLEKPKQ-------------TANVKIGVEGMTCQSCVKNIEGNMSSKPGVRHIQVSLERKEANITYDPSVVTAQMLRDQIDDMGFEATLPSHGSSTSLEDEFDEIAGRSAPTKSPSDGTLAKCMVDIEGMTCMSCVKNIEGTLSDEKGIAQVSVSLEEKRGTVQYDPALWSPATVAERISDMGY---------DSVVHASAIPKVPSTISTTVISIKGMTCNSCVKTIQEVISEKPGVRSIKVSLQEEQGVIQYDPDVTSPQQLRDAIDDMGFDACITDETKFPPETTVIMNGSAGPVKSTPSRGHLPKTNHGVVIQRKVDTVEEDDLEKCHLHVSGMTCASCVANIERNLLKVPGISSVLVALMAQKAEVKYDPAYMMPSQIATMVTELGYPAMLIEN 520          
BLAST of Copper-transporting ATPase 1 vs. TrEMBL
Match: A0A1S3JTE7 (copper-transporting ATPase 1-like isoform X5 OS=Lingula unguis OX=7574 GN=LOC106175926 PE=3 SV=1)

HSP 1 Score: 1054.28 bits (2725), Expect = 0.000e+0
Identity = 653/1360 (48.01%), Postives = 871/1360 (64.04%), Query Frame = 1
Query:  109 RMKVDGMTCMSCVRNIEENLMKFTGVCGIMVSLLHAEATVIFDADIATVEDISNKIDEMGFDVTVKSSEVSNVKDKV-----VRS-------RIKFESDINKSVEKSIETSLSS--KLLLVRFCQENNYADIWHYSSIRSTEILS-----------VIQQSEIYGVLVLEQCPT--------IRVIVRVNGMTCQSCVDNIESTVGKKQGIISIKVFLEKSEAHALVDASLAGPD-VEEMINDMGFNSEMILEIFNDSCAGK-PNNVSQKYEELKSNTIYPILSTTIVIKALKSIFCIFKIENHMRALPGVDKCSVNLIEEIGMIDYDSGKWNVQKIREEIESLGY---LTE---------------------------LPKQNWNSTRQSSAVSLNEESRSKCYLRITGMTCSSCVNKVESHLLKVEGVKSVLVALLAMKCEIIYDSAYVMPFQLSNRVKELGFNAEVIENGNEGIGIVNVLIRGMTCSSCVNHIENHISKIKGIASINVSLSTSKGKVEYFISECGPRDVIDAINDMGFDASLCDHLESNHAAADHINQMIKQWRSSFFFSLICGIPXXXXXXXXXXXXXXXXHTIIHENGSNRTIMKST-VPMVCSGLSADNLILFVLATPVQFYGARYFYIQAYLSLKHKTTNMDVLVVMATXXXXXXXXXXXXXXMAFRRNTSPKTFFETSPMLIVFLSLGRWLEHIAKGKTSEALTKLMSLQAVEATLYTPEN-----KERKIPINLVQRNDLIKILPGEKIPVDGKVVTGTSTCDESLITGESMPIEKTHGSDVIGGSINKSGMLIVKATHVGSDSALAQIVKLVEEAQTSKAPIQQLADRIAGMFVPSVLICAIITLIIWVIVGFS---KPEILPKYVNELSVTEITWEHAFQLAITVLSIACPCSLGLXXXXXXXXXXXXXXXNGILIKGGEPLENIHKLNVIVFDKTGTITNGSPSVTRFLVLIGNGVREHIDKLLKILAAAESASEHPIGKAIITFSKARISNENLPEVLESSAVSGCGLGCKLNLDPKTEVTKFVKNLINIESPSEETNILGQXXXXXXXXXXXXTYKDVIFPVRQHMAWTSDLCQTVTVIIGNRNWMLRNGILVDDEVDELMSEDENLGRTVILMAIDNELIAMISVADQVKREAALAVYTLKKMNIEVYLMTGDNSKTATAIARQVGIHYVFAEVLPSHKVAKVQQLQNTNRSLTSKRKMKVAMVGDGINDSPALAQSDVGIAIGTGTDVAVEAADVVLIRNSLLDVIAAIQLSKATVKRIRQNFIAATLYNLLGIPIAAGVLMPIGIEMMPWMXXXXXXXXXXXXXXXXXXXXXWKKPSEEKLITPEYINFIQSS 3966
            ++ V+GMTC SCV+NIE N+    GV  I VSL   EA + +D  + T + + ++I++MGF+ T+ S+  S   D+       RS       R+  E    +S  K+IE  +     +  ++   E   AD+   SSI + + ++           V  Q + +  +     PT         + +V + GMTC SCV NIE T+  ++GI  + V LE+       D +L  P  V E I+DMG++S     + + +   K P+ +S               +T I IK +    C+  I+  +   PGV    V+L EE G+I YD    + Q++R+ I+ +G+   +T+                           LPK N     Q    ++ E+   KC+L ++GMTC+SCV  +E +LLKV G+ SVLVAL+A K E+ YD AY+MP Q++  V ELG+ A +IEN   G G + + I GMTCSSCV+ IE+H+ K  GI S  VSL+T++G+ E+     GPRD+++ I DMG++ASL      N AA +H  +  +QWR+SF FSLI G+P M VMM+ MF +  +    +   GSN T   S  VPMV +GLS +NLILF+LATPVQF G RYFYIQAY +LKH++TNMDVL+VMAT+ISY+YSVIV+ ++M  + +TSP+TFFET+PML+VF+SLGRWLEHIAKGKTSEALTKLMSLQA EA L   +      KE++I ++LV R D++K+LPGEKIPVDGKV  G S CDESLITGESMP+EK  GS VIGGSIN++G L+V+ATHVG+DSALAQIV+LVEEAQTSKAP+Q +AD IAG FVP V   +++T ++WVIVG++   + +I  K  + +   EI ++HAF+ AITVL+IACPC+LGLATPTAVMVGTGVGA NGILIKGGEPLE  HK+  IVFDKTGTIT G   +TR L L   G+ +H+  ++ +   AE++SEHP+  AI+ ++K  +  E L +VL+  AV GCGL C++     T V   V ++   +   E TNI    +    +      Y+                     V+IGNR WM RN + V + +D+ MS  EN G T +L AI+ E++AM++VAD VK EA LAVYTLKKM + V+L+TGDN KTA AIA+QVGI  VFAEVLPSHKVAK++QLQ        K   +VAMVGDG+NDSPALAQ+D+GIAIGTGTDVAVEAA VVLIRN LLDV+AA++LSK TV+RIR NF+AAT+YN++GIP+AAG L PIGIE+MPWMASAAMAASSVSVV  SLLLKL+K P  E L+T EY   +Q +
Sbjct:  155 KIGVEGMTCQSCVKNIEGNMSSKPGVRHIQVSLERKEANITYDPSVVTAQMLRDQINDMGFEATLPSNGSSTSFDEFHELAKTRSHADFGKCRLHIEGMTCQSCIKNIEGVIGEFPGVKTIKVTLETKSADVTFDSSIVTAQAVADRISDMGFDCNVADQQDEFDEIASRSAPTKSPPDGTLAKCMVDIEGMTCMSCVKNIEGTLSDEKGIAQVSVSLEEKRGTVQYDPALWSPTTVAERISDMGYDS-----VVHAAAIPKVPSTIS---------------TTVISIKGMTCNSCVKTIQEVISEKPGVRSIKVSLQEEQGVIQYDPDVTSPQQLRDAIDDMGFDACITDETKFPPETTVIMNGSAGPVKSTPSRGHLPKTNHGMVLQRKVDTVEEDDLEKCHLHVSGMTCASCVANIERNLLKVPGISSVLVALMAQKAEVKYDPAYMMPSQIATLVTELGYPAMLIENEGTGDGHLEIQIGGMTCSSCVHRIESHMVKQPGIKSAIVSLATNRGRFEFDPENTGPRDIMNEIRDMGYEASLVTDNSKNSAAHEH-RKTTRQWRNSFLFSLILGVPCMVVMMYFMFAYMHMPGHQMAAGGSNDTADSSPGVPMVTAGLSVENLILFLLATPVQFIGGRYFYIQAYKALKHRSTNMDVLIVMATTISYVYSVIVVAVAMVMQESTSPRTFFETTPMLMVFISLGRWLEHIAKGKTSEALTKLMSLQASEALLLECDKNGQVIKEQRISVDLVHRGDILKVLPGEKIPVDGKVTEGHSMCDESLITGESMPVEKKKGSSVIGGSINQNGTLLVEATHVGADSALAQIVRLVEEAQTSKAPLQAVADTIAGYFVPGVCTISLLTAVVWVIVGYATYNQLDIHWKSESGMGKNEIIFQHAFKFAITVLAIACPCALGLATPTAVMVGTGVGATNGILIKGGEPLEIAHKVQSIVFDKTGTITRGIAELTR-LTLFNTGLSKHL--VIAVTGTAETSSEHPVAAAIVKYAKQALGAETLGKVLDFQAVPGCGLKCRV-----TNVDHLVSSMETKDILKEHTNIDRDEIQDLQDAPSSSGYE---------------------VLIGNREWMSRNMLTVTEAMDQEMSYHENKGETAVLCAINGEIVAMLAVADTVKEEAHLAVYTLKKMGLNVFLLTGDNLKTAKAIAKQVGISKVFAEVLPSHKVAKIKQLQ--------KDGHRVAMVGDGVNDSPALAQADLGIAIGTGTDVAVEAAGVVLIRNDLLDVVAAMRLSKKTVRRIRFNFLAATIYNIVGIPVAAGALFPIGIELMPWMASAAMAASSVSVVCSSLLLKLFKMPRPEDLLTSEYKARLQET 1456          

HSP 2 Score: 216.468 bits (550), Expect = 7.465e-53
Identity = 157/505 (31.09%), Postives = 241/505 (47.72%), Query Frame = 1
Query:   97 LGSARMKVDGMTCMSCVRNIEENLMKFTGVCGIMVSLLHAEATVIFDADIATVEDISNKIDEMGFDVTVKSSEVSN------VKDKVVRSRIK-FESDIN-KSVEKSIETSLSSKLLLVRF--CQENNYADIWHYSSIRSTEILSVIQQSEIYGVLVLEQCPTIRVIVRVNGMTCQSCVDNIESTVGKKQGIISIKVFLEKSEAHALVDASLAGPD-VEEMINDMGFNSEMILEIFNDSCAGKPNNVSQKYEELKSNTIYPILSTTIVIKALKSIFCIFKIENHMRALPGVDKCSVNLIEEIGMIDYDSGKWNVQKIREEIESLGYLTELPKQNWN----STRQSSAVSLNEESRSKCYLRITGMTCSSCVNKVESHLLKVEGVKSVLVALLAMKCEIIYDSAYVMPFQLSNRVKELGFN----AEVIENGNEGIGIVNVLIRGMTCSSCVNHIENHISKIKGIASINVSLSTSKGKVEYFISECGPRDVIDAINDMGFDASLCD 1554
            +  A + + GMTC SCV+NIE N+  F G+  I VSL + E  V FD  + T E I+  ID+MGF+  VKS   S       ++    +S +K  E  I+ +S  K I+ SLS K   +R+   Q N      H   +     L   +Q             T+ V + V GMTCQSCV NIE  +  K G+  I+V LE+ EA+   D S+     + + INDMGF + +          G   +  + +E  K+ +        + I+ +    CI  IE  +   PGV    V L  +   + +DS     Q + + I  +G+   +  Q       ++R +   S  + + +KC + I GMTC SCV  +E  L   +G+  V V+L   +  + YD A   P  ++ R+ ++G++    A  I      I    + I+GMTC+SCV  I+  IS+  G+ SI VSL   +G ++Y      P+ + DAI+DMGFDA + D
Sbjct:    2 MSEAVISIQGMTCQSCVKNIEVNMAAFPGISTIEVSLENQEGVVSFDPTVTTAEKIAEGIDDMGFEAKVKSPGSSPQEVTIYIEGMTCQSCVKNIEGAISMRSGVKQIKVSLSQKQASIRYDPSQTNPRTLREHIDDMGFEAFLEKPKQ-------------TVNVKIGVEGMTCQSCVKNIEGNMSSKPGVRHIQVSLERKEANITYDPSVVTAQMLRDQINDMGFEATL-------PSNGSSTSFDEFHELAKTRSHADFGKCRLHIEGMTCQSCIKNIEGVIGEFPGVKTIKVTLETKSADVTFDSSIVTAQAVADRISDMGFDCNVADQQDEFDEIASRSAPTKSPPDGTLAKCMVDIEGMTCMSCVKNIEGTLSDEKGIAQVSVSLEEKRGTVQYDPALWSPTTVAERISDMGYDSVVHAAAIPKVPSTISTTVISIKGMTCNSCVKTIQEVISEKPGVRSIKVSLQEEQGVIQYDPDVTSPQQLRDAIDDMGFDACITD 486          
BLAST of Copper-transporting ATPase 1 vs. Ensembl Cavefish
Match: atp7a (ATPase copper transporting alpha [Source:NCBI gene;Acc:103038584])

HSP 1 Score: 896.345 bits (2315), Expect = 0.000e+0
Identity = 587/1329 (44.17%), Postives = 800/1329 (60.20%), Query Frame = 1
Query:  109 RMKVDGMTCMSCVRNIEENLMKFTGVCGIMVSLLHAEATVIFDADIATVEDISNKIDEMGFDVTVKSSEVSNVKDKVVRSRIKFESDINKSVEKSIETSLSSKLLLVRFCQENNYADIWHYSSIRSTEILSVIQQSEIYGVLVLEQCPTIRVIVRVNGMTCQSCVDNIESTVGKKQGIISIKVFLEKSEAHALVDASL----AGPDVEEMINDMGFNSEMILEIFNDSCAGKPNNVSQKYEELKSNTIYPILSTT-IVIKALKSIFCIFKIENHMRALPGVDKCSVNLIEEIGMIDYDSGKWNVQKIREEIESLGYLTELPKQN----------WNSTRQSSAVSLNEE--------------SRSKCYLRITGMTCSSCVNKVESHLLKVEGVKSVLVALLAMKCEIIYDSAYVMPFQLSNRVKELGFNAEVIENGNEGIGIVNVLIRGMTCSSCVNHIENHISKIKGIASINVSLSTSKGKVEYFISECGPRDVIDAINDMGFDASLCDHLESNHAAADHINQMIKQWRSSFFFSLICGIPXXXXXXXXXXXXXXXXHTII---HENGS--NRTIMKSTVPM---VCSGLSADNLILFVLATPVQFYGARYFYIQAYLSLKHKTTNMDVLVVMATXXXXXXXXXXXXXXMAFRRNTSPKTFFETSPMLIVFLSLGRWLEHIAKGKTSEALTKLMSLQAVEATLYTPEN------KERKIPINLVQRNDLIKILPGEKIPVDGKVVTGTSTCDESLITGESMPIEKTHGSDVIGGSINKSGMLIVKATHVGSDSALAQIVKLVEEAQTSKAPIQQLADRIAGMFVPSVLICAIITLIIWVIVGFSKPEI----LPKYVNELSVTEITWEHAFQLAITVLSIACPCSLGLXXXXXXXXXXXXXXXNGILIKGGEPLENIHKLNVIVFDKTGTITNGSPSVTRFLVLIGNGVREHIDKLLKILAAAESASEHPIGKAIITFSKARISNENLPEVLESSAVSGCGLGCKL----NL----DPKTEVTKFVKNLINIESPSEETNILGQXXXXXXXXXXXXTYKDVIFPVRQHMAWTSDLCQTVTVIIGNRNWMLRNGILVDDEVDELMSEDENLGRTVILMAIDNELIAMISVADQVKREAALAVYTLKKMNIEVYLMTGDNSKTATAIARQVGIHYVFAEVLPSHKVAKVQQLQNTNRSLTSKRKMKVAMVGDGINDSPALAQSDVGIAIGTGTDVAVEAADVVLIRNSLLDVIAAIQLSKATVKRIRQNFIAATLYNLLGIPIAAGVLMPIGIEMMPWMXXXXXXXXXXXXXXXXXXXXXWKKPSEEKL 3930
            +M++DGM C+SC   IE  + K  GV  I V L   EATV++   + TVEDI N+I   GF  +VKS                          K  +  LSS   L+   Q ++       +S ++ E  +    +                ++ V+GM C SCV NI+  +GK +G+ S++V LEK +A    + S+    A     E +    F +++     +   A  P+++S+    L   +  P+ ST  I I+ +    C+  IE  +    GV    V+L    G  ++D      +++R  IE +G+   LP+ N            S+  S A+S  +E              + SKC+++I GMTC+SCV  +E +L    G+ SVLVAL+A K E+ Y+ A + P +++  ++ELGF A V+EN +   G + ++IRGMTC+SCV+ IE+ + K KGI   +V+L+T+K  V+Y     GPRD+I  I ++GF+A L     S  +  DH  + I+QW+ SF  SL+  +P M +M++ M       H I+   H N +  +R +  S + +   +  GLS  NL+ F+   PVQF G R+FY QAY +LKH + NMDVL+V+ATSI++ YS+++++++M  +   +P TFF+T PML VF+SLGRWLE IAK KTSEAL+KLMSLQA EAT+ T          E ++ + LVQR D++K++PG K PVDG+V+ G S  DESLITGE+MP+ K  GS VI GSIN++G L+++ATHVG+D+ L+QIVKLVEEAQTSKAPIQQ ADRI+G FVP ++  +++TL+ W+ +GF    +     P Y   +S  E     AFQ +ITVL IACPCSLGLATPTAVMVGTGVGA NGILIKGGEPLE  H++  +VFDKTGTIT G+P V +  +L+  G R    KLL I+  AE+ SEHP+G AI  F K  +  E L    +  AV GCG+ C +    NL    D   E  +    L+ I  P   +N                 +  ++ P    +  ++    + TV+IGNR WM RN + +  +VDE M+E E  GRT +L+A+D EL AM+++AD VK EA LAV+TL  M +EV LMTGDNSKTA AIA QVGI  VFAEVLPSHKVAKV+QLQ   +        +VAMVGDG+NDSPALA +DVGIAIGTGTDVA+EAADVVLIRN LLDV+A+I LSK TVKRIR NF+ A +YNL+GIPIAAGV MPIG+ + PWM SAAMAASSVSVV  SLLLK + KPS EKL
Sbjct:  171 KMRIDGMVCLSCTTTIEGKIGKLKGVEKIKVGLESQEATVLYLPYLITVEDIVNQIGVAGFKASVKS--------------------------KPRQLQLSSVERLLNASQLSSPTSPEEKTSTQALESTTTTTIT---------------TLINVSGMHCNSCVVNIQDNIGKVRGVSSVQVSLEKRQAVIQHNPSIVTVAALQRAIEALPPGKFKTQL-----DGQDATLPSSLSELS--LLQLSEQPLASTVQIHIEGMTCNSCVQSIEGTISQRKGVRSAQVSLANHQGTFEFDPLLTAPEELRAAIEEMGFDAFLPETNSLIPVKSPPSIRSSPSSPALSTIKEKEKELESDTEAGLNTHSKCFIQIGGMTCASCVANIERNLKNEHGIHSVLVALMASKAEVRYNPAVMDPLKIAECIRELGFTASVMENYDGSDGALELVIRGMTCASCVHKIESSLMKQKGIVYASVALATNKAHVKYDPEVTGPRDIIRLIENLGFEALLVKKDRSG-SHLDHSIE-IQQWKKSFLISLVFCVPVMGMMIYMMVVD----HMIVMSHHHNATREDRQMYHSHMFLERQLLPGLSIMNLLSFLFCVPVQFIGGRHFYAQAYKALKHWSANMDVLIVLATSIAFTYSLVILMVAMIEKAKVNPITFFDTPPMLFVFISLGRWLEQIAKSKTSEALSKLMSLQATEATVVTLNGDTMAVLSEEQVDVELVQRGDIVKVVPGGKFPVDGRVIEGHSMADESLITGEAMPVTKKPGSTVIAGSINQNGSLLIRATHVGTDTTLSQIVKLVEEAQTSKAPIQQFADRISGYFVPFIVAVSVLTLLAWIAIGFVNFRLVEMYFPGYDKSVSQAEAIIRFAFQASITVLCIACPCSLGLATPTAVMVGTGVGAQNGILIKGGEPLEMAHRIQSVVFDKTGTITYGAPKVVQVKILV-EGNRMPRSKLLAIVGTAENNSEHPLGAAITRFCKQELGTEMLGTCTDFQAVPGCGIRCHVSNTENLVKREDSDGEENQRNAILVQISDPRASSN----------------AHPLIMDPEPLTLVQSA----SYTVLIGNREWMRRNALHIRPDVDEAMTEHERRGRTAVLVAVDGELCAMVAIADTVKPEAELAVHTLTSMGLEVVLMTGDNSKTARAIAAQVGIRKVFAEVLPSHKVAKVEQLQQAGK--------RVAMVGDGVNDSPALAMADVGIAIGTGTDVAIEAADVVLIRNDLLDVVASIDLSKKTVKRIRINFVFALIYNLVGIPIAAGVFMPIGLVLQPWMGSAAMAASSVSVVLSSLLLKCYNKPSAEKL 1416          

HSP 2 Score: 138.658 bits (348), Expect = 2.038e-32
Identity = 142/568 (25.00%), Postives = 251/568 (44.19%), Query Frame = 1
Query:   97 LGSARMKVDGMTCMSCVRNIEENLMKFTGVCGIMVSLLHAEATVIFDADIATVEDISNKIDEMGFDVTVKSSEVSNVKDKV---VRSRIKFESDINKSVEKSIETSLSSKLLLVRFCQENNYADIWHYSSIRSTEILSVIQQSEIYGVLVLEQCPT-----------IRVI-VRVNGMTCQSCVDNIESTVGKKQGIISIKVFLEKSEAHALVDASLAGPDVEEMINDM---GFNSEM-----------ILEIFNDSCAGKPNNVSQKYEELKSNTIYPILSTTIV-IKALKSIFCIFKIENHMRALPGVDKCSVNLIEEIGMIDYDSGKWNVQKIREEIESL---GYLTELPKQNWN----STRQSSAVSLNEESRSKCYLRITGMTCSSCVNKVESHLLKVEGVKSVLVALLAMKCEIIYDSAYVMPFQLSNRVKELGFNA----------------------------------EVIENGNEGIGIVN---VLIRGMTCSSCVNHIENHISKIKGIASINVSLSTSKGKVEYFISECGPRDVIDAINDMGFDASLCDHLESNHAA 1578
            L S  + V+GMTC SCV+ IE+ +   +GV  I VSL    ATVIFD    + E +++ I++MGF+     S+V+N          +R+   +  +   ++   T L+ +L  V   QE+        + I +  ++S  +  E    LV +   T           + V+ +R++GM C SC   IE  +GK +G+  IKV LE  EA  L    L    VE+++N +   GF + +           +  + N S    P +  +K       +      TT++ +  +    C+  I++++  + GV    V+L +   +I ++     V  ++  IE+L    + T+L  Q+       +  S      +   S   + I GMTC+SCV  +E  + + +GV+S  V+L   +    +D     P +L   ++E+GF+A                                  E+  +   G+   +   + I GMTC+SCV +IE ++    GI S+ V+L  SK +V Y  +   P  + + I ++GF AS+ ++ + +  A
Sbjct:    8 LCSVTLTVEGMTCGSCVQTIEQQIGGLSGVIHIEVSLEQKNATVIFDPASHSPESLADAIEDMGFE-----SDVTNASPTTPVQTETRVYPTTGCSAEAQRQAHTQLA-QLKGVVETQESIEGKGLAVTFIPT--VVSPERVREAVSCLVPQPASTSERSTGRGSGNVEVVKMRIDGMVCLSCTTTIEGKIGKLKGVEKIKVGLESQEATVLYLPYLI--TVEDIVNQIGVAGFKASVKSKPRQLQLSSVERLLNASQLSSPTSPEEKTSTQALESTTTTTITTLINVSGMHCNSCVVNIQDNIGKVRGVSSVQVSLEKRQAVIQHNPSIVTVAALQRAIEALPPGKFKTQLDGQDATLPSSLSELSLLQLSEQPLASTVQIHIEGMTCNSCVQSIEGTISQRKGVRSAQVSLANHQGTFEFDPLLTAPEELRAAIEEMGFDAFLPETNSLIPVKSPPSIRSSPSSPALSTIKEKEKELESDTEAGLNTHSKCFIQIGGMTCASCVANIERNLKNEHGIHSVLVALMASKAEVRYNPAVMDPLKIAECIRELGFTASVMENYDGSDGA 565          

