Laminin subunit alpha-2

Overview
NameLaminin subunit alpha-2
Smed IDSMED30009787
Length (bp)9888
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Laminin subunit alpha-2 (SMED30009787) t-SNE clustered cells

Violin plots show distribution of expression levels for Laminin subunit alpha-2 (SMED30009787) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Laminin subunit alpha-2 (SMED30009787) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Laminin subunit alpha-2 (SMED30009787) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30009787

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 19

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30009787SMESG000056016.1 SMESG000056013.1 dd_Smed_v4_7924_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30009787SMESG000056016.1 SMESG000056013.1 dd_Smed_v4_7924_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30009787SMESG000056016.1 SMESG000056013.1 dd_Smed_v4_7924_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30009787SMESG000056016.1 SMESG000056013.1 dd_Smed_v4_7924_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30009787SMESG000056016.1 SMESG000056013.1 dd_Smed_v4_7924_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30009787SMESG000056016.1 SMESG000056013.1 dd_Smed_v4_7924_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30009787SMESG000056016.1 SMESG000056013.1 dd_Smed_v4_7924_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30009787SMESG000056016.1 SMESG000056013.1 dd_Smed_v4_7924_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009787SMESG000056013.1 Contig12771newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009787SMESG000056013.1 Contig12771uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009787SMESG000056013.1 Contig21620newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009787SMESG000056013.1 Contig21620uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009787SMESG000056013.1 Contig39661newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009787SMESG000056013.1 Contig39661uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009787SMESG000056013.1 Contig36214newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009787SMESG000056013.1 Contig36214uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009787SMESG000056016.1 SMESG000056013.1 Contig29092newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009787SMESG000056016.1 SMESG000056013.1 Contig29092uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
gutSMED30009787SMESG000056016.1 SMESG000056013.1 dd_Smed_v4_7924_0_1dd_Smed_v4PMID:30962434
Cote et al., 2019
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Laminin subunit alpha-2 vs. Ensembl Human
Match: LAMA1 (laminin subunit alpha 1 [Source:HGNC Symbol;Acc:HGNC:6481])

HSP 1 Score: 754.592 bits (1947), Expect = 0.000e+0
Identity = 448/1182 (37.90%), Postives = 632/1182 (53.47%), Query Frame = 2
Query:  188 LMENAKITSSATCGTGGPEIFCRLVDEIAIQRLINPDSHVLCDVCD--NRNETKRHPIEFAKSDDDNLWWQSPSMAQGLKYQNVNVTIDLKQVYQIVYILLKMGDSPRPGNWILERSLDGEIYMPWIFFAETPYSC---YNLFQRQYPDLKLTTNAKPSSLADDEMFCTTYYSQPKSLNSGEIIISLINGRKSIMNEEYLSIKSVPQTLINFLSARYIRFRFLKHLTLAADLMT--HK--GYLEQSIYNRYYYSLRNIEIGGKCICNNHADKCDKVIENGISVAKCNCKHNTCGSNCETCCPLFNQRPWKPVAV-----CEECNCNRKSNECSYNQTVATLQLSVNKMGRMEGGGVCINCQENTEGINCEKCIKGFYRPWNVLATELYPCTPCQCHGLGTIGS-CVSNG--EDIGDQK-PGDCICKKGYEGVNCDLCSIGYERYPNGECLPCPCSIDGSVRTSFYRCKPPCNCKVHVNSDDLCKTCKNGYFNLDSANPEGCEPCYCFGITNQCSSLSAKNLKISDLKGWKLTTFTGEKIALP----KFTSFQYLTSENSYIDERFNNPTVYYWTAPPPYLGNWITSYGTIFRYVVKIELQ-STLKGSLIDSPDVIIKCGDFRLFHSVSIEDRRLQ--RQVFIYIKPTEWKIGKLTPDKAATKEEFISCLVKVDKLLIKAKYYSNQKSI-ELLNITLSRGEVH-LALDEMPHIEKCNCPPGFNGLSCESCESGYRRVNNVLYQGQCEACACYNHSNTCDSLNGECQNCTHNTAGAHCEDCASGYYGDAKSKNLNSCKKCPCPR--LDYQMTELCSSYSSENYVCHKCLHNTSGVHCDRCIEGYYGNPK-KKISCKRCKCNNNQES-----CDPVTGEC-RCSYNTMGTECQLCKHGFYGDALT-KSCKKCDCDSLGSTSENCDKLTGKCDCRTNFVNRQCDSCTSGLYLKDK--KCIPCNCEIQGRISSEKFCNTTSGQCFCLENVNGDRCEKCVEGYFNYPN--CKKCLCSPHALSADCDLNNGKCKCGSNVINRICDKCENLHY-WNNRTDCVPCNCGR-GSLNPKCDMETGNCKCAQNVARRDCSKCDVGYFGLDVTGCKKCPPC------YNGQVCNNE----------GICVCPPNTIGNLCNKCSEDSWDF--NETIGCKKCNCYINGSYSNICNKI 3550
            L  NA I+++ATCG  GPE+FC+LV+ +  + + NP     C +CD  + N  +RHPI  A  D  N WWQSPS+  G +Y  V +T+DL+QV+Q+ Y+++K  ++PRPGNWILERSLDG  + PW ++A +   C   YN+  R+ P         P+  ADDE+ CT+YYS+   L  GEI  SLINGR S    + LS K     L+ F SARYIR R  +  TL ADLMT  H+    L+  +  RYYYS+++I +GG CIC  HA  C    +      +C C+HNTCG +C  CCP ++Q+PW+P  V     CE CNC+ K+ +C Y+++VA  + S+N  G+  GGGVCINC +NT GINCE CI G+YRP  V   E  PC PC C  +G++ S C+ +    D+ + K PG C CK+GY G  CD C +GY+ YP   C+ C C+  GS   S   C  PC CK +V     C  CK G++NL   NP GC  C+CFG+++ CSSLS    +++ + GW +T     +  +P           ++  N+ + +R      YYW AP  YLGN +T++G   +Y V  ++   T+  +L+   DVIIK     L  S   E   LQ   +    ++            +   +++ ++ L  V  LLI+A Y S + ++  L +++L     + + L     +E C CP G+ G SCESC SGY RV+ +L+ G C+ C C+ H+  C+ ++G C  C HNT G HCE C  G+YG+        C+ C CP        +  C     +  VC  C    SG  C+RC +GYYGNP     SC  C C+ N +      CD VTGEC +C  NT G  C+ C  GFYGDA+T K+C+ C+C   GS S  C   TG CDC+ N   +QCD C  G Y  D    C PCNC + G +S    C T  GQC C+  V G RC++C  G++ Y +  C  C C PH  +  CD   G+C C  +     C++CE+ H+ ++    C  CNC   GS + +CD+ TG+C+C      R C +C +GY          C PC       +G  CN E          G C C  N  G  CN+C E ++    +  +GC  C C      S++C+++
Sbjct:   29 LASNAHISTNATCGEKGPEMFCKLVEHVPGRPVRNPQ----CRICDGNSANPRERHPISHAI-DGTNNWWQSPSIQNGREYHWVTITLDLRQVFQVAYVIIKAANAPRPGNWILERSLDGTTFSPWQYYAVSDSECLSRYNITPRRGP---------PTYRADDEVICTSYYSRLVPLEHGEIHTSLINGRPSA---DDLSPK-----LLEFTSARYIRLRLQRIRTLNADLMTLSHREPKELDPIVTRRYYYSIKDISVGGMCICYGHASSCP--WDETTKKLQCQCEHNTCGESCNRCCPGYHQQPWRPGTVSSGNTCEACNCHNKAKDCYYDESVAKQKKSLNTAGQFRGGGVCINCLQNTMGINCETCIDGYYRPHKVSPYEDEPCRPCNCDPVGSLSSVCIKDDLHSDLHNGKQPGQCPCKEGYTGEKCDRCQLGYKDYPT--CVSCGCNPVGSA--SDEPCTGPCVCKENVEG-KACDRCKPGFYNLKEKNPRGCSECFCFGVSDVCSSLSWPVGQVNSMSGWLVTDLISPR-KIPSQQDALGGRHQVSINNTAVMQRL--APKYYWAAPEAYLGNKLTAFGGFLKYTVSYDIPVETVDSNLMSHADVIIKGNGLTL--STQAEGLSLQPYEEYLNVVRLVPENFQDFHSKRQIDRDQLMTVLANVTHLLIRANYNSAKMALYRLESVSLDIASSNAIDLVVAADVEHCECPQGYTGTSCESCLSGYYRVDGILFGGICQPCECHGHAAECN-VHGVCIACAHNTTGVHCEQCLPGFYGEPSRGTPGDCQPCACPLTIASNNFSPTCHLNDGDEVVCDWCAPGYSGAWCERCADGYYGNPTVPGESCVPCDCSGNVDPSEAGHCDSVTGECLKCLGNTDGAHCERCADGFYGDAVTAKNCRACECHVKGSHSAVCHLETGLCDCKPNVTGQQCDQCLHGYYGLDSGHGCRPCNCSVAGSVSDG--C-TDEGQCHCVPGVAGKRCDRCAHGFYAYQDGSCTPCDC-PHTQNT-CDPETGECVCPPHTQGVKCEECEDGHWGYDAEVGCQACNCSLVGSTHHRCDVVTGHCQCKSKFGGRACDQCSLGYRDF-----PDCVPCDCDLRGTSGDACNLEQGLCGCVEETGACPCKENVFGPQCNECREGTFALRADNPLGCSPCFC---SGLSHLCSEL 1162          

HSP 2 Score: 397.512 bits (1020), Expect = 6.053e-110
Identity = 410/1680 (24.40%), Postives = 683/1680 (40.65%), Query Frame = 2
Query: 2573 KCLHNTSGVHCDRCIEGYYGNPKKKIS--CKRCKCNNNQESCDPVTGEC-RCSYNTMGTECQLCKHGFYGD---ALTKSCKKCDCD-SLGST--SENCDKLTGK---CD-CRTNFVNRQCDSCTSGLY----LKDKKCIPCNCEIQGRISSEKFCNTTSGQCF-CLENVNGDRCEKCVEGYFN----YPNCKKCLCS-PHALSADCDLNNGKCKCGSNVINRICDKCENLHY-WNNRTDCVPCNCG-RGSLNPKCDMETGNCKCAQNVARRDCSKCDVGYFGLDVTGCKKCPPCYNGQVCNNE-GICVCPPNTIGNLCNKCSEDSWDFNETIGCKKCNCYINGSYSNICNKISGICACKTAFFGSKCDRCNEGYYGFPNCQPCSCAENGTKSNE------LTKCDKITGQCQCKQNVIGTKCKVCRKGTFPSDGTYEGGCFSCFCFGVSEKCHAILNHRIVENSIYE----YHIFDEKN--SLESGKDYST--IHLNANYPRRFGWPLTMFRPIYVNVMKLFNSHDLSLFYRSIFMNVSVDCLDN------------KCGREIPEQTEVFMESYNGLFGMRYXXXXXXXXXXXXXXDFNEHSKNGKWVISQYQNDILDKFIILEDSNVINSNLTRDIFMMALLNVTSLKVKL-YTDKVNPPLIK-IKIITYKVMETTQAIGKRVTAVEKCICNALTFGNHCQNPISGYYKEYFNLPNSTKSGSMRTGNRILINLKKCNCNGYSKVCDSVTGDCQNCMGNREGNKCQLCREGFY-KNDKNYDQCEPCQCP-SAHYNFAQNCTRIESSLELKCQ-CRIGYSGKSCENCQQGFYGNP-IKGIPCKSCDCNQQGSQSLNCNEF-GICQCSPGVLGIKCDQCAPNYVVEKKTCQSCYSGCTKDLLVRIDTLNETVINFKWK-TLPSTLDLRLNKINISIQMSSELL--NSINKFYKLK-----NEIKNFSIQFQKMKDDAKEKYGEIEKLKTRYNKV---LEDLRSTFTDINETISGHEQL--------GISNELIKNATAYLET--IKNIYKEMPNITLAASVLKDVLKYVDELNQ-------IIKYTQSHIQSDQINNLKILKNKTIMADE-----------INTNNKEYLNTMSTKKKEHELYIILINERMKDLQKIFRKMTKQRDNLRKKIQKLDAISKSFQDEKDLISINVR-EIEDLMKNLSSNHLV----------SKSLIIPDTLKKHVEQQLNKSSNLIKKLTKDFNFL----HNAEQAKEAYSNITRDILAVDYAINQTKKEL--------DFNRSNMNIDSLKKLLAEFNSNKSEIVENIKNIDKEHEKLLKQYKNCSYXXXXXXXXXXXXSSEIPTGFYDVEILKRNLSXXXXXXXXXXXXFILPINQTILNLGTPNVKSGLDTRNLEKLIKVVDNQYRDL-----VNESSFVENKIKDLRKSIKSLRERLQKARVMSELIHGAAARSVEPIRHVVRCVRHYVTYYLP---TSNAFSLEFYMKPQILNDQSLVLFGYDDSGSIPHAFAFTLERNNQYKFWYDSGNSVESIELTGKFSNENYVGIMITWKLGK-WHMVIRSISDGRTEQVETSSI--TNNILSNVRIGPQTNIFVGGFPSSKLLRSLKLEGRLISDLKENYDNYFYKGCLFGVKLMNTEFGLQDIEAIEEECRN 7216
            +C    +G  C+ C+ GYY          C+ C+C+ +   C+ V G C  C++NT G  C+ C  GFYG+        C+ C C  ++ S   S  C    G    CD C   +    C+ C  G Y    +  + C+PC+C      S    C++ +G+C  CL N +G  CE+C +G++       NC+ C C    + SA C L  G C C  NV  + CD+C + +Y  ++   C PCNC   GS++  C  E G C C   VA + C +C  G++      C  C   +    C+ E G CVCPP+T G  C +C +  W ++  +GC+ CNC + GS  + C+ ++G C CK+ F G  CD+C+ GY  FP+C PC C   GT  +       L  C + TG C CK+NV G +C  CR+GTF        GC  CFC G+S  C  + ++     ++        +  + N      G  Y      L+A   R+         P Y  + + F    L  +   +  +V+   LD             K GR I +Q  ++M++     G+R                  E     +    +Y N + +K +  ED            FM  L ++  + +K  Y   +    I  I +   +  E      +  + +E C+C   T G  CQ+   GY++    LP    +GS R    ++     C+CN +S  CD  TG C NC  N  G+ C +C  G+Y K   +   C  C CP S   +F+  C  +E   + +C  C +GY GK CE C   +YGNP   G  C+ CDCN  GS   +C+   G C C  G  G++CD+C P +++ +  C SC   C   LL  +D + + V++      +P    +  N  N +  +   LL  N      K+K      E  N   +  +M    ++     E++      +   +E L+ + T+I E  + ++ L             + +N T+ LE   I++  +   N TL     +D+L  + E  Q       ++K   SH+ S   N LK  +     A+            +N N +E+ +     ++E  L   LI +     + +      Q D ++  ++ L+      QD+  L S  +R  I+DL+ ++S  + V          ++   + D L   +E   N S N        +N       + E A++A+  +T   L  +  ++  K  +        + N  +  +  +   L+E  +  +   EN   I ++  + L   +                   IP G  D     + L+    +        +  ++Q +LN      +     R   +L++  D+    L     V +     N + D  K +K L E L +     +L+   A +    I+  V   R  +  Y P   ++N  +L   +K Q  ++    L  Y  S +     A  + R  +  F +D G+    +E      ++N    +   + G    + ++ +S  +    +TS    T N+L    +   T +FVGG    ++ +S  ++               +KGCL    L     GL +    E +CR 
Sbjct:  710 ECPQGYTGTSCESCLSGYYRVDGILFGGICQPCECHGHAAECN-VHGVCIACAHNTTGVHCEQCLPGFYGEPSRGTPGDCQPCACPLTIASNNFSPTCHLNDGDEVVCDWCAPGYSGAWCERCADGYYGNPTVPGESCVPCDCSGNVDPSEAGHCDSVTGECLKCLGNTDGAHCERCADGFYGDAVTAKNCRACECHVKGSHSAVCHLETGLCDCKPNVTGQQCDQCLHGYYGLDSGHGCRPCNCSVAGSVSDGCTDE-GQCHCVPGVAGKRCDRCAHGFYAYQDGSCTPCDCPHTQNTCDPETGECVCPPHTQGVKCEECEDGHWGYDAEVGCQACNCSLVGSTHHRCDVVTGHCQCKSKFGGRACDQCSLGYRDFPDCVPCDCDLRGTSGDACNLEQGLCGCVEETGACPCKENVFGPQCNECREGTFALRADNPLGCSPCFCSGLSHLCSELEDYVRTPVTLGSDQPLLRVVSQSNLRGTTEGVYYQAPDFLLDAATVRQH----IRAEPFYWRLPQQFQGDQLMAYGGKLKYSVAFYSLDGVGTSNFEPQVLIKGGR-IRKQV-IYMDAPAPENGVR-----------------QEQEVAMRENFWKYFNSVSEKPVTRED------------FMSVLSDIEYILIKASYGQGLQQSRISDISMEVGRKAEKLHPEEEVASLLENCVCPPGTVGFSCQDCAPGYHRG--KLP----AGSDRGPRPLVAPCVPCSCNNHSDTCDPNTGKCLNCGDNTAGDHCDVCTSGYYGKVTGSASDCALCACPHSPPASFSPTCV-LEGDHDFRCDACLLGYEGKHCERCSSSYYGNPQTPGGSCQKCDCNPHGSVHGDCDRTSGQCVCRLGASGLRCDECEPRHILMETDCVSCDDECVGVLLNDLDEIGDAVLSLNLTGIIPVPYGILSNLENTTKYLQESLLKENMQKDLGKIKLEGVAEETDNLQKKLTRMLASTQKVNRATERIFKESQDLAIAIERLQMSITEIMEKTTLNQTLDEDFLLPNSTLQNMQQNGTSLLEIMQIRDFTQLHQNATLELKAAEDLLSQIQENYQKPLEELEVLKEAASHVLSKHNNELKAAEALVREAEAKMQESNHLLLMVNANLREFSDKKLHVQEEQNLTSELIVQG----RGLIDAAAAQTDAVQDALEHLE----DHQDKLLLWSAKIRHHIDDLVMHMSQRNAVDLVYRAEDHAAEFQRLADVLYSGLENIRNVSLNATSAAYVHYNIQSLIEESEELARDAHRTVTETSLLSESLVSNGKAAVQRSSRFLKEGNNLSRKLPGIALELSELRNKTNRFQENAVEITRQTNESLLILR------------------AIPKGIRDKGAKTKELATSASQSAVSTLRDVAGLSQELLNTSASLSRVNTTLRETHQLLQ--DSTMATLLAGRKVKDVEIQANLLFDRLKPLKMLEENLSRNLSEIKLLISQARKQAASIKVAVSADRDCIRAYQPQISSTNYNTLTLNVKTQEPDN----LLFYLGSSTASDFLAVEMRR-GRVAFLWDLGSGSTRLEFPDFPIDDNRWHSIHVARFGNIGSLSVKEMSSNQKSPTKTSKSPGTANVLD---VNNSTLMFVGGL-GGQIKKSPAVK------------VTHFKGCLGEAFLNGKSIGLWNYIEREGKCRG 2296          

HSP 3 Score: 229.565 bits (584), Expect = 4.700e-59
Identity = 192/690 (27.83%), Postives = 286/690 (41.45%), Query Frame = 2
Query:  914 YYSLRNIEIGGKCICNNHADKCDKVIENGISVAKCNCKHNTCGSNCETCCPLFNQRPWKPVAVCEECNCNRKSNECSYNQTVATLQLSVNKMGRMEGGGVCINCQENTEGINCEKCIKGFYRPWNVLATELYPCTPCQCHGLGTIGSCVSNGEDIGDQKPGDCICKKGYEGVNCDLCSIGYERYPNGECLPCPCSIDGS------VRTSFYRC---KPPCNCKVHVNSDDLCKTCKNGYFNLDSANPEGCEPCYCFGITNQCSSLSAKNLKISDLKGWKLTTFT-GEKIALPKFTSFQYL--TSENSYI---DERFNNPTV--------YYWTAPPPYLGNWITSYGTIFRYVVKIELQSTLKGSLIDSPDVIIKCGDFR---LFHSVSIEDRRLQRQVFIYIKPTEWKIGKLTPDKAATKEEFISCLVKVDKLLIKAKYYSNQKSIELLNITLSRG----EVHLALDEMPHIEKCNCPPGFNGLSCESCESGYRRVNNVLYQGQ----------CEACACYNHSNTCDSLNGECQNCTHNTAGAHCEDCASGYYGDAKSKNLNSCKKCPCPR-LDYQMTELCSSYSSENYVCHKCLHNTSGVHCDRCIEGYYGNPKKK-ISCKRCKCNNN---QESCDPVTGECRCSYNTMGTECQLCKHGFYGDALTKSCKKCDCDSLGSTSENCDKL 2848
            YY L +      C C+      D   + G    +C+C     G  C+ C   F          C  C+C    N C                      G C+ C  +T+G+ CE+C  G    W   A     C  C C       S V +     D   G C CK  + G  CD CS+GY  +P  +C+PC C + G+      +      C      C CK +V     C  C+ G F L + NP GC PC+C G+++ CS          +L+ +  T  T G    L +  S   L  T+E  Y    D   +  TV        +YW  P  + G+ + +YG   +Y V       +  S  + P V+IK G  R   ++      +  ++++  + ++   WK      +K  T+E+F+S L  ++ +LIKA Y    +   + +I++  G    ++H   +    +E C CPPG  G SC+ C  GY R    L  G           C  C+C NHS+TCD   G+C NC  NTAG HC+ C SGYYG   + + + C  C CP       +  C      ++ C  CL    G HC+RC   YYGNP+    SC++C CN +      CD  +G+C C     G  C  C+       +   C  CD + +G    + D++
Sbjct:  939 YYGLDSGHGCRPCNCSVAGSVSDGCTDEG----QCHCVPGVAGKRCDRCAHGFYAYQ---DGSCTPCDCPHTQNTCDPET------------------GECV-CPPHTQGVKCEECEDGH---WGYDAE--VGCQACNC-------SLVGSTHHRCDVVTGHCQCKSKFGGRACDQCSLGYRDFP--DCVPCDCDLRGTSGDACNLEQGLCGCVEETGACPCKENVFGPQ-CNECREGTFALRADNPLGCSPCFCSGLSHLCS----------ELEDYVRTPVTLGSDQPLLRVVSQSNLRGTTEGVYYQAPDFLLDAATVRQHIRAEPFYWRLPQQFQGDQLMAYGGKLKYSVAFYSLDGVGTSNFE-PQVLIKGGRIRKQVIYMDAPAPENGVRQEQEVAMRENFWKYFNSVSEKPVTREDFMSVLSDIEYILIKASYGQGLQQSRISDISMEVGRKAEKLHPEEEVASLLENCVCPPGTVGFSCQDCAPGYHR--GKLPAGSDRGPRPLVAPCVPCSCNNHSDTCDPNTGKCLNCGDNTAGDHCDVCTSGYYGKV-TGSASDCALCACPHSPPASFSPTCVLEGDHDFRCDACLLGYEGKHCERCSSSYYGNPQTPGGSCQKCDCNPHGSVHGDCDRTSGQCVCRLGASGLRCDECEPRHI--LMETDCVSCDDECVGVLLNDLDEI 1571          