HSP 3 Score: 78.9518 bits (193), Expect = 3.901e-14
Identity = 76/343 (22.16%), Postives = 143/343 (41.69%), Query Frame = 1
Query:  103 SARMKVDGMTCMSCVRNIEENLMKFTGVCGIMVSLLHAEATVIFDADIATVEDISNKIDEMGFDVTV-KSSEVSNVKDKVVRSRIKFESDIN--KSVEKSIETSLSSKLLLVRFCQENNYADIWHYSSIRSTEILSVIQQSEIYGVLVLEQCPTIRVIVRVNGMTCQSCVDNIESTVGKKQGIISIKVFLEKSEAHALVDASLAGP-DVEEMINDMGFNSEMILEIFNDSCAGKPNNVSQKYEELKSNTIYPILSTTIVIKALKSIFCIFKIENHMRALPGVDKCSVNLIEEIGMIDYDSGKWNVQKIREEIESLGYLTELPKQNWNSTRQSSAVSLNEESRS 1119
            + ++ ++GMTC SCV++IE  + +  GV    VSL + + T  FD  +   E++   I+EMGFD  + +++ +  VK             ++  K  EK +E+   + L        N ++  +                                  +++ GMTC SCV NIE  +  + GI S+ V L  S+A    + ++  P  + E I ++GF +  ++E ++ S                        +  +VI+ +    C+ KIE+ +    G+   SV L      + YD      + I   IE+LG+   L K++ + +    ++ + +  +S
Sbjct:  376 TVQIHIEGMTCNSCVQSIEGTISQRKGVRSAQVSLANHQGTFEFDPLLTAPEELRAAIEEMGFDAFLPETNSLIPVKSPPSIRSSPSSPALSTIKEKEKELESDTEAGL--------NTHSKCF----------------------------------IQIGGMTCASCVANIERNLKNEHGIHSVLVALMASKAEVRYNPAVMDPLKIAECIRELGFTAS-VMENYDGSDG----------------------ALELVIRGMTCASCVHKIESSLMKQKGIVYASVALATNKAHVKYDPEVTGPRDIIRLIENLGFEALLVKKDRSGSHLDHSIEIQQWKKS 653          

HSP 4 Score: 53.9138 bits (128), Expect = 1.565e-6
Identity = 26/72 (36.11%), Postives = 38/72 (52.78%), Query Frame = 1
Query: 1339 GIGIVNVLIRGMTCSSCVNHIENHISKIKGIASINVSLSTSKGKVEYFISECGPRDVIDAINDMGFDASLCD 1554
            G+  V + + GMTC SCV  IE  I  + G+  I VSL      V +  +   P  + DAI DMGF++ + +
Sbjct:    7 GLCSVTLTVEGMTCGSCVQTIEQQIGGLSGVIHIEVSLEQKNATVIFDPASHSPESLADAIEDMGFESDVTN 78          
BLAST of Copper-transporting ATPase 1 vs. Ensembl Cavefish
Match: atp7b (ATPase copper transporting beta [Source:ZFIN;Acc:ZDB-GENE-061220-5])

HSP 1 Score: 560.066 bits (1442), Expect = 2.015e-176
Identity = 321/602 (53.32%), Postives = 405/602 (67.28%), Query Frame = 1
Query: 2050 KGKTSEALTKLMSLQAVEATLYTPEN-----KERKIPINLVQRNDLIKILPGEKIPVDGKVVTGTSTCDESLITGESMPIEKTHGSDVIGGSINKSGMLIVKATHVGSDSALAQIVKLVEEAQTSKAPIQQLADRIAGMFVPSVLICAIITLIIWVIVGFSKPEILPKYVNELSVTEITWEHAFQLAITVLSIACPCSLGLXXXXXXXXXXXXXXXNGILIKGGEPLENIHKLNVIVFDKTGTITNGSPSVTRFLVLIGNGVREHIDKLLKILAAAESASEHPIGKAIITFSKARISNENLPEVLESSAVSGCGLGCKLNLDPKTEVTKFVKNLINIESPSEETNILGQXXXXXXXXXXXXTYKDVIFPVRQHMAWTSDLCQTVTVIIGNRNWMLRNGILVDDEVDELMSEDENLGRTVILMAIDNELIAMISVADQVKREAALAVYTLKKMNIEVYLMTGDNSKTATAIARQVGIHYVFAEVLPSHKVAKVQQLQNTNRSLTSKRKMKVAMVGDGINDSPALAQSDVGIAIGTGTDVAVEAADVVLIRNSLLDVIAAIQLSKATVKRIRQNFIAATLYNLLGIPIAAGVLMPIGIEMMPWM 3840
            + KTSEAL KLMSLQAV+AT+ T  +      E ++ + LVQR D++K+ PG K PVDGKV+ G+S  DESLITGE MP+ K  GS VI GSIN  G L+V+ATHVG+D+ L+QIV+LVEEAQTSKAPIQQLAD+++G FVP +++ ++ TL                Y   +  T++    AFQ +ITVLSIACPCSLGLATPTAVMVGTGVGA NGILIKGGEPLE  HK+  ++FDKTGTITNG P VTR LVL  +  R  + K+L ++  AE++SEHP+G      S   + +E L    +  AV GCG+ CK+     + + + ++N    E P                                          T +V+IGNR WM RN I V  +VDE MS  E  G+T IL+AID  L AM+++AD VK E+ALAV+TL +M I+V ++TGDN +TA AIA QVGI  VFAEVLPSHKVAKVQ+LQ         + +KVAMVGDG+NDSPALA++D+GIAIGTGTDVA+EAADVVLIRN LLDV+A+I+LSK TV+RIR NF+ A +YNLLGIPIAAGV MP+G+ + PWM
Sbjct:  647 QSKTSEALAKLMSLQAVDATIVTLGHDNSIISEEQVSVQLVQRGDVVKVAPGGKFPVDGKVIEGSSMADESLITGEPMPVRKKPGSCVIAGSINAHGALLVEATHVGADTTLSQIVRLVEEAQTSKAPIQQLADKLSGYFVPFIVVVSVATL---------------GYDTNIPRTDVIVRFAFQASITVLSIACPCSLGLATPTAVMVGTGVGAQNGILIKGGEPLEMAHKIKAVMFDKTGTITNGVPRVTRVLVLW-DQARLPLRKVLAVVGTAEASSEHPLGNG----SCQTLQSELLGHCHDFQAVPGCGISCKV-----SNIEELLQNSSEAEGPP-----------------------------------------TYSVLIGNRQWMQRNAIQVTADVDEAMSSHETKGQTAILVAIDGVLCAMLAIADTVKEESALAVHTLSRMGIDVLMITGDNRRTAKAIATQVGIRKVFAEVLPSHKVAKVQELQ--------AKGLKVAMVGDGVNDSPALARADLGIAIGTGTDVAIEAADVVLIRNDLLDVVASIELSKKTVQRIRINFMFALIYNLLGIPIAAGVFMPVGLVLQPWM 1174          

HSP 2 Score: 215.312 bits (547), Expect = 3.555e-56
Identity = 179/612 (29.25%), Postives = 289/612 (47.22%), Query Frame = 1
Query:   88 RMKLGSARMKVDGMTCMSCVRNIEENLMKFTGVCGIMVSLLHAEATVIFDADIATVEDISNKIDEMGFDVTVKSSEVSNVKDKV-------VRSRIKFESDINKSVEKSIETSLSSKLLL--VRFCQENNYADIWHYSSIRSTEILSVIQQSEIYG--VLVLEQCPTI-------------------RVIVRVNGMTCQSCVDNIESTVGKKQGIISIKVFLEKSEAHALVDASL-AGPDVEEMINDMGFNSEMILEIFNDSCAGKPNNVSQKYEELKSNTIYPILSTTIVIKALKSIFCIFKIENHMRALPGVDKCSVNLIEEIGMIDYDSGKWNVQKIREEIESLGYLTELPKQNWNSTRQSSAVSLNEESRSKCYLRITGMTCSSCVNKVESHLLKVEGV--KSVLVALLAMKCEIIYDSAYVMPFQLSNRVKELGFNAEVIENGNEGIGIVNVLIRGMTCSSCVNHIENHISKIKGIASINVSLSTSKGKVEYFISECGPRDVIDAINDMGFDASL--CDHLESNHAAADHINQMIKQWRSSFFFSLICGIPXXXXXXXXXXXXXXXXHTIIHENGSNRTIMKSTVPMVCSGLSADNLILFVLATPVQ 1818
            R++    R+ V+GMTC SCVR IE  +    GV GI VSL   EA + F+ +    +++   I+EMGF+  VK   V ++  +        +  R+  E     S  K+I  +LS  L +  V    E+   D+ +  S+ + + +  + +S   G   + L +  +                    +V + + GMTC SCV +IE  + +K G+ SI V+L++ +     D+SL    ++ + I DMGF + +                  K   + S+T +             SIFC+  +  +                          K  + ++  +++S      LP   W    Q S + L    +  C++ +TGMTC+SCV+ +E  LLK +GV  KSVLVAL+A K EI YD   + P Q+   +  LGF A ++E G    G++++ + GMTC+SCV++IE+ + + KGI    VSL+TSK  V++     G RD+I  +  +GF ASL   D L  N+       + I+QW+ SF  SL+CGIP   + +         +H+   E+G +    ++ +P    GLS  NL+ F+L TPVQ
Sbjct:  115 RLEESLVRISVEGMTCHSCVRTIEGRIGALQGVLGIQVSLSEKEAVIWFNNETVKPDELRKHIEEMGFEAFVKDPLVPHLATQAGPHTPDWLEVRLGVEGMHCGSCVKNITENLSGMLGVQSVLVYLESKTLDLKYDPSLVTLDTVKGVLESLPPGNFKVTLPESGSFHKPRTNGSIRSQNSVESLQKVTIGIKGMTCNSCVQSIEGLISQKHGVHSITVYLKEEKGVITFDSSLTTSTELRDAIEDMGFEAFL------------------KQGRVCSHTFFSY-----------SIFCLLILSVYF-------------------------KKEMDRLNSKVDS-----NLP---W----QRSILHLAPFQK--CFVCVTGMTCASCVSNIERTLLKHKGVWIKSVLVALMAGKAEIKYDPEDLDPAQIVKLISGLGFGASLVEEGAINDGVLDLSVTGMTCASCVHNIESKLCRSKGILEATVSLATSKAHVKFDPDVVGVRDIIRIVEGLGFGASLIKSDDLRKNNDLGHQ--EEIRQWKHSFLISLVCGIP--VMGLMIYMMVMDSQHS---EHGGSMPEEQNILP----GLSLLNLVFFLLCTPVQ 647          

HSP 3 Score: 89.7373 bits (221), Expect = 1.790e-17
Identity = 95/362 (26.24%), Postives = 159/362 (43.92%), Query Frame = 1
Query:  559 RVIVRVNGMTCQSCVDNIESTVGKKQGIISIKVFLEKSEAHALVD---ASLAGPDVEEMINDMGFNSEMILEIFNDSCAGKPNNVSQKYEELKSNTIYPILSTTIVIKALKSIFCIFKIENHMRALPGVDKCSVNLIEEIGMIDYDSGKWNVQKIREEIESLGY--LTELPKQNWNSTRQSSAVSLNEESRSKCYLRITGMTCSSCVNKVESHLLKVEGVKSVLVALLAMKCEIIYDSAYVM------------PFQLSNRVKELGFNAEVIENGN-------EGIGIVNVLIRGMTCSSCVNHIENHISKIKGIASINVSLSTSKGKVEYFISECGPRDVIDAINDMGFDASL-----CDH 1557
            R+ + ++G T   CV  ++S +    G+ ++ V  +     A +D   +++   ++ + I  MG+    + E+ N   AG       + EE             I ++ +    C+  IE  + AL GV    V+L E+  +I +++      ++R+ IE +G+    + P     +T+         E R    L + GM C SCV  +  +L  + GV+SVLV L +   ++ YD + V             P      + E G   +   NG+       E +  V + I+GMTC+SCV  IE  IS+  G+ SI V L   KG + +  S     ++ DAI DMGF+A L     C H
Sbjct:   35 RLSLLISGPTSPDCVQGLQSWLSALSGVTAVSV-PQSGSGLAWIDFHPSTVTTREILQEIQGMGYG---VNEVSN---AGVSQPALPRLEESL---------VRISVEGMTCHSCVRTIEGRIGALQGVLGIQVSLSEKEAVIWFNNETVKPDELRKHIEEMGFEAFVKDPLVPHLATQAGPHTPDWLEVR----LGVEGMHCGSCVKNITENLSGMLGVQSVLVYLESKTLDLKYDPSLVTLDTVKGVLESLPPGNFKVTLPESGSFHKPRTNGSIRSQNSVESLQKVTIGIKGMTCNSCVQSIEGLISQKHGVHSITVYLKEEKGVITFDSSLTTSTELRDAIEDMGFEAFLKQGRVCSH 376          

HSP 4 Score: 60.4622 bits (145), Expect = 1.485e-8
Identity = 50/192 (26.04%), Postives = 83/192 (43.23%), Query Frame = 1
Query: 1051 LPKQNWNSTRQS-----------SAVSLNEESRSKCYLRITGMTCSSCVNKVESHLLKVEGVKSVLVALLAMKCEII-YDSAYVMPFQLSNRVKELGFNAEVIENGNEGIG----------IVNVLIRGMTCSSCVNHIENHISKIKGIASINVSLSTSKGKVEYFISECGPRDVIDAINDMGFDASLCDHL 1560
            +P + W S +             S +  N    S+  L I+G T   CV  ++S L  + GV +V V         I +  + V   ++   ++ +G+   V E  N G+           +V + + GMTC SCV  IE  I  ++G+  I VSLS  +  + +      P ++   I +MGF+A + D L
Sbjct:    1 VPSEAWASKKHGFNNLAYEPGSLSDLRPNSGHPSRLSLLISGPTSPDCVQGLQSWLSALSGVTAVSVPQSGSGLAWIDFHPSTVTTREILQEIQGMGYG--VNEVSNAGVSQPALPRLEESLVRISVEGMTCHSCVRTIEGRIGALQGVLGIQVSLSEKEAVIWFNNETVKPDELRKHIEEMGFEAFVKDPL 190          
BLAST of Copper-transporting ATPase 1 vs. Ensembl Cavefish
Match: ENSAMXT00000010500.2 (pep primary_assembly:Astyanax_mexicanus-2.0:6:36296634:36328247:1 gene:ENSAMXG00000010004.2 transcript:ENSAMXT00000010500.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 84.7297 bits (208), Expect = 5.899e-16
Identity = 52/178 (29.21%), Postives = 86/178 (48.31%), Query Frame = 1
Query: 3307 DNELIAMISVADQVKREAALAVYTLKKMNIEVYLMTGDNSKTATAIARQVGIH-------------------------------YVFAEVLPSHKVAKVQQLQNTNRSLTSKRKMKVAMVGDGINDSPALAQSDVGIAIGTGTDVAVEAADVVLIRNSLLDVIAAIQLSKATVKRIRQ 3747
            D   +  + + D  + E A ++   ++  I V ++TGDN  TA AI R++GI                                  FA V PSHK   V+ LQ  +           AM GDG+ND+PAL ++++GIA+G+GT VA  A+++VL  ++   ++AA++  +A    ++Q
Sbjct:  582 DLTFVGCVGMLDPPRTEVAASIKLCRQAGIRVIMITGDNKGTAVAICRRIGIFSEEDDVHRMAFTGREFDDLSPHSQREAVTNARCFARVEPSHKSKIVEFLQGFDEI--------TAMTGDGVNDAPALKKAEIGIAMGSGTAVAKTASEMVLADDNFSSIVAAVEEGRAIYNNMKQ 751          
BLAST of Copper-transporting ATPase 1 vs. Ensembl Cavefish
Match: ENSAMXT00000056792.1 (sarcoplasmic/endoplasmic reticulum calcium ATPase 2 [Source:NCBI gene;Acc:103040450])

HSP 1 Score: 83.9593 bits (206), Expect = 9.129e-16
Identity = 52/178 (29.21%), Postives = 86/178 (48.31%), Query Frame = 1
Query: 3307 DNELIAMISVADQVKREAALAVYTLKKMNIEVYLMTGDNSKTATAIARQVGIH-------------------------------YVFAEVLPSHKVAKVQQLQNTNRSLTSKRKMKVAMVGDGINDSPALAQSDVGIAIGTGTDVAVEAADVVLIRNSLLDVIAAIQLSKATVKRIRQ 3747
            D   +  + + D  + E A ++   +   I V ++TGDN  TA AI R++GI                                  FA V PSHK   V+ LQ+ +           AM GDG+ND+PAL ++++GIA+G+GT VA  A+++VL  ++   ++AA++  +A    ++Q
Sbjct:  588 DLTFVGCVGMLDPPRAEVAASMKLCRLAGIRVIMITGDNKGTAVAICRRIGIFGENDDVSSMAFTGREFDDLSPATQREAVLTARCFARVEPSHKSKIVEYLQSYDEI--------TAMTGDGVNDAPALKKAEIGIAMGSGTAVAKTASEMVLADDNFATIVAAVEEGRAIYNNMKQ 757          
BLAST of Copper-transporting ATPase 1 vs. Ensembl Cavefish
Match: ENSAMXT00000016753.2 (sarcoplasmic/endoplasmic reticulum calcium ATPase 2 [Source:NCBI gene;Acc:103040450])

HSP 1 Score: 83.9593 bits (206), Expect = 9.415e-16
Identity = 52/178 (29.21%), Postives = 86/178 (48.31%), Query Frame = 1
Query: 3307 DNELIAMISVADQVKREAALAVYTLKKMNIEVYLMTGDNSKTATAIARQVGIH-------------------------------YVFAEVLPSHKVAKVQQLQNTNRSLTSKRKMKVAMVGDGINDSPALAQSDVGIAIGTGTDVAVEAADVVLIRNSLLDVIAAIQLSKATVKRIRQ 3747
            D   +  + + D  + E A ++   +   I V ++TGDN  TA AI R++GI                                  FA V PSHK   V+ LQ+ +           AM GDG+ND+PAL ++++GIA+G+GT VA  A+++VL  ++   ++AA++  +A    ++Q
Sbjct:  582 DLTFVGCVGMLDPPRAEVAASMKLCRLAGIRVIMITGDNKGTAVAICRRIGIFGENDDVSSMAFTGREFDDLSPATQREAVLTARCFARVEPSHKSKIVEYLQSYDEI--------TAMTGDGVNDAPALKKAEIGIAMGSGTAVAKTASEMVLADDNFATIVAAVEEGRAIYNNMKQ 751          
BLAST of Copper-transporting ATPase 1 vs. Ensembl Sea Lamprey
Match: atp7b (ATPase copper transporting beta [Source:ZFIN;Acc:ZDB-GENE-061220-5])

HSP 1 Score: 668.692 bits (1724), Expect = 0.000e+0
Identity = 383/765 (50.07%), Postives = 514/765 (67.19%), Query Frame = 1
Query: 1528 MGFDASLCDHLESNHAAADHINQMIKQWRSSFFFSLICGIPXXXXXXXXXXXXXXXXHTIIHENGSNRTIMKSTVPMVCSGLSADNLILFVLATPVQFYGARYFYIQAYLSLKHKTTNMDVLVVMATXXXXXXXXXXXXXXMAFRRNTSPKTFFETSPMLIVFLSLGRWLEHIAKGKTSEALTKLMSLQAVEATLYT--PENK---ERKIPINLVQRNDLIKILPGEKIPVDGKVVTGTSTCDESLITGESMPIEKTHGSDVIGGSINKSGMLIVKATHVGSDSALAQIVKLVEEAQTSKAPIQQLADRIAGMFVPSVLICAIITLIIWVIVGFSKPEILPKYVNELSVT----EITWEHAFQLAITVLSIACPCSLGLXXXXXXXXXXXXXXXNGILIKGGEPLENIHKLNVIVFDKTGTITNGSPSVTRFLVLIGNGVREHIDKLLKILAAAESASEHPIGKAIITFSKARISNENLPEVLESSAVSGCGLGCKL-NLDPKTEVTKFVKNLINIESPSEETNILGQXXXXXXXXXXXXTYKDVIFPVRQHMAWTSDLCQTVTVIIGNRNWMLRNGILVDDEVDELMSEDENLGRTVILMAIDNELIAMISVADQVKREAALAVYTLKKMNIEVYLMTGDNSKTATAIARQVGIHYVFAEVLPSHKVAKVQQLQNTNRSLTSKRKMKVAMVGDGINDSPALAQSDVGIAIGTGTDVAVEAADVVLIRNSLLDVIAAIQLSKATVKRIRQNFIAATLYNLLGIPI 3792
            MG+ A+L        +  +H ++ I+QWR++F  +L+ GIP M +M++ +      KH  +  +            MV  GLS  NL+ F L TPVQF G R+FY +AY S+K++  NMDVL+V+ATSI+Y+YSV++++++MA R   SP TFF+T PML VF++LGRWLEH+AKGKTSEAL KLMSLQA EATL T  P+N    E ++ + L+QR D ++++PG + PVDG+V+ GTS  DES+ITGE MP+ K  GS VI GSIN+ G L+V+ATHVG+D+ LAQIV+LVEEAQTSKAPIQQLADR++G FVP+V++ + +TL+ W++VGF+   ++ KY  +   +    E+    AFQ AITVLSIACPC+LGLATPTAVMVGTGVGA NGILIKGGEPLE  HK+  +VFDKTGT+T+G P V RF  L GN  R    +L  I+  AE++SEHP+G AI    K  +S E L       AV G G+ C++ N+D         +      SPS   N                +   +I    +  A   +L Q   V+IGNR WM R+G+ V   V   M++ E  G T +L+A+D +L  M+++AD VK EAAL V TL  M + V L+TGDN +TA AIA QVG+   +AEVLP+ KV +V++LQ        ++ ++VAMVGDG+NDSPALAQ+DVGIAIG+GTDVA+ AAD+VLIR++LLDV+++I+LSK TV RIR NFI A +YNLLG+PI
Sbjct:    3 MGYTAALVKQECRGTSHLEHTDE-IRQWRNAFLLNLLFGIPVMALMVYMIVMDSQKKHNYLMNH------------MVLPGLSTINLVFFALCTPVQFVGGRHFYARAYKSVKYRAANMDVLIVLATSIAYVYSVVILLVAMAERAPRSPLTFFDTPPMLFVFITLGRWLEHLAKGKTSEALAKLMSLQAAEATLVTLGPDNSLVSEEQVEVELLQRGDALRVVPGARFPVDGRVIAGTSMADESIITGEVMPVSKGPGSLVIAGSINQMGSLLVEATHVGADTTLAQIVRLVEEAQTSKAPIQQLADRLSGYFVPTVVLLSTLTLVTWIVVGFADFAVVQKYFPDFDPSLPHGEVVLRFAFQAAITVLSIACPCALGLATPTAVMVGTGVGAQNGILIKGGEPLEMAHKIKAVVFDKTGTLTHGMPRVLRF-ALFGNRARVSPRRLTAIVGTAEASSEHPLGVAITKHCKQELSTERLGSCQAFQAVPGFGISCEVSNVDAALNAVDEDEENEKNASPSAPAN---------------RSAPHIIMDGDESTATRHEL-QRYAVLIGNREWMGRSGVEVAPAVHAAMAQHEEQGHTAVLVAVDGQLCGMLAIADAVKEEAALVVRTLTAMGLHVILLTGDNRRTARAIAAQVGVRTAYAEVLPADKVREVERLQ--------RQGLRVAMVGDGVNDSPALAQADVGIAIGSGTDVAIAAADIVLIRSNLLDVVSSIELSKKTVLRIRINFIFALVYNLLGLPI 729          
BLAST of Copper-transporting ATPase 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002230.1 (pep scaffold:Pmarinus_7.0:GL493059:69:4752:-1 gene:ENSPMAG00000002031.1 transcript:ENSPMAT00000002230.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 216.468 bits (550), Expect = 4.114e-65
Identity = 111/167 (66.47%), Postives = 133/167 (79.64%), Query Frame = 1
Query: 3301 AIDNELIAMISVADQVKREAALAVYTLKKMNIEVYLMTGDNSKTATAIARQVGIHYVFAEVLPSHKVAKVQQLQNTNRSLTSKRKMKVAMVGDGINDSPALAQSDVGIAIGTGTDVAVEAADVVLIRNSLLDVIAAIQLSKATVKRIRQNFIAATLYNLLGIPIAAG 3801
            A   +L  M+++AD VK EAALAV TL  M ++V LMTGDN KTA AIA QVGI  VFAEVLPSHKVAKV+QLQ + ++        VAMVGDG+NDSPALA+SDVGIA+GTGTDVA+EAAD+VLIRN LLDV+A+I LSK TV+RI  NF+ A +YN++GIPIAAG
Sbjct:    1 ACSGKLCGMLAIADTVKPEAALAVRTLADMGLQVVLMTGDNRKTAQAIAAQVGIRRVFAEVLPSHKVAKVEQLQESGQT--------VAMVGDGVNDSPALARSDVGIALGTGTDVAIEAADIVLIRNDLLDVVASIHLSKKTVRRIHINFVFALIYNVVGIPIAAG 159          
BLAST of Copper-transporting ATPase 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010051.1 (pep scaffold:Pmarinus_7.0:GL484878:2955:5956:-1 gene:ENSPMAG00000009092.1 transcript:ENSPMAT00000010051.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 105.531 bits (262), Expect = 1.008e-23
Identity = 81/299 (27.09%), Postives = 137/299 (45.82%), Query Frame = 1
Query:  796 NNVSQKYEE------LKSNTIYPILSTTIV-IKALKSIFCIFKIENHMRALPGVDKCSVNLIEEIGMIDYDSGKWNVQKIREEIESLGYLTELPKQNWNSTR--------QSSAVSLNEESRSKCYLRITGMTCSSCVNKVESHLLKVEGVKSVLVALLAMKCEIIYDSAYVMPFQLSNRVKEL---------GFNAEVIENGN---------------EGIGIVN---VLIR--GMTCSSCVNHIENHISKIKGIASINVSLSTSKGKVEYFISECGPRDVIDAINDMGFDASLCDHL 1560
            N + QK E+      L++    P L+T +V ++ +K   C  ++E+ +  LPGV+    +L      I Y S   N  ++R +IE+LG+   LPK      +        QSSA        +   L + GM C SCV+ +ESH+ ++  V S+ V+L   K +I Y+   + P  L   ++ L         G  +  + + N               E +   +   V++R  GMTC+SCV ++E  ++K  G+ S++VSL      V Y      P  +  A+ DMG+ A+L  ++
Sbjct:  112 NVICQKIEDFGYRATLQAGRRQPGLATLVVTVEGMKRQTCARRVESALAKLPGVEHVEASLASREVRIGYKSHLINASELRRQIEALGFAALLPKSPLKREKSRALPADPQSSAPPSEAIESATITLGVEGMHCKSCVDNIESHVGELAAVYSIEVSLSESKADIRYNPTLLGPADLKQAIESLPPGNLSVSFGLRSTDLPSPNVYQSLLSRCAKGAVEEPVPRADNPTVVLRVTGMTCASCVQNVEGGLAKRAGVRSVSVSLGDGTATVSYDRGVTSPEILQGAVEDMGYGATLTGNI 410          

HSP 2 Score: 93.2041 bits (230), Expect = 9.079e-20
Identity = 93/349 (26.65%), Postives = 146/349 (41.83%), Query Frame = 1
Query:  562 VIVRVNGMTCQSCVDNIESTVGKKQGIISIKVFLEKSEAH-----ALVDASLAGPDVEEMINDMGFNSEMILEIF----NDSCAGKPNNVSQKYEELKSNTIYPILSTTIVIKALKSIFCIFKIENHMRALPGVDKCSVNLIEEIGMIDYDSGKWNVQKIREEIESL--GYL--------TELPKQN-WNSTRQSSAVSLNEESRSKC-----YLRITGMTCSSCVNKVESHLLKVEGVKSVLVALLAMKCEIIYDSAYVMPFQLSNRVKELGFNAEVIENGNEGIGIVNV---------------------------------LIR--GMTCSSCVNHIENHISKIKG 1428
            ++V V GM  Q+C   +ES + K  G+  ++  L   E        L++AS    ++   I  +GF + +         + +    P + +   E ++S TI      T+ ++ +    C+  IE+H+  L  V    V+L E    I Y+        +++ IESL  G L        T+LP  N + S     A    EE   +       LR+TGMTC+SCV  VE  L K  GV+SV V+L      + YD     P  L   V+++G+ A +   GN  + +  V                                 L+R  GMTC+SCV +IEN++ K  G
Sbjct:  139 LVVTVEGMKRQTCARRVESALAKLPGVEHVEASLASREVRIGYKSHLINAS----ELRRQIEALGFAALLPKSPLKREKSRALPADPQSSAPPSEAIESATI------TLGVEGMHCKSCVDNIESHVGELAAVYSIEVSLSESKADIRYNPTLLGPADLKQAIESLPPGNLSVSFGLRSTDLPSPNVYQSLLSRCAKGAVEEPVPRADNPTVVLRVTGMTCASCVQNVEGGLAKRAGVRSVSVSLGDGTATVSYDRGVTSPEILQGAVEDMGYGATL--TGNIPLSLSPVTFPPSLTVNLDLYVELPPKPSGEREDAREPEKCLLRVTGMTCASCVANIENNLKKKDG 475          

HSP 3 Score: 65.4698 bits (158), Expect = 4.880e-11
Identity = 48/176 (27.27%), Postives = 75/176 (42.61%), Query Frame = 1
Query:  112 MKVDGMTCMSCVRNIEENLMKFTGVCGIMVSLLHAEATVIFDADIATVEDISNKIDEMGFDVTVKSSEVSNVKDKVVRSRIKFESDINKSVEKSIETSLSSKLLLVRFCQENNYADIWHYSSIRSTEILSVIQQSEIYGVLVLEQCPTIRVIVRVNGMTCQSCVDNIESTVGKKQG 639
            ++V GMTC SCV+N+E  L K  GV  + VSL    ATV +D  + + E +   +++MG+  T+      N+   +  S + F   +  +++  +E                                L      E       E+C     ++RV GMTC SCV NIE+ + KK G
Sbjct:  343 LRVTGMTCASCVQNVEGGLAKRAGVRSVSVSLGDGTATVSYDRGVTSPEILQGAVEDMGYGATL----TGNIPLSL--SPVTFPPSLTVNLDLYVE--------------------------------LPPKPSGEREDAREPEKC-----LLRVTGMTCASCVANIENNLKKKDG 475          
BLAST of Copper-transporting ATPase 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010373.1 (pep scaffold:Pmarinus_7.0:GL481096:3909:20014:1 gene:ENSPMAG00000009373.1 transcript:ENSPMAT00000010373.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 76.2554 bits (186), Expect = 3.646e-14
Identity = 51/181 (28.18%), Postives = 86/181 (47.51%), Query Frame = 1
Query: 3304 IDNELIAMISVA--DQVKREAALAVYTLKKMNIEVYLMTGDNSKTATAIARQVGIH-------------------------------YVFAEVLPSHKVAKVQQLQNTNRSLTSKRKMKVAMVGDGINDSPALAQSDVGIAIGTGTDVAVEAADVVLIRNSLLDVIAAIQLSKATVKRIRQ 3747
            +D   +  + V   D  ++E + ++   ++  I V    GDN  TA AI R++GI                                  FA V PSHK   V+ LQ+ +           AM GDG+ND+PAL ++++GIA+G+GT VA  A+++VL  ++   ++AA++  +A    ++Q
Sbjct:  437 VDLTFVGCVGVGMLDPPRKEVSSSIILCREAGIRV---IGDNKGTAVAICRRIGIFGEDEDVKDKAYTGREFDDLPLEEQRLACQRARCFARVEPSHKSKIVEFLQSCDEI--------TAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASEMVLADDNFSSIVAAVEEGRAIYNNMKQ 606          
BLAST of Copper-transporting ATPase 1 vs. Ensembl Sea Lamprey
Match: atp2c1 (ATPase secretory pathway Ca2+ transporting 1 [Source:ZFIN;Acc:ZDB-GENE-060503-615])

HSP 1 Score: 71.2478 bits (173), Expect = 6.366e-13
Identity = 56/193 (29.02%), Postives = 90/193 (46.63%), Query Frame = 1
Query: 3280 GRTVILMAIDNEL-----IAMISVADQVKREAALAVYTLKKMNIEVYLMTGDNSKTATAIARQVGIHY----------------------------VFAEVLPSHKVAKVQQLQNTNRSLTSKRKMKVAMVGDGINDSPALAQSDVGIAIG-TGTDVAVEAADVVLIRNSLLDVIAAIQLSKATVKRIRQNFI 3756
            G  V+ MA   EL     + ++ + D  +     +V  L    + V ++TGD+ +TA AIA ++G+                              VF    P HK+  V+ LQ        K    V M GDG+ND+ AL  +D+G+A+G +GTDV  EAAD++L+ +    +++AI+  K     I+ NF+
Sbjct:   40 GLRVLAMASGPELGQLTFLGLVGIIDPPRPGVRKSVAILVSSGVSVKMVTGDSMETAVAIANRLGLSSNGGGAAISGEEAWGGRHPAAAFVVLQVSVFYRASPRHKLKIVKALQ--------KNGEVVGMTGDGVNDAVALRAADIGVAMGRSGTDVCKEAADMILVDDDFYTIMSAIEEGKGIFYNIK-NFV 223          
BLAST of Copper-transporting ATPase 1 vs. Ensembl Yeast
Match: CCC2 (Cu(+2)-transporting P-type ATPase; required for export of copper from the cytosol into an extracytosolic compartment; similar to human proteins involved in Menkes and Wilsons diseases; protein abundance increases in response to DNA replication stress; affects TBSV model (+)RNA virus replication by regulating copper metabolism; human homologs ATP7A and ATP7B both complement yeast null mutant [Source:SGD;Acc:S000002678])

HSP 1 Score: 426.402 bits (1095), Expect = 8.063e-130
Identity = 336/1018 (33.01%), Postives = 526/1018 (51.67%), Query Frame = 1
Query:  892 CIFKIENHMRALPGVDKCSVNLIEEIGMIDYDSGKWNVQKIREEIESLGYLTELPKQNWNSTRQSSAVSLNEESRSKCYLRITGMTCSSCVNKVESHLLKVEGVKSVLVALLAMKCEIIYDSAYVMPFQLSNRVKELGFNAEVIENGNEGIGIVNVLIRGMTCSSCVNHIENHISKIK---------GIASINVSLSTSKGKVEYFISECGPRDVIDAINDMGFDASLCDHLESNH-----AAADHINQMIKQWRSSFFFSLICGIPXXXXXXXXXXXXXXXXHTIIHENGSNRTIMKSTVPMVCSGLSADNLILFVLATPVQFYGARYFYIQAYLSLKHKTTNMDVLVVMATXXXXXXXXXXXXXXMAFRRNTS--PKTFFETSPMLIVFLSLGRWLEHIAKGKTSEALTKLMSLQAVEATLYT--PENKERKIPINLVQRNDLIKILPGEKIPVDGKVVTGTSTCDESLITGESMPIEKTHGSDVIGGSINKSGMLIVKATHVGSDSALAQIVKLVEEAQTSKAPIQQLADRIAGMFVPSVLICAIITLIIW-VIVGFSKPEILPKYVNELSVTEITWEHAFQLAITVLSIACPCSLGLXXXXXXXXXXXXXXXNGILIKGGEPLENIHKLNVIVFDKTGTITNGSPSVTRFLV---LIGNGVREHIDKLLKILAAAESASEHPIGKAIITFSKARISNENLPE-VLESSAVSGCGLGCKLNLDPKTEVTKFVKNLINIESPSEETNILGQXXXXXXXXXXXXTYKDVIFPVRQHMAWTSDLCQTVTVIIGNRNWMLRNGI----LVDDEVDELMSEDENLGRTVILMAIDNELIAMISVADQVKREAALAVYTLKKMNIEVYLMTGDNSKTATAIARQVGIHY--VFAEVLPSHKVAKVQQLQNTNRSLTSKRKMKVAMVGDGINDSPALAQSDVGIAIGTGTDVAVEAADVVLI------RNSLLDVIAAIQLSKATVKRIRQNFIAATLYNLLGIPIAAGVLMPIGIEMMPWM 3840
            C   I   +RAL GV KC ++L+     + YD+ +     I+E IE  G+  E+ + +     + +A+S  E       L + GMTC SCV+ V   +  +EGV+SV+V+L+  +C +IY+ +          +++ GF++ +I +GN    +    +      +  +     +S +          G+ SI +S       ++Y  +E G RD++  +   G+  ++  +L++       +  D I    K    S   ++IC +              M+  TI+ +      I          GL   +++  +LA+ +QF    YFY  A+ SLKH +  MD LV ++T+ +Y +SV  +V +M    +T   P+  F+TS M+I ++S+G++LE +AK +TS AL+KL+ L     ++ +    N+ ++IPI L+Q ND+++I PG KIP DG +  G S  DESL+TGES+ + K  G  VI GS+N  G    + T VG ++ LA I+K+++EAQ SKAPIQ  AD +A +FVP +LI A++T  IW  I+  S     P      +     +    Q A +V+ +ACPC+LGLATPTA+MVGTGVGA NG+LIKGGE LE  + +   VFDKTGT+T G   V +FL     +GN V E  D++L  + A ES S+HP+ KAII +      N+ L   VLES  V G G+  K  ++  T                                                     D+C      IGN   +L + +     ++  VD+        G TV  ++++  +  +  + D+VK ++   V  L++   E Y++TGDN+  A  +AR+VGI +  V+++V P+ K   V+++Q+       +   KVA+VGDGIND+PALA SD+GIAI TGT++A+EAAD+V++       NSL  +  AI +S  T KRI+ N   A  YN+  IPIA GVL+P GI + P +
Sbjct:   16 CTNTINTQLRALKGVTKCDISLVTNECQVTYDN-EVTADSIKEIIEDCGFDCEILRDS-----EITAISTKEG-----LLSVQGMTCGSCVSTVTKQVEGIEGVESVVVSLVTEECHVIYEPSKTTLETAREMIEDCGFDSNIIMDGNGNADMTEKTVILKVTKAFEDESPLILSSVSERFQFLLDLGVKSIEISDDMHTLTIKYCCNELGIRDLLRHLERTGYKFTVFSNLDNTTQLRLLSKEDEIRFWKKNSIKSTLLAIICML--------LYMIVPMMWPTIVQDR-----IFPYKETSFVRGLFYRDILGVILASYIQFSVGFYFYKAAWASLKHGSGTMDTLVCVSTTCAYTFSVFSLVHNMFHPSSTGKLPRIVFDTSIMIISYISIGKYLETLAKSQTSTALSKLIQLTPSVCSIISDVERNETKEIPIELLQVNDIVEIKPGMKIPADGIITRGESEIDESLMTGESILVPKKTGFPVIAGSVNGPGHFYFRTTTVGEETKLANIIKVMKEAQLSKAPIQGYADYLASIFVPGILILAVLTFFIWCFILNISAN---PPVAFTANTKADNFFICLQTATSVVIVACPCALGLATPTAIMVGTGVGAQNGVLIKGGEVLEKFNSITTFVFDKTGTLTTGFMVVKKFLKDSNWVGN-VDE--DEVLACIKATESISDHPVSKAIIRYCDGLNCNKALNAVVLESEYVLGKGIVSKCQVNGNT----------------------------------------------------YDIC------IGNEALILEDALKKSGFINSNVDQ--------GNTVSYVSVNGHVFGLFEINDEVKHDSYATVQYLQRNGYETYMITGDNNSAAKRVAREVGISFENVYSDVSPTGKCDLVKKIQD------KEGNNKVAVVGDGINDAPALALSDLGIAISTGTEIAIEAADIVILCGNDLNTNSLRGLANAIDISLKTFKRIKLNLFWALCYNIFMIPIAMGVLIPWGITLPPML 931          

HSP 2 Score: 74.7146 bits (182), Expect = 8.441e-14
Identity = 43/147 (29.25%), Postives = 80/147 (54.42%), Query Frame = 1
Query: 1129 LRITGMTCSSCVNKVESHLLKVEGVKSVLVALLAMKCEIIYDSAYVMPFQLSNRVKELGFNAEVIENG-------NEGIGIVNVLIRGMTCSSCVNHIENHISKIKGIASINVSLSTSKGKVEYFISECGPRDVIDAINDMGFDASL 1548
            L + GMTCS+C N + + L  ++GV    ++L+  +C++ YD+  V    +   +++ GF+ E++ +         EG+    + ++GMTC SCV+ +   +  I+G+ S+ VSL T +  V Y  S+       + I D GFD+++
Sbjct:    6 LAVHGMTCSACTNTINTQLRALKGVTKCDISLVTNECQVTYDNE-VTADSIKEIIEDCGFDCEILRDSEITAISTKEGL----LSVQGMTCGSCVSTVTKQVEGIEGVESVVVSLVTEECHVIYEPSKTTLETAREMIEDCGFDSNI 147          

HSP 3 Score: 51.9878 bits (123), Expect = 7.452e-7
Identity = 40/161 (24.84%), Postives = 72/161 (44.72%), Query Frame = 1
Query:  559 RVIVRVNGMTCQSCVDNIESTVGKKQGIISIKVFLEKSEAHALVDASLAGPDVEEMINDMGFNSEMILEIFNDSCAGKPNNVSQKYEELKSNTIYPILSTTIVIKALKSIFCIFKIENHMRALPGVDKCSVNLIEEIGMIDYDSGKWNVQKIREEIESLGY 1041
             VI+ V+GMTC +C + I + +   +G+    + L  +E     D  +    ++E+I D GF+     EI  DS   +   +S K E L S            ++ +    C+  +   +  + GV+   V+L+ E   + Y+  K  ++  RE IE  G+
Sbjct:    3 EVILAVHGMTCSACTNTINTQLRALKGVTKCDISLVTNECQVTYDNEVTADSIKEIIEDCGFDC----EILRDS---EITAISTK-EGLLS------------VQGMTCGSCVSTVTKQVEGIEGVESVVVSLVTEECHVIYEPSKTTLETAREMIEDCGF 143          
BLAST of Copper-transporting ATPase 1 vs. Ensembl Yeast
Match: PCA1 (Cadmium transporting P-type ATPase; may also have a role in copper and iron homeostasis; stabilized by Cd binding, which prevents ubiquitination; S288C and other lab strains contain a G970R mutation which eliminates Cd transport function [Source:SGD;Acc:S000000499])

HSP 1 Score: 203.371 bits (516), Expect = 2.346e-53
Identity = 144/394 (36.55%), Postives = 229/394 (58.12%), Query Frame = 1
Query: 1795 FVLATPVQFYGARYFYIQAYLSL-KHKTTNMDVLVVMATXXXXXXXXXXXXXXMAFRRNTSPKTFFETSPMLIVFLSLGRWLEHIAKGKTSEALTKLMSLQAVEATLYTPENKERKIPINLVQRNDLIKILPGEKIPVDGKVVTGTSTCDESLITGESMPIEKTHGSDVIGGSINKSGMLIVKATHVGSDSALAQIVKLVEEAQTSKAPIQQLADRIAGMFVPSVLICAIITLIIWVIVGFSKPEILPKYVNELSVTEITWEHAFQLAITVLSIACPCSLGLXXXXXXXXXXXXXXXNGILIKGGEPLENIHKLNVIVFDKTGTITNGSPSVTRFLVLIGNGVREHIDKLLKILAAAESASEHPIGKAIITFSKAR-ISNENLPEVLESSAVSG 2970
             VLAT +QF  A  FY+ A  SL   +   MD+L+V++TS +YI+S++         R  S + FFETS +L+  + +GR++  +A+ +  ++++ + SLQA  A L     KE +I I L+Q  D+ K+LP  +IP DG V++G+S  DE+LITGESMP+ K   S V+ GS+N +G L VK + +  ++ ++ I  +V+EA+ +K  IQ +AD+IA  FVP+++   ++T  +W+ VG          V + S ++   + A   AITVL ++CPC +GLA P   ++ +GV A  G++ K  E +E  H  + +VFDKTGT+T G  +V    V    G R +   LL  L   E   +HP+  AI ++ K + +S +N   V  + AV+G
Sbjct:  595 MVLATIIQFVIAGPFYLNALKSLIFSRLIEMDLLIVLSTSAAYIFSIVSFGY-FVVGRPLSTEQFFETSSLLVTLIMVGRFVSELARHRAVKSIS-VRSLQASSAILVDKTGKETEINIRLLQYGDIFKVLPDSRIPTDGTVISGSSEVDEALITGESMPVPKKCQSIVVAGSVNGTGTLFVKLSKLPGNNTISTIATMVDEAKLTKPKIQNIADKIASYFVPTIIGITVVTFCVWIAVGIR--------VEKQSRSDAVIQ-AIIYAITVLIVSCPCVIGLAVPIVFVIASGVAAKRGVIFKSAESIEVAHNTSHVVFDKTGTLTEGKLTVVHETV---RGDRHNSQSLL--LGLTEGI-KHPVSMAIASYLKEKGVSAQN---VSNTKAVTG 968          

HSP 2 Score: 96.2857 bits (238), Expect = 2.599e-20
Identity = 57/213 (26.76%), Postives = 116/213 (54.46%), Query Frame = 1
Query: 3199 GNRNWMLRNGILVDDEVDELMSEDENLGRTVILMAIDNELIAMISVADQVKREAALAVYTLKKMNIEVYLMTGDNSKTATAIARQVGIHY--VFAEVLPSHKVAKVQQL---QNTNRSLTSKRKMKVAMVGDGINDSPALAQSDVGIAIGTGTDVAVEAADVVLIRNSLLDVIAAIQLSKATVKRIRQNFIAATLYNLLGIPIAAGVLMPIGI 3822
            GN  W+  N    D +V + + +    G +V   +++  + A+ ++ D ++ +A   +  L++  I +++++GD+     ++A ++GI    + +   P+ K   ++ +   +N + S  SKR + V   GDG ND+  L Q+ +G+ I  G++VA  AADVV+++  L +++  I +S+  + R++ NF+ +  YNL  I +AAG  +   I
Sbjct:  984 GNCRWLGHNN---DPDVRKALEQ----GYSVFCFSVNGSVTAVYALEDSLRADAVSTINLLRQRGISLHILSGDDDGAVRSMAARLGIESSNIRSHATPAEKSEYIKDIVEGRNCDSSSQSKRPV-VVFCGDGTNDAIGLTQATIGVHINEGSEVAKLAADVVMLKPKLNNILTMITVSQKAMFRVKLNFLWSFTYNLFAILLAAGAFVDFHI 1188          
BLAST of Copper-transporting ATPase 1 vs. Ensembl Yeast
Match: PMA2 (Plasma membrane H+-ATPase; isoform of Pma1p, involved in pumping protons out of the cell; regulator of cytoplasmic pH and plasma membrane potential [Source:SGD;Acc:S000005957])