HSP 4 Score: 168.318 bits (425), Expect = 1.826e-40
Identity = 191/712 (26.83%), Postives = 285/712 (40.03%), Query Frame = 2
Query: 3086 CLCSPHALSADCDLNNGK--CKCGSNVINRICDKC---ENLHYWNNRT-----DCVPCNCGRGSLNPKCDMETGNCKCAQNVARRDCSKCDVGYFGLDVTGCKKCPPCYNGQVCNNEGICVCPPNTIGNLCNKCSEDSWDFN-----ETIGCKKCNCYINGSYSNIC-----------NKISGICACKTAFFGSKCDRCNEGYYGFPNCQPCSCAENGTKSNELTKCDKITGQCQCKQNVIGTKCKVCRKGTFPSDGTYEGGCFSCFCFGVSEKCHAI---------LNHRIVENSIYEYHIFDEKNSLESGKDYSTIHLNANYPRRFGWPLTMFRPIYVNVMKLFNSHDLSLFYRSIFMNVSVDCLDNKCGREIPEQTEVFMESYNGLFGMRYXXXXXXXXXXXXXXDFNEHSKNGKWVISQYQNDILDKFIILEDSNVINSNLTRDIFMMALLNVTSLKVKLYTDKVNPPLIKIKIITYKVMETTQAIGKRVTA-VEKCICNALTFGNHCQNPISGYYKEYFNLPNSTKSGSMRTGNRILIN--LKKCNCNGYSKVCDSVTGDCQNCMGNREGNKCQLCREGFY--KNDKNYDQCEPCQCPS--AHYNFAQNCTRIESSLELKCQ-CRIGYSGKSCENCQQGFYGNP-IKGIPCKSCDC--NQQGSQSLNCNEF-GIC-QCSPGVLGIKCDQCAPNY---VVEKKTCQSC 5068
            C+C  HA S   D    K  C+C  N     C++C    +   W   T      C  CNC           +  +C   ++VA++  S    G F               G VC N     C  NT+G  C  C +  +  +     E   C+ CNC   GS S++C            K  G C CK  + G KCDRC  GY  +P C  C C   G+ S+E       TG C CK+NV G  C  C+ G +        GC  CFCFGVS+ C ++         ++  +V + I    I  ++++L  G+   +I+  A   R       +    Y    + +  + L+ F   +   VS D         +    +V ++  NGL         S       +  + E+    + V   +Q D   K             + RD  M  L NVT L ++   +     L +++ ++  +  ++ AI   V A VE C C     G  C++ +SGYY+                 + IL     + C C+G++  C+ V G C  C  N  G  C+ C  GFY   +      C+PC CP   A  NF+  C  +    E+ C  C  GYSG  CE C  G+YGNP + G  C  CDC  N   S++ +C+   G C +C     G  C++CA  +    V  K C++C
Sbjct:  270 CICYGHASSCPWDETTKKLQCQCEHNTCGESCNRCCPGYHQQPWRPGTVSSGNTCEACNCHN---------KAKDCYYDESVAKQKKSLNTAGQF-------------RGGGVCIN-----CLQNTMGINCETCIDGYYRPHKVSPYEDEPCRPCNCDPVGSLSSVCIKDDLHSDLHNGKQPGQCPCKEGYTGEKCDRCQLGYKDYPTCVSCGCNPVGSASDE-----PCTGPCVCKENVEGKACDRCKPGFYNLKEKNPRGCSECFCFGVSDVCSSLSWPVGQVNSMSGWLVTDLISPRKIPSQQDAL-GGRHQVSINNTAVMQR-------LAPKYYWAAPEAYLGNKLTAFGGFLKYTVSYDIPVETVDSNLMSHADVIIKG-NGL-------TLSTQAEGLSLQPYEEYLNVVRLVPENFQ-DFHSK-----------RQIDRDQLMTVLANVTHLLIRANYNSAKMALYRLESVSLDIA-SSNAIDLVVAADVEHCECPQGYTGTSCESCLSGYYRV----------------DGILFGGICQPCECHGHAAECN-VHGVCIACAHNTTGVHCEQCLPGFYGEPSRGTPGDCQPCACPLTIASNNFSPTC-HLNDGDEVVCDWCAPGYSGAWCERCADGYYGNPTVPGESCVPCDCSGNVDPSEAGHCDSVTGECLKCLGNTDGAHCERCADGFYGDAVTAKNCRAC 902          
BLAST of Laminin subunit alpha-2 vs. Ensembl Human
Match: LAMA2 (laminin subunit alpha 2 [Source:HGNC Symbol;Acc:HGNC:6482])

HSP 1 Score: 715.687 bits (1846), Expect = 0.000e+0
Identity = 433/1176 (36.82%), Postives = 614/1176 (52.21%), Query Frame = 2
Query:  188 LMENAKITSSATCGTGGPEIFCRLVDEIAIQRLINPDSHVLCDVCD--NRNETKRHPIEFAKSDDDNLWWQSPSMAQGLKYQNVNVTIDLKQVYQIVYILLKMGDSPRPGNWILERSLDGEIYMPWIFFAETPYSC---YNLFQRQYPDLKLTTNAKPSSLADDEMFCTTYYSQPKSLNSGEIIISLINGRKSIMNEEYLSIKSVPQTLINFLSARYIRFRFLKHLTLAADLM--THKG--YLEQSIYNRYYYSLRNIEIGGKCICNNHADKCDKVIENGISVAKCNCKHNTCGSNCETCCPLFNQRPWKPVAV-----CEECNCNRKSNECSYNQTVATLQLSVNKMGRMEGGGVCINCQENTEGINCEKCIKGFYRPWNVLATELYPCTPCQCHGLGTIGSCVSNGEDIGDQ--KPGDCICKKGYEGVNCDLCSIGYERYPNGECLPCPCSIDGSVRTSFYRCKPPCNCKVHVNSDDLCKTCKNGYFNLDSANPEGCEPCYCFGITNQCSSLSAKNLKISDLKGWKLTTFTGEKIALPK---FTSFQYLTSENSYIDERFNNPTVYYWTAPPPYLGNWITSYGTIFRYVVKIELQSTLKGS--------LIDSPDVIIKCGDFRLFHSVSIEDRR--LQRQVFIYIKPTEWKIGKLTPDKAATKEEFISCLVKVDKLLIKAKYYSNQKSIELLNITLSRGEVHLALDE--MPHIEKCNCPPGFNGLSCESCESGYRRVNNVLYQGQCEACACYNHSNTCDSLNGECQNCTHNTAGAHCEDCASGYYGDAKSKNLNSCKKCPCPR--LDYQMTELCSSYSSENYVCHKCLHNTSGVHCDRCIEGYYGNPK-KKISCKRCKCNNNQE-----SCDPVTGECR-CSYNTMGTECQLCKHGFYGDAL-TKSCKKCDCDSLGSTSENCDKLTGKCDCRTNFVNRQCDSCTSGLY--LKDKKCIPCNCEIQGRISSEKFCNTTSGQCFCLENVNGDRCEKCVEGYFNYP--NCKKCLCSPHALSADCDLNNGKCKCGSNVINRICDKCENLHYWNNR--TDCVPCNCGR-GSLNPKCDMETGNCKCAQNVARRDCSKCDVGYF-------------GLDVTGC----KKCPPCYNGQVCNNEGICVCPPNTIGNLCNKCSEDSW--DFNETIGCKKCNCY 3514
            L  NA IT++ATCG  GPE++C+LV+ +  Q + NP     C +C+  + N  +RHPI  A  D  N WWQSPS+  G++Y  V +T+DL+QV+QI Y+++K  +SPRPGNWILERSLD   Y PW + A T   C   YN++ R  P         PS   DDE+ CT++YS+   L +GEI ISLINGR S  +         P+ L+ F SARYIR RF +  TL ADLM   HK    ++  +  RYYYS+++I +GG CIC  HA  C   ++   + ++C C+HNTCG +C+ CCP F+Q+PW+         CE CNC+ K+ EC Y++ VA   LS+N  G+  GGGVCINC +NT GINCE C  GF+RP  V      PC PC C  +G++       E    +   PG C CK G+ GV+CD C+ GY  YP  +C  C CS  GS       C  PC CK +V   D C  CK+G+FNL   N +GC+ C+C G++N+C S      KI D+ GW LT   G     P+     S Q ++  N+  + R   P  YYW+AP PYLGN + + G    + +  +L+   + +        +++  D+ I      ++   S E     L ++    I  T + +          ++EF++ L  + ++L++  Y     +I  L+       V    D      +E C CPPG+ G SCESC   +RRVN  ++ G CE C C+ H+ +CD + GEC NC  +T G +C+ C  G+YG+        C+ C CP        +  C    S   +C  C    +G  C+RC EGY+G P     SC+ C+CN+N +     SCD ++G C  C   T G  C+LC  G++GDA+  K+C+ C C++ GS SE C   TG+C+CR N   ++CD C +G +     + C+PCNC   G   S+ F    SGQC+C   V G +C++C  GYFN+    C  C CS   L  +CD   G+C C  N I   C KC   + W +   T C  CNC   GSL+ +C++ TG C C    +   C++C  G++             G D T C    KKC         +  G C C  N  G  C++C    +  D    +GC  C C+
Sbjct:   46 LASNALITTNATCGEKGPEMYCKLVEHVPGQPVRNPQ----CRICNQNSSNPNQRHPITNA-IDGKNTWWQSPSIKNGIEYHYVTITLDLQQVFQIAYVIVKAANSPRPGNWILERSLDDVEYKPWQYHAVTDTECLTLYNIYPRTGP---------PSYAKDDEVICTSFYSKIHPLENGEIHISLINGRPSADDPS-------PE-LLEFTSARYIRLRFQRIRTLNADLMMFAHKDPREIDPIVTRRYYYSVKDISVGGMCICYGHARACP--LDPATNKSRCECEHNTCGDSCDQCCPGFHQKPWRAGTFLTKTECEACNCHGKAEECYYDENVARRNLSLNIRGKYIGGGVCINCTQNTAGINCETCTDGFFRPKGVSPNYPRPCQPCHCDPIGSLNEVCVKDEKHARRGLAPGSCHCKTGFGGVSCDRCARGYTGYP--DCKACNCSGLGSKNED--PCFGPCICKENVEGGD-CSRCKSGFFNLQEDNWKGCDECFCSGVSNRCQSSYWTYGKIQDMSGWYLTDLPGRIRVAPQQDDLDSPQQISISNA--EARQALPHSYYWSAPAPYLGNKLPAVGGQLTFTISYDLEEEEEDTERVLQLMIILEGNDLSISTAQDEVYLHPSEEHTNVLLLKEESFTIHGTHFPV---------RRKEFMTVLANLKRVLLQITYSFGMDAIFRLSSVNLESAVSYPTDGSIAAAVEVCQCPPGYTGSSCESCWPRHRRVNGTIFGGICEPCQCFGHAESCDDVTGECLNCKDHTGGPYCDKCLPGFYGEPTKGTSEDCQPCACPLNIPSNNFSPTCHLDRSLGLICDGCPVGYTGPRCERCAEGYFGQPSVPGGSCQPCQCNDNLDFSIPGSCDSLSGSCLICKPGTTGRYCELCADGYFGDAVDAKNCQPCRCNAGGSFSEVCHSQTGQCECRANVQGQRCDKCKAGTFGLQSARGCVPCNCNSFG---SKSFDCEESGQCWCQPGVTGKKCDRCAHGYFNFQEGGCTACECS--HLGNNCDPKTGRCICPPNTIGEKCSKCAP-NTWGHSITTGCKACNCSTVGSLDFQCNVNTGQCNCHPKFSGAKCTECSRGHWNYPRCNLCDCFLPGTDATTCDSETKKC------SCSDQTGQCTCKVNVEGIHCDRCRPGKFGLDAKNPLGCSSCYCF 1169          

HSP 2 Score: 234.187 bits (596), Expect = 1.979e-60
Identity = 156/424 (36.79%), Postives = 209/424 (49.29%), Query Frame = 2
Query: 2654 CKRCKCNNNQESCDPVTGEC-RCSYNTMGTECQLCKHGFYGD---ALTKSCKKCDCDSLGSTSEN------CDKLTGK-CD-CRTNFVNRQCDSCTSGLY----LKDKKCIPCNCEIQGRISSEKFCNTTSGQCF-CLENVNGDRCEKCVEGYF----NYPNCKKCLC-SPHALSADCDLNNGKCKCGSNVINRICDKCENLHY-WNNRTDCVPCNCGR-GSLNPKCDMETGNCKCAQNVARRDCSKCDVGYFGLDVTGCKKCPPCYNGQVCNNE-GICVCPPNTIGNLCNKCSEDSWDFNETIGCKKCNCYINGSYSNICNKISGICACKTAFFGSKCDRCNEGYYGFPNCQPCSCAENGTKS----NELTK--CDKITGQCQCKQNVIGTKCKVCRKGTFPSDGTYEGGCFSCFCFGVSEKC 3832
            C+ C+C  + ESCD VTGEC  C  +T G  C  C  GFYG+     ++ C+ C C  L   S N       D+  G  CD C   +   +C+ C  G +    +    C PC C      S    C++ SG C  C     G  CE C +GYF    +  NC+ C C +  + S  C    G+C+C +NV  + CDKC+   +   +   CVPCNC   GS +  C+ E+G C C   V  + C +C  GYF     GC  C   + G  C+ + G C+CPPNTIG  C+KC+ ++W  + T GCK CNC   GS    CN  +G C C   F G+KC  C+ G++ +P C  C C   GT +    +E  K  C   TGQC CK NV G  C  CR G F  D     GC SC+CFG + +C
Sbjct:  754 CEPCQCFGHAESCDDVTGECLNCKDHTGGPYCDKCLPGFYGEPTKGTSEDCQPCAC-PLNIPSNNFSPTCHLDRSLGLICDGCPVGYTGPRCERCAEGYFGQPSVPGGSCQPCQCNDNLDFSIPGSCDSLSGSCLICKPGTTGRYCELCADGYFGDAVDAKNCQPCRCNAGGSFSEVCHSQTGQCECRANVQGQRCDKCKAGTFGLQSARGCVPCNCNSFGSKSFDCE-ESGQCWCQPGVTGKKCDRCAHGYFNFQEGGCTACECSHLGNNCDPKTGRCICPPNTIGEKCSKCAPNTWGHSITTGCKACNCSTVGSLDFQCNVNTGQCNCHPKFSGAKCTECSRGHWNYPRCNLCDCFLPGTDATTCDSETKKCSCSDQTGQCTCKVNVEGIHCDRCRPGKFGLDAKNPLGCSSCYCFGTTTQC 1175          

HSP 3 Score: 221.09 bits (562), Expect = 2.141e-56
Identity = 198/654 (30.28%), Postives = 273/654 (41.74%), Query Frame = 2
Query:  950 CICNNHADKCDKVIENGISVAKCNCKHNTCGSNCETCC-PLFNQRPWKPVAVCEECNCNRKSNECSYNQTVATLQLSVNKMGRMEGGGVCINCQENTEGINCEKCIKGFYRPWNVLATELYPCTPCQCHGLGTIG-SCVSNGEDIGDQKPGDCICKKGYEGVNCDLCSIGYERYPNGECLPCPCSIDGSVRTS----FYRCK-----PPCNCKVHVNSDDLCKTCKNGYFNLDSANPEGCEPCYCFGITNQCSSLSAKNLKISDLKGWKLTTFTGEKIALPKF-TSFQYLTSENSYIDERFNNPTV---------------YYWTAPPPYLGNWITSYGTIFRYVVKIELQSTLKGSLIDSPDVIIKCGD-----FRLFHSVSIEDRRLQRQVFIYIKPTEWKIGKLTP--DKAATKEEFISCLVKVDKLLIKAKYYSNQKSIELLNITLSRGEVHLALDEMPH---IEKCNCPPGFNGLSCESCESGYRRVNNVL-------YQGQCEACACYNHSNTCDSLNGECQNCTHNTAGAHCEDCASGYYGDAKSKNLNSCKKCPCPRLDYQ--MTELCSSYSSENYVCHKCLHNTSGVHCDRCIEGYYGNP-KKKISCKRCKCNNNQE---SCDPVTGECRCSYNTMGTECQLCKH 2761
            C CN+   K     E+G    +C C+    G  C+ C    FN +       C  C C+   N C              K GR      CI C  NT G  C KC       W    T    C  C C  +G++   C  N         G C C   + G  C  CS G+  YP   C  C C + G+  T+      +C        C CKV+V     C  C+ G F LD+ NP GC  CYCFG T QCS   AK L    ++ W   T   E+  LP    + Q+ T++       F +P +               +YW  P  + G  + +YG   +Y +  E +     S  + P VII+ G        + H  +    +L R   I +   EWK     P   +  T+E+F+  L  +  +LIKA Y +  +   +  I++   E        P    IEKC+CP G++GLSCE+C  G+ R+ +           G C  C C  HS+ CD     CQNC H+TAG  CE CA GYYG  K    N C++C CP +      +  C +   ++Y C  C     G +C+RC  GY G+P     SC+ C+C+        CDPVTG C C     G +C  CKH
Sbjct:  967 CNCNSFGSKSFDCEESG----QCWCQPGVTGKKCDRCAHGYFNFQE----GGCTACECSHLGNNCD------------PKTGR------CI-CPPNTIGEKCSKCAP---NTWGHSITT--GCKACNCSTVGSLDFQCNVN--------TGQCNCHPKFSGAKCTECSRGHWNYP--RCNLCDCFLPGTDATTCDSETKKCSCSDQTGQCTCKVNVEGIH-CDRCRPGKFGLDAKNPLGCSSCYCFGTTTQCSE--AKGL----IRTW--VTLKAEQTILPLVDEALQHTTTKGIV----FQHPEIVAHMDLMREDLHLEPFYWKLPEQFEGKKLMAYGGKLKYAIYFEAREETGFSTYN-PQVIIRGGTPTHARIIVRHMAAPLIGQLTRHE-IEMTEKEWKYYGDDPRVHRTVTREDFLDILYDIHYILIKATYGNFMRQSRISEISMEVAEQGRGTTMTPPADLIEKCDCPLGYSGLSCEACLPGFYRLRSQPGGRTPGPTLGTCVPCQCNGHSSLCDPETSICQNCQHHTAGDFCERCALGYYGIVKGLP-NDCQQCACPLISSSNNFSPSCVAEGLDDYRCTACPRGYEGQYCERCAPGYTGSPGNPGGSCQECECDPYGSLPVPCDPVTGFCTCRPGATGRKCDGCKH 1562          