HSP 1 Score: 93.2041 bits (230), Expect = 1.939e-19
Identity = 138/561 (24.60%), Postives = 243/561 (43.32%), Query Frame = 1
Query: 2137 KIPINLVQRNDLIKILPGEKIPVDGKVVTGTSTC----DESLITGESMPIEKTHGSDVIGGSINKSGMLIVKATHVGSDSALAQIVKLVEEAQTSKAPIQQLADRIAGMFVPSVLICAIITLIIWVIVGFSKPEILPKYVNELSVTEITWEHAFQLAITVLSIACPCSLGLXXXXXXXXXXXXXXXNGILIKGGEPLENIHKLNVIVFDKTGTITNGSPSVTRFLVLIGNGVREHIDKLLKILAAAE-----SASEHPIGKAIITFSKARISNENLPEVLESSAVSGCGLGCKLNLDPKTEVTKFVKNLINIESPSEETNILGQXXXXXXXXXXXXTYKDVIFPVRQHMAWTSDLCQTVTVII---------GNRNWMLRNGIL--VD---DEVDELMSEDENLGRTVILMAIDNELIAMISVADQVKREAALA--VYTLKKMNIEVYL-MTGDNSKTATAIARQVGIHYVFAEVLPSHKVAKVQQLQNTNRSLTSKRKMKVAMVGDGINDSPALAQSDVGIAIGTGTDVAVEAADVVLIRNSLLDVIAAIQLSKATVKRI 3741
            +IP N V   +++++  G   P DG++VT    C    D+S ITGES+  EK +G +V   S  K+G   +  T  G ++ + +   LV +A   +    ++ + I  + +  VL+ A + L++W    +       + V  +S+   T      L IT+  I  P  L     T + VG    A    +++    +E++  + ++  DKTGT+T    S+     +   GV      L   LAA+       A +    K++I + KA+       + L    V        L   P   V+K V  +  +ESP  E  +  +   + +   +    +D   P   H  + + + +  +            G  +W +  G++  +D   D+  + ++E  NLG  + ++  D      + +A +  R+  L   +Y  +++ +     M G  S+ A  +    G     AEV P HK   V+ LQN        R   VAM GDG+ND+P+L ++D GIA+   TD A  AAD+V +   L  +I A++ S+    R+
Sbjct:  219 EIPANEVVPGEILQLESGTIAPADGRIVT--EDCFLQIDQSAITGESLAAEKHYGDEVFSSSTVKTGEAFMVVTATGDNTFVGRAAALVGQASGVEGHFTEVLNGIGIILL--VLVIATL-LLVWTACFY-------RTVGIVSILRYT------LGITI--IGVPVGLPAVVTTTMAVGAAYLAKKQAIVQKLSAIESLAGVEILCSDKTGTLTKNKLSLHEPYTV--EGVSPDDLMLTACLAASRKKKGLDAIDKAFLKSLIEYPKAK-------DALTKYKV--------LEFHPFDPVSKKVTAV--VESPEGERIVCVKGAPLFVLKTVE---EDHPIPEDVHENYENKVAELASRGFRALGVARKRGEGHWEIL-GVMPCMDPPRDDTAQTINEARNLGLRIKMLTGD-----AVGIAKETCRQLGLGTNIYNAERLGLGGGGDMPG--SELADFVENADGF----AEVFPQHKYRVVEILQN--------RGYLVAMTGDGVNDAPSLKKADTGIAVEGATDAARSAADIVFLAPGLSAIIDALKTSRQIFHRM 717          
BLAST of Copper-transporting ATPase 1 vs. Ensembl Yeast
Match: PMR1 (High affinity Ca2+/Mn2+ P-type ATPase; required for Ca2+ and Mn2+ transport into Golgi; involved in Ca2+ dependent protein sorting, processing; D53A mutant (Mn2+ transporting) is rapamycin sensitive, Q783A mutant (Ca2+ transporting) is rapamycin resistant; Mn2+ transport into Golgi lumen required for rapamycin sensitivity; mutations in human homolog ATP2C1 cause acantholytic skin condition Hailey-Hailey disease; human ATP2C1 can complement yeast null mutant [Source:SGD;Acc:S000003135])

HSP 1 Score: 82.8037 bits (203), Expect = 2.880e-16
Identity = 57/184 (30.98%), Postives = 86/184 (46.74%), Query Frame = 1
Query: 3307 DNELIAMISVADQVKREAALAVYTLKKMNIEVYLMTGDNSKTATAIARQVGIHY-----------------------------VFAEVLPSHKVAKVQQLQNTNRSLTSKRKMKVAMVGDGINDSPALAQSDVGIAIGT-GTDVAVEAADVVLIRNSLLDVIAAIQLSKATVKRIRQNFIAATL 3768
            D     +I + D  +     A+  L +  + + ++TGD+  TA  IA+Q+GI                               +FA   P HK+  V+ L+        KR   VAM GDG+ND+PAL  SD+G+++G  GTDVA EA+D+VL  +    ++ AI+  K     I QNF+   L
Sbjct:  569 DLTFTGLIGMNDPPRPNVKFAIEQLLQGGVHIIMITGDSENTAVNIAKQIGIPVIDPKLSVLSGDKLDEMSDDQLANVIDHVNIFARATPEHKLNIVRALR--------KRGDVVAMTGDGVNDAPALKLSDIGVSMGRIGTDVAKEASDMVLTDDDFSTILTAIEEGKGIFNNI-QNFLTFQL 743          
BLAST of Copper-transporting ATPase 1 vs. Ensembl Yeast
Match: ENA2 (P-type ATPase sodium pump; involved in Na+ efflux to allow salt tolerance; likely not involved in Li+ efflux [Source:SGD;Acc:S000002446])

HSP 1 Score: 79.7221 bits (195), Expect = 2.622e-15
Identity = 61/207 (29.47%), Postives = 95/207 (45.89%), Query Frame = 1
Query: 3316 LIAMISVADQVKREAALAVYTLKKMNIEVYLMTGDNSKTATAIARQVGI------HY-------------------------------VFAEVLPSHKVAKVQQLQNTNRSLTSKRKMKVAMVGDGINDSPALAQSDVGIAIG-TGTDVAVEAADVVLIRNSLLDVIAAIQLSKATVKRIRQNFIAATLYNLLGIPIAAGVLMPIGI 3822
             + +I + D  + E A AV    +  I V+++TGD   TA AIA++VGI      HY                               V A   P  KV  ++ L         +RK   AM GDG+NDSP+L  ++VGIA+G  G+DV+ EA+D+VL  ++   ++ A++  +     I Q F+      LL   +A  + + IG+
Sbjct:  641 FLGLIGIYDPPRNETAGAVKKFHQAGINVHMLTGDFVGTAKAIAQEVGILPTNLYHYSQEIVDSMVMTGSQFDGLSEEEVDDLPVLPLVIARCSPQTKVRMIEALH--------RRKKFCAMTGDGVNDSPSLKMANVGIAMGINGSDVSKEASDIVLSDDNFASILNAVEEGRRMTDNI-QKFV----LQLLAENVAQALYLIIGL 834          
BLAST of Copper-transporting ATPase 1 vs. Ensembl Nematostella
Match: EDO47080 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RN63])

HSP 1 Score: 845.499 bits (2183), Expect = 0.000e+0
Identity = 503/1120 (44.91%), Postives = 696/1120 (62.14%), Query Frame = 1
Query:  574 VNGMTCQSCVDNIESTVGKKQGIISIKVFLEKSEAHALVDASLAGPD-VEEMINDMGFNSEMILEIFNDSCAGKPNNVSQKYEELKSNTIYPILSTTIVIKALKSIFCIFKIENHMRALPGVDKCSVNLIEEIGMIDYDSGKWNVQKIREEIESLGY----------LTELPKQ---NWN---STRQSSAVSLNEESRSKCYLRITGMTCSSCVNKVESHLLKVEGVKSVLVALLAMKCEIIYDSAYVMPFQLSNRVKELGFNAEVIENGNEGIGIVNVLIRGMTCSSCVNHIENHISKIKGIASINVSLSTSKGKVEYFISECGPRDVIDAINDMGFDASLCDHLESNHAAADHINQMIKQWRSSFFFSLICGIPXXXXXXXXXXXXXXXXHTIIHENGSNRTIMKSTVPMVCSGLSADNLILFVLATPVQFYGARYFYIQAYLSLKHKTTNMDVLVVMATXXXXXXXXXXXXXXMAFRRNTSPKTFFETSPMLIVFLSLGRWLEHIAKGKTSEALTKLMSLQAVEATLYTPE------NKERKIPINLVQRNDLIKILPGEKIPVDGKVVTGTSTCDESLITGESMPIEKTHGSDVIGGSINKSGMLIVKATHVGSDSALAQIVKLVEEAQTSKAPIQQLADRIAGMFVPSVLICAIITLIIWVIVGFSKPEILPKYVN--ELSVTEITWEHAFQLAITVLSIACPCSLGLXXXXXXXXXXXXXXXNGILIKGGEPLENIHKLNVIVFDKTGTITNGSPSVTRFLVLIGNGVREHIDKLLKILAAAESASEHPIGKAIITFSKARISNENLPEVLESSAVSGCGLGCKLN------LDPKTEVTKFVKNLINIESPSEETNILGQXXXXXXXXXXXXTYKDVIFPVRQHMAWTSDLCQTVTVIIGNRNWMLRNGILVDDEVDELMSEDENLGRTVILMAIDNELIAMISVADQVKREAALAVYTLKKMNIEVYLMTGDNSKTATAIARQVGIHYVFAEVLPSHKVAKVQQLQNTNRSLTSKRKMKVAMVGDGINDSPALAQSDVGIAIGTGTDVAVEAADVVLIRNSLLDVIAAIQLSKATVKRIRQNFIAATLYNLLGIPIAAGVLMPIGIEMMPWM 3840
            V+GMTCQSCV +IE  + K  G++++KV L K  A       L  P+ + E+I D GF  E++L          P + S   +           S  I ++ +    C+  IE ++  L GV    V+L ++   +++   K   +++RE IE +G+             +  Q   +W    S+R+        E   K YL I GMTC+SCV  +E  L K EGVKSVLV LLA K E+ Y+   +   ++   V  +GF  E+++   +G  +V++ I GMTCSSCV+ IE+ + K  GI   +V+L+TS G+ +Y     GPRD+I+AI  +GF A+L D   S+    DH    IK+WR SF  SLI G+P   + +          +  + E G    +M      V  GLS +NL++F+L TPVQ  G R+FY+ AY +LKH++TNMDVL+++AT+I+Y+YS++V V++M+ + + SP TFF+T PML+VF+SLGRW+EH+AKGKTSEAL KL+SLQ   A L   +       +E  I ++LVQR D++K++PG KIPVDG+V+ GTS  DESLITGESMP+ K  G  VIGG++N++G ++++ATHVG D+ LAQIVKLVEEAQTSKAPIQ+ AD ++G FVP V++ +I T +IWVI+G+S   I+    N  E +  E     AFQ+ ITVL+IACPC+LGLATPTAVMVGTG+GA NGILIKGGEPLE  HK+  +VFDKTGT+T+G P V +  + +   + + +  LL +   AE++SEHP+G AI T++K  +S ENL       A  G GL C ++      L+P    +K  K+       S + N++         D ++      I+  R        L +   V+IGNR+WM +NG++V DE++E M   E +G T IL+ I + L+ M++VAD VK EA +AV TLK+M + V L+TGDN KTA AIARQVGI  VFAEVLPSHKV K++ LQ         +    AMVGDGINDSPALAQ+ VGIAIGTGTDVAVEAAD+VLI++ L+DV AAI LS+ TV+RI  NF  A LYN++GIP AAGV  P+G+ M PWM
Sbjct:   96 VHGMTCQSCVKSIEKALSKSTGVLNVKVSLPKESAVIKYRKLLTSPEKLAELIEDAGF--EVVL----------PRSGSTDVK-----------SVMITVQGMTCNSCVNTIEKNISKLDGVQSVKVSLDDKCARLEFAPEKVTPEQMREAIEDMGFDALLLGNVDEFVAVAGQMTGDWGVRFSSRKKHVEQDPLEDVEKIYLHIEGMTCASCVASIERALSKKEGVKSVLVGLLAQKAEVKYNKNRITTDEIVYHVTAMGFGCELMDKTGQGENVVDIRISGMTCSSCVHLIESSLIKRPGILQTSVALATSSGRFKYDTEITGPRDIIEAIKGLGFGAALADS-SSSKDKVDH-TLSIKKWRRSFLVSLIFGLPVFAIFIS---------YVFLEEAGKRPHVM------VIPGLSLENLLMFLLCTPVQILGGRHFYVTAYKALKHRSTNMDVLIMLATTIAYVYSIVVCVVAMSEQSSHSPMTFFDTPPMLLVFISLGRWMEHVAKGKTSEALAKLLSLQPATAMLVKLKPGSHQITEETVISVDLVQRADVLKVVPGAKIPVDGRVIEGTSMADESLITGESMPVPKKVGDSVIGGTMNQNGAILIEATHVGQDTTLAQIVKLVEEAQTSKAPIQKFADTLSGYFVPIVILISIATFMIWVIIGYSDITIIRMVYNPKEDNRDEFIIGFAFQIGITVLAIACPCALGLATPTAVMVGTGIGAQNGILIKGGEPLETAHKVTAVVFDKTGTLTHGKPEVVKTALFVSPDICD-LQLLLAVAGTAENSSEHPLGVAITTYAKKELSTENLGICSGFKAQPGYGLTCTVSGVEDLLLEPNQRQSKTSKD-------STQGNLILPVDGSIARDFVKADLDSTIYDCR--------LGKQYKVLIGNRDWMQQNGLVVTDEMEEDMVAHETIGHTAILIGIRDSLVGMMAVADTVKNEAQVAVSTLKRMGLRVVLLTGDNKKTAMAIARQVGIQQVFAEVLPSHKVEKIRALQ--------AKGFVTAMVGDGINDSPALAQAHVGIAIGTGTDVAVEAADIVLIKSDLMDVAAAIDLSRVTVRRIHLNFAFALLYNMIGIPFAAGVFEPLGVVMKPWM 1151          

HSP 2 Score: 137.887 bits (346), Expect = 1.236e-32
Identity = 119/430 (27.67%), Postives = 200/430 (46.51%), Query Frame = 1
Query:  118 VDGMTCMSCVRNIEENLMKFTGVCGIMVSLLHAEATVIFDADIATVEDISNKIDEMGFDVTVK-------SSEVSNVKDKVVRSRIKFESDINKSVE--------KSIETSL--SSKLLLVRFCQENNYADIWHYSSIRSTEILSVIQQSEIYGVLVLEQCPT--IRVIVRVNGMTCQSCVDNIESTVGKKQGIISIKVFLEKSEAHALVDASLAGPD-VEEMINDMGFNSEMILEIFND-SCAGKPNN-----VSQKYEELKSNTIYPILSTTIVIKALKSIFCIFKIENHMRALPGVDKCSVNLIEEIGMIDYDSGKWNVQKIREEIESLGYLTELPKQNWNSTRQSSAVSLNEESRSKCYLRITGMTCSSCVNKVESHLLKVEGVKSVLVALLAMKCEIIYDSAYVMPFQLSNRVKELGFNAEVIEN 1329
            ++GMTC SCV+ IE ++   +GV  I VSL   EA V FD  I     ++N ID+MGF+  +K         EV+  K   +++  + E +I  +V         KSIE +L  S+ +L V+       A I +   + S E L+ + +   + V++     T    V++ V GMTC SCV+ IE  + K  G+ S+KV L+   A          P+ + E I DMGF++ ++  +    + AG+         S + + ++ + +  +    + I+ +    C+  IE  +    GV    V L+ +   + Y+  +    +I   + ++G+  EL     + T Q   V           +RI+GMTCSSCV+ +ES L+K  G+    VAL        YD+    P  +   +K LGF A + ++
Sbjct:    1 MEGMTCNSCVKTIETSMSSTSGVKNIKVSLEEKEAEVTFDPKITNGTSLANAIDDMGFEACLKRVVDILTKQEVAQSKGTSIKNADEREEEIEFTVHGMTCQSCVKSIEKALSKSTGVLNVKVSLPKESAVIKYRKLLTSPEKLAELIEDAGFEVVLPRSGSTDVKSVMITVQGMTCNSCVNTIEKNISKLDGVQSVKVSLDDKCARLEFAPEKVTPEQMREAIEDMGFDALLLGNVDEFVAVAGQMTGDWGVRFSSRKKHVEQDPLEDVEKIYLHIEGMTCASCVASIERALSKKEGVKSVLVGLLAQKAEVKYNKNRITTDEIVYHVTAMGFGCEL----MDKTGQGENV---------VDIRISGMTCSSCVHLIESSLIKRPGILQTSVALATSSGRFKYDTEITGPRDIIEAIKGLGFGAALADS 417          

HSP 3 Score: 115.161 bits (287), Expect = 9.956e-26
Identity = 76/251 (30.28%), Postives = 123/251 (49.00%), Query Frame = 1
Query:  892 CIFKIENHMRALPGVDKCSVNLIEEIGMIDYDSGKWNVQKIREEIESLGY-------LTELPKQNWNSTRQSSAVSLNEESRSKCYLRITGMTCSSCVNKVESHLLKVEGVKSVLVALLAMKCEIIYDSAYVMPFQLSNRVKELGFNAEVIENGNEGIGIVNVLIRGMTCSSCVNHIENHISKIKGIASINVSLSTSKGKVEYFISECGPRDVIDAINDMGFDASLCDHLESNHAAADHINQMIKQWRSSF 1623
            C+  IE  M +  GV    V+L E+   + +D    N   +   I+ +G+       +  L KQ    ++ +S +   +E   +    + GMTC SCV  +E  L K  GV +V V+L      I Y      P +L+  +++ GF   +  +G+  +  V + ++GMTC+SCVN IE +ISK+ G+ S+ VSL     ++E+   +  P  + +AI DMGFDA L  +++   A A    QM   W   F
Sbjct:    9 CVKTIETSMSSTSGVKNIKVSLEEKEAEVTFDPKITNGTSLANAIDDMGFEACLKRVVDILTKQEVAQSKGTS-IKNADEREEEIEFTVHGMTCQSCVKSIEKALSKSTGVLNVKVSLPKESAVIKYRKLLTSPEKLAELIEDAGFEVVLPRSGSTDVKSVMITVQGMTCNSCVNTIEKNISKLDGVQSVKVSLDDKCARLEFAPEKVTPEQMREAIEDMGFDALLLGNVDEFVAVA---GQMTGDWGVRF 255          

HSP 4 Score: 75.8702 bits (185), Expect = 1.174e-13
Identity = 72/251 (28.69%), Postives = 112/251 (44.62%), Query Frame = 1
Query:  103 SARMKVDGMTCMSCVRNIEENLMKFTGVCGIMVSLLHAEATVIFDADIATVEDISNKIDEMGFD----------VTVKSSEVSNVKDKVVRSRIKFESDINKSVEK---------------SIETSLSSK-----LLLVRFCQENNYADIWHYSSIRSTEILSVIQQSEIYGVLVLEQCPTIR--VIVRVNGMTCQSCVDNIESTVGKKQGIISIKVFLEKSEAHALVDASLAGP-DVEEMINDMGFNSEM 756
            S  + V GMTC SCV  IE+N+ K  GV  + VSL    A + F  +  T E +   I++MGFD          V V      +   +    +   E D  + VEK               SIE +LS K     +L+    Q+      ++ + I + EI+  +     +G  ++++       V +R++GMTC SCV  IES++ K+ GI+   V L  S      D  + GP D+ E I  +GF + +
Sbjct:  167 SVMITVQGMTCNSCVNTIEKNISKLDGVQSVKVSLDDKCARLEFAPEKVTPEQMREAIEDMGFDALLLGNVDEFVAVAGQMTGDWGVRFSSRKKHVEQDPLEDVEKIYLHIEGMTCASCVASIERALSKKEGVKSVLVGLLAQKAEVK--YNKNRITTDEIVYHVTAMG-FGCELMDKTGQGENVVDIRISGMTCSSCVHLIESSLIKRPGILQTSVALATSSGRFKYDTEITGPRDIIEAIKGLGFGAAL 414          
BLAST of Copper-transporting ATPase 1 vs. Ensembl Nematostella
Match: EDO43417 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RYT4])

HSP 1 Score: 218.394 bits (555), Expect = 1.657e-59
Identity = 199/705 (28.23%), Postives = 334/705 (47.38%), Query Frame = 1
Query: 1708 IHENGSNRTIMKSTVPMVCS--GLSADNLILFVLATPVQFYGARYFYIQAYLSLKHKTTNMDVLVVMATXXXXXXXXXXXXXXMAFRRNTSPKTFFETSPMLIVFLSLGRWLEHIAKGKTSEALTKLMSLQAVEATLYTPENKERKIPINLVQRNDLIKILPGEKIPVDGKVVTGTSTCDESLITGESMPIEKTHGSDVIGGSINKSGMLIVKATHVGSDSALAQIVKLVEEAQTSKAPIQQLADRIAGMFVPSVLICAIITLIIWVIVGFSKPEILPKYVNELSVTEITWEHAFQLAITVLSIACPCSLGLXXXXXXXXXXXXXXXNGILIKGGEPLENIHKLNVIVFDKTGTITNGSPSVTRFLVLIGNGVREHIDKLLKILAAAESASEHPIGKAIITFSKARISNENLPEVLESSAVSGC-GLGCKLNLDPKTEVTKFVKNLINIESPSEETNILGQXXXXXXXXXXXXTYKDVIFPVRQHMAWTSDLCQTVTVIIGNRNWMLRNGILVDDEVDELMSED--------ENLGRTVILMAIDNELIAMISVADQVKREAALAVYTLKKMNIEVYLMTGDNSKTATAIARQVGIHYVFAEVLPSHKVAKVQQLQNTNRSLTSKR---KMKVAMVGDGINDSPALAQSDVGIAIGT-GTDVAVEAADVVLIRNSLLDVIAAIQLSKATVKRIRQNFIAATLYNL 3777
            + E G++  + K TV  + +  GL         +A     +G+     +A++S+K+   +++VL+++A                      +   + E + ++ VF +L   +E  +  K    +++LM  +   A L   E  E  + I+ V    LI + PG+ IP+DG VV G ++ DES ITGE +P+EK   S V  G+++++G L +K T   S+S ++++ ++V+EAQ+S    +Q+ +  A  + P V++ + + + I  I+G +      + ++E       W H    A+ +L +ACPC+L + +P AV+      A  G LIK GE LE + KL V+ FDKTGT+T G   VT    + G   RE    +L++ A  ES S HPI  AI+        NE           SGC G   K N+    EV KF           E   I G                               + +   V++GN +       LV D+  E +            N  +TV+ +++++++  M+++AD ++     A+  L+   I+  ++TGDN++TA A+   +G+    AE+ PS K+       + +     +R   ++ V MVGDG+ND PALA +D+GIA+G  GT +AVEAADV L+ N+L  +   + L K     I QN   + +  L
Sbjct:   66 VMETGNHHGVEKHTVLFIVAVVGLFLKTKWFMWVAIAEILFGSIPILKRAFISMKNLRVDINVLMLIAIIG-----------------TAALSDWVEGATVVYVF-ALADAIEEYSLHKVQRTISRLMLKRPQVAVLV--ETGE-VVNIDTVVIGTLIAVRPGDLIPLDGIVVKGRASVDESSITGECLPVEKKVDSKVFSGTVDQNGYLEIKTTTDSSNSTVSRVAEMVQEAQSSSTRTEQIINHFAKYYTPLVVVTSALVIAIPAILGVAGVGTYQQDLHE-------WGHK---ALVLLVVACPCALVMTSPIAVVCSITAAARRGSLIKKGEHLETLAKLEVLAFDKTGTLTEGKFQVTDMESVYGVNERE----VLRLAAGIESKSSHPIAAAIV--------NE----------FSGCVGSMVKSNVFSIPEVKKF--------KLHEGKGISG-------------------------------IVEGKKVLVGNHS-------LVTDQCGEKLGSSMTDKYIQWSNESKTVVFVSVNSKVQLMVALADSIRPNTIDALDWLRHHGIQTSMITGDNARTAAAVKESLGLDECTAEMKPSDKL-------DPHFCCVRRRNVGRVSVGMVGDGVNDGPALAAADLGIAMGAGGTALAVEAADVTLMSNNLAKIPELVSLGKFCRTIITQNIALSVVLKL 664          
BLAST of Copper-transporting ATPase 1 vs. Ensembl Nematostella
Match: EDO35616 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SL15])

HSP 1 Score: 83.5741 bits (205), Expect = 3.902e-16
Identity = 56/158 (35.44%), Postives = 83/158 (52.53%), Query Frame = 1
Query: 3367 AVYTLKKMNIEVYLMTGDNSKTATAIARQVGIHY---------------------------VFAEVLPSHKVAKVQQLQNTNRSLTSKRKMKVAMVGDGINDSPALAQSDVGIAIG-TGTDVAVEAADVVLIRNSLLDVIAAIQLSKATVKRIRQNFI 3756
            AV TL    ++V ++TGD+ +TA  IA  +GIH+                           VF  V P HKVA V+ LQ             VAM GDG+ND+ AL ++D+GIA+G +GTDV+ EAA+++L+ +    ++AAI+  K     I+ NF+
Sbjct:  546 AVRTLLDSGVQVKMITGDSRETAITIAELLGIHFKGRPTLSGEELEALDGLQLSTIIDQVSVFYRVSPRHKVAIVKALQQHGHV--------VAMTGDGVNDAVALKRADIGIAMGKSGTDVSKEAAEMILVDDDFNTIMAAIEEGKGIFYNIK-NFV 694          
BLAST of Copper-transporting ATPase 1 vs. Ensembl Nematostella
Match: EDO47465 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RM93])

HSP 1 Score: 75.485 bits (184), Expect = 1.409e-13
Identity = 53/200 (26.50%), Postives = 94/200 (47.00%), Query Frame = 1
Query: 3316 LIAMISVADQVKREAALAVYTLKKMNIEVYLMTGDNSKTATAIARQV----------GIHY---------------------VFAEVLPSHKVAKVQQLQNTNRSLTSKRKMKVAMVGDGINDSPALAQSDVGIAIGTGTDVAVEAADVVLIRNSLLDVIAAIQLSKATVKRIRQ---NFIAATLYNLLGIPIAAGVLMP 3813
             + +  + D  + E   A+    K  I V ++TGDN  TA AI R++          G+ Y                     +F+ V PSHK   V  LQ              AM GDG+ND+PAL ++++G+A+G+GT VA  A++++L  ++   ++AA++  ++     +Q     I++ +  ++ I + A + MP
Sbjct:  596 FVGVAGMLDPPRPEVTDAIKLCAKAGIRVIVITGDNKATAEAICRRIEVFGQDEDTTGLSYSGREFDDLTPSEQREACLRARLFSRVEPSHKSKIVTYLQEEGEI--------SAMTGDGVNDAPALKKAEIGVAMGSGTAVAKTASEMILADDNFSTIVAAVEEGRSIYDNTKQFIRYLISSNIGEVVSIFLTAALGMP 787          
BLAST of Copper-transporting ATPase 1 vs. Ensembl Nematostella
Match: EDO41775 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S3I0])

HSP 1 Score: 70.8626 bits (172), Expect = 3.879e-12
Identity = 55/195 (28.21%), Postives = 88/195 (45.13%), Query Frame = 1
Query: 3319 IAMISVADQVKREAALAVYTLKKMNIEVYLMTGDNSKTATAIARQVGI---------------------------HYVFAEVLPSHKVAKVQQLQNT--------NRSLTSKRKMKVAMVGDGINDSPALAQSDVGIAIG-TGTDVAVEAADVVLIRNSLLDVIAAIQLSKATVKRIRQNFIAATLYNLLGIPIA 3795
            IA+  + D V++E   A+   ++  I V ++TGDN  TA +IA + GI                              F E+ P  +V      ++         +  L   R++ VA+ GDG ND PAL ++DVG A+G  GTDVA EA+D++L  ++   ++ A+   +     I +        NL+ I IA
Sbjct:  651 IAIAGIEDPVRQEVPAAIKKCQQAGIVVRMVTGDNVNTARSIAGKCGILEPDKDFLVLDGKEFNKLIRDSNGRVSQKKFDEIWPRLRVLARSSPEDKYTLVKGIIDSKLNPAREI-VAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFRSIVMAVMWGRNVYDSISKFLQFQLTVNLVAIVIA 844          
BLAST of Copper-transporting ATPase 1 vs. Ensembl Medaka
Match: atp7a (copper-transporting ATPase 1 [Source:NCBI gene;Acc:101164902])

HSP 1 Score: 899.042 bits (2322), Expect = 0.000e+0
Identity = 584/1319 (44.28%), Postives = 802/1319 (60.80%), Query Frame = 1
Query:  109 RMKVDGMTCMSCVRNIEENLMKFTGVCGIMVSLLHAEATVIFDADIATVEDISNKIDEMGFDVTVKSSEVSNVKDKVVRSRIKFESDINKSVEKSIETSLSSKLLLVRFCQENNYADIWHYSSIRSTEILSVIQQSEIYGVLVLEQCPTIRVIVRVNGMTCQSCVDNIESTVGKKQGIISIKVFLEKSEA-----------HALVDASLAGPDVEEMINDMGFNSEMILEIFNDSCAGKPNNVSQ-KYEELKSNTIYPILSTT-IVIKALKSIFCIFKIENHMRALPGVDKCSVNLIEEIGMIDYDSGKWNVQKIREEIESLGYLTELPKQNWN-----STRQSSAVSLNEE-------------SRSKCYLRITGMTCSSCVNKVESHLLKVEGVKSVLVALLAMKCEIIYDSAYVMPFQLSNRVKELGFNAEVIENGNEGIGIVNVLIRGMTCSSCVNHIENHISKIKGIASINVSLSTSKGKVEYFISECGPRDVIDAINDMGFDASLCDHLESNHAAADHINQMIKQWRSSFFFSLICGIPXXXXXXXXXXXXXXXXHTIIHENGS--NRTIMKSTVPM---VCSGLSADNLILFVLATPVQFYGARYFYIQAYLSLKHKTTNMDVLVVMATXXXXXXXXXXXXXXMAFRRNTSPKTFFETSPMLIVFLSLGRWLEHIAKGKTSEALTKLMSLQAVEATLYT--PEN---KERKIPINLVQRNDLIKILPGEKIPVDGKVVTGTSTCDESLITGESMPIEKTHGSDVIGGSINKSGMLIVKATHVGSDSALAQIVKLVEEAQTSKAPIQQLADRIAGMFVPSVLICAIITLIIWVIVGFSK----PEILPKYVNELSVTEITWEHAFQLAITVLSIACPCSLGLXXXXXXXXXXXXXXXNGILIKGGEPLENIHKLNVIVFDKTGTITNGSPSVTRFLVLIGNGVREHIDKLLKILAAAESASEHPIGKAIITFSKARISNENLPEVLESSAVSGCGLGCKLNLDPKTEVTKFVKNLINIESPSEETNILGQXXXXXXXXXXXXTYKDVIFPVRQHMAWTSDLCQTVTVIIGNRNWMLRNGILVDDEVDELMSEDENLGRTVILMAIDNELIAMISVADQVKREAALAVYTLKKMNIEVYLMTGDNSKTATAIARQVGIHYVFAEVLPSHKVAKVQQLQNTNRSLTSKRKMKVAMVGDGINDSPALAQSDVGIAIGTGTDVAVEAADVVLIRNSLLDVIAAIQLSKATVKRIRQNFIAATLYNLLGIPIAAGVLMPIGIEMMPWMXXXXXXXXXXXXXXXXXXXXXWKKPSEEKL 3930
            +++++GMTC SCV  IE  + K  G+  I V L   EAT+I+   + T + I  +I   GF  +VKS                          K     LS++             DI  ++  +   + S  +++E++         T  V++ V GM C+SCV NI+  +    G+ S++V LEK +A            AL  A  A P     +   G  + +       S   +P  V+Q K   L+     P++ST  I I+ +    C+  IE  +    GV    V+L +  G+ +YD    + Q++RE +E +G+   LP+ N       +T  S+A    +E             + SKCY++I GMTC+SCV+ +E +L    G+  VLVAL+A K E+ Y+   + P ++   VKELGF A V+EN     G + ++IRGMTC+SCV+ IE+++ K KGI   +V+L+T+K  V++     GPRD+I  I ++GF ASL    + + +  DH ++ I+QWR SF  SLI  +P M +M++ M     +  +  H N +  +R    ST+ +   +  GLS  NL+ F+   PVQF G RYFYIQAY +LKHK+ NMDVL+V+ATS+++ YS++V++++M  R   +P TFF+T PML VF+SLGRWLE IAK KTSEAL+KLMSLQA EAT+ T   +N    E ++ + LVQR D++K++PG K PVDG+V+ G S  DESLITGE+MP+ K  GS VI GSIN++G L+V ATHVG D+ L+QIVKLVEEAQTSKAPIQQ AD+I+G FVP ++  +++TLI+W+I+GF       +  P Y   +S +E     AFQ +ITVL IACPCSLGLATPTAVMVGTGVGA NGILIKGGEPLE  HK+  +VFDKTGTIT G+P V +   ++  G +  + +LL I+  AE+ SEHP+G AI  + K  +  E+L    +  AV GCG+ C+++ + +T V +        +S SE+ N     +    +     +   +I   +   +  +DL     V+IGNR WM RN + +  E+DE M E E  GRT +L+A++N L AMI+++D VK EA LAV TL  M +EV LMTGDNSKTA  IA QVGI  VFAEVLPSHKVAKV+QLQ   +         VAMVGDG+NDSPALA +DVGIAIGTGTDVA+EAADVVLIRN LLDV+ +I LSK TVKRIR NF+ A +YNL+GIPIAAGV +PIG+ + PWM SAAMA SSVSVV  SLLLK + KP+ EKL
Sbjct:  166 KLRIEGMTCHSCVTTIEGKIGKLNGIQKIKVVLESKEATIIYLPYLITHQSIVEQIAFAGFKASVKS--------------------------KPKPLQLSNR-------------DIERFADSQKATLTSSSEETEVF-------IDTTLVLLGVKGMHCRSCVVNIQDNISLLPGVSSVEVSLEKEQATICYDPHKVTVSALQQAIEALPPGNFKVEAPGSTNPVT------SARAQPACVTQAKPAALQPCFTQPLVSTVNIHIEGMTCNSCVQSIEGMISQRKGVVSAQVSLADHQGIFEYDPLLTSPQELREAVEDMGFDAFLPETNSLLEPNITTSASTAPDQGKEFDPKEAHRGSTEGTHSKCYIQIGGMTCASCVSNIERNLKNEPGIYFVLVALMASKAEVRYNPEVIDPPKIVECVKELGFTASVMENYEGSNGNLELVIRGMTCASCVHKIESNLMKEKGIEYASVALATNKAHVKFDSEVLGPRDIIKLIENLGFKASLVKR-DRSASHLDH-SKEIRQWRKSFLISLIFCVPVMGMMIYMMVMDHHMNASH-HHNATVEDRNHYHSTMFLERQLFPGLSIMNLLSFIFCVPVQFIGGRYFYIQAYKALKHKSANMDVLIVLATSVAFSYSLVVLIVAMVERAKVNPITFFDTPPMLFVFISLGRWLEQIAKSKTSEALSKLMSLQATEATVVTLGSDNVILSEEQVDVELVQRGDVVKVVPGGKFPVDGRVLEGHSMADESLITGEAMPVTKKPGSTVIAGSINQNGSLLVSATHVGMDTTLSQIVKLVEEAQTSKAPIQQYADKISGYFVPFIVAVSLLTLIVWIIIGFLDFSLVKKYFPGYNESISRSETVIRFAFQASITVLCIACPCSLGLATPTAVMVGTGVGAQNGILIKGGEPLEMAHKVQAVVFDKTGTITYGAPKVVQVKTVV-EGNKMPLSRLLAIVGTAENNSEHPLGAAITKYCKQELGTESLGTCTDFQAVPGCGVRCQVS-NTETVVKQG-------DSDSEDNNHRNSVLVQISDTRTSSSSHPLIMDPQPLSSGPTDL---YVVLIGNREWMRRNFLEITAEIDEAMMEHERRGRTAVLVAVNNMLCAMIAISDTVKPEAELAVQTLTNMGLEVVLMTGDNSKTARVIAAQVGIRKVFAEVLPSHKVAKVEQLQQAGKI--------VAMVGDGVNDSPALAMADVGIAIGTGTDVAIEAADVVLIRNDLLDVVGSIDLSKKTVKRIRINFVFALIYNLVGIPIAAGVFLPIGLVLQPWMGSAAMALSSVSVVVSSLLLKCYTKPTAEKL 1409          

HSP 2 Score: 166.392 bits (420), Expect = 6.326e-41
Identity = 151/567 (26.63%), Postives = 248/567 (43.74%), Query Frame = 1
Query:   88 RMKLGSARMKVDGMTCMSCVRNIEENLMKFTGVCGIMVSLLHAEATVIFDADIATVEDISNKIDEMGFDVTVKSSEVSNVKDKVVRSRIKFESDINKSVEKSIETSLSSKLLLVRFCQENNYADIWHYSSIRSTEILSVIQQSEIYGVLVLEQCPTIR--------VIVRVNGMTCQSCVDNIESTVGKKQGIISIKVFLEKSEAHALVDASL-AGPDVEEMINDMGFN------------SEMILEIFNDSCAGKPNNVSQKYEELKSNTIYPILSTTIVIKALKSIF---CIFKIENHMRALPGVDKCSVNLIEEIGMIDYDSGKWNVQKIREEIESL---GYLTELPKQN--WNSTRQSSA--VSLNEESRSKCY---------LRITGMTCSSCVNKVESHLLKVEGVKSVLVALLAMKCEIIYDSAYVMPFQLSNRVKELGFNA------------------------------EVIENGNEGI-GIVNVLIRGMTCSSCVNHIENHISKIKGIASINVSLSTSKGKVEYFISECGPRDVIDAINDMGFDASLCDHLESNHA 1575
            ++ L S  +KV+GMTC SCV++IE+ +    GV  I VSL    AT+IFD    + E +S  I++MGF+ +      +        +++   S +  +  +     LS    ++  C+  +  D+ H +   S  ++S ++ S++   L L    T +        + +R+ GMTC SCV  IE  +GK  GI  IKV LE  EA  +    L     + E I   GF             S   +E F DS      + S++ E          + TT+V+  +K +    C+  I++++  LPGV    V+L +E   I YD  K  V  +++ IE+L    +  E P       S R   A        +   C+         + I GMTC+SCV  +E  + + +GV S  V+L   +    YD     P +L   V+++GF+A                              E      EG      + I GMTC+SCV++IE ++    GI  + V+L  SK +V Y      P  +++ + ++GF AS+ ++ E ++ 
Sbjct:    4 KVNLCSVALKVEGMTCGSCVQSIEQRIGSLPGVIHIRVSLEQKTATLIFDQGQQSPESLSEAIEDMGFESSFPDGSTATAVS--TETQLIPTSALAPAAHQEAREKLSQTKGVLEVCESPSQKDL-HITFAPS--LISTLELSKVVESLTLADVQTSKMKDDGVALLKLRIEGMTCHSCVTTIEGKIGKLNGIQKIKVVLESKEATIIYLPYLITHQSIVEQIAFAGFKASVKSKPKPLQLSNRDIERFADSQKATLTSSSEETEVF--------IDTTLVLLGVKGMHCRSCVVNIQDNISLLPGVSSVEVSLEKEQATICYDPHKVTVSALQQAIEALPPGNFKVEAPGSTNPVTSARAQPACVTQAKPAALQPCFTQPLVSTVNIHIEGMTCNSCVQSIEGMISQRKGVVSAQVSLADHQGIFEYDPLLTSPQELREAVEDMGFDAFLPETNSLLEPNITTSASTAPDQGKEFDPKEAHRGSTEGTHSKCYIQIGGMTCASCVSNIERNLKNEPGIYFVLVALMASKAEVRYNPEVIDPPKIVECVKELGFTASVMENYEGSNG 557          
BLAST of Copper-transporting ATPase 1 vs. Ensembl Medaka
Match: atp7b (copper-transporting ATPase 2 [Source:NCBI gene;Acc:101171807])

HSP 1 Score: 892.493 bits (2305), Expect = 0.000e+0
Identity = 546/1184 (46.11%), Postives = 761/1184 (64.27%), Query Frame = 1
Query:  562 VIVRVNGMTCQSCVDNIESTVGKKQGIISIKVFLEKSEAHALVDA-SLAGPDVEEMINDMGFNSEMILEIFNDSCAGKPNNVSQKYEELKSNTIYPILSTTIVIKALKSIFCIFKIENHMRALPGVDKCSVNLIEEIGMIDYDSGKWNVQKIREEIESLGYLTEL--PKQNWNSTRQSSAVSLNEESRS----------------------KCYLRITGMTCSSCVNKVESHLLKVEGVKSVLVALLAMKCEIIYDSAYVMPFQLSNRVKELGFNAEVIENGNEGIGIVNVLIRGMTCSSCVNHIENHISKIKGIASINVSLSTSKGKVEYFISECGPRDVIDAINDMGFDASLCDHLESNHAAADHINQMIKQWRSSFFFSLICGIPXXXXXXXXXXXXXXXXHTIIHENGSNRTIMKSTVPMVCSGLSADNLILFVLATPVQFYGARYFYIQAYLSLKHKTTNMDVLVVMATXXXXXXXXXXXXXXMAFRRNTSPKTFFETSPMLIVFLSLGRWLEHIAKGKTSEALTKLMSLQAVEATLYT--PENK---ERKIPINLVQRNDLIKILPGEKIPVDGKVVTGTSTCDESLITGESMPIEKTHGSDVIGGSINKSGMLIVKATHVGSDSALAQIVKLVEEAQTSKAPIQQLADRIAGMFVPSVLICAIITLIIWVIVGFSK----PEILPKYVNELSVTEITWEHAFQLAITVLSIACPCSLGLXXXXXXXXXXXXXXXNGILIKGGEPLENIHKLNVIVFDKTGTITNGSPSVTRFLVLIGNGVREHIDKLLKILAAAESASEHPIGKAIITFSKARISNENLPEVLESSAVSGCGLGCKL-NLDPKTEVTKFVKNLINIESPSEETNILGQXXXXXXXXXXXXTYKDVIFPVRQHMAWTSDLCQTVTVIIGNRNWMLRNGILVDDEVDELMSEDENLGRTVILMAIDNELIAMISVADQVKREAALAVYTLKKMNIEVYLMTGDNSKTATAIARQVGIHYVFAEVLPSHKVAKVQQLQNTNRSLTSKRKMKVAMVGDGINDSPALAQSDVGIAIGTGTDVAVEAADVVLIRNSLLDVIAAIQLSKATVKRIRQNFIAATLYNLLGIPIAAGVLMPIGIEMMPWMXXXXXXXXXXXXXXXXXXXXXWKKPSEEKLITPEYINFIQSSGLSESQIIVRRGID 4008
            V ++V+GM C+SCV++IE  + +  G++ I+V LE+++A  +     +   ++++ I DMGF++ ++L+   ++ +G    V +            I +TTI I  +    C+  IE  +    GV    V+L EE   I +D G    +++R  IE +G+   L  P+++  +  +S +V   ++ +S                      KC++ + GMTC+SCV  +E ++LK  G+ SVLV+L+A K E+ YD+  +    ++  +++LGF A++IE+     G +++ I GMTC+SCV+ IE+ +   KGI   +V+L+T K  +++     GPRD+I  I  +GF+ASL      N+   DH  + I+QWR+SF FSL+ G+P M +M++ M        T+  E+G +    ++  P    GLS  NLI F+L TPVQ +G RYFYIQAY SLKH T NMDVL+V+AT+I+Y+YS +V+VI+M  R + SP TFF+T PML VF+SLGRWLEH+AK KTSEAL KLMSLQA +AT+ T  P++    E ++ + LVQR D++KI+PG K P+DGKV+ G+S  DESLITGE MP+ KT GS VI GSIN  G L+V+ATHVG+++ L+QIVKLVEEAQTSKAPIQQ ADRI+G FVP ++  ++ TL+ W+++GF       E  P Y   +S  E+    AFQ +ITVLSIACPCSLGLATPTAVMVGTGVGA NGILIKGGEPLE  HK+NV++FDKTGTITNG P VTR LVL     R  + ++L ++  AE++SEHP+G A+    K  + ++ +    +  AV GCG+ C++ N+D   +   F+       + ++E+++L                                   + +V+IGNR WM RNG+ +  +VD  MS  E  G+T +L+AID  L AMI++AD VK E+ALAV+TL  M +EV ++TGDN  TA AIA QVGI  VFAEVLPSHKVAKVQ+LQ        +R ++VAMVGDGINDSPALA +DVGIAIGTGTDVA+EAAD+VLIRN+LLDV+A+I+LSK TV+RIR NF+ A +YNLLGIPIAAGV MP+G+ + PWM SAAMAASSVSVV  SLLL+ ++K S E   +  ++       L  SQI    G+D
Sbjct:  156 VQMKVDGMHCRSCVESIERRIRELPGVVQIRVSLEEAKAEVMFQPLVITQQELQDQIEDMGFSATLMLK---ETSSGDLTFVQRDLN-------MSIQNTTIWIAGMSCSSCVQSIEGRISQTRGVKSIVVSLKEEKATISFDPGLTEPEQLRAAIEDMGFDASLKEPERSIQNQEKSRSVDFYQQPQSTAAFNHPSGAQPKPDSPKTEIKKCFVLVAGMTCTSCVANIEKNILKHRGIVSVLVSLMAGKAEVKYDAGVLSAPAVAQLIQDLGFGAKLIEDHAGEHGKLDLTITGMTCASCVHKIESKLVATKGILVASVALATRKAHIQFDSEILGPRDIIRIIQSLGFEASLEKKGFKNNV--DHTEE-IRQWRNSFLFSLVFGLPVMGLMVYMMVM-----DTLHQEHGGSMPEDQNVAP----GLSLLNLIFFLLCTPVQIFGGRYFYIQAYRSLKHHTANMDVLIVLATTIAYVYSCLVLVIAMVERASQSPVTFFDTPPMLFVFISLGRWLEHVAKRKTSEALAKLMSLQATDATVVTVGPDHSIISEEQVMVELVQRGDVVKIVPGGKFPIDGKVIEGSSMADESLITGEPMPVSKTVGSLVIAGSINAHGSLLVEATHVGAETTLSQIVKLVEEAQTSKAPIQQFADRISGYFVPFIVFVSLATLVAWLVIGFVNFTIVTENFPGYNQNISKAEVIIRFAFQASITVLSIACPCSLGLATPTAVMVGTGVGAQNGILIKGGEPLEMAHKINVVMFDKTGTITNGVPQVTRVLVLW-ETARMPLRQILAVVGTAEASSEHPLGVAVTKHCKDELGSDAMGFCQDFQAVPGCGISCRVSNVDHLLQQQSFLLP----GATTDESSLLAAQEAPPTVGGA-----------------------SYSVLIGNREWMRRNGLHIKADVDAAMSSHETKGQTAVLVAIDGVLCAMIAIADTVKPESALAVHTLNSMGVEVVMVTGDNRCTAKAIAAQVGIRKVFAEVLPSHKVAKVQELQ--------ERGLRVAMVGDGINDSPALACADVGIAIGTGTDVAIEAADIVLIRNNLLDVVASIELSKKTVRRIRINFVFALIYNLLGIPIAAGVFMPVGLVLQPWMGSAAMAASSVSVVLSSLLLRTYRKTSAESYQSRSHMR----RSLRSSQISAHLGLD 1277          