HSP 4 Score: 137.117 bits (344), Expect = 5.205e-31
Identity = 167/688 (24.27%), Postives = 291/688 (42.30%), Query Frame = 2
Query: 4289 DSNVINSNLTRDIFMMALLNVTSLKVKL-YTDKVNPPLIKIKIITYKVMETTQAIGKRVTA----VEKCICNALTFGNHCQNPISGYYKEYFNLPNSTKSGSMRTGNRILINLKKCNCNGYSKVCDSVTGDCQNCMGNREGNKCQLCREGFYKNDKNY-DQCEPCQCP--SAHYNFAQNCTRIESSLELKC-QCRIGYSGKSCENCQQGFYGNPI-KGIPCKSCDCNQQGSQSLNCNEF-GICQCSPGVLGIKCDQCAPNYVVEKKTCQSCYSGCTKDLLVRIDTLNETVINFKWK-TLPSTLDLRLNKINISIQMSSELLNSINKFYKLKNEIKNFSIQFQKMKDDAKEKYGEIEKLKTRYNKVLEDLRSTFTDINETISGHEQLG-ISNELIKNATAYLETIKNIYKEMPNITLA-----ASVLKDVLKYVDELNQIIKYTQSHIQSDQINNLK-ILKNKTIMADEINTNNKEYLNTMSTKKKEHELYIILINERMKDLQKIFRKMTKQRDNLRKKIQKLDAISK----SFQDEKDLISINVREIEDLMKNLSSNHLVSKSLIIPDTLKKHVE-------------QQLNKSSNLIKKLTKDFNFLHNAEQAKEAYSNITRDILAVDYAINQTKKELDFNRSNMNIDSLKKLLAEFNSNKSEIVENIKNIDKEHEKLLKQYKNCSY 6244
            D   ++  +TR+ F+  L ++  + +K  Y + +     +I  I+ +V E  Q  G  +T     +EKC C     G  C+  + G+Y+       S   G  RT    L     C CNG+S +CD  T  CQNC  +  G+ C+ C  G+Y   K   + C+ C CP  S+  NF+ +C   E   + +C  C  GY G+ CE C  G+ G+P   G  C+ C+C+  GS  + C+   G C C PG  G KCD C   +  E   C  C   CT  LL  +  L + V++      LP+   +     N++ ++   LL+      +L           Q  + +      E+ +L TR  KV  D   T  D   T +  + LG    EL ++A A  E    + + +     A       + K++ + + EL +    TQ  I  D++   + +LK    +  E    N+E    +  K  +++        ++ D   + R+ T   D +R+   +L A+++    + + +K+ +    R+IE+ +K    N ++ ++  + D +   ++             ++LN   + + +  KD        QA E+++    D  AV   I    K + FN +           A F +       NIK+   E EK+ K+ K+ ++
Sbjct: 1316 DDPRVHRTVTREDFLDILYDIHYILIKATYGNFMRQS--RISEISMEVAE--QGRGTTMTPPADLIEKCDCPLGYSGLSCEACLPGFYRL-----RSQPGG--RTPGPTLGTCVPCQCNGHSSLCDPETSICQNCQHHTAGDFCERCALGYYGIVKGLPNDCQQCACPLISSSNNFSPSCV-AEGLDDYRCTACPRGYEGQYCERCAPGYTGSPGNPGGSCQECECDPYGSLPVPCDPVTGFCTCRPGATGRKCDGCKHWHAREGWECVFCGDECTGLLLGDLARLEQMVMSINLTGPLPAPYKMLYGLENMTQEL-KHLLSPQRAPERL----------IQLAEGNLNTLVTEMNELLTRATKVTADGEQTGQDAERTNTRAKSLGEFIKELARDAEAVNEKAIKLNETLGTRDEAFERNLEGLQKEIDQMIKELRRKNLETQKEIAEDELVAAEALLKKVKKLFGESRGENEEMEKDLREKLADYK-------NKVDDAWDLLREAT---DKIREA-NRLFAVNQKNMTALEKKKEAVESGKRQIENTLK--EGNDILDEANRLADEINSIIDYVEDIQTKLPPMSEELNDKIDDLSQEIKDRKLAEKVSQA-ESHAAQLNDSSAVLDGILDEAKNISFNAT-----------AAFKA-----YSNIKDYIDEAEKVAKEAKDLAH 1950          

HSP 5 Score: 100.908 bits (250), Expect = 5.401e-20
Identity = 87/275 (31.64%), Postives = 117/275 (42.55%), Query Frame = 2
Query: 3086 CLCSPHALSADCD--LNNGKCKCGSNVINRICDKC-ENLHY--WN-----NRTDCVPCNCGRGSLNPKCDMETGNCKCAQNVARRDCSKCDVGYFGLDVTGCKKCPPCYNGQVCNNEGICVCPPNTIGNLCNKCSEDSW-----DFNETIGCKKCNCYINGSYSNICNK---------ISGICACKTAFFGSKCDRCNEGYYGFPNCQPCSCAENGTKSNELTKCDKITGQCQCKQNVIGTKCKVCRKGTFPSDGTYEGGCFSCFCFGVSEKCHA 3838
            C+C  HA +   D   N  +C+C  N     CD+C    H   W       +T+C  CNC           +   C   +NVARR+ S        L++ G         G VC N     C  NT G  C  C++  +       N    C+ C+C   GS + +C K           G C CKT F G  CDRC  GY G+P+C+ C+C+  G+K+      D   G C CK+NV G  C  C+ G F        GC  CFC GVS +C +
Sbjct:  287 CICYGHARACPLDPATNKSRCECEHNTCGDSCDQCCPGFHQKPWRAGTFLTKTECEACNC---------HGKAEECYYDENVARRNLS--------LNIRG-----KYIGGGVCIN-----CTQNTAGINCETCTDGFFRPKGVSPNYPRPCQPCHCDPIGSLNEVCVKDEKHARRGLAPGSCHCKTGFGGVSCDRCARGYTGYPDCKACNCSGLGSKNE-----DPCFGPCICKENVEGGDCSRCKSGFFNLQEDNWKGCDECFCSGVSNRCQS 529          

HSP 6 Score: 99.3673 bits (246), Expect = 1.249e-19
Identity = 80/281 (28.47%), Postives = 125/281 (44.48%), Query Frame = 2
Query: 4274 FIILEDSNVINSN---LTRDIFMMALLNVTSLKVKLYTDKVNPPLIKIKIITYKVMETTQAIGKRVTAVEKCICNALTFGNHCQNPISGYYKEYFNLPNSTKSGSMRTGNRILINLKKCNCNGYSKVCDSVTGDCQNCMGNREGNKCQLCREGFY--KNDKNYDQCEPCQCP--SAHYNFAQNCTRIESSLELKCQ-CRIGYSGKSCENCQQGFYGNP-IKGIPCKSCDCNQQGSQSL--NCNEF-GICQ-CSPGVLGIKCDQCAPNY---VVEKKTCQSC 5068
             ++ E+S  I+     + R  FM  L N+  + +++        + ++  +  +   +    G    AVE C C     G+ C++    + +      N T  G +          + C C G+++ CD VTG+C NC  +  G  C  C  GFY        + C+PC CP      NF+  C  ++ SL L C  C +GY+G  CE C +G++G P + G  C+ C CN     S+  +C+   G C  C PG  G  C+ CA  Y    V+ K CQ C
Sbjct:  653 LLLKEESFTIHGTHFPVRRKEFMTVLANLKRVLLQITYSFGMDAIFRLSSVNLESAVSYPTDGSIAAAVEVCQCPPGYTGSSCESCWPRHRRV-----NGTIFGGI---------CEPCQCFGHAESCDDVTGECLNCKDHTGGPYCDKCLPGFYGEPTKGTSEDCQPCACPLNIPSNNFSPTC-HLDRSLGLICDGCPVGYTGPRCERCAEGYFGQPSVPGGSCQPCQCNDNLDFSIPGSCDSLSGSCLICKPGTTGRYCELCADGYFGDAVDAKNCQPC 918          

HSP 7 Score: 94.3597 bits (233), Expect = 4.449e-18
Identity = 52/143 (36.36%), Postives = 80/143 (55.94%), Query Frame = 2
Query: 4646 CDSVTGDCQNCMGNREGNKCQLCREGFYKNDKNYDQCEPCQCPSAHYNFAQNCTRIESSLELKCQCRIGYSGKSCENCQQGFYG-NPIKGIPCKSCDCNQQGSQSLNCNEFGICQCSPGVLGIKCDQCAPNYV-VEKKTCQSC 5068
            CDS++G C  C     G  C+LC +G++ +  +   C+PC+C +A  +F++ C     S   +C+CR    G+ C+ C+ G +G    +G  C  C+CN  GS+S +C E G C C PGV G KCD+CA  Y   ++  C +C
Sbjct:  879 CDSLSGSCLICKPGTTGRYCELCADGYFGDAVDAKNCQPCRC-NAGGSFSEVC----HSQTGQCECRANVQGQRCDKCKAGTFGLQSARG--CVPCNCNSFGSKSFDCEESGQCWCQPGVTGKKCDRCAHGYFNFQEGGCTAC 1014          

HSP 8 Score: 69.707 bits (169), Expect = 1.378e-10
Identity = 60/225 (26.67%), Postives = 88/225 (39.11%), Query Frame = 2
Query: 2576 CLHNTSGVHCDRCIEGYY---GNPKKKI------SCKRCKCNNNQESCDPVTGECR-CSYNTMGTECQLCKHGFYG--DALTKSCKKCDCDSLGSTSENCDKLTGKCDCRTNFVNRQCDSCTSGLYLKDKKCIPCNCEIQGRISSEKFCNTTSGQCFCLENVNGDRCEKCVEGYFNYP-----NCKKCLCSPH-ALSADCDLNNGKCKCGSNVINRICDKCENLH 3196
            C    SG+ C+ C+ G+Y     P  +       +C  C+CN +   CDP T  C+ C ++T G  C+ C  G+YG    L   C++C C  + S++              NF      SC +   L D +C  C                            G  CE+C  GY   P     +C++C C P+ +L   CD   G C C      R CD C++ H
Sbjct: 1382 CPLGYSGLSCEACLPGFYRLRSQPGGRTPGPTLGTCVPCQCNGHSSLCDPETSICQNCQHHTAGDFCERCALGYYGIVKGLPNDCQQCACPLISSSN--------------NF----SPSCVAE-GLDDYRCTACP-----------------------RGYEGQYCERCAPGYTGSPGNPGGSCQECECDPYGSLPVPCDPVTGFCTCRPGATGRKCDGCKHWH 1564          

HSP 9 Score: 63.1586 bits (152), Expect = 1.421e-8
Identity = 61/224 (27.23%), Postives = 96/224 (42.86%), Query Frame = 2
Query: 4460 VTAVEKCICNALTFGNHCQNPISGYYKEYFNLPNSTKSGSMRTGNRILINLKKCNCNGYSKVC---DSVT---------------GDCQNCMGNREGNKCQLCREGFYKN---DKNYDQ-CEPCQC-PSAHYNFAQNCTRIESSLEL-----KCQCRIGYSGKSCENCQQGFYGNPIKGIPCKSCDCNQQGSQSLNCNE---FGICQCSPGVLGIKCDQCAPNY 5038
             T   +C C   T G+ C     G++++ +      ++G+  T        + CNC+G ++ C   ++V                G C NC  N  G  C+ C +GF++      NY + C+PC C P    N  + C + E           C C+ G+ G SC+ C +G+ G P     CK+C+C+  GS+    NE   FG C C   V G  C +C   +
Sbjct:  301 ATNKSRCECEHNTCGDSCDQCCPGFHQKPW------RAGTFLTKTEC----EACNCHGKAEECYYDENVARRNLSLNIRGKYIGGGVCINCTQNTAGINCETCTDGFFRPKGVSPNYPRPCQPCHCDPIGSLN--EVCVKDEKHARRGLAPGSCHCKTGFGGVSCDRCARGYTGYP----DCKACNCSGLGSK----NEDPCFGPCICKENVEGGDCSRCKSGF 504          

HSP 10 Score: 58.5362 bits (140), Expect = 3.162e-7
Identity = 56/201 (27.86%), Postives = 84/201 (41.79%), Query Frame = 2
Query: 3236 GRGS-LNPKCDMETGNCKCAQNVARRDCSKCDVGYFGLDVTGCKKCP--------PCY-NGQ--VCNNE-GICV-CPPNTIGNLCNKCSEDSWDFNETI--GCKKCNCYINGSYSNICNK--ISGI-----CACKTAFFGSKCDRCNEGYYGFP-----NCQPCSCAENGTKSNELTKCDKITGQCQCKQNVIGTKCKVCR 3754
            GRG+ + P  D+    C C    +   C  C  G++ L      + P        PC  NG   +C+ E  IC  C  +T G+ C +C+   +   + +   C++C C +  S +N        G+      AC   + G  C+RC  GY G P     +CQ C C   G+       CD +TG C C+    G KC  C+
Sbjct: 1365 GRGTTMTPPADL-IEKCDCPLGYSGLSCEACLPGFYRLRSQPGGRTPGPTLGTCVPCQCNGHSSLCDPETSICQNCQHHTAGDFCERCALGYYGIVKGLPNDCQQCACPLISSSNNFSPSCVAEGLDDYRCTACPRGYEGQYCERCAPGYTGSPGNPGGSCQECECDPYGSLP---VPCDPVTGFCTCRPGATGRKCDGCK 1561          

HSP 11 Score: 58.151 bits (139), Expect = 4.240e-7
Identity = 48/148 (32.43%), Postives = 66/148 (44.59%), Query Frame = 2
Query: 3218 CVPCNC-GRGSLNPKCDMETGNCK-CAQNVARRDCSKCDVGYFGLDVTG----CKKCP-PCYNGQ-----VCNNEGI-----CVCPPNTIGNLCNKCSED--SWDFNETIGCKKCNCYINGSYSNICNKISGICACKTAFFGSKCDRC 3604
            CVPC C G  SL   CD ET  C+ C  + A   C +C +GY+G+ V G    C++C  P  +        C  EG+       CP    G  C +C+        N    C++C C   GS    C+ ++G C C+    G KCD C
Sbjct: 1417 CVPCQCNGHSSL---CDPETSICQNCQHHTAGDFCERCALGYYGI-VKGLPNDCQQCACPLISSSNNFSPSCVAEGLDDYRCTACPRGYEGQYCERCAPGYTGSPGNPGGSCQECECDPYGSLPVPCDPVTGFCTCRPGATGRKCDGC 1560          

HSP 12 Score: 54.299 bits (129), Expect = 5.798e-6
Identity = 55/199 (27.64%), Postives = 77/199 (38.69%), Query Frame = 2
Query: 2819 GSTSENCDKLTGKCDCRTNFVNRQCDSCTSGLY-LKDKK-----------CIPCNCEIQGRISSEKFCNTTSGQCF-CLENVNGDRCEKCVEGYF----NYPN-CKKCLC----SPHALSADC---DLNNGKC-KCGSNVINRICDKCENLHY---WNNRTDCVPCNCGR-GSLNPKCDMETGNCKCAQNVARRDCSKC 3325
            G+T      L  KCDC   +    C++C  G Y L+ +            C+PC C           C+  +  C  C  +  GD CE+C  GY+      PN C++C C    S +  S  C    L++ +C  C      + C++C   +     N    C  C C   GSL   CD  TG C C      R C  C
Sbjct: 1367 GTTMTPPADLIEKCDCPLGYSGLSCEACLPGFYRLRSQPGGRTPGPTLGTCVPCQCN-----GHSSLCDPETSICQNCQHHTAGDFCERCALGYYGIVKGLPNDCQQCACPLISSSNNFSPSCVAEGLDDYRCTACPRGYEGQYCERCAPGYTGSPGNPGGSCQECECDPYGSLPVPCDPVTGFCTCRPGATGRKCDGC 1560          
BLAST of Laminin subunit alpha-2 vs. Ensembl Human
Match: LAMA2 (laminin subunit alpha 2 [Source:HGNC Symbol;Acc:HGNC:6482])

HSP 1 Score: 715.687 bits (1846), Expect = 0.000e+0
Identity = 433/1176 (36.82%), Postives = 614/1176 (52.21%), Query Frame = 2
Query:  188 LMENAKITSSATCGTGGPEIFCRLVDEIAIQRLINPDSHVLCDVCD--NRNETKRHPIEFAKSDDDNLWWQSPSMAQGLKYQNVNVTIDLKQVYQIVYILLKMGDSPRPGNWILERSLDGEIYMPWIFFAETPYSC---YNLFQRQYPDLKLTTNAKPSSLADDEMFCTTYYSQPKSLNSGEIIISLINGRKSIMNEEYLSIKSVPQTLINFLSARYIRFRFLKHLTLAADLM--THKG--YLEQSIYNRYYYSLRNIEIGGKCICNNHADKCDKVIENGISVAKCNCKHNTCGSNCETCCPLFNQRPWKPVAV-----CEECNCNRKSNECSYNQTVATLQLSVNKMGRMEGGGVCINCQENTEGINCEKCIKGFYRPWNVLATELYPCTPCQCHGLGTIGSCVSNGEDIGDQ--KPGDCICKKGYEGVNCDLCSIGYERYPNGECLPCPCSIDGSVRTSFYRCKPPCNCKVHVNSDDLCKTCKNGYFNLDSANPEGCEPCYCFGITNQCSSLSAKNLKISDLKGWKLTTFTGEKIALPK---FTSFQYLTSENSYIDERFNNPTVYYWTAPPPYLGNWITSYGTIFRYVVKIELQSTLKGS--------LIDSPDVIIKCGDFRLFHSVSIEDRR--LQRQVFIYIKPTEWKIGKLTPDKAATKEEFISCLVKVDKLLIKAKYYSNQKSIELLNITLSRGEVHLALDE--MPHIEKCNCPPGFNGLSCESCESGYRRVNNVLYQGQCEACACYNHSNTCDSLNGECQNCTHNTAGAHCEDCASGYYGDAKSKNLNSCKKCPCPR--LDYQMTELCSSYSSENYVCHKCLHNTSGVHCDRCIEGYYGNPK-KKISCKRCKCNNNQE-----SCDPVTGECR-CSYNTMGTECQLCKHGFYGDAL-TKSCKKCDCDSLGSTSENCDKLTGKCDCRTNFVNRQCDSCTSGLY--LKDKKCIPCNCEIQGRISSEKFCNTTSGQCFCLENVNGDRCEKCVEGYFNYP--NCKKCLCSPHALSADCDLNNGKCKCGSNVINRICDKCENLHYWNNR--TDCVPCNCGR-GSLNPKCDMETGNCKCAQNVARRDCSKCDVGYF-------------GLDVTGC----KKCPPCYNGQVCNNEGICVCPPNTIGNLCNKCSEDSW--DFNETIGCKKCNCY 3514
            L  NA IT++ATCG  GPE++C+LV+ +  Q + NP     C +C+  + N  +RHPI  A  D  N WWQSPS+  G++Y  V +T+DL+QV+QI Y+++K  +SPRPGNWILERSLD   Y PW + A T   C   YN++ R  P         PS   DDE+ CT++YS+   L +GEI ISLINGR S  +         P+ L+ F SARYIR RF +  TL ADLM   HK    ++  +  RYYYS+++I +GG CIC  HA  C   ++   + ++C C+HNTCG +C+ CCP F+Q+PW+         CE CNC+ K+ EC Y++ VA   LS+N  G+  GGGVCINC +NT GINCE C  GF+RP  V      PC PC C  +G++       E    +   PG C CK G+ GV+CD C+ GY  YP  +C  C CS  GS       C  PC CK +V   D C  CK+G+FNL   N +GC+ C+C G++N+C S      KI D+ GW LT   G     P+     S Q ++  N+  + R   P  YYW+AP PYLGN + + G    + +  +L+   + +        +++  D+ I      ++   S E     L ++    I  T + +          ++EF++ L  + ++L++  Y     +I  L+       V    D      +E C CPPG+ G SCESC   +RRVN  ++ G CE C C+ H+ +CD + GEC NC  +T G +C+ C  G+YG+        C+ C CP        +  C    S   +C  C    +G  C+RC EGY+G P     SC+ C+CN+N +     SCD ++G C  C   T G  C+LC  G++GDA+  K+C+ C C++ GS SE C   TG+C+CR N   ++CD C +G +     + C+PCNC   G   S+ F    SGQC+C   V G +C++C  GYFN+    C  C CS   L  +CD   G+C C  N I   C KC   + W +   T C  CNC   GSL+ +C++ TG C C    +   C++C  G++             G D T C    KKC         +  G C C  N  G  C++C    +  D    +GC  C C+
Sbjct:   46 LASNALITTNATCGEKGPEMYCKLVEHVPGQPVRNPQ----CRICNQNSSNPNQRHPITNA-IDGKNTWWQSPSIKNGIEYHYVTITLDLQQVFQIAYVIVKAANSPRPGNWILERSLDDVEYKPWQYHAVTDTECLTLYNIYPRTGP---------PSYAKDDEVICTSFYSKIHPLENGEIHISLINGRPSADDPS-------PE-LLEFTSARYIRLRFQRIRTLNADLMMFAHKDPREIDPIVTRRYYYSVKDISVGGMCICYGHARACP--LDPATNKSRCECEHNTCGDSCDQCCPGFHQKPWRAGTFLTKTECEACNCHGKAEECYYDENVARRNLSLNIRGKYIGGGVCINCTQNTAGINCETCTDGFFRPKGVSPNYPRPCQPCHCDPIGSLNEVCVKDEKHARRGLAPGSCHCKTGFGGVSCDRCARGYTGYP--DCKACNCSGLGSKNED--PCFGPCICKENVEGGD-CSRCKSGFFNLQEDNWKGCDECFCSGVSNRCQSSYWTYGKIQDMSGWYLTDLPGRIRVAPQQDDLDSPQQISISNA--EARQALPHSYYWSAPAPYLGNKLPAVGGQLTFTISYDLEEEEEDTERVLQLMIILEGNDLSISTAQDEVYLHPSEEHTNVLLLKEESFTIHGTHFPV---------RRKEFMTVLANLKRVLLQITYSFGMDAIFRLSSVNLESAVSYPTDGSIAAAVEVCQCPPGYTGSSCESCWPRHRRVNGTIFGGICEPCQCFGHAESCDDVTGECLNCKDHTGGPYCDKCLPGFYGEPTKGTSEDCQPCACPLNIPSNNFSPTCHLDRSLGLICDGCPVGYTGPRCERCAEGYFGQPSVPGGSCQPCQCNDNLDFSIPGSCDSLSGSCLICKPGTTGRYCELCADGYFGDAVDAKNCQPCRCNAGGSFSEVCHSQTGQCECRANVQGQRCDKCKAGTFGLQSARGCVPCNCNSFG---SKSFDCEESGQCWCQPGVTGKKCDRCAHGYFNFQEGGCTACECS--HLGNNCDPKTGRCICPPNTIGEKCSKCAP-NTWGHSITTGCKACNCSTVGSLDFQCNVNTGQCNCHPKFSGAKCTECSRGHWNYPRCNLCDCFLPGTDATTCDSETKKC------SCSDQTGQCTCKVNVEGIHCDRCRPGKFGLDAKNPLGCSSCYCF 1169          