HSP 2 Score: 126.716 bits (317), Expect = 8.576e-29
Identity = 107/435 (24.60%), Postives = 178/435 (40.92%), Query Frame = 1
Query:  100 GSARMKVDGMTCMSCVRNIEENLMKFTGVCGIMVSLLHAEATVIFDADIATVEDISNKIDEMGFDVTVKSSEVSNVKDKVVRSRIKFESDINKSVEKSIETSLSSKLLLVRFCQENNYADIWHYSSIRSTEILSVIQQSEIYGVLVLEQCPTIRVIVRVNGMTCQSCVDNIESTVGKKQGIISIKVFLEKSEAHALVDASLAGPD-VEEMINDMGFNSEM-----------------------ILEIFNDSCAGKPNNVSQKYEELKSNTIYPILSTTIVIKALKSIFCIFKIENHMRALPGVDKCSVNLIEEIGMIDYDSGKWNVQKIREEIESLGYLTELPKQNWNSTRQSSAVSLNEESRSKCYLRITGMTCSSCVNKVESHLLKVEGVKSVLVALLAMKCEIIYDSAYVMPFQLSNRVKELGFNAEVIENG 1332
             + +MKVDGM C SCV +IE  + +  GV  I VSL  A+A V+F   + T +++ ++I++MGF  T+   E S+     V      + D+N S++ +                      IW                                    + GM+C SCV +IE  + + +G+ SI V L++ +A    D  L  P+ +   I DMGF++ +                           FN     +P   S K E         I    +++  +    C+  IE ++    G+    V+L+     + YD+G  +   + + I+ LG+  +L             +  +     K  L ITGMTC+SCV+K+ES L+  +G+    VAL   K  I +DS  + P  +   ++ LGF A + + G
Sbjct:  154 AAVQMKVDGMHCRSCVESIERRIRELPGVVQIRVSLEEAKAEVMFQPLVITQQELQDQIEDMGFSATLMLKETSSGDLTFV------QRDLNMSIQNTT---------------------IW------------------------------------IAGMSCSSCVQSIEGRISQTRGVKSIVVSLKEEKATISFDPGLTEPEQLRAAIEDMGFDASLKEPERSIQNQEKSRSVDFYQQPQSTAAFNHPSGAQPKPDSPKTE---------IKKCFVLVAGMTCTSCVANIEKNILKHRGIVSVLVSLMAGKAEVKYDAGVLSAPAVAQLIQDLGFGAKL-------------IEDHAGEHGKLDLTITGMTCASCVHKIESKLVATKGILVASVALATRKAHIQFDSEILGPRDIIRIIQSLGFEASLEKKG 503          

HSP 3 Score: 101.293 bits (251), Expect = 5.073e-21
Identity = 89/331 (26.89%), Postives = 144/331 (43.50%), Query Frame = 1
Query:   85 IRMKLGSARMKVDGMTCMSCVRNIEENLMKFTGVCGIMVSLLHAEATVIFDADIATVEDISNKIDEMGFDVTVKSSEVSNVKDKVVRSRIKFESDINKSVEKSIETSLSSKLLLVRFCQENNYADIWHYSSIRSTEILSVIQQSEIYGVLVLEQCPTIRVIVRVNGMTCQSCVDNIESTVGKKQGIISIKVFLEKSEAHALVDAS-LAGPDVEEMINDMGFNSEMILEIFNDSCAGKPNNVSQKYEELKSNTIYPILSTTIVIKALKSIFCIFKIENHMRALPGVDKCSVNLIEEIGMIDYDSGKWNVQKIREEIESLGYLTELPKQNWNS 1074
            + M + +  + + GM+C SCV++IE  + +  GV  I+VSL   +AT+ FD  +   E +   I++MGFD ++K  E S    +  RS                          V F Q+      +++ S    +  S   ++EI    VL           V GMTC SCV NIE  + K +GI+S+ V L   +A    DA  L+ P V ++I D+GF +++I     +  AG+   +                   + I  +    C+ KIE+ + A  G+   SV L      I +DS     + I   I+SLG+   L K+ + +
Sbjct:  238 LNMSIQNTTIWIAGMSCSSCVQSIEGRISQTRGVKSIVVSLKEEKATISFDPGLTEPEQLRAAIEDMGFDASLKEPERSIQNQEKSRS--------------------------VDFYQQPQSTAAFNHPSGAQPKPDS--PKTEIKKCFVL-----------VAGMTCTSCVANIEKNILKHRGIVSVLVSLMAGKAEVKYDAGVLSAPAVAQLIQDLGFGAKLI-----EDHAGEHGKLD------------------LTITGMTCASCVHKIESKLVATKGILVASVALATRKAHIQFDSEILGPRDIIRIIQSLGFEASLEKKGFKN 506          

HSP 4 Score: 57.7658 bits (138), Expect = 9.432e-8
Identity = 41/154 (26.62%), Postives = 76/154 (49.35%), Query Frame = 1
Query: 1087 SAVSLNEESRSKCYLRITGMTCSSCVNKVESHLLKVEGVKSVLVALLAMKCEIIYDSAYVMPFQLSNRVKELGFNAEVIENGNEGIGIVNVLIRGMTCSSCVNHIENHISKIKGIASINVSLSTSKGKVEYFISECGPRDVIDAINDMGFDASL 1548
            S +  + ++ S    ++ G+  S+ +  VE+ L  ++GV +V   +     ++ YDS+     +++ +++ LG   E           V + + GM C SCV  IE  I ++ G+  I VSL  +K +V +       +++ D I DMGF A+L
Sbjct:   79 SELCTSPKAASTATFKLFGL--STALEAVETTLPALDGVLAVTWLVPDALVQVDYDSSATTTKEIAMQLQALGCTVE---------AAVQMKVDGMHCRSCVESIERRIRELPGVVQIRVSLEEAKAEVMFQPLVITQQELQDQIEDMGFSATL 221          
BLAST of Copper-transporting ATPase 1 vs. Ensembl Medaka
Match: atp7a (copper-transporting ATPase 1 [Source:NCBI gene;Acc:101173428])

HSP 1 Score: 874.774 bits (2259), Expect = 0.000e+0
Identity = 588/1388 (42.36%), Postives = 812/1388 (58.50%), Query Frame = 1
Query:   88 RMKLGSARMKVDGMTCMSCVRNIEENLMKFTGVCGIMVSLLHAEATVIFDADIATVEDISNKIDEMGFDVTVKSSEVSNVKDKVVRSRIKFESDINKSVEKSIETSLSSKLLLVRFCQENNYADIWHYSSIRSTEILSVIQQSEIYGVLVLEQCPTIR--------VIVRVNGMTCQSCVDNIESTVGKKQGIISIKVFLEKSEAHALVDASL-AGPDVEEMINDMGFN------------SEMILEIFNDSCAGKPNNVSQKYEELKSNTIYPILSTTIVIKALKSIFC---IFKIENHMRALPGVDKCSVNLIEEIGMIDYDSGKWNVQKIREEIESL---GYLTELP---------KQNWNSTRQSSAVSLN----EESRSKCYLRITGMTCSSCVNKVESHLLKVEGVKS----------------------------------------------------VLVALLAMKCEIIYDSAYVMPFQLSNRVKELGFNAEVIENGNEGIGIVNVLIRGMTCSSCVNHIENHISKIKGIASINVSLSTSKGKVEYFISECGPRDVIDAINDMGFDASLCDHLESNHAAADHINQMIKQWRSSFFFSLICGIPXXXXXXXXXXXXXXXXHTIIHENGS--NRTIMKSTVPM---VCSGLSADNLILFVLATPVQFYGARYFYIQAYLSLKHKTTNMDVLVVMATXXXXXXXXXXXXXXMAFRRNTSPKTFFETSPMLIVFLSLGRWLEHIAKGKTSEALTKLMSLQAVEATLYT--PEN---KERKIPINLVQRNDLIKILPGEKIPVDGKVVTGTSTCDESLITGESMPIEKTHGSDVIGGSINKSGMLIVKATHVGSDSALAQIVKLVEEAQTSKAPIQQLADRIAGMFVPSVLICAIITLIIWVIVGFSK----PEILPKYVNELSVTEITWEHAFQLAITVLSIACPCSLGLXXXXXXXXXXXXXXXNGILIKGGEPLENIHKLNVIVFDKTGTITNGSPSVTRFLVLIGNGVREHIDKLLKILAAAESASEHPIGKAIITFSKARISNENLPEVLESSAVSGCGLGCKLNLDPKTEVTKFVKNLINIESPSEETNILGQXXXXXXXXXXXXTYKDVIFPVRQHMAWTSDLCQTVTVIIGNRNWMLRNGILVDDEVDELMSEDENLGRTVILMAI-DNELIAMISVADQVKREAALAVYTLKKMNIEVYLMTGDNSKTATAIARQVGIHYVFAEVLPSHKVAKVQQLQNTNRSLTSKRKMKVAMVGDGINDSPALAQSDVGIAIGTGTDVAVEAADVVLIRNSLLDVIAAIQLSKATVKRIRQNFIAATLYNLLGIPIAAGVLMPIGIEMMPWMXXXXXXXXXXXXXXXXXXXXXWKKPSEEKL 3930
            ++ L S  +KV+GMTC SCV++IE+ +    GV  I VSL    AT+IFD    + E +S  I++MGF+ +      + V      +++   S +  +  +     LS    ++  C+  +  D+ H +   S  ++S ++ S++   L L    T +        + +RV GMTC SCV  IE  +GK  GI  +KV LE  EA  +    L     + E I   GF             S   +E F DS      + S++ E          + TT+V+  +K + C   +  I++++  LPGV    V+L +E   I YD  K  V  +++ IE+L    +  E P         +    S  Q+   +L     +   S   + I GMTC+SCV  +E  + + +GV S                                                    VLVAL+A K E+ Y+   + P ++   VKELGF A V+EN       + +++RGMTC+SCV+ IE+++ K KGI   +V+L+T+   +++     GPRD+I  I ++GF ASL    + + +  DH ++ I+QWR SF  SLI  +P M +M++ M     +  +  H N +  +R    ST+ +   +  GLS  NL+ F+   PVQF G RYFYIQAY +LKHK+ NMDVL+V+ATS+++ YS++V++++M  R   +P TFF+T PML VF+SLGRWLE IAK KTSEAL+KLMSLQA EAT+     +N    E ++ + LVQR D++K++PG K PVDG+V+ G S  DESLITGE+MP+ K  GS VI GSIN++G L+V ATHVG D+ L+QIVKLVEEAQTSKAPIQQ AD+I+G FVP ++  +++TLI+W+I+GF       +  P Y   +S TE     AFQ +ITVL IACPC LGLATPTAVMVGTGVGA NGILIKGGEPLE  HK+  IVFDKTGTIT G+P V +   ++  G +  + +LL I+  AE+ SEHP+G AI  + K  +  E+L    +  AV GCG+ C+++ + +T V +        +S SE+ N     +    +     +   +I   +   +  +DL     V+IGNR WM RN + +  E+DE M E E  GRT +L+++  + L AMI+++D VK EA LAV TL  M +EV LMTGDNSKTA  IA QVGI  VFAEVLPSHKVAKV+QLQ   +         VAMVGDG+NDSPALA +DVGIAIGTGTDVA+EAADVVLIRN LLDV+ +I LSK TVKRIR NF+ A +YNL+GIPIAAGV +PIG+ + PWM SAAMA SSVSVV  SLLLK + KP+ EKL
Sbjct:    4 KVNLCSVALKVEGMTCGSCVQSIEQRIGSLPGVIHIRVSLEQKTATLIFDQGQQSPESLSEAIEDMGFESSFPDGSTATVVS--TETQLIPTSALAPAAHQEAREKLSQTKGVLEVCESPSQKDL-HITFAPS--LISTLELSKVVESLTLADVQTSKMKDDGVALLKLRVEGMTCHSCVTTIEGKIGKLNGIQKVKVVLESKEATIIYLPYLITHQSIVEQIAFAGFKASVKSKPKPLQLSNRDIERFADSQKATLTSPSEETEVF--------IDTTLVLLGVKGMHCRSCVVNIQDNISLLPGVSSVEVSLEKEQATICYDPHKVTVSALQQAIEALPPGNFKVEAPGSTNPVTSARAQPASVTQAKPAALQPCCTQPLVSTVNIHIEGMTCNSCVQSIEGMISQRKGVVSAQVSLADHQGIFEYDPLLTSPQELREAVEDMGFDAFLPGKSKKSGKGLWIYFVLVALMASKAEVRYNPEVIDPPRIVECVKELGFTASVMENYEGSDRNLELVVRGMTCASCVHKIESNLMKEKGIEYASVALATNIAHIKFDSEVLGPRDIIKLIENLGFKASLVKR-DRSASHLDH-SKEIRQWRKSFLISLIFCVPVMGMMIYMMVMDHHMNASH-HHNATVEDRNHYHSTMFLERQLFPGLSIMNLLSFIFCVPVQFIGGRYFYIQAYKALKHKSANMDVLIVLATSVAFSYSLVVLIVAMVERAKVNPITFFDTPPMLFVFISLGRWLEQIAKSKTSEALSKLMSLQATEATVVALGSDNVILSEEQVDVELVQRGDVVKVVPGGKFPVDGRVLEGHSMADESLITGEAMPVTKKPGSTVIAGSINQNGSLLVSATHVGMDTTLSQIVKLVEEAQTSKAPIQQYADKISGYFVPFIVAVSLLTLIVWIIIGFLDFSLVKKYFPGYDKSISTTETVIRFAFQTSITVLCIACPCCLGLATPTAVMVGTGVGAQNGILIKGGEPLEMAHKVQAIVFDKTGTITYGAPKVVQVKTVV-EGNKMPLSRLLAIVGTAENNSEHPLGAAITKYCKQELGTESLGTCTDFQAVPGCGVRCQVS-NTETVVKQG-------DSDSEDNNHWNSVLVQISDTRTSSSSHPLIMDPQPLSSGPTDL---YVVLIGNREWMRRNFLEITAEIDEAMMEHERRGRTAVLVSLCADMLCAMIAISDTVKPEAELAVQTLTNMGLEVVLMTGDNSKTARVIAAQVGIRKVFAEVLPSHKVAKVEQLQQAGKI--------VAMVGDGVNDSPALAMADVGIAIGTGTDVAIEAADVVLIRNDLLDVVGSIDLSKKTVKRIRINFVFALIYNLVGIPIAAGVFLPIGLVLQPWMGSAAMALSSVSVVVSSLLLKCYTKPTAEKL 1355          
BLAST of Copper-transporting ATPase 1 vs. Ensembl Medaka
Match: ENSORLT00000013512.2 (sarcoplasmic/endoplasmic reticulum calcium ATPase 2 [Source:NCBI gene;Acc:101161069])

HSP 1 Score: 85.5001 bits (210), Expect = 2.988e-16
Identity = 57/197 (28.93%), Postives = 92/197 (46.70%), Query Frame = 1
Query: 3250 DELMSEDENLGRTVILMAIDNELIAMISVADQVKREAALAVYTLKKMNIEVYLMTGDNSKTATAIARQVGIH-------------------------------YVFAEVLPSHKVAKVQQLQNTNRSLTSKRKMKVAMVGDGINDSPALAQSDVGIAIGTGTDVAVEAADVVLIRNSLLDVIAAIQLSKATVKRIRQ 3747
            D L+ ED       I    D   +  + + D  + E A ++   +   I V ++TGDN  TA AI R++GI                                  FA V P+HK   V+ LQ+ +           AM GDG+ND+PAL +S++GIA+G+GT VA  A+++VL  ++   ++AA++  +A    ++Q
Sbjct:  572 DRLVLEDST---RFIEYETDLTFVGCVGMLDPPRAEVAASIRLCRLAGIRVIMITGDNKGTAVAICRRIGIFGEEDDVSSMAFTGREFDDLSPAAQREAVVKARCFARVEPAHKSKIVEYLQSYDEI--------TAMTGDGVNDAPALKKSEIGIAMGSGTAVAKSASEMVLADDNFATIVAAVEEGRAIYNNMKQ 757          
BLAST of Copper-transporting ATPase 1 vs. Ensembl Medaka
Match: ENSORLT00000013513.2 (sarcoplasmic/endoplasmic reticulum calcium ATPase 2 [Source:NCBI gene;Acc:101161069])

HSP 1 Score: 85.1149 bits (209), Expect = 3.855e-16
Identity = 57/197 (28.93%), Postives = 92/197 (46.70%), Query Frame = 1
Query: 3250 DELMSEDENLGRTVILMAIDNELIAMISVADQVKREAALAVYTLKKMNIEVYLMTGDNSKTATAIARQVGIH-------------------------------YVFAEVLPSHKVAKVQQLQNTNRSLTSKRKMKVAMVGDGINDSPALAQSDVGIAIGTGTDVAVEAADVVLIRNSLLDVIAAIQLSKATVKRIRQ 3747
            D L+ ED       I    D   +  + + D  + E A ++   +   I V ++TGDN  TA AI R++GI                                  FA V P+HK   V+ LQ+ +           AM GDG+ND+PAL +S++GIA+G+GT VA  A+++VL  ++   ++AA++  +A    ++Q
Sbjct:  572 DRLVLEDST---RFIEYETDLTFVGCVGMLDPPRAEVAASIRLCRLAGIRVIMITGDNKGTAVAICRRIGIFGEEDDVSSMAFTGREFDDLSPAAQREAVVKARCFARVEPAHKSKIVEYLQSYDEI--------TAMTGDGVNDAPALKKSEIGIAMGSGTAVAKSASEMVLADDNFATIVAAVEEGRAIYNNMKQ 757          
BLAST of Copper-transporting ATPase 1 vs. Planmine SMEST
Match: SMESG000039812.1 (SMESG000039812.1)

HSP 1 Score: 2625.89 bits (6805), Expect = 0.000e+0
Identity = 1379/1385 (99.57%), Postives = 1382/1385 (99.78%), Query Frame = 1
Query:   91 MKLGSARMKVDGMTCMSCVRNIEENLMKFTGVCGIMVSLLHAEATVIFDADIATVEDISNKIDEMGFDVTVKSSEVSNVKDKVVRSRIKFESDINKSVEKSIETSLSSKLLLVRFCQENNYADIWHYSSIRSTEILSVIQQSEIYGVLVLEQCPTIRVIVRVNGMTCQSCVDNIESTVGKKQGIISIKVFLEKSEAHALVDASLAGPDVEEMINDMGFNSEMILEIFNDSCAGKPNNVSQKYEELKSNTIYPILSTTIVIKALKSIFCIFKIENHMRALPGVDKCSVNLIEEIGMIDYDSGKWNVQKIREEIESLGYLTELPKQNWNSTRQSSAVSLNEESRSKCYLRITGMTCSSCVNKVESHLLKVEGVKSVLVALLAMKCEIIYDSAYVMPFQLSNRVKELGFNAEVIENGNEGIGIVNVLIRGMTCSSCVNHIENHISKIKGIASINVSLSTSKGKVEYFISECGPRDVIDAINDMGFDASLCDHLESNHAAADHINQMIKQWRSSFFFSLICGIPXXXXXXXXXXXXXXXXHTIIHENGSNRTIMKSTVPMVCSGLSADNLILFVLATPVQFYGARYFYIQAYLSLKHKTTNMDVLVVMATXXXXXXXXXXXXXXMAFRRNTSPKTFFETSPMLIVFLSLGRWLEHIAKGKTSEALTKLMSLQAVEATLYTPENKERKIPINLVQRNDLIKILPGEKIPVDGKVVTGTSTCDESLITGESMPIEKTHGSDVIGGSINKSGMLIVKATHVGSDSALAQIVKLVEEAQTSKAPIQQLADRIAGMFVPSVLICAIITLIIWVIVGFSKPEILPKYVNELSVTEITWEHAFQLAITVLSIACPCSLGLXXXXXXXXXXXXXXXNGILIKGGEPLENIHKLNVIVFDKTGTITNGSPSVTRFLVLIGNGVREHIDKLLKILAAAESASEHPIGKAIITFSKARISNENLPEVLESSAVSGCGLGCKLNLDPKTEVTKFVKNLINIESPSEETNILGQXXXXXXXXXXXXTYKDVIFPVRQHMAWTSDLCQTVTVIIGNRNWMLRNGILVDDEVDELMSEDENLGRTVILMAIDNELIAMISVADQVKREAALAVYTLKKMNIEVYLMTGDNSKTATAIARQVGIHYVFAEVLPSHKVAKVQQLQNTNRSLTSKRKMKVAMVGDGINDSPALAQSDVGIAIGTGTDVAVEAADVVLIRNSLLDVIAAIQLSKATVKRIRQNFIAATLYNLLGIPIAAGVLMPIGIEMMPWMXXXXXXXXXXXXXXXXXXXXXWKKPSEEKLITPEYINFIQSSGLSESQIIVRRGIDLMTPQIETTSSLKGSVKSVLGKLNFSNKSKHKSDKLDSCRFLRNSDRTKVSTSTEESDIDIEIGLLSKNKLDLDLTTNM 4245
            MKLGSARMKVDGMTCMSCVRNIEENLMKFTGVCGIMVSLL AEATVIFDADIATVEDISNKIDEMGFDVTVKSSEVSNVKDKVVRSRIKFESDINKSVEKSIETSLSSKLLLVRFCQENNYADIWHYSSIRSTEILSVIQQSEIYGVLVLEQCPTIRVIVRVNGMTCQSCVDNIESTVGKKQGIISIKVFLEKSEAHALVDASLAGPDVEEMINDMGFNSEMILEIFNDSCAGKPNNVSQKYEELKSNTIYPILSTTIVIKALKSIFCIFKIENHMRALPGVDKCSVNLIEEIGMIDYDSGKWNVQKIREEIESLGYLTELPKQNWNSTRQSSAVSLNEESRSKCYLRITGMTCSSCVNKVESHLLKVEGVKSVLVALLAMKCEIIYDSAYVMPFQLSNRVKELGFNAEVIENGNEGIG+VNVLIRGMTCSSCVNHIENHISKIKGIASINVSLSTSKGKVEYFISECGPRDVIDAINDMGFDASLCDHLESNHAAADHINQMIKQWRSSFFFSLICGIPTMFVMMFTMFNFKMVKHTIIHENGSNRTIM+STVPMVCSGLSADNLILFVLATPVQFYGARYFYIQAYLSLKHKTTNMDVLVVMATSISYIYSVIVIVISMAFRRNTSPKTFFETSPMLIVFLSLGRWLEHIAKGKTSEALTKLMSLQAVEATLYTPENKERKIPINLVQRNDLIKILPGEKIPVDGKVVTGTSTCDESLITGESMPIEKTHGSDVIGGSINKSGMLIVKATHVGSDSALAQIVKLVEEAQTSKAPIQQLADRIAGMFVPSVLICAIITLIIWVIVGFSKPEILPKYVNELSVTEITWEHAFQLAITVLSIACPCSLGLATPTAVMVGTGVGAVNGILIKGGEPLENIHKLNVIVFDKTGTITNGSPSVTRFLVLIGNGVREHIDKLLKILAAAESASEHPIGKAIITFSKARISNENLPEVLESSAVSGCGLGCKLNLDPKTEVTKFVKNLINIESPSEETNILGQNMNININDDIRITYKDVIFPVRQHMAWTSDLCQTVTVIIGNRNWM RNGILVDDEVDELMSEDENLGRTVILMAIDNELIAMISVADQVKREAALAVYTLKKMNIEVYLMTGDNSKTATAIARQVGIHYVFAEVLPSHKVAKVQQLQNTNRSLTSKRKMKVAMVGDGINDSPALAQSDVGIAIGTGTDVAVEAADVVLIRNSLLDVIAAIQLSKATVKRIRQNFIAATLYNLLGIPIAAGVLMPIGIEMMPWMASAAMAASSVSVVTLSLLLKLWKKPSEEKLITPEYINFIQSSGLSESQIIVRRGIDLMTPQIETTSSLKGSVKSVLGKLNFSNKSKHKSDKLDSCR LRNSDRTKVSTSTEESDIDIEIGLLS+NKLDLDLTTNM
Sbjct:    1 MKLGSARMKVDGMTCMSCVRNIEENLMKFTGVCGIMVSLLQAEATVIFDADIATVEDISNKIDEMGFDVTVKSSEVSNVKDKVVRSRIKFESDINKSVEKSIETSLSSKLLLVRFCQENNYADIWHYSSIRSTEILSVIQQSEIYGVLVLEQCPTIRVIVRVNGMTCQSCVDNIESTVGKKQGIISIKVFLEKSEAHALVDASLAGPDVEEMINDMGFNSEMILEIFNDSCAGKPNNVSQKYEELKSNTIYPILSTTIVIKALKSIFCIFKIENHMRALPGVDKCSVNLIEEIGMIDYDSGKWNVQKIREEIESLGYLTELPKQNWNSTRQSSAVSLNEESRSKCYLRITGMTCSSCVNKVESHLLKVEGVKSVLVALLAMKCEIIYDSAYVMPFQLSNRVKELGFNAEVIENGNEGIGVVNVLIRGMTCSSCVNHIENHISKIKGIASINVSLSTSKGKVEYFISECGPRDVIDAINDMGFDASLCDHLESNHAAADHINQMIKQWRSSFFFSLICGIPTMFVMMFTMFNFKMVKHTIIHENGSNRTIMRSTVPMVCSGLSADNLILFVLATPVQFYGARYFYIQAYLSLKHKTTNMDVLVVMATSISYIYSVIVIVISMAFRRNTSPKTFFETSPMLIVFLSLGRWLEHIAKGKTSEALTKLMSLQAVEATLYTPENKERKIPINLVQRNDLIKILPGEKIPVDGKVVTGTSTCDESLITGESMPIEKTHGSDVIGGSINKSGMLIVKATHVGSDSALAQIVKLVEEAQTSKAPIQQLADRIAGMFVPSVLICAIITLIIWVIVGFSKPEILPKYVNELSVTEITWEHAFQLAITVLSIACPCSLGLATPTAVMVGTGVGAVNGILIKGGEPLENIHKLNVIVFDKTGTITNGSPSVTRFLVLIGNGVREHIDKLLKILAAAESASEHPIGKAIITFSKARISNENLPEVLESSAVSGCGLGCKLNLDPKTEVTKFVKNLINIESPSEETNILGQNMNININDDIRITYKDVIFPVRQHMAWTSDLCQTVTVIIGNRNWMQRNGILVDDEVDELMSEDENLGRTVILMAIDNELIAMISVADQVKREAALAVYTLKKMNIEVYLMTGDNSKTATAIARQVGIHYVFAEVLPSHKVAKVQQLQNTNRSLTSKRKMKVAMVGDGINDSPALAQSDVGIAIGTGTDVAVEAADVVLIRNSLLDVIAAIQLSKATVKRIRQNFIAATLYNLLGIPIAAGVLMPIGIEMMPWMASAAMAASSVSVVTLSLLLKLWKKPSEEKLITPEYINFIQSSGLSESQIIVRRGIDLMTPQIETTSSLKGSVKSVLGKLNFSNKSKHKSDKLDSCRLLRNSDRTKVSTSTEESDIDIEIGLLSENKLDLDLTTNM 1385          
BLAST of Copper-transporting ATPase 1 vs. Planmine SMEST
Match: SMESG000058134.1 (SMESG000058134.1)