HSP 2 Score: 234.187 bits (596), Expect = 2.118e-60
Identity = 156/424 (36.79%), Postives = 209/424 (49.29%), Query Frame = 2
Query: 2654 CKRCKCNNNQESCDPVTGEC-RCSYNTMGTECQLCKHGFYGD---ALTKSCKKCDCDSLGSTSEN------CDKLTGK-CD-CRTNFVNRQCDSCTSGLY----LKDKKCIPCNCEIQGRISSEKFCNTTSGQCF-CLENVNGDRCEKCVEGYF----NYPNCKKCLC-SPHALSADCDLNNGKCKCGSNVINRICDKCENLHY-WNNRTDCVPCNCGR-GSLNPKCDMETGNCKCAQNVARRDCSKCDVGYFGLDVTGCKKCPPCYNGQVCNNE-GICVCPPNTIGNLCNKCSEDSWDFNETIGCKKCNCYINGSYSNICNKISGICACKTAFFGSKCDRCNEGYYGFPNCQPCSCAENGTKS----NELTK--CDKITGQCQCKQNVIGTKCKVCRKGTFPSDGTYEGGCFSCFCFGVSEKC 3832
            C+ C+C  + ESCD VTGEC  C  +T G  C  C  GFYG+     ++ C+ C C  L   S N       D+  G  CD C   +   +C+ C  G +    +    C PC C      S    C++ SG C  C     G  CE C +GYF    +  NC+ C C +  + S  C    G+C+C +NV  + CDKC+   +   +   CVPCNC   GS +  C+ E+G C C   V  + C +C  GYF     GC  C   + G  C+ + G C+CPPNTIG  C+KC+ ++W  + T GCK CNC   GS    CN  +G C C   F G+KC  C+ G++ +P C  C C   GT +    +E  K  C   TGQC CK NV G  C  CR G F  D     GC SC+CFG + +C
Sbjct:  754 CEPCQCFGHAESCDDVTGECLNCKDHTGGPYCDKCLPGFYGEPTKGTSEDCQPCAC-PLNIPSNNFSPTCHLDRSLGLICDGCPVGYTGPRCERCAEGYFGQPSVPGGSCQPCQCNDNLDFSIPGSCDSLSGSCLICKPGTTGRYCELCADGYFGDAVDAKNCQPCRCNAGGSFSEVCHSQTGQCECRANVQGQRCDKCKAGTFGLQSARGCVPCNCNSFGSKSFDCE-ESGQCWCQPGVTGKKCDRCAHGYFNFQEGGCTACECSHLGNNCDPKTGRCICPPNTIGEKCSKCAPNTWGHSITTGCKACNCSTVGSLDFQCNVNTGQCNCHPKFSGAKCTECSRGHWNYPRCNLCDCFLPGTDATTCDSETKKCSCSDQTGQCTCKVNVEGIHCDRCRPGKFGLDAKNPLGCSSCYCFGTTTQC 1175          

HSP 3 Score: 221.09 bits (562), Expect = 2.125e-56
Identity = 198/654 (30.28%), Postives = 273/654 (41.74%), Query Frame = 2
Query:  950 CICNNHADKCDKVIENGISVAKCNCKHNTCGSNCETCC-PLFNQRPWKPVAVCEECNCNRKSNECSYNQTVATLQLSVNKMGRMEGGGVCINCQENTEGINCEKCIKGFYRPWNVLATELYPCTPCQCHGLGTIG-SCVSNGEDIGDQKPGDCICKKGYEGVNCDLCSIGYERYPNGECLPCPCSIDGSVRTS----FYRCK-----PPCNCKVHVNSDDLCKTCKNGYFNLDSANPEGCEPCYCFGITNQCSSLSAKNLKISDLKGWKLTTFTGEKIALPKF-TSFQYLTSENSYIDERFNNPTV---------------YYWTAPPPYLGNWITSYGTIFRYVVKIELQSTLKGSLIDSPDVIIKCGD-----FRLFHSVSIEDRRLQRQVFIYIKPTEWKIGKLTP--DKAATKEEFISCLVKVDKLLIKAKYYSNQKSIELLNITLSRGEVHLALDEMPH---IEKCNCPPGFNGLSCESCESGYRRVNNVL-------YQGQCEACACYNHSNTCDSLNGECQNCTHNTAGAHCEDCASGYYGDAKSKNLNSCKKCPCPRLDYQ--MTELCSSYSSENYVCHKCLHNTSGVHCDRCIEGYYGNP-KKKISCKRCKCNNNQE---SCDPVTGECRCSYNTMGTECQLCKH 2761
            C CN+   K     E+G    +C C+    G  C+ C    FN +       C  C C+   N C              K GR      CI C  NT G  C KC       W    T    C  C C  +G++   C  N         G C C   + G  C  CS G+  YP   C  C C + G+  T+      +C        C CKV+V     C  C+ G F LD+ NP GC  CYCFG T QCS   AK L    ++ W   T   E+  LP    + Q+ T++       F +P +               +YW  P  + G  + +YG   +Y +  E +     S  + P VII+ G        + H  +    +L R   I +   EWK     P   +  T+E+F+  L  +  +LIKA Y +  +   +  I++   E        P    IEKC+CP G++GLSCE+C  G+ R+ +           G C  C C  HS+ CD     CQNC H+TAG  CE CA GYYG  K    N C++C CP +      +  C +   ++Y C  C     G +C+RC  GY G+P     SC+ C+C+        CDPVTG C C     G +C  CKH
Sbjct:  967 CNCNSFGSKSFDCEESG----QCWCQPGVTGKKCDRCAHGYFNFQE----GGCTACECSHLGNNCD------------PKTGR------CI-CPPNTIGEKCSKCAP---NTWGHSITT--GCKACNCSTVGSLDFQCNVN--------TGQCNCHPKFSGAKCTECSRGHWNYP--RCNLCDCFLPGTDATTCDSETKKCSCSDQTGQCTCKVNVEGIH-CDRCRPGKFGLDAKNPLGCSSCYCFGTTTQCSE--AKGL----IRTW--VTLKAEQTILPLVDEALQHTTTKGIV----FQHPEIVAHMDLMREDLHLEPFYWKLPEQFEGKKLMAYGGKLKYAIYFEAREETGFSTYN-PQVIIRGGTPTHARIIVRHMAAPLIGQLTRHE-IEMTEKEWKYYGDDPRVHRTVTREDFLDILYDIHYILIKATYGNFMRQSRISEISMEVAEQGRGTTMTPPADLIEKCDCPLGYSGLSCEACLPGFYRLRSQPGGRTPGPTLGTCVPCQCNGHSSLCDPETSICQNCQHHTAGDFCERCALGYYGIVKGLP-NDCQQCACPLISSSNNFSPSCVAEGLDDYRCTACPRGYEGQYCERCAPGYTGSPGNPGGSCQECECDPYGSLPVPCDPVTGFCTCRPGATGRKCDGCKH 1562          

HSP 4 Score: 137.117 bits (344), Expect = 5.662e-31
Identity = 167/688 (24.27%), Postives = 291/688 (42.30%), Query Frame = 2
Query: 4289 DSNVINSNLTRDIFMMALLNVTSLKVKL-YTDKVNPPLIKIKIITYKVMETTQAIGKRVTA----VEKCICNALTFGNHCQNPISGYYKEYFNLPNSTKSGSMRTGNRILINLKKCNCNGYSKVCDSVTGDCQNCMGNREGNKCQLCREGFYKNDKNY-DQCEPCQCP--SAHYNFAQNCTRIESSLELKC-QCRIGYSGKSCENCQQGFYGNPI-KGIPCKSCDCNQQGSQSLNCNEF-GICQCSPGVLGIKCDQCAPNYVVEKKTCQSCYSGCTKDLLVRIDTLNETVINFKWK-TLPSTLDLRLNKINISIQMSSELLNSINKFYKLKNEIKNFSIQFQKMKDDAKEKYGEIEKLKTRYNKVLEDLRSTFTDINETISGHEQLG-ISNELIKNATAYLETIKNIYKEMPNITLA-----ASVLKDVLKYVDELNQIIKYTQSHIQSDQINNLK-ILKNKTIMADEINTNNKEYLNTMSTKKKEHELYIILINERMKDLQKIFRKMTKQRDNLRKKIQKLDAISK----SFQDEKDLISINVREIEDLMKNLSSNHLVSKSLIIPDTLKKHVE-------------QQLNKSSNLIKKLTKDFNFLHNAEQAKEAYSNITRDILAVDYAINQTKKELDFNRSNMNIDSLKKLLAEFNSNKSEIVENIKNIDKEHEKLLKQYKNCSY 6244
            D   ++  +TR+ F+  L ++  + +K  Y + +     +I  I+ +V E  Q  G  +T     +EKC C     G  C+  + G+Y+       S   G  RT    L     C CNG+S +CD  T  CQNC  +  G+ C+ C  G+Y   K   + C+ C CP  S+  NF+ +C   E   + +C  C  GY G+ CE C  G+ G+P   G  C+ C+C+  GS  + C+   G C C PG  G KCD C   +  E   C  C   CT  LL  +  L + V++      LP+   +     N++ ++   LL+      +L           Q  + +      E+ +L TR  KV  D   T  D   T +  + LG    EL ++A A  E    + + +     A       + K++ + + EL +    TQ  I  D++   + +LK    +  E    N+E    +  K  +++        ++ D   + R+ T   D +R+   +L A+++    + + +K+ +    R+IE+ +K    N ++ ++  + D +   ++             ++LN   + + +  KD        QA E+++    D  AV   I    K + FN +           A F +       NIK+   E EK+ K+ K+ ++
Sbjct: 1316 DDPRVHRTVTREDFLDILYDIHYILIKATYGNFMRQS--RISEISMEVAE--QGRGTTMTPPADLIEKCDCPLGYSGLSCEACLPGFYRL-----RSQPGG--RTPGPTLGTCVPCQCNGHSSLCDPETSICQNCQHHTAGDFCERCALGYYGIVKGLPNDCQQCACPLISSSNNFSPSCV-AEGLDDYRCTACPRGYEGQYCERCAPGYTGSPGNPGGSCQECECDPYGSLPVPCDPVTGFCTCRPGATGRKCDGCKHWHAREGWECVFCGDECTGLLLGDLARLEQMVMSINLTGPLPAPYKMLYGLENMTQEL-KHLLSPQRAPERL----------IQLAEGNLNTLVTEMNELLTRATKVTADGEQTGQDAERTNTRAKSLGEFIKELARDAEAVNEKAIKLNETLGTRDEAFERNLEGLQKEIDQMIKELRRKNLETQKEIAEDELVAAEALLKKVKKLFGESRGENEEMEKDLREKLADYK-------NKVDDAWDLLREAT---DKIREA-NRLFAVNQKNMTALEKKKEAVESGKRQIENTLK--EGNDILDEANRLADEINSIIDYVEDIQTKLPPMSEELNDKIDDLSQEIKDRKLAEKVSQA-ESHAAQLNDSSAVLDGILDEAKNISFNAT-----------AAFKA-----YSNIKDYIDEAEKVAKEAKDLAH 1950          

HSP 5 Score: 100.908 bits (250), Expect = 5.313e-20
Identity = 87/275 (31.64%), Postives = 117/275 (42.55%), Query Frame = 2
Query: 3086 CLCSPHALSADCD--LNNGKCKCGSNVINRICDKC-ENLHY--WN-----NRTDCVPCNCGRGSLNPKCDMETGNCKCAQNVARRDCSKCDVGYFGLDVTGCKKCPPCYNGQVCNNEGICVCPPNTIGNLCNKCSEDSW-----DFNETIGCKKCNCYINGSYSNICNK---------ISGICACKTAFFGSKCDRCNEGYYGFPNCQPCSCAENGTKSNELTKCDKITGQCQCKQNVIGTKCKVCRKGTFPSDGTYEGGCFSCFCFGVSEKCHA 3838
            C+C  HA +   D   N  +C+C  N     CD+C    H   W       +T+C  CNC           +   C   +NVARR+ S        L++ G         G VC N     C  NT G  C  C++  +       N    C+ C+C   GS + +C K           G C CKT F G  CDRC  GY G+P+C+ C+C+  G+K+      D   G C CK+NV G  C  C+ G F        GC  CFC GVS +C +
Sbjct:  287 CICYGHARACPLDPATNKSRCECEHNTCGDSCDQCCPGFHQKPWRAGTFLTKTECEACNC---------HGKAEECYYDENVARRNLS--------LNIRG-----KYIGGGVCIN-----CTQNTAGINCETCTDGFFRPKGVSPNYPRPCQPCHCDPIGSLNEVCVKDEKHARRGLAPGSCHCKTGFGGVSCDRCARGYTGYPDCKACNCSGLGSKNE-----DPCFGPCICKENVEGGDCSRCKSGFFNLQEDNWKGCDECFCSGVSNRCQS 529          

HSP 6 Score: 99.3673 bits (246), Expect = 1.325e-19
Identity = 80/281 (28.47%), Postives = 125/281 (44.48%), Query Frame = 2
Query: 4274 FIILEDSNVINSN---LTRDIFMMALLNVTSLKVKLYTDKVNPPLIKIKIITYKVMETTQAIGKRVTAVEKCICNALTFGNHCQNPISGYYKEYFNLPNSTKSGSMRTGNRILINLKKCNCNGYSKVCDSVTGDCQNCMGNREGNKCQLCREGFY--KNDKNYDQCEPCQCP--SAHYNFAQNCTRIESSLELKCQ-CRIGYSGKSCENCQQGFYGNP-IKGIPCKSCDCNQQGSQSL--NCNEF-GICQ-CSPGVLGIKCDQCAPNY---VVEKKTCQSC 5068
             ++ E+S  I+     + R  FM  L N+  + +++        + ++  +  +   +    G    AVE C C     G+ C++    + +      N T  G +          + C C G+++ CD VTG+C NC  +  G  C  C  GFY        + C+PC CP      NF+  C  ++ SL L C  C +GY+G  CE C +G++G P + G  C+ C CN     S+  +C+   G C  C PG  G  C+ CA  Y    V+ K CQ C
Sbjct:  653 LLLKEESFTIHGTHFPVRRKEFMTVLANLKRVLLQITYSFGMDAIFRLSSVNLESAVSYPTDGSIAAAVEVCQCPPGYTGSSCESCWPRHRRV-----NGTIFGGI---------CEPCQCFGHAESCDDVTGECLNCKDHTGGPYCDKCLPGFYGEPTKGTSEDCQPCACPLNIPSNNFSPTC-HLDRSLGLICDGCPVGYTGPRCERCAEGYFGQPSVPGGSCQPCQCNDNLDFSIPGSCDSLSGSCLICKPGTTGRYCELCADGYFGDAVDAKNCQPC 918          

HSP 7 Score: 94.3597 bits (233), Expect = 4.525e-18
Identity = 52/143 (36.36%), Postives = 80/143 (55.94%), Query Frame = 2
Query: 4646 CDSVTGDCQNCMGNREGNKCQLCREGFYKNDKNYDQCEPCQCPSAHYNFAQNCTRIESSLELKCQCRIGYSGKSCENCQQGFYG-NPIKGIPCKSCDCNQQGSQSLNCNEFGICQCSPGVLGIKCDQCAPNYV-VEKKTCQSC 5068
            CDS++G C  C     G  C+LC +G++ +  +   C+PC+C +A  +F++ C     S   +C+CR    G+ C+ C+ G +G    +G  C  C+CN  GS+S +C E G C C PGV G KCD+CA  Y   ++  C +C
Sbjct:  879 CDSLSGSCLICKPGTTGRYCELCADGYFGDAVDAKNCQPCRC-NAGGSFSEVC----HSQTGQCECRANVQGQRCDKCKAGTFGLQSARG--CVPCNCNSFGSKSFDCEESGQCWCQPGVTGKKCDRCAHGYFNFQEGGCTAC 1014          

HSP 8 Score: 69.707 bits (169), Expect = 1.449e-10
Identity = 60/225 (26.67%), Postives = 88/225 (39.11%), Query Frame = 2
Query: 2576 CLHNTSGVHCDRCIEGYY---GNPKKKI------SCKRCKCNNNQESCDPVTGECR-CSYNTMGTECQLCKHGFYG--DALTKSCKKCDCDSLGSTSENCDKLTGKCDCRTNFVNRQCDSCTSGLYLKDKKCIPCNCEIQGRISSEKFCNTTSGQCFCLENVNGDRCEKCVEGYFNYP-----NCKKCLCSPH-ALSADCDLNNGKCKCGSNVINRICDKCENLH 3196
            C    SG+ C+ C+ G+Y     P  +       +C  C+CN +   CDP T  C+ C ++T G  C+ C  G+YG    L   C++C C  + S++              NF      SC +   L D +C  C                            G  CE+C  GY   P     +C++C C P+ +L   CD   G C C      R CD C++ H
Sbjct: 1382 CPLGYSGLSCEACLPGFYRLRSQPGGRTPGPTLGTCVPCQCNGHSSLCDPETSICQNCQHHTAGDFCERCALGYYGIVKGLPNDCQQCACPLISSSN--------------NF----SPSCVAE-GLDDYRCTACP-----------------------RGYEGQYCERCAPGYTGSPGNPGGSCQECECDPYGSLPVPCDPVTGFCTCRPGATGRKCDGCKHWH 1564          

HSP 9 Score: 63.1586 bits (152), Expect = 1.410e-8
Identity = 61/224 (27.23%), Postives = 96/224 (42.86%), Query Frame = 2
Query: 4460 VTAVEKCICNALTFGNHCQNPISGYYKEYFNLPNSTKSGSMRTGNRILINLKKCNCNGYSKVC---DSVT---------------GDCQNCMGNREGNKCQLCREGFYKN---DKNYDQ-CEPCQC-PSAHYNFAQNCTRIESSLEL-----KCQCRIGYSGKSCENCQQGFYGNPIKGIPCKSCDCNQQGSQSLNCNE---FGICQCSPGVLGIKCDQCAPNY 5038
             T   +C C   T G+ C     G++++ +      ++G+  T        + CNC+G ++ C   ++V                G C NC  N  G  C+ C +GF++      NY + C+PC C P    N  + C + E           C C+ G+ G SC+ C +G+ G P     CK+C+C+  GS+    NE   FG C C   V G  C +C   +
Sbjct:  301 ATNKSRCECEHNTCGDSCDQCCPGFHQKPW------RAGTFLTKTEC----EACNCHGKAEECYYDENVARRNLSLNIRGKYIGGGVCINCTQNTAGINCETCTDGFFRPKGVSPNYPRPCQPCHCDPIGSLN--EVCVKDEKHARRGLAPGSCHCKTGFGGVSCDRCARGYTGYP----DCKACNCSGLGSK----NEDPCFGPCICKENVEGGDCSRCKSGF 504          

HSP 10 Score: 58.5362 bits (140), Expect = 3.058e-7
Identity = 56/201 (27.86%), Postives = 84/201 (41.79%), Query Frame = 2
Query: 3236 GRGS-LNPKCDMETGNCKCAQNVARRDCSKCDVGYFGLDVTGCKKCP--------PCY-NGQ--VCNNE-GICV-CPPNTIGNLCNKCSEDSWDFNETI--GCKKCNCYINGSYSNICNK--ISGI-----CACKTAFFGSKCDRCNEGYYGFP-----NCQPCSCAENGTKSNELTKCDKITGQCQCKQNVIGTKCKVCR 3754
            GRG+ + P  D+    C C    +   C  C  G++ L      + P        PC  NG   +C+ E  IC  C  +T G+ C +C+   +   + +   C++C C +  S +N        G+      AC   + G  C+RC  GY G P     +CQ C C   G+       CD +TG C C+    G KC  C+
Sbjct: 1365 GRGTTMTPPADL-IEKCDCPLGYSGLSCEACLPGFYRLRSQPGGRTPGPTLGTCVPCQCNGHSSLCDPETSICQNCQHHTAGDFCERCALGYYGIVKGLPNDCQQCACPLISSSNNFSPSCVAEGLDDYRCTACPRGYEGQYCERCAPGYTGSPGNPGGSCQECECDPYGSLP---VPCDPVTGFCTCRPGATGRKCDGCK 1561          

HSP 11 Score: 58.151 bits (139), Expect = 4.205e-7
Identity = 48/148 (32.43%), Postives = 66/148 (44.59%), Query Frame = 2
Query: 3218 CVPCNC-GRGSLNPKCDMETGNCK-CAQNVARRDCSKCDVGYFGLDVTG----CKKCP-PCYNGQ-----VCNNEGI-----CVCPPNTIGNLCNKCSED--SWDFNETIGCKKCNCYINGSYSNICNKISGICACKTAFFGSKCDRC 3604
            CVPC C G  SL   CD ET  C+ C  + A   C +C +GY+G+ V G    C++C  P  +        C  EG+       CP    G  C +C+        N    C++C C   GS    C+ ++G C C+    G KCD C
Sbjct: 1417 CVPCQCNGHSSL---CDPETSICQNCQHHTAGDFCERCALGYYGI-VKGLPNDCQQCACPLISSSNNFSPSCVAEGLDDYRCTACPRGYEGQYCERCAPGYTGSPGNPGGSCQECECDPYGSLPVPCDPVTGFCTCRPGATGRKCDGC 1560          