HSP 1 Score: 986.867 bits (2550), Expect = 0.000e+0
Identity = 575/1056 (54.45%), Postives = 769/1056 (72.82%), Query Frame = 1
Query: 1018 EEIESLGYLTELPKQNWNSTRQSSAVSLNEESRSKCYLRITGMTCSSCVNKVESHLLKVEGVKSVLVALLAMKCEIIYDSAYVMPFQLSNRVKELGFNAEVIENGNEGIGIVNVLIRGMTCSSCVNHIENHISKIKGIASINVSLSTSKGKVEYFISECGPRDVIDAINDMGFDASLCDHLESNHAAADHINQMIKQWRSSFFFSLICGIPXXXXXXXXXXXXXXXXHTIIHENGSNRTIMKSTVPMVCSGLSADNLILFVLATPVQFYGARYFYIQAYLSLKHKTTNMDVLVVMATXXXXXXXXXXXXXXMAFRRNTSPKTFFETSPMLIVFLSLGRWLEHIAKGKTSEALTKLMSLQAVEATLYTPENKERKIPINLVQRNDLIKILPGEKIPVDGKVVTGTSTCDESLITGESMPIEKTHGSDVIGGSINKSGMLIVKATHVGSDSALAQIVKLVEEAQTSKAPIQQLADRIAGMFVPSVLICAIITLIIWVIVGFSKPEILPKYVN-ELSVTEITWEHAFQLAITVLSIACPCSLGLXXXXXXXXXXXXXXXNGILIKGGEPLENIHKLNVIVFDKTGTITNGSPSVTRFLVLIGNGVREHIDKLLKILAAAESASEHPIGKAIITFSKARISNENLPEVLESSAVSGCGLGCKLNLD-----PKTEVTKFVKNLINIESPSEETNILGQXXXXXXXXXXXXTYKDVIFPVRQHMAWTSDLCQTVTVIIGNRNWMLRNGILVDDEVDELMSEDENLGRTVILMAIDNELIAMISVADQVKREAALAVYTLKKMNIEVYLMTGDNSKTATAIARQVGIHYVFAEVLPSHKVAKVQQLQNTNR-------SLTSK--RKMKVAMVGDGINDSPALAQSDVGIAIGTGTDVAVEAADVVLIRNSLLDVIAAIQLSKATVKRIRQNFIAATLYNLLGIPIAAGVLMPIGIEMMPWMXXXXXXXXXXXXXXXXXXXXXWKKPSEEKLITPEYINFIQSSGLSESQIIVRRGIDLMTPQIETTSSLKGSVKSVLGKLNFSNKSKHKSDKLDSCRFLRN 4140
            E IE+LG+L        N  +++     N +   KC++RI GMTCSSCV+ +E+ +LK++GVKS L+ LL+   E+ YD   +M   +++ + ++GF+AE+ +       I+ V+I+GMTCSSCV  IE+ +++++GI S+ V+L+T KGK ++      PRD++DAI +MGFDA L    +  +   DH+ + IK+W+ SF  SLI G+PTM VMM  M+ F      I  +NG N T+M S  P++  GLS +NL+LF+ ++PVQFYGARYFY+QAY S+KH + NMDVLVVMATS+SYIYS IVI++SM  R+++SP+TFFET+PMLIVFLSLGRWLEHIAKGKTSEAL+KL+SLQA EAT+   +N+ERKI ++LV++ DL+K+LPGEKIP+DG+VV+G S CDESLITGESM +EK  GSDVIGG++N SGMLI++AT VG DSAL QIVKLVEEAQTSKAPIQ+LAD++AG+FVP V+IC++ TL+IW+ +G++ P +LP + +     TE+ W++AFQLAITVLS+ACPCSLGLATPTAVMVGTGVGA+NGILIKGG PLE +H+L+VIVFDKTGTIT G PSVT F++ + N   +  + +L +L AAES+SEHPIGKAI+ + +       +P+V+ S +VSG GL C L L      P +E+   +  + + +  +   N+           +  + ++ +  PV             V + +GNRN M  N I + D++DELMS DE+ GRTV+LMAID  L+AMIS+ADQVK+EAAL VYTL+KM +EV+L+TGDN KTATAIA+++GI  VFAEVLPSHKVAK+QQ+QN ++       S  SK  +   VAMVGDGINDSPALAQ+DVGIAIGTGTDVAVEAADVVLIRNSLLDVIAA++LSK TV+RIRQNF+AAT+YNL+GIPIAAG LMPIG+  MPWMAS AMAASS+ VV LSLLLKLWKKP+E++L   E+ N ++     + ++ V  G D++ P+ +   S + S+ S+   +  S K  + SD++      +N
Sbjct:   62 EAIENLGFLI-------NKNKETD----NTKELFKCHMRIQGMTCSSCVHTIENQVLKLKGVKSALINLLSTIGEVTYDPDLIMASDIADTINDMGFDAEIFQFKEHTKDIIEVMIQGMTCSSCVYTIESKLAQMQGILSVKVALTTEKGKFKFDPQIISPRDILDAIEEMGFDAKLAP--KKTNKYNDHVGESIKKWKHSFLISLIFGVPTMIVMMVFMYGFSHRMQVIHLKNGINVTVMVSNAPILFPGLSLENLLLFLFSSPVQFYGARYFYVQAYKSIKHGSANMDVLVVMATSVSYIYSFIVILVSMILRQDSSPQTFFETTPMLIVFLSLGRWLEHIAKGKTSEALSKLLSLQAFEATIIVNDNQERKISVDLVKKGDLVKVLPGEKIPIDGRVVSGKSRCDESLITGESMSVEKIPGSDVIGGTLNISGMLIIRATLVGEDSALNQIVKLVEEAQTSKAPIQELADKVAGLFVPGVIICSMFTLLIWIAIGYTNPNLLPGHSSINTDNTELIWKYAFQLAITVLSVACPCSLGLATPTAVMVGTGVGAINGILIKGGVPLEKMHQLDVIVFDKTGTITTGKPSVTNFVMCVENVTSQIRNCILLMLGAAESSSEHPIGKAILQYVRETCDINEMPQVVHSKSVSGFGLECSLKLQSDMFVPDSEIDNVLVKINDFQENNLTENL----------KETSVKWRKINEPVE------------VVLYLGNRNMMKENHISIPDKLDELMSRDEDNGRTVVLMAIDKVLLAMISIADQVKKEAALVVYTLEKMGVEVFLLTGDNHKTATAIAKEIGIRNVFAEVLPSHKVAKIQQIQNMSKYKRSWLFSCCSKPSKLTNVAMVGDGINDSPALAQADVGIAIGTGTDVAVEAADVVLIRNSLLDVIAAMKLSKDTVRRIRQNFVAATMYNLIGIPIAAGALMPIGVVFMPWMASVAMAASSICVVCLSLLLKLWKKPNEDQLANQEFKNHLECLKYGDMEVGVNLGKDIILPKRKPRRSFRSSISSLWSSMEISKKKPNVSDRIALLENFKN 1082          

HSP 2 Score: 75.0998 bits (183), Expect = 3.617e-13
Identity = 43/143 (30.07%), Postives = 71/143 (49.65%), Query Frame = 1
Query:  892 CIFKIENHMRALPGVDKCSVNLIEEIGMIDYDSGKWNVQKIREEIESLGYLTELPKQNWNSTRQSSAVSLNEESRSKCYLRITGMTCSSCVNKVESHLLKVEGVKSVLVALLAMKCEIIYDSAYVMPFQLSNRVKELGFNAEV 1320
            C+  IEN +  L GV    +NL+  IG + YD        I + I  +G+  E+                 E ++    + I GMTCSSCV  +ES L +++G+ SV VAL   K +  +D   + P  + + ++E+GF+A++
Sbjct:   98 CVHTIENQVLKLKGVKSALINLLSTIGEVTYDPDLIMASDIADTINDMGFDAEI-------------FQFKEHTKDIIEVMIQGMTCSSCVYTIESKLAQMQGILSVKVALTTEKGKFKFDPQIISPRDILDAIEEMGFDAKL 227          

HSP 3 Score: 60.077 bits (144), Expect = 1.268e-8
Identity = 43/169 (25.44%), Postives = 77/169 (45.56%), Query Frame = 1
Query:  568 VRVNGMTCQSCVDNIESTVGKKQGIISIKVFLEKSEAHALVDASL-AGPDVEEMINDMGFNSEMILEIFNDSCAGKPNNVSQKYEELKSNTIYPILSTTIVIKALKSIFCIFKIENHMRALPGVDKCSVNLIEEIGMIDYDSGKWNVQKIREEIESLGYLTELPKQNWN 1071
            +R+ GMTC SCV  IE+ V K +G+ S  + L  +      D  L    D+ + INDMGF++E+                  +++E   + I       ++I+ +    C++ IE+ +  + G+    V L  E G   +D    + + I + IE +G+  +L  +  N
Sbjct:   88 MRIQGMTCSSCVHTIENQVLKLKGVKSALINLLSTIGEVTYDPDLIMASDIADTINDMGFDAEIF-----------------QFKEHTKDII------EVMIQGMTCSSCVYTIESKLAQMQGILSVKVALTTEKGKFKFDPQIISPRDILDAIEEMGFDAKLAPKKTN 233          

HSP 4 Score: 59.6918 bits (143), Expect = 1.935e-8
Identity = 26/70 (37.14%), Postives = 41/70 (58.57%), Query Frame = 1
Query:   94 KLGSARMKVDGMTCMSCVRNIEENLMKFTGVCGIMVSLLHAEATVIFDADIATVEDISNKIDEMGFDVTV 303
            +L    M++ GMTC SCV  IE  ++K  GV   +++LL     V +D D+    DI++ I++MGFD  +
Sbjct:   82 ELFKCHMRIQGMTCSSCVHTIENQVLKLKGVKSALINLLSTIGEVTYDPDLIMASDIADTINDMGFDAEI 151          

HSP 5 Score: 53.5286 bits (127), Expect = 1.264e-6
Identity = 28/82 (34.15%), Postives = 42/82 (51.22%), Query Frame = 1
Query:  118 VDGMTCMSCVRNIEENLMKFTGVCGIMVSLLHAEATVIFDADIATVEDISNKIDEMGFDVTVKSSEVSNVKDKVVRSRIKFE 363
            + GMTC SCV  IE  L +  G+  + V+L   +    FD  I +  DI + I+EMGFD  +   + +   D V  S  K++
Sbjct:  166 IQGMTCSSCVYTIESKLAQMQGILSVKVALTTEKGKFKFDPQIISPRDILDAIEEMGFDAKLAPKKTNKYNDHVGESIKKWK 247          
BLAST of Copper-transporting ATPase 1 vs. Planmine SMEST
Match: SMESG000010260.1 (SMESG000010260.1)

HSP 1 Score: 83.5741 bits (205), Expect = 9.118e-16
Identity = 55/201 (27.36%), Postives = 99/201 (49.25%), Query Frame = 1
Query: 3316 LIAMISVADQVKREAALAVYTLKKMNIEVYLMTGDNSKTATAIARQVGIH-------------------------------YVFAEVLPSHKVAKVQQLQNTNRSLTSKRKMKV-AMVGDGINDSPALAQSDVGIAIGTGTDVAVEAADVVLIRNSLLDVIAAIQLSKATVKRIRQ---NFIAATLYNLLGIPIAAGVLMP 3813
             + ++ + D  + E   ++   +   I V ++TGDN  TA AI R++GI                                 +FA V P+HK   ++ LQ         R  ++ AM GDG+ND+PAL ++++GIA+G+GT VA  A+D+VL  ++   ++AA++  +A    ++Q     I++ +  ++ I + A + MP
Sbjct:  602 FVGLVGMLDPPRSEVLDSIGACRNAGIRVIVITGDNKATAEAICRRIGIFGEDESTVGKSYTGREFDQLSDFEQRNAVRNASLFARVEPAHKSKIIEHLQ---------RDGEISAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASDMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNIGEVVCIFLTAALGMP 793          
BLAST of Copper-transporting ATPase 1 vs. Planmine SMEST
Match: SMESG000039058.1 (SMESG000039058.1)

HSP 1 Score: 82.8037 bits (203), Expect = 1.410e-15
Identity = 54/200 (27.00%), Postives = 98/200 (49.00%), Query Frame = 1
Query: 3316 LIAMISVADQVKREAALAVYTLKKMNIEVYLMTGDNSKTATAIARQVGIH-------------------------------YVFAEVLPSHKVAKVQQLQNTNRSLTSKRKMKVAMVGDGINDSPALAQSDVGIAIGTGTDVAVEAADVVLIRNSLLDVIAAIQLSKATVKRIRQ---NFIAATLYNLLGIPIAAGVLMP 3813
            L+ ++ + D  + E   ++    K  I V ++TGDN  TA AI R++G+                                 +FA V P+HK   ++ LQ+             AM GDG+ND+PAL ++++GIA+G+GT VA  A+D+VL  ++   +++A++  +A    ++Q     I++ +  ++ I + A + MP
Sbjct:  593 LVGVVGMLDPPRSEVHDSIKKCYKAGIRVIVITGDNKATAEAICRRIGVFEENETTFGKSFTGREFDELSPEMQLDACRKAKLFARVEPAHKSKIIEYLQSDGHI--------SAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASDMVLSDDNFSSIVSAVEEGRAIYNNMKQFIRYLISSNIGEVVSIFLTAALGMP 784          
BLAST of Copper-transporting ATPase 1 vs. Planmine SMEST
Match: SMESG000039058.1 (SMESG000039058.1)