HSP 12 Score: 54.299 bits (129), Expect = 5.703e-6
Identity = 55/199 (27.64%), Postives = 77/199 (38.69%), Query Frame = 2
Query: 2819 GSTSENCDKLTGKCDCRTNFVNRQCDSCTSGLY-LKDKK-----------CIPCNCEIQGRISSEKFCNTTSGQCF-CLENVNGDRCEKCVEGYF----NYPN-CKKCLC----SPHALSADC---DLNNGKC-KCGSNVINRICDKCENLHY---WNNRTDCVPCNCGR-GSLNPKCDMETGNCKCAQNVARRDCSKC 3325
            G+T      L  KCDC   +    C++C  G Y L+ +            C+PC C           C+  +  C  C  +  GD CE+C  GY+      PN C++C C    S +  S  C    L++ +C  C      + C++C   +     N    C  C C   GSL   CD  TG C C      R C  C
Sbjct: 1367 GTTMTPPADLIEKCDCPLGYSGLSCEACLPGFYRLRSQPGGRTPGPTLGTCVPCQCN-----GHSSLCDPETSICQNCQHHTAGDFCERCALGYYGIVKGLPNDCQQCACPLISSSNNFSPSCVAEGLDDYRCTACPRGYEGQYCERCAPGYTGSPGNPGGSCQECECDPYGSLPVPCDPVTGFCTCRPGATGRKCDGC 1560          
BLAST of Laminin subunit alpha-2 vs. Ensembl Human
Match: LAMA2 (laminin subunit alpha 2 [Source:HGNC Symbol;Acc:HGNC:6482])

HSP 1 Score: 715.301 bits (1845), Expect = 0.000e+0
Identity = 433/1176 (36.82%), Postives = 614/1176 (52.21%), Query Frame = 2
Query:  188 LMENAKITSSATCGTGGPEIFCRLVDEIAIQRLINPDSHVLCDVCD--NRNETKRHPIEFAKSDDDNLWWQSPSMAQGLKYQNVNVTIDLKQVYQIVYILLKMGDSPRPGNWILERSLDGEIYMPWIFFAETPYSC---YNLFQRQYPDLKLTTNAKPSSLADDEMFCTTYYSQPKSLNSGEIIISLINGRKSIMNEEYLSIKSVPQTLINFLSARYIRFRFLKHLTLAADLM--THKG--YLEQSIYNRYYYSLRNIEIGGKCICNNHADKCDKVIENGISVAKCNCKHNTCGSNCETCCPLFNQRPWKPVAV-----CEECNCNRKSNECSYNQTVATLQLSVNKMGRMEGGGVCINCQENTEGINCEKCIKGFYRPWNVLATELYPCTPCQCHGLGTIGSCVSNGEDIGDQ--KPGDCICKKGYEGVNCDLCSIGYERYPNGECLPCPCSIDGSVRTSFYRCKPPCNCKVHVNSDDLCKTCKNGYFNLDSANPEGCEPCYCFGITNQCSSLSAKNLKISDLKGWKLTTFTGEKIALPK---FTSFQYLTSENSYIDERFNNPTVYYWTAPPPYLGNWITSYGTIFRYVVKIELQSTLKGS--------LIDSPDVIIKCGDFRLFHSVSIEDRR--LQRQVFIYIKPTEWKIGKLTPDKAATKEEFISCLVKVDKLLIKAKYYSNQKSIELLNITLSRGEVHLALDE--MPHIEKCNCPPGFNGLSCESCESGYRRVNNVLYQGQCEACACYNHSNTCDSLNGECQNCTHNTAGAHCEDCASGYYGDAKSKNLNSCKKCPCPR--LDYQMTELCSSYSSENYVCHKCLHNTSGVHCDRCIEGYYGNPK-KKISCKRCKCNNNQE-----SCDPVTGECR-CSYNTMGTECQLCKHGFYGDAL-TKSCKKCDCDSLGSTSENCDKLTGKCDCRTNFVNRQCDSCTSGLY--LKDKKCIPCNCEIQGRISSEKFCNTTSGQCFCLENVNGDRCEKCVEGYFNYP--NCKKCLCSPHALSADCDLNNGKCKCGSNVINRICDKCENLHYWNNR--TDCVPCNCGR-GSLNPKCDMETGNCKCAQNVARRDCSKCDVGYF-------------GLDVTGC----KKCPPCYNGQVCNNEGICVCPPNTIGNLCNKCSEDSW--DFNETIGCKKCNCY 3514
            L  NA IT++ATCG  GPE++C+LV+ +  Q + NP     C +C+  + N  +RHPI  A  D  N WWQSPS+  G++Y  V +T+DL+QV+QI Y+++K  +SPRPGNWILERSLD   Y PW + A T   C   YN++ R  P         PS   DDE+ CT++YS+   L +GEI ISLINGR S  +         P+ L+ F SARYIR RF +  TL ADLM   HK    ++  +  RYYYS+++I +GG CIC  HA  C   ++   + ++C C+HNTCG +C+ CCP F+Q+PW+         CE CNC+ K+ EC Y++ VA   LS+N  G+  GGGVCINC +NT GINCE C  GF+RP  V      PC PC C  +G++       E    +   PG C CK G+ GV+CD C+ GY  YP  +C  C CS  GS       C  PC CK +V   D C  CK+G+FNL   N +GC+ C+C G++N+C S      KI D+ GW LT   G     P+     S Q ++  N+  + R   P  YYW+AP PYLGN + + G    + +  +L+   + +        +++  D+ I      ++   S E     L ++    I  T + +          ++EF++ L  + ++L++  Y     +I  L+       V    D      +E C CPPG+ G SCESC   +RRVN  ++ G CE C C+ H+ +CD + GEC NC  +T G +C+ C  G+YG+        C+ C CP        +  C    S   +C  C    +G  C+RC EGY+G P     SC+ C+CN+N +     SCD ++G C  C   T G  C+LC  G++GDA+  K+C+ C C++ GS SE C   TG+C+CR N   ++CD C +G +     + C+PCNC   G   S+ F    SGQC+C   V G +C++C  GYFN+    C  C CS   L  +CD   G+C C  N I   C KC   + W +   T C  CNC   GSL+ +C++ TG C C    +   C++C  G++             G D T C    KKC         +  G C C  N  G  C++C    +  D    +GC  C C+
Sbjct:   46 LASNALITTNATCGEKGPEMYCKLVEHVPGQPVRNPQ----CRICNQNSSNPNQRHPITNA-IDGKNTWWQSPSIKNGIEYHYVTITLDLQQVFQIAYVIVKAANSPRPGNWILERSLDDVEYKPWQYHAVTDTECLTLYNIYPRTGP---------PSYAKDDEVICTSFYSKIHPLENGEIHISLINGRPSADDPS-------PE-LLEFTSARYIRLRFQRIRTLNADLMMFAHKDPREIDPIVTRRYYYSVKDISVGGMCICYGHARACP--LDPATNKSRCECEHNTCGDSCDQCCPGFHQKPWRAGTFLTKTECEACNCHGKAEECYYDENVARRNLSLNIRGKYIGGGVCINCTQNTAGINCETCTDGFFRPKGVSPNYPRPCQPCHCDPIGSLNEVCVKDEKHARRGLAPGSCHCKTGFGGVSCDRCARGYTGYP--DCKACNCSGLGSKNED--PCFGPCICKENVEGGD-CSRCKSGFFNLQEDNWKGCDECFCSGVSNRCQSSYWTYGKIQDMSGWYLTDLPGRIRVAPQQDDLDSPQQISISNA--EARQALPHSYYWSAPAPYLGNKLPAVGGQLTFTISYDLEEEEEDTERVLQLMIILEGNDLSISTAQDEVYLHPSEEHTNVLLLKEESFTIHGTHFPV---------RRKEFMTVLANLKRVLLQITYSFGMDAIFRLSSVNLESAVSYPTDGSIAAAVEVCQCPPGYTGSSCESCWPRHRRVNGTIFGGICEPCQCFGHAESCDDVTGECLNCKDHTGGPYCDKCLPGFYGEPTKGTSEDCQPCACPLNIPSNNFSPTCHLDRSLGLICDGCPVGYTGPRCERCAEGYFGQPSVPGGSCQPCQCNDNLDFSIPGSCDSLSGSCLICKPGTTGRYCELCADGYFGDAVDAKNCQPCRCNAGGSFSEVCHSQTGQCECRANVQGQRCDKCKAGTFGLQSARGCVPCNCNSFG---SKSFDCEESGQCWCQPGVTGKKCDRCAHGYFNFQEGGCTACECS--HLGNNCDPKTGRCICPPNTIGEKCSKCAP-NTWGHSITTGCKACNCSTVGSLDFQCNVNTGQCNCHPKFSGAKCTECSRGHWNYPRCNLCDCFLPGTDATTCDSETKKC------SCSDQTGQCTCKVNVEGIHCDRCRPGKFGLDAKNPLGCSSCYCF 1169          

HSP 2 Score: 234.187 bits (596), Expect = 2.190e-60
Identity = 156/424 (36.79%), Postives = 209/424 (49.29%), Query Frame = 2
Query: 2654 CKRCKCNNNQESCDPVTGEC-RCSYNTMGTECQLCKHGFYGD---ALTKSCKKCDCDSLGSTSEN------CDKLTGK-CD-CRTNFVNRQCDSCTSGLY----LKDKKCIPCNCEIQGRISSEKFCNTTSGQCF-CLENVNGDRCEKCVEGYF----NYPNCKKCLC-SPHALSADCDLNNGKCKCGSNVINRICDKCENLHY-WNNRTDCVPCNCGR-GSLNPKCDMETGNCKCAQNVARRDCSKCDVGYFGLDVTGCKKCPPCYNGQVCNNE-GICVCPPNTIGNLCNKCSEDSWDFNETIGCKKCNCYINGSYSNICNKISGICACKTAFFGSKCDRCNEGYYGFPNCQPCSCAENGTKS----NELTK--CDKITGQCQCKQNVIGTKCKVCRKGTFPSDGTYEGGCFSCFCFGVSEKC 3832
            C+ C+C  + ESCD VTGEC  C  +T G  C  C  GFYG+     ++ C+ C C  L   S N       D+  G  CD C   +   +C+ C  G +    +    C PC C      S    C++ SG C  C     G  CE C +GYF    +  NC+ C C +  + S  C    G+C+C +NV  + CDKC+   +   +   CVPCNC   GS +  C+ E+G C C   V  + C +C  GYF     GC  C   + G  C+ + G C+CPPNTIG  C+KC+ ++W  + T GCK CNC   GS    CN  +G C C   F G+KC  C+ G++ +P C  C C   GT +    +E  K  C   TGQC CK NV G  C  CR G F  D     GC SC+CFG + +C
Sbjct:  754 CEPCQCFGHAESCDDVTGECLNCKDHTGGPYCDKCLPGFYGEPTKGTSEDCQPCAC-PLNIPSNNFSPTCHLDRSLGLICDGCPVGYTGPRCERCAEGYFGQPSVPGGSCQPCQCNDNLDFSIPGSCDSLSGSCLICKPGTTGRYCELCADGYFGDAVDAKNCQPCRCNAGGSFSEVCHSQTGQCECRANVQGQRCDKCKAGTFGLQSARGCVPCNCNSFGSKSFDCE-ESGQCWCQPGVTGKKCDRCAHGYFNFQEGGCTACECSHLGNNCDPKTGRCICPPNTIGEKCSKCAPNTWGHSITTGCKACNCSTVGSLDFQCNVNTGQCNCHPKFSGAKCTECSRGHWNYPRCNLCDCFLPGTDATTCDSETKKCSCSDQTGQCTCKVNVEGIHCDRCRPGKFGLDAKNPLGCSSCYCFGTTTQC 1175          

HSP 3 Score: 220.705 bits (561), Expect = 2.330e-56
Identity = 198/654 (30.28%), Postives = 273/654 (41.74%), Query Frame = 2
Query:  950 CICNNHADKCDKVIENGISVAKCNCKHNTCGSNCETCC-PLFNQRPWKPVAVCEECNCNRKSNECSYNQTVATLQLSVNKMGRMEGGGVCINCQENTEGINCEKCIKGFYRPWNVLATELYPCTPCQCHGLGTIG-SCVSNGEDIGDQKPGDCICKKGYEGVNCDLCSIGYERYPNGECLPCPCSIDGSVRTS----FYRCK-----PPCNCKVHVNSDDLCKTCKNGYFNLDSANPEGCEPCYCFGITNQCSSLSAKNLKISDLKGWKLTTFTGEKIALPKF-TSFQYLTSENSYIDERFNNPTV---------------YYWTAPPPYLGNWITSYGTIFRYVVKIELQSTLKGSLIDSPDVIIKCGD-----FRLFHSVSIEDRRLQRQVFIYIKPTEWKIGKLTP--DKAATKEEFISCLVKVDKLLIKAKYYSNQKSIELLNITLSRGEVHLALDEMPH---IEKCNCPPGFNGLSCESCESGYRRVNNVL-------YQGQCEACACYNHSNTCDSLNGECQNCTHNTAGAHCEDCASGYYGDAKSKNLNSCKKCPCPRLDYQ--MTELCSSYSSENYVCHKCLHNTSGVHCDRCIEGYYGNP-KKKISCKRCKCNNNQE---SCDPVTGECRCSYNTMGTECQLCKH 2761
            C CN+   K     E+G    +C C+    G  C+ C    FN +       C  C C+   N C              K GR      CI C  NT G  C KC       W    T    C  C C  +G++   C  N         G C C   + G  C  CS G+  YP   C  C C + G+  T+      +C        C CKV+V     C  C+ G F LD+ NP GC  CYCFG T QCS   AK L    ++ W   T   E+  LP    + Q+ T++       F +P +               +YW  P  + G  + +YG   +Y +  E +     S  + P VII+ G        + H  +    +L R   I +   EWK     P   +  T+E+F+  L  +  +LIKA Y +  +   +  I++   E        P    IEKC+CP G++GLSCE+C  G+ R+ +           G C  C C  HS+ CD     CQNC H+TAG  CE CA GYYG  K    N C++C CP +      +  C +   ++Y C  C     G +C+RC  GY G+P     SC+ C+C+        CDPVTG C C     G +C  CKH
Sbjct:  967 CNCNSFGSKSFDCEESG----QCWCQPGVTGKKCDRCAHGYFNFQE----GGCTACECSHLGNNCD------------PKTGR------CI-CPPNTIGEKCSKCAP---NTWGHSITT--GCKACNCSTVGSLDFQCNVN--------TGQCNCHPKFSGAKCTECSRGHWNYP--RCNLCDCFLPGTDATTCDSETKKCSCSDQTGQCTCKVNVEGIH-CDRCRPGKFGLDAKNPLGCSSCYCFGTTTQCSE--AKGL----IRTW--VTLKAEQTILPLVDEALQHTTTKGIV----FQHPEIVAHMDLMREDLHLEPFYWKLPEQFEGKKLMAYGGKLKYAIYFEAREETGFSTYN-PQVIIRGGTPTHARIIVRHMAAPLIGQLTRHE-IEMTEKEWKYYGDDPRVHRTVTREDFLDILYDIHYILIKATYGNFMRQSRISEISMEVAEQGRGTTMTPPADLIEKCDCPLGYSGLSCEACLPGFYRLRSQPGGRTPGPTLGTCVPCQCNGHSSLCDPETSICQNCQHHTAGDFCERCALGYYGIVKGLP-NDCQQCACPLISSSNNFSPSCVAEGLDDYRCTACPRGYEGQYCERCAPGYTGSPGNPGGSCQECECDPYGSLPVPCDPVTGFCTCRPGATGRKCDGCKH 1562          

HSP 4 Score: 136.732 bits (343), Expect = 6.209e-31
Identity = 167/688 (24.27%), Postives = 291/688 (42.30%), Query Frame = 2
Query: 4289 DSNVINSNLTRDIFMMALLNVTSLKVKL-YTDKVNPPLIKIKIITYKVMETTQAIGKRVTA----VEKCICNALTFGNHCQNPISGYYKEYFNLPNSTKSGSMRTGNRILINLKKCNCNGYSKVCDSVTGDCQNCMGNREGNKCQLCREGFYKNDKNY-DQCEPCQCP--SAHYNFAQNCTRIESSLELKC-QCRIGYSGKSCENCQQGFYGNPI-KGIPCKSCDCNQQGSQSLNCNEF-GICQCSPGVLGIKCDQCAPNYVVEKKTCQSCYSGCTKDLLVRIDTLNETVINFKWK-TLPSTLDLRLNKINISIQMSSELLNSINKFYKLKNEIKNFSIQFQKMKDDAKEKYGEIEKLKTRYNKVLEDLRSTFTDINETISGHEQLG-ISNELIKNATAYLETIKNIYKEMPNITLA-----ASVLKDVLKYVDELNQIIKYTQSHIQSDQINNLK-ILKNKTIMADEINTNNKEYLNTMSTKKKEHELYIILINERMKDLQKIFRKMTKQRDNLRKKIQKLDAISK----SFQDEKDLISINVREIEDLMKNLSSNHLVSKSLIIPDTLKKHVE-------------QQLNKSSNLIKKLTKDFNFLHNAEQAKEAYSNITRDILAVDYAINQTKKELDFNRSNMNIDSLKKLLAEFNSNKSEIVENIKNIDKEHEKLLKQYKNCSY 6244
            D   ++  +TR+ F+  L ++  + +K  Y + +     +I  I+ +V E  Q  G  +T     +EKC C     G  C+  + G+Y+       S   G  RT    L     C CNG+S +CD  T  CQNC  +  G+ C+ C  G+Y   K   + C+ C CP  S+  NF+ +C   E   + +C  C  GY G+ CE C  G+ G+P   G  C+ C+C+  GS  + C+   G C C PG  G KCD C   +  E   C  C   CT  LL  +  L + V++      LP+   +     N++ ++   LL+      +L           Q  + +      E+ +L TR  KV  D   T  D   T +  + LG    EL ++A A  E    + + +     A       + K++ + + EL +    TQ  I  D++   + +LK    +  E    N+E    +  K  +++        ++ D   + R+ T   D +R+   +L A+++    + + +K+ +    R+IE+ +K    N ++ ++  + D +   ++             ++LN   + + +  KD        QA E+++    D  AV   I    K + FN +           A F +       NIK+   E EK+ K+ K+ ++
Sbjct: 1316 DDPRVHRTVTREDFLDILYDIHYILIKATYGNFMRQS--RISEISMEVAE--QGRGTTMTPPADLIEKCDCPLGYSGLSCEACLPGFYRL-----RSQPGG--RTPGPTLGTCVPCQCNGHSSLCDPETSICQNCQHHTAGDFCERCALGYYGIVKGLPNDCQQCACPLISSSNNFSPSCV-AEGLDDYRCTACPRGYEGQYCERCAPGYTGSPGNPGGSCQECECDPYGSLPVPCDPVTGFCTCRPGATGRKCDGCKHWHAREGWECVFCGDECTGLLLGDLARLEQMVMSINLTGPLPAPYKMLYGLENMTQEL-KHLLSPQRAPERL----------IQLAEGNLNTLVTEMNELLTRATKVTADGEQTGQDAERTNTRAKSLGEFIKELARDAEAVNEKAIKLNETLGTRDEAFERNLEGLQKEIDQMIKELRRKNLETQKEIAEDELVAAEALLKKVKKLFGESRGENEEMEKDLREKLADYK-------NKVDDAWDLLREAT---DKIREA-NRLFAVNQKNMTALEKKKEAVESGKRQIENTLK--EGNDILDEANRLADEINSIIDYVEDIQTKLPPMSEELNDKIDDLSQEIKDRKLAEKVSQA-ESHAAQLNDSSAVLDGILDEAKNISFNAT-----------AAFKA-----YSNIKDYIDEAEKVAKEAKDLAH 1950          

HSP 5 Score: 100.523 bits (249), Expect = 5.681e-20
Identity = 87/275 (31.64%), Postives = 117/275 (42.55%), Query Frame = 2
Query: 3086 CLCSPHALSADCD--LNNGKCKCGSNVINRICDKC-ENLHY--WN-----NRTDCVPCNCGRGSLNPKCDMETGNCKCAQNVARRDCSKCDVGYFGLDVTGCKKCPPCYNGQVCNNEGICVCPPNTIGNLCNKCSEDSW-----DFNETIGCKKCNCYINGSYSNICNK---------ISGICACKTAFFGSKCDRCNEGYYGFPNCQPCSCAENGTKSNELTKCDKITGQCQCKQNVIGTKCKVCRKGTFPSDGTYEGGCFSCFCFGVSEKCHA 3838
            C+C  HA +   D   N  +C+C  N     CD+C    H   W       +T+C  CNC           +   C   +NVARR+ S        L++ G         G VC N     C  NT G  C  C++  +       N    C+ C+C   GS + +C K           G C CKT F G  CDRC  GY G+P+C+ C+C+  G+K+      D   G C CK+NV G  C  C+ G F        GC  CFC GVS +C +
Sbjct:  287 CICYGHARACPLDPATNKSRCECEHNTCGDSCDQCCPGFHQKPWRAGTFLTKTECEACNC---------HGKAEECYYDENVARRNLS--------LNIRG-----KYIGGGVCIN-----CTQNTAGINCETCTDGFFRPKGVSPNYPRPCQPCHCDPIGSLNEVCVKDEKHARRGLAPGSCHCKTGFGGVSCDRCARGYTGYPDCKACNCSGLGSKNE-----DPCFGPCICKENVEGGDCSRCKSGFFNLQEDNWKGCDECFCSGVSNRCQS 529          

HSP 6 Score: 99.3673 bits (246), Expect = 1.325e-19
Identity = 80/281 (28.47%), Postives = 125/281 (44.48%), Query Frame = 2
Query: 4274 FIILEDSNVINSN---LTRDIFMMALLNVTSLKVKLYTDKVNPPLIKIKIITYKVMETTQAIGKRVTAVEKCICNALTFGNHCQNPISGYYKEYFNLPNSTKSGSMRTGNRILINLKKCNCNGYSKVCDSVTGDCQNCMGNREGNKCQLCREGFY--KNDKNYDQCEPCQCP--SAHYNFAQNCTRIESSLELKCQ-CRIGYSGKSCENCQQGFYGNP-IKGIPCKSCDCNQQGSQSL--NCNEF-GICQ-CSPGVLGIKCDQCAPNY---VVEKKTCQSC 5068
             ++ E+S  I+     + R  FM  L N+  + +++        + ++  +  +   +    G    AVE C C     G+ C++    + +      N T  G +          + C C G+++ CD VTG+C NC  +  G  C  C  GFY        + C+PC CP      NF+  C  ++ SL L C  C +GY+G  CE C +G++G P + G  C+ C CN     S+  +C+   G C  C PG  G  C+ CA  Y    V+ K CQ C
Sbjct:  653 LLLKEESFTIHGTHFPVRRKEFMTVLANLKRVLLQITYSFGMDAIFRLSSVNLESAVSYPTDGSIAAAVEVCQCPPGYTGSSCESCWPRHRRV-----NGTIFGGI---------CEPCQCFGHAESCDDVTGECLNCKDHTGGPYCDKCLPGFYGEPTKGTSEDCQPCACPLNIPSNNFSPTC-HLDRSLGLICDGCPVGYTGPRCERCAEGYFGQPSVPGGSCQPCQCNDNLDFSIPGSCDSLSGSCLICKPGTTGRYCELCADGYFGDAVDAKNCQPC 918          

HSP 7 Score: 94.3597 bits (233), Expect = 4.601e-18
Identity = 52/143 (36.36%), Postives = 80/143 (55.94%), Query Frame = 2
Query: 4646 CDSVTGDCQNCMGNREGNKCQLCREGFYKNDKNYDQCEPCQCPSAHYNFAQNCTRIESSLELKCQCRIGYSGKSCENCQQGFYG-NPIKGIPCKSCDCNQQGSQSLNCNEFGICQCSPGVLGIKCDQCAPNYV-VEKKTCQSC 5068
            CDS++G C  C     G  C+LC +G++ +  +   C+PC+C +A  +F++ C     S   +C+CR    G+ C+ C+ G +G    +G  C  C+CN  GS+S +C E G C C PGV G KCD+CA  Y   ++  C +C
Sbjct:  879 CDSLSGSCLICKPGTTGRYCELCADGYFGDAVDAKNCQPCRC-NAGGSFSEVC----HSQTGQCECRANVQGQRCDKCKAGTFGLQSARG--CVPCNCNSFGSKSFDCEESGQCWCQPGVTGKKCDRCAHGYFNFQEGGCTAC 1014          

HSP 8 Score: 69.707 bits (169), Expect = 1.449e-10
Identity = 60/225 (26.67%), Postives = 88/225 (39.11%), Query Frame = 2
Query: 2576 CLHNTSGVHCDRCIEGYY---GNPKKKI------SCKRCKCNNNQESCDPVTGECR-CSYNTMGTECQLCKHGFYG--DALTKSCKKCDCDSLGSTSENCDKLTGKCDCRTNFVNRQCDSCTSGLYLKDKKCIPCNCEIQGRISSEKFCNTTSGQCFCLENVNGDRCEKCVEGYFNYP-----NCKKCLCSPH-ALSADCDLNNGKCKCGSNVINRICDKCENLH 3196
            C    SG+ C+ C+ G+Y     P  +       +C  C+CN +   CDP T  C+ C ++T G  C+ C  G+YG    L   C++C C  + S++              NF      SC +   L D +C  C                            G  CE+C  GY   P     +C++C C P+ +L   CD   G C C      R CD C++ H
Sbjct: 1382 CPLGYSGLSCEACLPGFYRLRSQPGGRTPGPTLGTCVPCQCNGHSSLCDPETSICQNCQHHTAGDFCERCALGYYGIVKGLPNDCQQCACPLISSSN--------------NF----SPSCVAE-GLDDYRCTACP-----------------------RGYEGQYCERCAPGYTGSPGNPGGSCQECECDPYGSLPVPCDPVTGFCTCRPGATGRKCDGCKHWH 1564          

HSP 9 Score: 62.7734 bits (151), Expect = 1.533e-8
Identity = 61/224 (27.23%), Postives = 96/224 (42.86%), Query Frame = 2
Query: 4460 VTAVEKCICNALTFGNHCQNPISGYYKEYFNLPNSTKSGSMRTGNRILINLKKCNCNGYSKVC---DSVT---------------GDCQNCMGNREGNKCQLCREGFYKN---DKNYDQ-CEPCQC-PSAHYNFAQNCTRIESSLEL-----KCQCRIGYSGKSCENCQQGFYGNPIKGIPCKSCDCNQQGSQSLNCNE---FGICQCSPGVLGIKCDQCAPNY 5038
             T   +C C   T G+ C     G++++ +      ++G+  T        + CNC+G ++ C   ++V                G C NC  N  G  C+ C +GF++      NY + C+PC C P    N  + C + E           C C+ G+ G SC+ C +G+ G P     CK+C+C+  GS+    NE   FG C C   V G  C +C   +
Sbjct:  301 ATNKSRCECEHNTCGDSCDQCCPGFHQKPW------RAGTFLTKTEC----EACNCHGKAEECYYDENVARRNLSLNIRGKYIGGGVCINCTQNTAGINCETCTDGFFRPKGVSPNYPRPCQPCHCDPIGSLN--EVCVKDEKHARRGLAPGSCHCKTGFGGVSCDRCARGYTGYP----DCKACNCSGLGSK----NEDPCFGPCICKENVEGGDCSRCKSGF 504          

HSP 10 Score: 58.5362 bits (140), Expect = 3.109e-7
Identity = 56/201 (27.86%), Postives = 84/201 (41.79%), Query Frame = 2
Query: 3236 GRGS-LNPKCDMETGNCKCAQNVARRDCSKCDVGYFGLDVTGCKKCP--------PCY-NGQ--VCNNE-GICV-CPPNTIGNLCNKCSEDSWDFNETI--GCKKCNCYINGSYSNICNK--ISGI-----CACKTAFFGSKCDRCNEGYYGFP-----NCQPCSCAENGTKSNELTKCDKITGQCQCKQNVIGTKCKVCR 3754
            GRG+ + P  D+    C C    +   C  C  G++ L      + P        PC  NG   +C+ E  IC  C  +T G+ C +C+   +   + +   C++C C +  S +N        G+      AC   + G  C+RC  GY G P     +CQ C C   G+       CD +TG C C+    G KC  C+
Sbjct: 1365 GRGTTMTPPADL-IEKCDCPLGYSGLSCEACLPGFYRLRSQPGGRTPGPTLGTCVPCQCNGHSSLCDPETSICQNCQHHTAGDFCERCALGYYGIVKGLPNDCQQCACPLISSSNNFSPSCVAEGLDDYRCTACPRGYEGQYCERCAPGYTGSPGNPGGSCQECECDPYGSLP---VPCDPVTGFCTCRPGATGRKCDGCK 1561          

HSP 11 Score: 58.151 bits (139), Expect = 4.276e-7
Identity = 48/148 (32.43%), Postives = 66/148 (44.59%), Query Frame = 2
Query: 3218 CVPCNC-GRGSLNPKCDMETGNCK-CAQNVARRDCSKCDVGYFGLDVTG----CKKCP-PCYNGQ-----VCNNEGI-----CVCPPNTIGNLCNKCSED--SWDFNETIGCKKCNCYINGSYSNICNKISGICACKTAFFGSKCDRC 3604
            CVPC C G  SL   CD ET  C+ C  + A   C +C +GY+G+ V G    C++C  P  +        C  EG+       CP    G  C +C+        N    C++C C   GS    C+ ++G C C+    G KCD C
Sbjct: 1417 CVPCQCNGHSSL---CDPETSICQNCQHHTAGDFCERCALGYYGI-VKGLPNDCQQCACPLISSSNNFSPSCVAEGLDDYRCTACPRGYEGQYCERCAPGYTGSPGNPGGSCQECECDPYGSLPVPCDPVTGFCTCRPGATGRKCDGC 1560          

HSP 12 Score: 54.299 bits (129), Expect = 5.897e-6
Identity = 55/199 (27.64%), Postives = 77/199 (38.69%), Query Frame = 2
Query: 2819 GSTSENCDKLTGKCDCRTNFVNRQCDSCTSGLY-LKDKK-----------CIPCNCEIQGRISSEKFCNTTSGQCF-CLENVNGDRCEKCVEGYF----NYPN-CKKCLC----SPHALSADC---DLNNGKC-KCGSNVINRICDKCENLHY---WNNRTDCVPCNCGR-GSLNPKCDMETGNCKCAQNVARRDCSKC 3325
            G+T      L  KCDC   +    C++C  G Y L+ +            C+PC C           C+  +  C  C  +  GD CE+C  GY+      PN C++C C    S +  S  C    L++ +C  C      + C++C   +     N    C  C C   GSL   CD  TG C C      R C  C
Sbjct: 1367 GTTMTPPADLIEKCDCPLGYSGLSCEACLPGFYRLRSQPGGRTPGPTLGTCVPCQCN-----GHSSLCDPETSICQNCQHHTAGDFCERCALGYYGIVKGLPNDCQQCACPLISSSNNFSPSCVAEGLDDYRCTACPRGYEGQYCERCAPGYTGSPGNPGGSCQECECDPYGSLPVPCDPVTGFCTCRPGATGRKCDGC 1560          
BLAST of Laminin subunit alpha-2 vs. Ensembl Human
Match: LAMC1 (laminin subunit gamma 1 [Source:HGNC Symbol;Acc:HGNC:6492])

HSP 1 Score: 430.254 bits (1105), Expect = 1.877e-122
Identity = 313/1052 (29.75%), Postives = 492/1052 (46.77%), Query Frame = 2
Query:  197 NAKITSSATCGTGGPEIFCRLVDEIAIQRLINPDSHVLCDVCDNRNETKRHPIEFAK---SDDDNLWWQSPSMAQGLKY-QNVNVTIDLKQVYQIVYILLKMGDSPRPGNWILERSL--DGEIYMPWIFFAETPYSCYNLFQRQYPDLKLTTNAKPSSLADDEMFCTTYYSQPKSLNSGEIIISLINGRKSIMNEEYLSIKSVPQTLINFLSARYIRFRFLKHLTLAADLMTHKGYLEQSIYNRYYYSLRNIEIGGKCICNNHADKCDKVIENGISVAKCNCKHNTCGSNCETCCPLFNQRPWKPVAV-----CEECNCNRKSNECSYNQTVATLQLSVNKMGRMEG-GGVCINCQENTEGINCEKCIKGFYRPWNVLATELYPCTPCQCHGLGTIGS-CVSNGEDIGDQKPGDCICKKGYEGVNCDLCSIGYERYPNGECLPCPCSIDGSVRTSFYRCKPPCNCKVHVNSDDLCKTCKNGYFNLDSANPEGCEPCYCFGITNQCSSLSAKNL-KIS-----DLKGWKLTTFTGEKIALPKFTSFQYLTS-ENSYIDERFNNPTVYYWTAPPPYLGNWITSYGTIFRYVVKIELQSTLKGSLIDSPDVIIKCGDFR-----LFHSVSIEDRRLQRQVFIYIKPTE--WKIGKLTPDKAATKEEFISCLVKVDKLLIKAKYYSNQKSIELLNITLSRGEVHLALDEMPHIEKCNCPPGFNGLSCESCESGYRR-VNNVLYQGQCEACACYNHSNTCDSLNGECQNCTHNTAGAHCEDCASGYYGDAKSKNLNSCKKCPCPRLDYQMTELCSSYSSENYVCHKCLHNTSGVHCDRCIEGYYGNPKKKIS----CKRCKCNNNQE-----SCDPVTGEC-RCSYNTMGTECQLCKHGFYGDALTKS----CKKCDCDSLGSTSE--NCDKLTGKCDCRTNFVNRQCDSCTSGLY--LKDKKCIPCNCEIQGRISSEKFCNTTSGQCFCLENVNGDRCEKCVEGYFNY--PNCKKCLCSPH-ALSADCDLNNGKCKCGSNVINRICDKCENLHYWN 3205
            N  + ++ TCGT  PE +C       + +         C +CD      +H   F     +  D  WWQS +M  G++Y  ++N+T+ L + + I Y+ LK   S RP ++ + +    DG    PWI +     SC N + +       T   +  +L      CT  +S    L  G +  S + GR S  N +   +      L  +++A  IR    +  T   ++     + +  +   YYY++ +  +GG+C CN HA +C   ++N      CNCKHNT G +CE C P FN RPW+         C  C+CN +S EC ++           ++ R  G GG C NCQ+NT+G +CE+C + F+R  N  A     C+ C C  +G++ + C S G          C CK G  G  CD C  G+       C PC C   GS+          C CK +V   + C+ CK G+FNL+S+NP GC PC+CFG ++ C++    ++  IS     D  GW+     G + +L   +  Q +    +SY           Y+ AP  +LG  + SYG    +  +++ + T     + + D++++    R     +    S       + VF   + T+  W+        A T  EF   L  +  + I+   YS + +  L ++TL+       +     +E C CP G+ G  CE C SGYRR   N+     C  CAC  HS TCD   G C NC  NTAG HCE C+ GYYGD+ +   + C+ CPCP      +       ++  VC  C   T+G  C+ C +GY+G+P  +      C+ C+C++N +     +C+ +TGEC +C YNT G  C  CK GF+G+ L  +    CK C+C+  G+  +  +C+ +TG+C+C  +   + C +C  G Y     + C  C+C   G  + +  C+  +GQC C   + G  CE+C   +F +    CK C C P  +LS  C  ++G+C+C    +   CD+CE  +++N
Sbjct:   60 NVTVVATNTCGTP-PEEYCVQTGVTGVTKS--------CHLCDAGQPHLQHGAAFLTDYNNQADTTWWQSQTMLAGVQYPSSINLTLHLGKAFDITYVRLKFHTS-RPESFAIYKRTREDG----PWIPYQYYSGSCENTYSKANRGFIRTGGDEQQAL------CTDEFSDISPLTGGNVAFSTLEGRPSAYNFDNSPV------LQEWVTATDIRVTLNRLNTFGDEV-----FNDPKVLKSYYYAISDFAVGGRCKCNGHASEC---MKNEFDKLVCNCKHNTYGVDCEKCLPFFNDRPWRRATAESASECLPCDCNGRSQECYFDP----------ELYRSTGHGGHCTNCQDNTDGAHCERCRENFFRLGNNEA-----CSSCHCSPVGSLSTQCDSYGR---------CSCKPGVMGDKCDRCQPGFHSLTEAGCRPCSCDPSGSIDECNIETGR-CVCKDNVEGFN-CERCKPGFFNLESSNPRGCTPCFCFGHSSVCTNAVGYSVYSISSTFQIDEDGWRAEQRDGSEASLEWSSERQDIAVISDSYFPR--------YFIAPAKFLGKQVLSYGQNLSFSFRVDRRDT----RLSAEDLVLEGAGLRVSVPLIAQGNSYPSETTVKYVFRLHEATDYPWR-------PALTPFEFQKLLNNLTSIKIRGT-YSERSAGYLDDVTLASARPGPGVPAT-WVESCTCPVGYGGQFCEMCLSGYRRETPNLGPYSPCVLCACNGHSETCDPETGVC-NCRDNTAGPHCEKCSDGYYGDSTAGTSSDCQPCPCP----GGSSCAVVPKTKEVVCTNCPTGTTGKRCELCDDGYFGDPLGRNGPVRLCRLCQCSDNIDPNAVGNCNRLTGECLKCIYNTAGFYCDRCKDGFFGNPLAPNPADKCKACNCNLYGTMKQQSSCNPVTGQCECLPHVTGQDCGACDPGFYNLQSGQGCERCDCHALGSTNGQ--CDIRTGQCECQPGITGQHCERCEVNHFGFGPEGCKPCDCHPEGSLSLQCK-DDGRCECREGFVGNRCDQCEENYFYN 1022          

HSP 2 Score: 160.229 bits (404), Expect = 3.827e-38
Identity = 170/626 (27.16%), Postives = 256/626 (40.89%), Query Frame = 2
Query: 3281 CKCAQNVARRDCSKC-----DVGYFGLDVTGCKKCPPCY-NG--QVC----------NNEGICV-CPPNTIGNLCNKCSEDSWDFNETIGCKKCNCYINGSYSNICNKISGICACKTAFFGSKCDRCNEGYYGF--PNCQPCSCAENGTKSNELTKCDKITGQCQCKQNVIGTKCKVCRKGTFPSDGTYEGGCFSCFCFGVSEKCHAILNHRIVENSIYEYHIFDEKNSLESGKDYSTIHLNANYPRR-FGWPLTMFRPIYVNVMKLFNSHDLSLFYRSIFMNVSVDCLDNKCGREIPEQTEVFMESYNGLFGMRYXXXXXXXXXXXXXXDFNEHSKNGKWVISQ---YQNDILDKFII-LEDSN--VINSNLTRDIFMMALLNVTSLKVK-LYTDKVNPPLIKIKIITYKVMETTQAIGKRVTAVEKCICNALTFGNHCQNPISGYYKEYFNLPNSTKSGSMRTGNRILINLKKCNCNGYSKVCDSVTGDCQNCMGNREGNKCQLCREGFYKNDK--NYDQCEPCQCPSAHYNFAQNCTRIESSLELKC-QCRIGYSGKSCENCQQGFYGNPI-KGIP---CKSCDC--NQQGSQSLNCNEF-GIC-QCSPGVLGIKCDQCAPNY 5038
            C C  N    DC KC     D  +         +C PC  NG  Q C           + G C  C  NT G  C +C E+ +       C  C+C   GS S  C+   G C+CK    G KCDRC  G++      C+PCSC  +G+    + +C+  TG+C CK NV G  C+ C+ G F  + +   GC  CFCFG S  C   + + +   SI      DE       +D S   L  +  R+        + P Y      F    +  + +++  +  VD  D +   E     ++ +E      G+R  V                       +I+Q   Y ++   K++  L ++        LT   F   L N+TS+K++  Y+++    L  + + + +        G   T VE C C     G  C+  +SGY +E  NL   +          +L     C CNG+S+ CD  TG C NC  N  G  C+ C +G+Y +        C+PC CP        +C  +  + E+ C  C  G +GK CE C  G++G+P+ +  P   C+ C C  N   +   NCN   G C +C     G  CD+C   +
Sbjct:  305 CNCKHNTYGVDCEKCLPFFNDRPWRRATAESASECLPCDCNGRSQECYFDPELYRSTGHGGHCTNCQDNTDGAHCERCRENFFRLGNNEACSSCHCSPVGSLSTQCDSY-GRCSCKPGVMGDKCDRCQPGFHSLTEAGCRPCSCDPSGS----IDECNIETGRCVCKDNVEGFNCERCKPGFFNLESSNPRGCTPCFCFGHSSVCTNAVGYSVY--SISSTFQIDEDGWRAEQRDGSEASLEWSSERQDIAVISDSYFPRYFIAPAKFLGKQVLSYGQNLSFSFRVDRRDTRLSAE-----DLVLEGA----GLRVSVP----------------------LIAQGNSYPSETTVKYVFRLHEATDYPWRPALTPFEFQKLLNNLTSIKIRGTYSERSAGYLDDVTLASAR-----PGPGVPATWVESCTCPVGYGGQFCEMCLSGYRRETPNLGPYSPC--------VL-----CACNGHSETCDPETGVC-NCRDNTAGPHCEKCSDGYYGDSTAGTSSDCQPCPCPG-----GSSCAVVPKTKEVVCTNCPTGTTGKRCELCDDGYFGDPLGRNGPVRLCRLCQCSDNIDPNAVGNCNRLTGECLKCIYNTAGFYCDRCKDGF 868          

HSP 3 Score: 135.961 bits (341), Expect = 1.025e-30
Identity = 115/351 (32.76%), Postives = 154/351 (43.87%), Query Frame = 2
Query: 2711 CRCSYNTMGTECQLCKHGFYGDALT----KSCKKCDCDSLGSTSENCDKLTGKCDCRTNFVNRQCDSCTSGLYLKD-----KKCIPCNCEIQGRISSEKFCNTTSGQCF-CLENVNGDRCEKCVEGYFNYPN--------CKKCLCS----PHALSADCDLNNGKC-KCGSNVINRICDKCENLHYWN----NRTD-CVPCNC---GRGSLNPKCDMETGNCKCAQNVARRDCSKCDVGYFGLDV-TGCKKCPPCY-----NGQVCNNEGICVCPPNTIGNLCNKCSEDSWDFNETIGCKKCNCYINGSYSNICNKISGICACKTAFFGSKCDRCNEGYY---GFPNCQPC 3643
            C C     G  C++C  G+  +         C  C C+     SE CD  TG C+CR N     C+ C+ G Y          C PC C   G  S      T    C  C     G RCE C +GYF  P         C+ C CS    P+A+  +C+   G+C KC  N     CD+C++  + N    N  D C  CNC   G       C+  TG C+C  +V  +DC  CD G++ L    GC++C  C+     NGQ     G C C P   G  C +C  + + F    GCK C+C+  GS S  C K  G C C+  F G++CD+C E Y+    +P CQ C
Sbjct:  690 CTCPVGYGGQFCEMCLSGYRRETPNLGPYSPCVLCACNG---HSETCDPETGVCNCRDNTAGPHCEKCSDGYYGDSTAGTSSDCQPCPC--PGGSSCAVVPKTKEVVCTNCPTGTTGKRCELCDDGYFGDPLGRNGPVRLCRLCQCSDNIDPNAV-GNCNRLTGECLKCIYNTAGFYCDRCKDGFFGNPLAPNPADKCKACNCNLYGTMKQQSSCNPVTGQCECLPHVTGQDCGACDPGFYNLQSGQGCERCD-CHALGSTNGQCDIRTGQCECQPGITGQHCERCEVNHFGFGPE-GCKPCDCHPEGSLSLQC-KDDGRCECREGFVGNRCDQCEENYFYNRSWPGCQEC 1031          