HSP 1 Score: 82.8037 bits (203), Expect = 1.480e-15
Identity = 54/200 (27.00%), Postives = 98/200 (49.00%), Query Frame = 1
Query: 3316 LIAMISVADQVKREAALAVYTLKKMNIEVYLMTGDNSKTATAIARQVGIH-------------------------------YVFAEVLPSHKVAKVQQLQNTNRSLTSKRKMKVAMVGDGINDSPALAQSDVGIAIGTGTDVAVEAADVVLIRNSLLDVIAAIQLSKATVKRIRQ---NFIAATLYNLLGIPIAAGVLMP 3813
            L+ ++ + D  + E   ++    K  I V ++TGDN  TA AI R++G+                                 +FA V P+HK   ++ LQ+             AM GDG+ND+PAL ++++GIA+G+GT VA  A+D+VL  ++   +++A++  +A    ++Q     I++ +  ++ I + A + MP
Sbjct:  590 LVGVVGMLDPPRSEVHDSIKKCYKAGIRVIVITGDNKATAEAICRRIGVFEENETTFGKSFTGREFDELSPEMQLDACRKAKLFARVEPAHKSKIIEYLQSDGHI--------SAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSASDMVLSDDNFSSIVSAVEEGRAIYNNMKQFIRYLISSNIGEVVSIFLTAALGMP 781          
The following BLAST results are available for this feature:
BLAST of Copper-transporting ATPase 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ATP7B1.245e-2742.96ATPase copper transporting beta [Source:HGNC Symbo... [more]
ATP7A3.598e-3247.09ATPase copper transporting alpha [Source:HGNC Symb... [more]
ATP7B1.190e-2045.51ATPase copper transporting beta [Source:HGNC Symbo... [more]
ATP7B1.004e-2741.12ATPase copper transporting beta [Source:HGNC Symbo... [more]
ATP7B8.222e-4854.12ATPase copper transporting beta [Source:HGNC Symbo... [more]
back to top
BLAST of Copper-transporting ATPase 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cua-11.160e-1842.12CU (Copper) ATPase [Source:UniProtKB/TrEMBL;Acc:G... [more]
cua-19.277e-1943.61CU (Copper) ATPase [Source:UniProtKB/TrEMBL;Acc:G... [more]
catp-34.640e-1726.52Cation transporting ATPase [Source:UniProtKB/TrEM... [more]
catp-25.628e-1726.55Cation transporting ATPase [Source:UniProtKB/TrEM... [more]
catp-26.007e-1726.55Cation transporting ATPase [Source:UniProtKB/TrEM... [more]
back to top
BLAST of Copper-transporting ATPase 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ATP75.848e-7441.59gene:FBgn0030343 transcript:FBtr0334454[more]
ATP75.848e-7441.59gene:FBgn0030343 transcript:FBtr0273257[more]
SERCA3.358e-1526.22gene:FBgn0263006 transcript:FBtr0343281[more]
SERCA3.664e-1526.22gene:FBgn0263006 transcript:FBtr0072216[more]
SERCA3.664e-1526.22gene:FBgn0263006 transcript:FBtr0072211[more]
back to top
BLAST of Copper-transporting ATPase 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
atp7b4.869e-2547.11ATPase copper transporting beta [Source:ZFIN;Acc:Z... [more]
atp7a2.632e-3343.68ATPase copper transporting alpha [Source:ZFIN;Acc:... [more]
atp7b8.564e-3246.91ATPase copper transporting beta [Source:ZFIN;Acc:Z... [more]
atp7a3.016e-3343.09ATPase copper transporting alpha [Source:ZFIN;Acc:... [more]
atp7a4.388e-3342.44ATPase copper transporting alpha [Source:ZFIN;Acc:... [more]
back to top
BLAST of Copper-transporting ATPase 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dhx344.723e-3944.75DEAH-box helicase 34 [Source:Xenbase;Acc:XB-GENE-1... [more]
dhx341.396e-3544.38DEAH-box helicase 34 [Source:Xenbase;Acc:XB-GENE-1... [more]
dhx348.704e-3644.18DEAH-box helicase 34 [Source:Xenbase;Acc:XB-GENE-1... [more]
dhx343.161e-3644.45DEAH-box helicase 34 [Source:Xenbase;Acc:XB-GENE-1... [more]
ATP7B2.722e-1144.00ATPase, Cu++ transporting, beta polypeptide [Sourc... [more]
back to top
BLAST of Copper-transporting ATPase 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Atp7b1.232e-2541.97ATPase, Cu++ transporting, beta polypeptide [Sourc... [more]
Atp7a2.165e-3447.66ATPase, Cu++ transporting, alpha polypeptide [Sour... [more]
Atp7a9.882e-3447.70ATPase, Cu++ transporting, alpha polypeptide [Sour... [more]
Atp7b5.379e-1945.04ATPase, Cu++ transporting, beta polypeptide [Sourc... [more]
Atp2a31.942e-1628.30ATPase, Ca++ transporting, ubiquitous [Source:MGI ... [more]
back to top
BLAST of Copper-transporting ATPase 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q64446|ATP7B_MOUSE8.619e-2541.97Copper-transporting ATPase 2 OS=Mus musculus OX=10... [more]
sp|P35670|ATP7B_HUMAN5.981e-2742.96Copper-transporting ATPase 2 OS=Homo sapiens OX=96... [more]
sp|Q04656|ATP7A_HUMAN1.728e-3147.09Copper-transporting ATPase 1 OS=Homo sapiens OX=96... [more]
sp|P49015|ATP7A_CRIGR2.534e-3243.93Copper-transporting ATPase 1 (Fragment) OS=Cricetu... [more]
sp|P70705|ATP7A_RAT1.190e-3247.32Copper-transporting ATPase 1 OS=Rattus norvegicus ... [more]
back to top
BLAST of Copper-transporting ATPase 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3JU271.017e-3647.84copper-transporting ATPase 1-like isoform X4 OS=Li... [more]
A0A1S3JU051.125e-5247.84copper-transporting ATPase 1-like isoform X2 OS=Li... [more]
A0A1S3JT411.125e-5247.84copper-transporting ATPase 1-like isoform X1 OS=Li... [more]
A0A1S3JD931.495e-4747.97copper-transporting ATPase 1 OS=Lingula unguis OX=... [more]
A0A1S3JTE77.465e-5348.01copper-transporting ATPase 1-like isoform X5 OS=Li... [more]
back to top
BLAST of Copper-transporting ATPase 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
atp7a2.038e-3244.17ATPase copper transporting alpha [Source:NCBI gene... [more]
atp7b2.015e-17653.32ATPase copper transporting beta [Source:ZFIN;Acc:Z... [more]
ENSAMXT00000010500.25.899e-1629.21pep primary_assembly:Astyanax_mexicanus-2.0:6:3629... [more]
ENSAMXT00000056792.19.129e-1629.21sarcoplasmic/endoplasmic reticulum calcium ATPase ... [more]
ENSAMXT00000016753.29.415e-1629.21sarcoplasmic/endoplasmic reticulum calcium ATPase ... [more]
back to top
BLAST of Copper-transporting ATPase 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
atp7b0.000e+050.07ATPase copper transporting beta [Source:ZFIN;Acc:Z... [more]
ENSPMAT00000002230.14.114e-6566.47pep scaffold:Pmarinus_7.0:GL493059:69:4752:-1 gene... [more]
ENSPMAT00000010051.11.008e-2327.09pep scaffold:Pmarinus_7.0:GL484878:2955:5956:-1 ge... [more]
ENSPMAT00000010373.13.646e-1428.18pep scaffold:Pmarinus_7.0:GL481096:3909:20014:1 ge... [more]
atp2c16.366e-1329.02ATPase secretory pathway Ca2+ transporting 1 [Sour... [more]
back to top
BLAST of Copper-transporting ATPase 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
CCC28.063e-13033.01Cu(+2)-transporting P-type ATPase; required for ex... [more]
PCA12.346e-5336.55Cadmium transporting P-type ATPase; may also have ... [more]
PMA21.939e-1924.60Plasma membrane H+-ATPase; isoform of Pma1p, invol... [more]
PMR12.880e-1630.98High affinity Ca2+/Mn2+ P-type ATPase; required fo... [more]
ENA22.622e-1529.47P-type ATPase sodium pump; involved in Na+ efflux ... [more]
back to top
BLAST of Copper-transporting ATPase 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO470801.236e-3244.91Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO434171.657e-5928.23Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO356163.902e-1635.44Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO474651.409e-1326.50Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO417753.879e-1228.21Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Copper-transporting ATPase 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
atp7a6.326e-4144.28copper-transporting ATPase 1 [Source:NCBI gene;Acc... [more]
atp7b8.576e-2946.11copper-transporting ATPase 2 [Source:NCBI gene;Acc... [more]
atp7a0.000e+042.36copper-transporting ATPase 1 [Source:NCBI gene;Acc... [more]
ENSORLT00000013512.22.988e-1628.93sarcoplasmic/endoplasmic reticulum calcium ATPase ... [more]
ENSORLT00000013513.23.855e-1628.93sarcoplasmic/endoplasmic reticulum calcium ATPase ... [more]
back to top
BLAST of Copper-transporting ATPase 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000039812.10.000e+099.57SMESG000039812.1[more]
SMESG000058134.13.617e-1354.45SMESG000058134.1[more]
SMESG000010260.19.118e-1627.36SMESG000010260.1[more]
SMESG000039058.11.410e-1527.00SMESG000039058.1[more]
SMESG000039058.11.480e-1527.00SMESG000039058.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30009791 ID=SMED30009791|Name=Copper-transporting ATPase 1|organism=Schmidtea mediterranea sexual|type=transcript|length=4394bp
TTTAATCTAGCATTTTAATATTTTAATTTAATTTATATAAATTTTTATTA
TTATATATATTTAAATATACATAGTATACTTGCAATCAGAATGAAATTGG
GGTCAGCTCGAATGAAAGTTGATGGAATGACATGCATGTCATGTGTTAGA
AACATAGAAGAAAATTTGATGAAATTCACTGGTGTTTGTGGAATAATGGT
GAGCTTGTTACATGCTGAAGCCACCGTAATTTTCGATGCCGATATTGCAA
CAGTTGAGGACATATCAAACAAGATCGACGAGATGGGGTTCGACGTAACA
GTGAAAAGTAGCGAGGTATCAAATGTTAAGGATAAAGTCGTCCGCAGCCG
CATTAAATTTGAGTCAGATATCAACAAAAGTGTTGAGAAATCAATCGAAA
CTTCATTATCATCAAAGTTATTGCTCGTTAGATTTTGCCAGGAAAATAAT
TATGCTGATATTTGGCATTATTCCAGCATCCGATCGACAGAAATCCTCTC
TGTGATCCAGCAAAGTGAGATATATGGAGTCTTAGTCCTTGAACAATGTC
CCACTATTCGTGTCATTGTCAGGGTGAATGGTATGACTTGTCAGTCTTGT
GTTGATAATATCGAATCTACTGTTGGTAAAAAGCAAGGAATCATTTCAAT
TAAAGTGTTCTTGGAGAAATCCGAAGCACATGCCTTAGTAGACGCAAGTC
TAGCTGGACCCGATGTTGAAGAGATGATCAATGATATGGGATTTAATTCA
GAGATGATATTAGAAATATTCAATGATTCGTGTGCAGGGAAGCCTAACAA
TGTTTCACAGAAATATGAAGAATTAAAATCTAACACAATCTATCCCATAT
TATCAACAACAATTGTCATTAAAGCGTTGAAATCCATATTCTGTATATTT
AAAATAGAGAATCATATGAGAGCTTTACCAGGAGTCGATAAATGTTCTGT
AAATCTTATCGAAGAAATTGGAATGATTGACTATGATTCTGGAAAATGGA
ATGTCCAGAAAATTCGGGAGGAAATCGAATCTTTGGGTTATCTAACAGAA
TTACCGAAACAAAACTGGAACAGCACTCGACAGTCTTCTGCGGTTTCTTT
GAATGAAGAATCAAGATCCAAATGTTATTTACGAATAACAGGAATGACTT
GCAGTTCTTGTGTGAATAAAGTTGAATCTCATTTATTGAAGGTTGAAGGA
GTTAAATCTGTATTGGTAGCTCTGTTAGCAATGAAATGTGAAATCATTTA
CGATTCGGCATATGTAATGCCATTTCAATTATCAAACAGAGTCAAGGAAT
TGGGCTTCAACGCCGAAGTCATTGAAAATGGCAATGAAGGAATAGGCATT
GTTAACGTATTGATACGAGGTATGACGTGTTCCAGCTGTGTTAATCATAT
TGAAAACCATATAAGTAAAATAAAAGGCATCGCGTCAATAAATGTATCAT
TATCAACATCCAAAGGGAAAGTTGAATATTTCATCAGTGAATGCGGCCCG
CGTGATGTGATTGATGCTATAAATGATATGGGATTCGATGCAAGTCTCTG
TGATCATCTAGAGTCAAATCATGCTGCTGCTGACCATATTAATCAAATGA
TAAAACAATGGAGAAGCTCATTTTTCTTTTCTTTGATATGTGGCATTCCA
ACTATGTTTGTAATGATGTTTACCATGTTTAATTTTAAAATGGTTAAACA
TACCATAATTCATGAAAATGGATCTAACAGAACTATAATGAAATCTACTG
TACCGATGGTATGCTCGGGTTTGTCGGCGGATAATTTGATTTTGTTTGTA
TTGGCTACACCGGTGCAATTTTATGGCGCGCGATATTTTTATATCCAAGC
ATATCTTTCACTGAAGCATAAAACAACGAATATGGATGTTCTTGTTGTCA
TGGCCACTAGCATATCTTATATCTATTCGGTAATCGTCATCGTGATCAGT
ATGGCATTTCGCAGGAACACTAGTCCAAAAACATTTTTTGAAACTTCACC
AATGCTAATAGTGTTCCTTTCTCTTGGAAGGTGGTTGGAACACATTGCTA
AAGGAAAAACCTCAGAGGCACTAACTAAACTTATGTCTTTACAGGCAGTA
GAAGCGACACTATATACGCCAGAAAATAAAGAACGGAAAATCCCAATTAA
TCTTGTTCAGCGAAATGATTTAATCAAGATTTTACCAGGAGAAAAAATCC
CAGTCGATGGAAAAGTAGTTACTGGCACATCTACTTGCGACGAATCACTG
ATCACCGGAGAATCTATGCCCATTGAAAAAACCCATGGATCAGATGTTAT
TGGGGGTTCCATCAATAAATCAGGAATGCTAATTGTAAAAGCTACTCATG
TCGGTTCAGATTCAGCTCTAGCACAAATTGTGAAGCTGGTCGAGGAAGCG
CAAACATCGAAGGCTCCAATTCAGCAATTAGCTGATCGAATTGCAGGAAT
GTTTGTTCCGTCTGTTTTGATATGTGCCATAATTACACTTATTATTTGGG
TCATCGTTGGATTTTCAAAGCCTGAAATTCTACCTAAATACGTGAATGAA
CTCTCTGTGACCGAAATAACATGGGAACATGCATTTCAACTTGCGATTAC
AGTGTTGAGTATAGCTTGTCCTTGTAGTTTAGGATTGGCCACCCCAACTG
CAGTAATGGTTGGCACTGGAGTTGGTGCTGTCAATGGTATCTTAATTAAA
GGTGGTGAACCCCTGGAAAATATTCACAAGTTGAATGTAATCGTTTTTGA
TAAAACTGGAACAATAACTAATGGATCCCCATCCGTTACCAGATTTCTAG
TGTTAATTGGGAATGGAGTACGTGAGCATATTGATAAATTACTTAAAATA
CTCGCGGCAGCGGAATCGGCGTCTGAACATCCAATTGGGAAAGCTATAAT
AACGTTTTCAAAAGCGAGAATATCCAATGAAAATTTACCCGAGGTACTAG
AGTCAAGCGCCGTCAGTGGTTGCGGATTGGGCTGTAAGCTTAATCTGGAT
CCAAAAACTGAAGTCACAAAATTTGTTAAGAATCTCATCAATATTGAGTC
GCCGAGTGAGGAAACTAATATATTAGGCCAAAACATGAACATTAATATCA
ATGATGATATTCGTATTACCTATAAGGATGTGATTTTCCCTGTTCGGCAG
CATATGGCTTGGACTAGTGACTTATGTCAAACGGTTACTGTTATTATTGG
TAACAGAAATTGGATGCTAAGAAACGGAATTCTAGTTGATGATGAAGTCG
ATGAACTCATGTCTGAGGATGAAAATCTTGGTCGCACAGTAATTTTAATG
GCGATTGACAATGAATTAATTGCCATGATTTCCGTGGCTGATCAAGTAAA
AAGAGAAGCGGCACTGGCTGTTTACACTCTAAAGAAAATGAATATTGAAG
TTTACCTAATGACTGGTGATAACAGTAAAACTGCAACCGCAATAGCTAGA
CAGGTGGGAATCCATTATGTGTTTGCAGAAGTATTACCATCGCATAAAGT
CGCTAAAGTGCAGCAGTTACAGAACACAAATCGTTCATTGACATCAAAAC
GAAAGATGAAAGTCGCGATGGTTGGTGATGGTATCAATGACAGTCCAGCT
TTAGCCCAGTCTGATGTTGGTATTGCTATTGGTACTGGAACTGACGTGGC
AGTAGAAGCTGCGGATGTTGTATTGATAAGAAACTCATTGCTCGACGTCA
TTGCAGCCATTCAATTGAGTAAAGCCACAGTGAAAAGAATCCGACAGAAT
TTTATAGCCGCTACATTGTATAATCTTTTAGGTATTCCAATAGCTGCCGG
TGTTCTTATGCCAATCGGAATAGAAATGATGCCTTGGATGGCATCAGCAG
CTATGGCTGCTAGTTCTGTTTCAGTGGTCACTCTGAGTCTTTTGTTAAAA
CTTTGGAAAAAGCCTTCCGAAGAGAAACTTATCACTCCAGAATATATCAA
TTTTATTCAATCGAGTGGATTATCAGAAAGTCAAATCATTGTTAGGCGAG
GCATTGATCTGATGACTCCACAAATCGAGACCACAAGTAGTCTTAAAGGC
AGTGTTAAAAGTGTTTTGGGCAAACTGAATTTCAGCAATAAGTCCAAGCA
TAAATCTGACAAACTCGATTCCTGCCGATTTCTCAGAAATTCAGATCGTA
CGAAAGTCAGTACAAGTACTGAGGAATCCGATATCGACATTGAAATTGGT
CTTTTGTCGAAAAATAAACTAGATCTAGATCTGACTACTAACATGTAACA
TGCGATTGGTTTCACTGTCTTCGATGTCTTTCGTCATCTGTTAAAATATT
TCCAATACAAAAGAATTTTACAGTTTCGATTGTATTGAACTTTTTTATTA
ATAAACTCTACCCATATTTCAATAACGGTCTGAATTTGTAACAG
back to top

protein sequence of SMED30009791-orf-1

>SMED30009791-orf-1 ID=SMED30009791-orf-1|Name=SMED30009791-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1386bp
MKLGSARMKVDGMTCMSCVRNIEENLMKFTGVCGIMVSLLHAEATVIFDA
DIATVEDISNKIDEMGFDVTVKSSEVSNVKDKVVRSRIKFESDINKSVEK
SIETSLSSKLLLVRFCQENNYADIWHYSSIRSTEILSVIQQSEIYGVLVL
EQCPTIRVIVRVNGMTCQSCVDNIESTVGKKQGIISIKVFLEKSEAHALV
DASLAGPDVEEMINDMGFNSEMILEIFNDSCAGKPNNVSQKYEELKSNTI
YPILSTTIVIKALKSIFCIFKIENHMRALPGVDKCSVNLIEEIGMIDYDS
GKWNVQKIREEIESLGYLTELPKQNWNSTRQSSAVSLNEESRSKCYLRIT
GMTCSSCVNKVESHLLKVEGVKSVLVALLAMKCEIIYDSAYVMPFQLSNR
VKELGFNAEVIENGNEGIGIVNVLIRGMTCSSCVNHIENHISKIKGIASI
NVSLSTSKGKVEYFISECGPRDVIDAINDMGFDASLCDHLESNHAAADHI
NQMIKQWRSSFFFSLICGIPTMFVMMFTMFNFKMVKHTIIHENGSNRTIM
KSTVPMVCSGLSADNLILFVLATPVQFYGARYFYIQAYLSLKHKTTNMDV
LVVMATSISYIYSVIVIVISMAFRRNTSPKTFFETSPMLIVFLSLGRWLE
HIAKGKTSEALTKLMSLQAVEATLYTPENKERKIPINLVQRNDLIKILPG
EKIPVDGKVVTGTSTCDESLITGESMPIEKTHGSDVIGGSINKSGMLIVK
ATHVGSDSALAQIVKLVEEAQTSKAPIQQLADRIAGMFVPSVLICAIITL
IIWVIVGFSKPEILPKYVNELSVTEITWEHAFQLAITVLSIACPCSLGLA
TPTAVMVGTGVGAVNGILIKGGEPLENIHKLNVIVFDKTGTITNGSPSVT
RFLVLIGNGVREHIDKLLKILAAAESASEHPIGKAIITFSKARISNENLP
EVLESSAVSGCGLGCKLNLDPKTEVTKFVKNLINIESPSEETNILGQNMN
ININDDIRITYKDVIFPVRQHMAWTSDLCQTVTVIIGNRNWMLRNGILVD
DEVDELMSEDENLGRTVILMAIDNELIAMISVADQVKREAALAVYTLKKM
NIEVYLMTGDNSKTATAIARQVGIHYVFAEVLPSHKVAKVQQLQNTNRSL
TSKRKMKVAMVGDGINDSPALAQSDVGIAIGTGTDVAVEAADVVLIRNSL
LDVIAAIQLSKATVKRIRQNFIAATLYNLLGIPIAAGVLMPIGIEMMPWM
ASAAMAASSVSVVTLSLLLKLWKKPSEEKLITPEYINFIQSSGLSESQII
VRRGIDLMTPQIETTSSLKGSVKSVLGKLNFSNKSKHKSDKLDSCRFLRN
SDRTKVSTSTEESDIDIEIGLLSKNKLDLDLTTNM*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0005524ATP binding
GO:0000166nucleotide binding
GO:0046872metal ion binding
GO:0005507copper ion binding
GO:0016787hydrolase activity
GO:0019829cation-transporting ATPase activity
Vocabulary: biological process
TermDefinition
GO:0098655cation transmembrane transport
GO:0030001metal ion transport
GO:0006812cation transport
GO:0099132ATP hydrolysis coupled cation transmembrane transport
Vocabulary: INTERPRO
TermDefinition
IPR006122HMA_Cu_ion-bd
IPR027256P-typ_ATPase_IB
IPR001757P_typ_ATPase
IPR036163HMA_dom_sf
IPR023298ATPase_P-typ_TM_dom_sf
IPR036412HAD-like_sf
IPR008250ATPase_P-typ_transduc_dom_A_sf
IPR023299ATPase_P-typ_cyto_dom_N
IPR023214HAD_sf
IPR006121HMA_dom
IPR017969Heavy-metal-associated_CS
IPR018303ATPase_P-typ_P_site
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePRINTSPR00942CUATPASEIcoord: 34..51
score: 41.11
coord: 581..606
score: 72.31
coord: 370..393
score: 48.75
coord: 16..34
score: 46.84
coord: 344..369
score: 50.77
coord: 561..581
score: 51.43
coord: 511..532
score: 36.36
coord: 399..419
score: 45.71
coord: 443..464
score: 38.18
NoneNo IPR availablePRINTSPR00119CATATPASEcoord: 717..731
score: 51.49
coord: 1161..1180
score: 60.41
coord: 885..899
score: 50.11
coord: 1100..1110
score: 42.9
coord: 1184..1196
score: 54.2
NoneNo IPR availablePFAMPF00122E1-E2_ATPasecoord: 667..863
e-value: 2.3E-47
score: 160.9
NoneNo IPR availableGENE3DG3DSA:3.30.70.100coord: 419..488
e-value: 3.4E-19
score: 71.0
NoneNo IPR availableGENE3DG3DSA:3.30.70.100coord: 156..224
e-value: 2.9E-13
score: 51.9
NoneNo IPR availablePFAMPF00702Hydrolasecoord: 882..1175
e-value: 2.1E-49
score: 168.7
NoneNo IPR availableGENE3DG3DSA:3.30.70.100coord: 342..415
e-value: 1.7E-18
score: 68.8
NoneNo IPR availableGENE3DG3DSA:3.30.70.100coord: 4..77
e-value: 7.5E-18
score: 66.6
NoneNo IPR availableGENE3DG3DSA:3.30.70.100coord: 255..321
e-value: 5.2E-11
score: 44.7
NoneNo IPR availableGENE3DG3DSA:2.70.150.20coord: 654..771
e-value: 7.5E-44
score: 150.5
NoneNo IPR availableSFLDSFLDG00002C1.7:_P-type_atpase_likecoord: 867..1212
e-value: 0.0
score: 166.9
NoneNo IPR availableSFLDSFLDF00027p-type_atpasecoord: 867..1212
e-value: 0.0
score: 166.9
NoneNo IPR availablePANTHERPTHR43520FAMILY NOT NAMEDcoord: 337..1279
NoneNo IPR availablePANTHERPTHR43520FAMILY NOT NAMEDcoord: 152..226
coord: 158..323
coord: 7..85
NoneNo IPR availablePANTHERPTHR43520:SF9COPPER-TRANSPORTING ATPASE 2coord: 158..323
NoneNo IPR availablePANTHERPTHR43520:SF9COPPER-TRANSPORTING ATPASE 2coord: 337..1279
NoneNo IPR availablePANTHERPTHR43520:SF9COPPER-TRANSPORTING ATPASE 2coord: 152..226
coord: 7..85
NoneNo IPR availableCDDcd02094P-type_ATPase_Cu-likecoord: 511..1243
e-value: 0.0
score: 872.57
NoneNo IPR availableTMHMMTMhelixcoord: 784..806
NoneNo IPR availableTMHMMTMhelixcoord: 1221..1243
NoneNo IPR availableTMHMMTMhelixcoord: 510..532
NoneNo IPR availableTMHMMTMhelixcoord: 1247..1269
NoneNo IPR availableTMHMMTMhelixcoord: 600..622
NoneNo IPR availableTMHMMTMhelixcoord: 847..869
NoneNo IPR availableTMHMMTMhelixcoord: 566..585
IPR006122Heavy metal-associated domain, copper ion-bindingTIGRFAMTIGR00003TIGR00003coord: 8..69
e-value: 3.4E-12
score: 44.4
coord: 424..484
e-value: 4.3E-11
score: 40.9
coord: 160..219
e-value: 1.3E-11
score: 42.5
coord: 347..408
e-value: 4.5E-8
score: 31.2
IPR006121Heavy metal-associated domain, HMAPFAMPF00403HMAcoord: 8..68
e-value: 2.1E-11
score: 44.1
coord: 160..197
e-value: 1.4E-5
score: 25.5
coord: 347..405
e-value: 4.4E-9
score: 36.7
coord: 424..483
e-value: 9.5E-11
score: 42.0
IPR006121Heavy metal-associated domain, HMAPROSITEPS50846HMA_2coord: 420..486
score: 19.906
IPR006121Heavy metal-associated domain, HMAPROSITEPS50846HMA_2coord: 5..71
score: 20.035
IPR006121Heavy metal-associated domain, HMAPROSITEPS50846HMA_2coord: 255..321
score: 12.606
IPR006121Heavy metal-associated domain, HMAPROSITEPS50846HMA_2coord: 344..410
score: 19.777
IPR006121Heavy metal-associated domain, HMAPROSITEPS50846HMA_2coord: 157..222
score: 17.24
IPR006121Heavy metal-associated domain, HMACDDcd00371HMAcoord: 8..70
e-value: 1.5108E-14
score: 67.2457
IPR006121Heavy metal-associated domain, HMACDDcd00371HMAcoord: 425..485
e-value: 6.21578E-15
score: 68.4013
IPR006121Heavy metal-associated domain, HMACDDcd00371HMAcoord: 347..409
e-value: 1.2398E-11
score: 59.1565
IPR006121Heavy metal-associated domain, HMACDDcd00371HMAcoord: 160..218
e-value: 3.79994E-12
score: 60.6973
IPR006121Heavy metal-associated domain, HMACDDcd00371HMAcoord: 268..317
e-value: 1.20566E-6
score: 44.9041
IPR027256P-type ATPase, subfamily IBTIGRFAMTIGR01525TIGR01525coord: 598..1269
e-value: 9.0E-191
score: 633.5
IPR001757P-type ATPaseTIGRFAMTIGR01494TIGR01494coord: 639..911
e-value: 3.1E-34
score: 116.2
coord: 1059..1240
e-value: 1.4E-37
score: 127.2
IPR023299P-type ATPase, cytoplasmic domain NGENE3DG3DSA:3.40.1110.10coord: 897..1081
e-value: 4.0E-38
score: 132.6
IPR023299P-type ATPase, cytoplasmic domain NSUPERFAMILYSSF81660Metal cation-transporting ATPase, ATP-binding domain Ncoord: 887..964
IPR017969Heavy-metal-associated, conserved sitePROSITEPS01047HMA_1coord: 349..379
IPR017969Heavy-metal-associated, conserved sitePROSITEPS01047HMA_1coord: 425..454
IPR017969Heavy-metal-associated, conserved sitePROSITEPS01047HMA_1coord: 10..39
IPR017969Heavy-metal-associated, conserved sitePROSITEPS01047HMA_1coord: 162..191
IPR018303P-type ATPase, phosphorylation sitePROSITEPS00154ATPASE_E1_E2coord: 887..893
IPR036163Heavy metal-associated domain superfamilySUPERFAMILYSSF55008HMA, heavy metal-associated domaincoord: 256..323
IPR036163Heavy metal-associated domain superfamilySUPERFAMILYSSF55008HMA, heavy metal-associated domaincoord: 6..73
IPR036163Heavy metal-associated domain superfamilySUPERFAMILYSSF55008HMA, heavy metal-associated domaincoord: 341..414
IPR036163Heavy metal-associated domain superfamilySUPERFAMILYSSF55008HMA, heavy metal-associated domaincoord: 154..221
IPR036163Heavy metal-associated domain superfamilySUPERFAMILYSSF55008HMA, heavy metal-associated domaincoord: 420..488
IPR023298P-type ATPase, transmembrane domain superfamilySUPERFAMILYSSF81665Calcium ATPase, transmembrane domain Mcoord: 634..872
IPR036412HAD-like superfamilySUPERFAMILYSSF56784HAD-likecoord: 883..1264
IPR008250P-type ATPase, A domain superfamilySUPERFAMILYSSF81653Calcium ATPase, transduction domain Acoord: 677..767