HSP 4 Score: 132.109 bits (331), Expect = 1.456e-29
Identity = 98/341 (28.74%), Postives = 142/341 (41.64%), Query Frame = 2
Query: 2594 GVHCDRCIEGYY---GNPKKKISCKRCKCNNNQESCDPVTGECRCSYNTMGTECQLCKHGFYGDA---LTKSCKKCDCDS-------------------LGSTSENCD--------------------------------------KLTGKC-DCRTNFVNRQCDSCTSGLYLKD------KKCIPCNCEIQGRISSEKFCNTTSGQCFCLENVNGDRCEKCVEGYFNYPN---CKKCLCSPHALSA---DCDLNNGKCKCGSNVINRICDKCENLHYWNNRTDCVPCNC-GRGSLNPKCDMETGNCKCAQNVARRDCSKCDVGYF-GLDVTGCKKCPPCY 3382
            G  C+ C+ GY     N      C  C CN + E+CDP TG C C  NT G  C+ C  G+YGD+    +  C+ C C                      G+T + C+                                      +LTG+C  C  N     CD C  G +          KC  CNC + G +  +  CN  +GQC CL +V G  C  C  G++N  +   C++C C  HAL +    CD+  G+C+C   +  + C++CE  H+      C PC+C   GSL+ +C  + G C+C +      C +C+  YF      GC++CP CY
Sbjct:  698 GQFCEMCLSGYRRETPNLGPYSPCVLCACNGHSETCDPETGVCNCRDNTAGPHCEKCSDGYYGDSTAGTSSDCQPCPCPGGSSCAVVPKTKEVVCTNCPTGTTGKRCELCDDGYFGDPLGRNGPVRLCRLCQCSDNIDPNAVGNCNRLTGECLKCIYNTAGFYCDRCKDGFFGNPLAPNPADKCKACNCNLYGTMKQQSSCNPVTGQCECLPHVTGQDCGACDPGFYNLQSGQGCERCDC--HALGSTNGQCDIRTGQCECQPGITGQHCERCEVNHFGFGPEGCKPCDCHPEGSLSLQC-KDDGRCECREGFVGNRCDQCEENYFYNRSWPGCQECPACY 1035          

HSP 5 Score: 99.7525 bits (247), Expect = 9.246e-20
Identity = 120/480 (25.00%), Postives = 203/480 (42.29%), Query Frame = 2
Query: 4613 KKCNCNGYSKV-----CDSVTGDCQNCMGNREGNKCQLCREGFYKNDKNYDQCEPCQCPSAHYNFAQNCTRIESSLELKCQCRIGYSGKSCENCQQGFYGNPIKGIPCKSCDCNQQGSQSLNCNEFGICQCSPGVLGIKCDQCAPNYVVEK-----KTCQSCYSGCTKDLLVRIDTLNETVINFKWKTLPSTL-DLRLNKINISIQMSSELLNSINKFYKLKNEIKNFSIQFQKMKDDAKEKYGEIEKLKTRYNKVLEDLRSTFTDINETISGHEQLGISNE----LIKNATAYLETIK----NIYKEMPNIT--------LAASVLKDVLKYVDELNQIIKYTQ-SHIQSDQINN--LKILKNKTIMADEINTNNKEY--LNTMSTKKKEHELYIILINERMKDLQKIFRKMTKQRDNLRKKIQKLDA--ISKSFQDEKDLISINVREIEDLMKNLSSNHLVSKSLIIPDTLKKHVEQQ 5950
            K CNCN Y  +     C+ VTG C+ C+ +  G  C  C  GFY N ++   CE C C +      Q   R       +C+C+ G +G+ CE C+   +G   +G  CK CDC+ +GS SL C + G C+C  G +G +CDQC  NY   +     + C +CY       LV+    +  V   K + L S + +L      ++ Q   + L    +      E+ +   + Q +KD  +     ++++    +  +  L++    I ET +  EQ     E    LI+ A+  LE  K    N+    P  T        LA    K   ++  E + I++  + ++  S +  N  L+ L  +   A EI   N++Y     +S   ++    +    +R  D          Q   L  +  + +A  I    ++ + LI   +++ EDL +++    L  K+L+     K   EQQ
Sbjct:  882 KACNCNLYGTMKQQSSCNPVTGQCE-CLPHVTGQDCGACDPGFY-NLQSGQGCERCDCHALGSTNGQCDIRTG-----QCECQPGITGQHCERCEVNHFGFGPEG--CKPCDCHPEGSLSLQCKDDGRCECREGFVGNRCDQCEENYFYNRSWPGCQECPACYR------LVKDKVADHRV---KLQELESLIANLGTGDEMVTDQAFEDRLKEAER------EVMDLLREAQDVKDVDQNLMDRLQRVNNTLSSQISRLQNIRNTIEETGNLAEQARAHVENTERLIEIASRELEKAKVAAANVSVTQPESTGDPNNMTLLAEEARKLAERHKQEADDIVRVAKTANDTSTEAYNLLLRTLAGENQTAFEIEELNRKYEQAKNISQDLEKQAARVHEEAKRAGDKAVEIYASVAQLSPLDSETLENEANNIKMEAENLEQLIDQKLKDYEDLREDMRGKELEVKNLL----EKGKTEQQ 1333          

HSP 6 Score: 97.4413 bits (241), Expect = 4.651e-19
Identity = 93/306 (30.39%), Postives = 125/306 (40.85%), Query Frame = 2
Query: 3005 CFCLENVNGDRCEKCVEGYFN-------YPNCKKCLCSPHALSADCDLNNGKCKCGSNVINRICDKCENLHYWNN----RTDCVPCNCGRGS---LNPKCDMETGNCKCAQNVARRDCSKCDVGYFGLDVTG-------CKKCP------PCYNGQVCNNEGICV-CPPNTIGNLCNKCSE----DSWDFNETIGCKKCNCYINGSY--SNICNKISGICACKTAFFGSKCDRCNEGYYGFPN---CQPCSCAENGTKSNELTKCDKITGQCQCKQNVIGTKCKVCRKGTFPSDGTYEGGCFSCFC 3811
            C C     G  CE C+ GY         Y  C  C C+ H  S  CD   G C C  N     C+KC + +Y ++     +DC PC C  GS   + PK   E     C      + C  CD GYFG D  G       C+ C       P   G      G C+ C  NT G  C++C +    +    N    CK CNC + G+    + CN ++G C C     G  C  C+ G+Y   +   C+ C C   G+ + +   CD  TGQC+C+  + G  C+ C    F   G    GC  C C
Sbjct:  690 CTCPVGYGGQFCEMCLSGYRRETPNLGPYSPCVLCACNGH--SETCDPETGVCNCRDNTAGPHCEKCSDGYYGDSTAGTSSDCQPCPCPGGSSCAVVPKT-KEVVCTNCPTGTTGKRCELCDDGYFG-DPLGRNGPVRLCRLCQCSDNIDPNAVGNCNRLTGECLKCIYNTAGFYCDRCKDGFFGNPLAPNPADKCKACNCNLYGTMKQQSSCNPVTGQCECLPHVTGQDCGACDPGFYNLQSGQGCERCDCHALGSTNGQ---CDIRTGQCECQPGITGQHCERCEVNHF---GFGPEGCKPCDC 985          

HSP 7 Score: 90.1225 bits (222), Expect = 8.287e-17
Identity = 65/211 (30.81%), Postives = 100/211 (47.39%), Query Frame = 2
Query: 2840 DKLTGKCDCRTNFVNRQCDSCTSGLYLKDK-----------KCIPCNCEIQGR---ISSEKFCNTT-SGQCF-CLENVNGDRCEKCVEGYFNYPN---CKKCLCSP-HALSADCDLNNGKCKCGSNVINRICDKCENLHYWNNRTDCVPCNCGRGSLNPKCDMETGNCKCAQNVARRDCSKCDVGYFGLDVTGCKKCPPCY---NGQVCNN 3403
            DKL   C+C+ N     C+ C    +  D+           +C+PC+C  + +      E + +T   G C  C +N +G  CE+C E +F   N   C  C CSP  +LS  CD + G+C C   V+   CD+C+   +      C PC+C       +C++ETG C C  NV   +C +C  G+F L+ +  + C PC+   +  VC N
Sbjct:  301 DKLV--CNCKHNTYGVDCEKCLP--FFNDRPWRRATAESASECLPCDCNGRSQECYFDPELYRSTGHGGHCTNCQDNTDGAHCERCRENFFRLGNNEACSSCHCSPVGSLSTQCD-SYGRCSCKPGVMGDKCDRCQPGFHSLTEAGCRPCSCDPSGSIDECNIETGRCVCKDNVEGFNCERCKPGFFNLESSNPRGCTPCFCFGHSSVCTN 506          

HSP 8 Score: 63.1586 bits (152), Expect = 1.257e-8
Identity = 59/199 (29.65%), Postives = 84/199 (42.21%), Query Frame = 2
Query: 4517 NPISGYYKEYFNLPNSTKSGSMRTGNRILINLKKCNCNGYSKVCDSVTGD--CQNCMGNREGNKCQLCREGFYKNDKNY--------DQCEPCQC--PSAHYNFAQNCTRIESSLELKCQCRIGYSGKSCENCQQGFY--GNPIKGIPCKSCDCNQQGSQSLNCNEFGICQCSPGVLGIKCDQCAPNY-VVEKKTCQSC 5068
            N ++ +  E FN P   KS      +  +    +C CNG++  C     D    NC  N  G  C+ C   F  ND+ +         +C PC C   S    F     R          C+    G  CE C++ F+  GN      C SC C+  GS S  C+ +G C C PGV+G KCD+C P +  + +  C+ C
Sbjct:  254 NRLNTFGDEVFNDPKVLKSYYYAISDFAVGG--RCKCNGHASECMKNEFDKLVCNCKHNTYGVDCEKCLPFF--NDRPWRRATAESASECLPCDCNGRSQECYFDPELYRSTGHGGHCTNCQDNTDGAHCERCRENFFRLGN---NEACSSCHCSPVGSLSTQCDSYGRCSCKPGVMGDKCDRCQPGFHSLTEAGCRPC 445          
BLAST of Laminin subunit alpha-2 vs. Ensembl Celegans
Match: lam-3 (LAMinin related. See also lmb; Laminin alpha chain [Source:UniProtKB/TrEMBL;Acc:G5ECE3])

HSP 1 Score: 947.192 bits (2447), Expect = 0.000e+0
Identity = 676/2152 (31.41%), Postives = 1024/2152 (47.58%), Query Frame = 2
Query:  188 LMENAKITSSATCGTGGPEIFCRLVDEIAIQRLINPDSHVLCDVCDNRNETKRHPIEFAKSDDDNLWWQSPSMAQGLKYQNVNVTIDLKQVYQIVYILLKMGDSPRPGNWILERSLDGEIYMPWIFFAETPYSCYNLFQRQYPDLKLTTNAKPSSLADDEMFCTTYYSQPKSLNSGEIIISLINGRKSIMNEEYLSIKSVPQTLINFLSARYIRFRFLKHLTLAADLMT---HKGYLEQSIYNRYYYSLRNIEIGGKCICNNHADKCDKVIENGISVAKCNCKHNTCGSNCETCCPLFNQRPWKPVA-----VCEECNCNRKSNECSYNQTVATLQLSVNKMGRMEGGGVCINCQENTEGINCEKCIKGFYRPWNVLATELYPCTPCQCHGLGTIG-SCVSNGEDIGD-QKPGDCICKKGYEGVNCDLCSIGYERYPNGECLPCPCSIDGSVRTSFYRCK-PPCNCKVHVNSDDLCKTCKNGYFNLDSANPEGCEPCYCFGITNQCSSLSAKNLKISDLKGWKLTTFTGEKIALPKFTSFQYLTSENSYIDERFNNPTVYYWTAPPPYLGNWITSYGTIFRYVVKIELQSTLKGSLIDSPDVIIKCGDFRLFHSVSIEDRRLQRQVFIYIKPTEWKIGKLTPDKAAT--KEEFISCLVKVDKLLIKAKYYSNQKSIELLNITLSRG-----------------EVHLALDEMPHIEKCNCPPGFNGLSCESCESGYRRVNNVLYQGQCEACACYNHSNTCDSLNGECQNCTHNTAGAHCEDCASGYYGD-AKSKNLNSCKKCPCPRLDY---------QMTELCSSYSSE-NYVCHKCLHNTSGVHCDRCIEGYYGNPKKKISCKRCKCNNNQE-----SCDPVTGEC-RCSYNTMGTECQLCKHGFYGDALTKSCKKCDCDSLGSTSENCDKLTGKCDCRTNFVNRQCDSCTSGLYLKDKKCIPCNCEIQGRISSEKFCNTTSGQCFCLENVNGDRCEKCVEGYFNYPN--CKKCLCSPHALSAD--CDLNNGKCKCGSNVINRICDKCENLHYWNNRTD-CVPCNCG-RGSLNPKCDMETGNCKCAQNVARRDCSKCDVGYFGLDVTGCKKCPPC-YNGQVCNN-EGICVCPPNTIGNLCNKCSEDSWDFNETIGCKKCNCYINGSYSNICNKISGICACKTAFFGSKCDRCNEGYYGFPNCQPCSCAENGTKSNELTK----CDKITGQCQCKQNVIGTKCKVCRKGTFPSDGTYEGGCFSCFCFGVSEKCHAILNHRIVENSIY---EYHIFDEKNSLESGKDYSTIHLNANYPRRFGWPLTMFRPIYVNVMKLFNSHDLSLFYRSIFMNVSVDCLDNKCGREIPEQTEVFMESYNGLFGMRYXXXXXXXXXXXXXXDFNEHSKNGKWVISQYQNDILDKFIILEDSNVINSN----LTRDIFMMALLNVTSLKVK-LYTDKVNPPLIKIKIITYKV----------METTQAIGKRVTAVEKCI-CNALTFGNHCQNPISGYY----KEYFNLPNSTKSGSMRTGNRILINLKK-CNCNGYSKVCDSVTGDCQNCMGNREGNKCQLCREGFYKNDK--NYDQCEPCQCPSAHYNFAQNCTRIESSLELKC-QCRIGYSGKSCENCQQGFYGNPIK-GIPCKSCDCNQQGSQSLNCNEF-GICQCSPGVLGIKCDQCAPNYVVEKKTCQSCYSGCTKDLLVRIDTLNETVINFKWKTLPSTLDLRLNKINISIQMSSELLNSINKFYKLKNEIKNFSIQFQKMKDDAKEKYGEIEKLKTRYNKVLEDLRSTFTDINETISGHEQLGISNELIKNATAYLETIKNIYKEMPNITLAASVLKDVLKYVD-ELNQII-----------KYTQSHIQSDQINNL-----------KILKNKTIMADEINTNNKEYLNTMSTKK-KEHELYIILINERMKDLQKIFRKMTKQRDNLRKKIQ-KLDAISKSFQDE-------KDLISINVREIEDLMKNLSSNHLVSKSLI------IPDTLKKHVEQQLNKSSNLIKKLTKDFNFLHNAEQAKEAYSNITRDIL----AVDYAINQTK---KELDFNRS---NMNIDSLKKLLAEF----------NSNKSEIVENIKNIDKE 6205
            L  N+ IT++ TCG    E +C+LV+ + +++  N  S   CD+CD  N  KRHPIE+A  D    WWQSPS+A GL+++ VN+TIDL+Q YQ+ YI+LKMG+SPRPG W+LE+SLDGE Y PW ++A     C   F      +  TT   P    +DE+ CT+ YS+   L +GEI  SL+NGR    N            L  F  AR++R R +   TL ADLM        L++S+  RY+YS+ +I IGG+CIC  HA+ C      G    KC C+HNTCG +C  CCPLFNQ PWKP       VC++C C   ++ C Y+  +   + S+   G  EGGG C+ C  NTEG NCE+C  G+YRP  +       C  C+C  +G++  +CV + +   + QKPGDCICK G+ G  C+ C+ GY  +P   C PCPC+  GSV  +F  C    C CK +V     C  CK G  +L ++NP GC+PC+CFG ++ C+       +I +  GW LT  TG K   P+  + + L    +   +R    ++YYW AP  + GN + SYG    Y   +    T +G+ +   DV I+    ++ +   IE   L R+      P     G    +  +   K + +  L  VD+  ++A Y+  Q    +  ++L                      H     M  +E C CP  F G SCESC  GYRRVNN LY G+CE C C+ +S  CD   GEC NC HNT G+ CE C  G+ G+ ++   L +C++C CP LD          ++  L S  S+E NYVC  C     G  C+ C +G++ +P     C  C CN N +     +CD  TG+C +C  +T G  C+ CK   +G+A   +CK C C + G+ +  C +  G+C+C+ N++  QCD C       +  C  C+C   G I S+  C+  SGQC C + V G +C++C   YFN+ +  C+ C C+ +    D  CD   GKC+C  NV   +C+KC + ++     D C  C C   GS +  C++ TG C C   V    C  C   ++GL   GC +C PC   GQVC+  +G CVCPPNT+G +C  C+ ++WD++   GCK C+C   GS   +CN  +G C CK A+ G KCD C  G++ FP C+PC C   GT   +       C++I G+C CK+NV GTKC  C +GTF  D +   GC  CFCF  +  C       +V   +Y      +F E     + K    I+L    P  F    T   P+Y  +       D +  Y   F+   +   DN+                 GL G+R    +       II  F  +    + +  +  +D + K  + E    +  +    LTR   M+AL +   + ++  YT       I I+ ++  V          + TT+AIG     VEKC+ C     G  CQNP  GYY    +EY N          +  +  LI   + C+C+G+S+ C+  T  C +C  N  G+ C+ C  G+  + +    + C  C CP    +F+ +C  ++      C  C+ GY+G+ CE C  G+YG+P   G  C  CDC+  GS    CN   G C+C PGV G  C  C   +    + C SC  GC   L+  +DT+ E +    +  L      R+ +I    Q  S  +  I+K  ++        ++  K   DA     E+     R NK    ++  FT I E +    Q+  +N    N T +L+    ++ E    T+  + L  +L   +  LN  +           +  Q H +++++  +           + LKN+  + ++   + +E +  +S K   + E   +++ +R+   +++  ++ K R     +I    ++I K+  +E       K+ I++ + E+ DL++   +  L+   LI         T  +H E+   ++  ++ +         N  +A  AY NI   +     AVD A   ++   K L    S   + N +SL+  L +           NSN  +IVE +K   K+
Sbjct:   55 LATNSLITATDTCGQYTAEEYCKLVEHVLLRKTTNTQS-PQCDICDANNVHKRHPIEYA-IDGTRRWWQSPSLANGLRFEKVNITIDLRQEYQVAYIILKMGNSPRPGTWVLEKSLDGEYYEPWQYYAMQDAECMRQF-----GIPATTGV-PRFQKEDEVHCTSEYSKITPLENGEIHTSLVNGRPGAENTSL--------ELQKFTRARFVRLRLISPRTLNADLMIINKKSDSLDKSVTMRYFYSISDISIGGQCICYGHAESCPSDPVTG--QFKCECRHNTCGESCNRCCPLFNQLPWKPGTNSHPNVCQQCQCFNHAHSCVYDDELDRNKWSITPEGVYEGGGRCLECAHNTEGFNCERCKDGYYRPSGLSHYREDACRTCECDPVGSVSDACVRDDQSAENGQKPGDCICKPGFGGRRCERCAPGYRNHPT--CEPCPCNRAGSV--NFDTCDGASCQCKANVEGI-YCDRCKAGTIHLSASNPLGCQPCFCFGHSSTCTQGKWNKAQIINNIGWHLTDLTGGKDVKPEVENGEVLMFNANQNQDR----SLYYWKAPDSFKGNMLNSYGGYLHY--DVYYVPTEQGATVFVADVAIEGNGIKIEYHSRIE--FLPREKMTVAIPMSELSGWYNAEARSPVDKADMMRALANVDRFTVRATYHQPQLQSSIFGLSLDTAVPAPDEIVEEDTSLKALAYHTQDTLMGGVEVCECPENFAGNSCESCVPGYRRVNNQLYGGRCEKCDCHGNSEECDPFTGECLNCRHNTTGSRCELCKPGHVGNPSRGGELGACEQCECPSLDLNPNPECISTELAVLGSVASNEDNYVCINCPLGYEGNKCEYCSDGFFEDPLTG-KCIECTCNGNIDPMGIGNCDSETGKCLKCIGHTTGDSCESCKEHHWGNAQLHTCKPCGCHTQGAVNPQCSEENGECECKENYIGAQCDRCKENHGDVENGCPACDCNDTGSIGSD--CDQVSGQCNCKQGVFGKQCDQCRPSYFNFTDAGCQFCHCNIYGSIEDGKCDQTTGKCECRENVEGTMCEKCADGYFNITSGDGCEDCGCDPTGSEDVSCNLVTGQCVCKPGVTGLKCDSCLPNFYGLTSEGCTECEPCPAPGQVCDPIDGSCVCPPNTVGEMCENCTTNAWDYHPLNGCKLCDCSDIGSDGGMCNTFTGQCKCKAAYVGLKCDLCTHGFFNFPTCEPCGCNAAGTDPLQCKDGQCLCNEI-GECPCKKNVHGTKCDQCGEGTFSLDSSNLKGCTECFCFNRTSNCE---QSDLVWQQMYAEDRRAVFQEPWEFYTKK--HNINLLREKPSHFNSYPTDATPLYWPLPSTMLG-DRTASYNG-FLRFKIWNEDNR----------------RGLHGIRPDQQYFRHFPQVII--FGNNRIELEHIPMEINDDGIYKIRLHESEWRVRHSPELTLTRKQMMVALQDTQGIYIRGTYTYPARGDAINIQEVSLDVAVPESKIVAGLSTTKAIG-----VEKCLGCPQGYTGLSCQNPEVGYYRKKHREYLN----------QADDIALIGWSEPCSCHGHSQTCNPDTSVCTDCEHNTFGDFCEHCLPGYIGDAREGGANACTKCACPLVENSFSDSCVAVDHGRGYVCNSCKPGYTGQYCETCVAGYYGDPQHIGGTCSPCDCHPDGSLHGACNPLSGQCECKPGVTGRTCSMCQERHAFINRVCTSCDQGCYLPLMETMDTMEEHLGRQNFSGLKPIPWKRVWRIGNESQDLSTFVGGIDKDGEI--------VKDSKWAKDAFALLDEVNFQMGRSNKSAVSIKQ-FTGIAEQLILDAQIHYANAF--NTTNFLK----MFAEHGATTVGGAALDGMLMEAEAHLNATVERGEYVEKRLNRAQQEHKKAEELLKMVTAQKLNETIFEDLKNRIDVLEQWMNDYRETIYDVSKKDTADAERMSLVVGKRINRYKEVSNEIEKLRVEAEDQIAYSRNSIEKARSEELMNMFEDKEKINMTLAELPDLVEQCQNITLLYSQLIDEYDEEYVQTAGRHAEKLEVQAQKIVDRFVDTRTETENPLKASHAYENIVEALKNATEAVDSAAEASEAVSKMLGSEGSESGDANEESLRSQLEKLKNESSLSNVDNSNAVKIVEELKKEKKD 2116          
BLAST of Laminin subunit alpha-2 vs. Ensembl Celegans
Match: lam-2 (Laminin-like protein lam-2 [Source:UniProtKB/Swiss-Prot;Acc:Q18823])

HSP 1 Score: 433.335 bits (1113), Expect = 1.082e-123
Identity = 326/1059 (30.78%), Postives = 498/1059 (47.03%), Query Frame = 2
Query:  197 NAKITSSATCGTGGPEIFCRLVDEIAIQRLINPDSHVLCDVCDNRNETKRHPIEFAKS---DDDNLWWQSPSMAQGLKY-QNVNVTIDLKQVYQIVYILLKMGDSPRPGNW-ILERSLDGEIYMPWIFFAETPYSCYNLFQRQYPDLKLTTNAKPSSLADDEMFCTTYYSQPKSLNSGEIIISLINGRKSIMNEEYLSIKSVPQTLINFLSARYIRFRFLKHLTLAADLMTHKGYLEQSIYNRYYYSLRNIEIGGKCICNNHADKC-DKVIENGISVAKCNCKHNTCGSNCETCCPLFNQRPWKPVAVCEE-----CNCNRKSNECSYNQTVATLQLSVNKMGRMEGGGVCINCQENTEGINCEKCIKGFYRPWNVLATELYPCTPCQCHGLGTIGSCVSNGEDIGDQKPGDCICKKGYEGVNCDLCSIGYERYPNGECLPCPCSIDGSVRTSFYRCKPPCNCKVHVNSDDL-CKTCKNGYFNLDSANPEGCEPCYCFGITNQCSSLSAK-NLKISDLKGWKLTTFTGEKIALPKFTSFQYLTSENSYIDERFNNPTVYYWTAPPPYLGNWITSYGTIFRYVVKIELQSTLKGSLIDSPDVIIKCGDFRLFHSVSIEDRRLQRQVFIYIKPTEWKIGKLTPDK------AATKEEFISCLVKVDKLLIKAKYYSNQKSIELL-NITLSRGEVHLAL---DEMPHIEKCNCPPGFNGLSCESCESGYRRVNNVLYQG---QCEACACYNHSNTCDSLNGECQNCTHNTAGAHCEDCASGYYGDAKSKNLNSCKKCPCPRLDYQMTELCSSYSSENYVCHKCLHNTSGVHCDRCIEGYYGNPKKKISCKRCKCNNNQE-----SCDPVTGEC-RCSYNTMGTECQLCKHGFYGDALTK---SCKKCDCDSLGSTSEN-------CDKLTGKCDCRTNFVNRQCDSCTSGLY--LKDKKCIPCNCEIQGRISSEKFCNTTSGQCFCLENVNGDRCEKCVEGYFNYP--NCKKCLCS-PHALSADCDLNNGKCKCGSNVINRICDKCENLHYWNNRTDCVPCN 3232
            N ++  + TCGT  P  FC        QR +       C+ CD+R+E   HP ++       ++  WWQS +M +G +Y    N+T+ L + + I Y+ LK   SPRP ++ I +++     + PW F++ +  + Y L  R  P L       P + A  +  CT  +S    +  G I  S + GR S    E   +      L  +++A  IR    +  T   ++     + +  +   YYY++ +  +GG+C CN HA +C      +G +   C C+HNT G++C  C P +N RPW+     E      CNC++ SN C ++Q +        + G    GG CI+CQ NT+G++CE+CI   +R       E Y C  C C+ +G++ +   N         G C CK G  G  CD C  G+  +    C  C C   GS+           +C   +N +   C  CK GYF+L + N  GC PC+CFG ++ C++      + +S +       + G+     + T +  L    +  D   N+P   Y+ AP  +LG+  +SY     + +K+    T +    D  D+II   D R   S SI     Q   F   +   ++  ++  D          + +FI  L  +  + I+  Y  + K I  L N+ L    V  +     +   IE C C PGF G  CESCESG+RR     + G    C  C C+NHSN+C++ +G C  C HNTAG  CE CA GYYGDA       C+KCPCP         C  ++  + +C +C +  +G  CD C +GY+GNPK    C  C C+ N +     +CD +TGEC +C +NT G  C+ CK G++GDAL +   +C+ C C + G+   N       C++  G+CDC  N +  QCD C  G Y       C  CNC+  G  S    C+  +GQC C   V G RC++C + +F +    C+ C C    + +  CD+N+G+C C  NV  R CD+C    Y   +  C+PC+
Sbjct:   61 NLEVQVTNTCGTKRPTKFCVQSGHTG-QRSV-------CETCDDRHEGFSHPAKYLTDFNVGNNETWWQSDTMQEGQQYPTTTNLTLVLGKSFDITYVRLKF-ISPRPESFTIYKKTHTDSEWEPWQFYSGSCRATYGLSDRA-PIL-------PGNEATAQ--CTKEFSDISPITGGNIAFSTLEGRPSAHAFEESEV------LQKWVTASAIRISLNRMNTFGDEV-----FKDPQVLRSYYYAISDFAVGGRCKCNGHASECVGSSSVDGENRLVCRCEHNTQGADCNECLPFYNDRPWRSGTSVEANECIACNCSQLSNRCYFDQQL------FEETGH---GGHCIDCQGNTQGVHCEQCIANHWR----RPGENY-CVACGCNEIGSLSTQCDN--------EGKCQCKPGVTGRFCDQCLDGFYDFSTNGCKNCGCETSGSLNNQPRCDSSSGSCSCKLNVEGRQCDKCKPGYFDLSTENQFGCTPCFCFGHSSICNTADGYFAMNVSSVFDQDKQKWAGQNRIGLQDTQWAELDKAVAVSDTD-NSPV--YFVAPEQFLGDQRSSYNQDLVFTLKVAKHVTNQ----DVKDIIIVGAD-RQELSTSI---TAQGNPFPTTEAQTYRF-RVHADPYFGWYPRINELDFIGILSNITAIKIRGTY--SYKDIGYLSNVNLGTAGVAPSAANPKQATWIEHCECLPGFVGQFCESCESGFRR--ETKFGGPFNHCIKCDCHNHSNSCEAESGSCI-CEHNTAGDTCERCARGYYGDALQGTEEDCQKCPCPN-----DGPCILHADGDVICTECPNGYTGRRCDECSDGYFGNPKDGTECVECACSGNTDPNSIGNCDKITGECKKCIFNTHGFNCENCKPGYWGDALIEPKGNCQSCGCFAAGTRRPNNDYTLLECNQQDGQCDCLPNVIGIQCDQCAHGFYNITSGLGCQECNCDPLG--SEGNTCDVNTGQCQCKPGVTGQRCDRCADYHFGFSANGCQPCDCEYIGSENQQCDVNSGQCLCKENVEGRRCDQCAENRYGITQG-CLPCD 1042          

HSP 2 Score: 159.458 bits (402), Expect = 2.661e-38
Identity = 122/373 (32.71%), Postives = 175/373 (46.92%), Query Frame = 2
Query: 2858 CDCRTNFVNRQCDSCTSGLYLKDK------KCIPCNCEIQGRISSEKFCNTTSGQCFCLENVNGDRCEKCVEGYFN------YPNCKKCLC---SPHALSADCDLNNGKCKCGSNVINRICDKCENLHYWNNR--TDCVPCNCGRGSLNPK----CDMETGNCK-CAQNVARRDCSKCDVGYFG---LDVTG-CKKCPPCYNGQV-----------CNNE-GICVCPPNTIGNLCNKCSEDSWDFNETIGCKKCNCYINGSYSNICNKISGICACKTAFFGSKCDRCNEGYYGFP--NCQPCSCAENGTKSNELTKCDKITGQCQCKQNVIGTKCKVCRKGTFPSDGTYEGGCFSCFCFGVSEKCHAILNHRI 3856
            C+C   FV + C+SC SG   + K       CI C+C      +    C   SG C C  N  GD CE+C  GY+         +C+KC C    P  L AD D+   +C  G     R CD+C + ++ N +  T+CV C C  G+ +P     CD  TG CK C  N    +C  C  GY+G   ++  G C+ C  C+               CN + G C C PN IG  C++C+   ++    +GC++CNC   GS  N C+  +G C CK    G +CDRC + ++GF    CQPC C   G+   E  +CD  +GQC CK+NV G +C  C +  +        GC  C      + C+ ++  R+
Sbjct:  702 CECLPGFVGQFCESCESGFRRETKFGGPFNHCIKCDCH-----NHSNSCEAESGSCICEHNTAGDTCERCARGYYGDALQGTEEDCQKCPCPNDGPCILHADGDVICTECPNG--YTGRRCDECSDGYFGNPKDGTECVECACS-GNTDPNSIGNCDKITGECKKCIFNTHGFNCENCKPGYWGDALIEPKGNCQSCG-CFAAGTRRPNNDYTLLECNQQDGQCDCLPNVIGIQCDQCAHGFYNITSGLGCQECNCDPLGSEGNTCDVNTGQCQCKPGVTGQRCDRCADYHFGFSANGCQPCDCEYIGS---ENQQCDVNSGQCLCKENVEGRRCDQCAENRY----GITQGCLPC------DDCYTLIQSRV 1052          

HSP 3 Score: 147.517 bits (371), Expect = 9.548e-35
Identity = 110/347 (31.70%), Postives = 162/347 (46.69%), Query Frame = 2
Query: 2573 KCLHNTSGVHCDRCIEGY-----YGNPKKKISCKRCKCNNNQESCDPVTGECRCSYNTMGTECQLCKHGFYGDALT---KSCKKCDCDSLGSTSENCDKLTGKCDCRTNFVNRQCDSCTSGLYLKDK---KCIPCNCEIQGRISSEKFCNTTSGQC-FCLENVNGDRCEKCVEGYFNYP------NCKKCLCSPHALSA--------DCDLNNGKCKCGSNVINRICDKCENLHY-WNNRTDCVPCNCGR-GSLNPKCDMETGNCKCAQNVARRDCSKCDVGYFGLDVTGCKKCPPCYNG---QVCN-NEGICVCPPNTIGNLCNKCSEDSWDFNETIGCKKC-NCY 3514
            +CL    G  C+ C  G+     +G P     C +C C+N+  SC+  +G C C +NT G  C+ C  G+YGDAL    + C+KC C + G    + D      +C   +  R+CD C+ G +   K   +C+ C C      +S   C+  +G+C  C+ N +G  CE C  GY+         NC+ C C               +C+  +G+C C  NVI   CD+C +  Y   +   C  CNC   GS    CD+ TG C+C   V  + C +C   +FG    GC+ C   Y G   Q C+ N G C+C  N  G  C++C+E+ +    T GC  C +CY
Sbjct:  703 ECLPGFVGQFCESCESGFRRETKFGGPFNH--CIKCDCHNHSNSCEAESGSCICEHNTAGDTCERCARGYYGDALQGTEEDCQKCPCPNDGPCILHADGDVICTECPNGYTGRRCDECSDGYFGNPKDGTECVECACSGNTDPNSIGNCDKITGECKKCIFNTHGFNCENCKPGYWGDALIEPKGNCQSCGCFAAGTRRPNNDYTLLECNQQDGQCDCLPNVIGIQCDQCAHGFYNITSGLGCQECNCDPLGSEGNTCDVNTGQCQCKPGVTGQRCDRCADYHFGFSANGCQPCDCEYIGSENQQCDVNSGQCLCKENVEGRRCDQCAENRYGI--TQGCLPCDDCY 1045          

HSP 4 Score: 91.2781 bits (225), Expect = 1.300e-17
Identity = 121/575 (21.04%), Postives = 234/575 (40.70%), Query Frame = 2
Query: 4616 KCNCNGYSKV-----CDSVTGDCQNCMGNREGNKCQLCREGFYKND--KNYDQCEPCQCPSAHYNFAQN-CTRIE-SSLELKCQCRIGYSGKSCENCQQGFYGNPIKGIPCKSCDCNQQGSQSLNCN-EFGICQCSPGVLGIKCDQCAP-NYVVEKKTCQSC---YSG--------------CTKDLL-VRIDTLNETVINFKWKTLP--STLDLRLNKINISIQMSSELLNSINKFYKLKNEIKNFSIQFQKMKDDAKEKYGEIEKLKTRYNKVLEDLRSTFTDI-NETISGHEQLGISNELIKNATAYLETIKNIYKEMPNITL-AASVLKDVLKYVD---ELNQIIKYTQSHIQSDQINNLKILKNKTI--------MADEINTNNKEYLNTMSTKKKEHELYIILINERMKDLQKIFRKMTKQRDNLRKKIQKLDAISKSFQDEKDLISINVREIEDLMKNLSSNHLVSKSLIIPDTLKKHVEQQLNKSSNLIKKLTKDFNFLHNAEQAKEAYSNITRDIL--AVDYAINQTKKELDFNRSNMNIDSLKKLLAEFNSNKSEIVENIKNIDK 6202
            +C C+G +       CD +TG+C+ C+ N  G  C+ C+ G++ +   +    C+ C C +A      N  T +E +  + +C C     G  C+ C  GFY N   G+ C+ C+C+  GS+   C+   G CQC PGV G +CD+CA  ++      CQ C   Y G              C +++   R D   E         LP      L  +++N+  +    L N++ +  +    + +     +K+K+ ++      E +K +  +    +++    I +E ++  E+L   +E +  A    +  +N  K    I   A   +++VL Y++   E    I Y  S    +Q   +  L + T          A EI   +++ +   +   KE    I    +  K + ++  K  +  +++ + +   +   KS  +  +L ++++  +E           V    + P  L+  V   L +S NL+    K+               N   D L   V+ ++   + EL  ++    +    +L+ E   ++  IV+++   DK
Sbjct:  834 ECACSGNTDPNSIGNCDKITGECKKCIFNTHGFNCENCKPGYWGDALIEPKGNCQSCGCFAAGTRRPNNDYTLLECNQQDGQCDCLPNVIGIQCDQCAHGFY-NITSGLGCQECNCDPLGSEGNTCDVNTGQCQCKPGVTGQRCDRCADYHFGFSANGCQPCDCEYIGSENQQCDVNSGQCLCKENVEGRRCDQCAENRYGITQGCLPCDDCYTLIQSRVNVFREKVKSLDNTLQEIIENPAPVNDTKFD-EKVKETSRAASEVWEAVKQKTKEGGGTIKTKSKAIKDEIVAALEKLTSIDESVAQAKVGADAAENDMKRWEIIIENARREIENVLHYLETEGEERAQIAYNASQKYGEQSKRMSELASGTREEAEKHLKQASEIEQLSEQAIANATQANKEASDAIYGGEQISKQIAELKEKQNQLNESIHRTLDLAEEQKKSADEANNLAAVSLTNVE----------AVKIPSVDPKELRNDVAGVLEESENLVDSSVKE---------------NSANDELFDEVNRSVADARNELQSSQDQQRVSD--QLMLELEKSRERIVDSVSTADK 1379          

HSP 5 Score: 80.8777 bits (198), Expect = 1.668e-14
Identity = 77/268 (28.73%), Postives = 120/268 (44.78%), Query Frame = 2
Query: 4328 FMMALLNVTSLKVK-LYTDKVNPPLIKIKIITYKVMETTQAIGKRVTAVEKCICNALTFGNHCQNPISGYYKEYFNLPNSTKSGSMRTGNRILINLKKCNCNGYSKVCDSVTGDCQNCMGNREGNKCQLCREGFYKN--DKNYDQCEPCQCPS-----AHYNFAQNCTRIESSLELKCQCRIGYSGKSCENCQQGFYGNPIKGIPCKSCDC--NQQGSQSLNCNEF-GIC-QCSPGVLGIKCDQCAPNY-----VVEKKTCQSCYSGC 5080
            F+  L N+T++K++  Y+ K    L  + + T  V  +  A  K+ T +E C C     G  C++  SG+ +E       TK G          +  KC+C+ +S  C++ +G C  C  N  G+ C+ C  G+Y +      + C+ C CP+      H +    CT          +C  GY+G+ C+ C  G++GNP  G  C  C C  N   +   NC++  G C +C     G  C+ C P Y     +  K  CQSC  GC
Sbjct:  652 FIGILSNITAIKIRGTYSYKDIGYLSNVNLGTAGVAPSA-ANPKQATWIEHCECLPGFVGQFCESCESGFRRE-------TKFGGP------FNHCIKCDCHNHSNSCEAESGSCI-CEHNTAGDTCERCARGYYGDALQGTEEDCQKCPCPNDGPCILHADGDVICT----------ECPNGYTGRRCDECSDGYFGNPKDGTECVECACSGNTDPNSIGNCDKITGECKKCIFNTHGFNCENCKPGYWGDALIEPKGNCQSC--GC 892          

HSP 6 Score: 80.1073 bits (196), Expect = 3.242e-14
Identity = 66/212 (31.13%), Postives = 95/212 (44.81%), Query Frame = 2
Query: 3245 SLNPKCDMETGNCKCAQNVARRDCSKCDVGY-----FGLDVTGCKKCPPCYNGQVCNNE-GICVCPPNTIGNLCNKCSE----DSWDFNETIGCKKCNCYINGSYSNICNKISGICACKTAFFGSKCDRCNEGYYGFP----NCQPCSCAENGTKSNELTKCDKITGQC-QCKQNVIGTKCKVCRKGTFPSDGTYE--GGCFSCFCFGVSEK 3829
            + NPK      +C+C      + C  C+ G+     FG     C KC    +   C  E G C+C  NT G+ C +C+     D+    E   C+KC C  +G      +       C   + G +CD C++GY+G P     C  C+C+ N T  N +  CDKITG+C +C  N  G  C+ C+ G +  D   E  G C SC CF    +
Sbjct:  690 AANPKQATWIEHCECLPGFVGQFCESCESGFRRETKFGGPFNHCIKCDCHNHSNSCEAESGSCICEHNTAGDTCERCARGYYGDALQGTEE-DCQKCPCPNDGPCILHADGDVICTECPNGYTGRRCDECSDGYFGNPKDGTECVECACSGN-TDPNSIGNCDKITGECKKCIFNTHGFNCENCKPG-YWGDALIEPKGNCQSCGCFAAGTR 898          

HSP 7 Score: 77.7962 bits (190), Expect = 1.401e-13
Identity = 85/269 (31.60%), Postives = 111/269 (41.26%), Query Frame = 2
Query: 2660 RCKCNNNQESC---DPVTGE----CRCSYNTMGTECQLCKHGFYGDALTKSCKKCDCDSLGSTSENCDKLTGKCDCRTNFVNRQCDSCTSGLYLKDKKCIPCNC-EIQGR--ISSEKFCNTT-SGQCF-CLENVNGDRCEKCVEGYFNYPN---CKKCLCSP-HALSADCDLNNGKCKCGSNVINRICDKCENLHYWNNRTDCVPCNC-GRGSLN--PKCDMETGNCKCAQNVARRDCSKCDVGYFGLDVTGCKKCPPCY---NGQVCN 3400
            RCKCN +   C     V GE    CRC +NT G +C  C   FY D   +S                                       G  ++  +CI CNC ++  R     + F  T   G C  C  N  G  CE+C+  ++  P    C  C C+   +LS  CD N GKC+C   V  R CD+C +  Y  +   C  C C   GSLN  P+CD  +G+C C  NV  R C KC  GYF L       C PC+   +  +CN
Sbjct:  286 RCKCNGHASECVGSSSVDGENRLVCRCEHNTQGADCNECLP-FYNDRPWRS---------------------------------------GTSVEANECIACNCSQLSNRCYFDQQLFEETGHGGHCIDCQGNTQGVHCEQCIANHWRRPGENYCVACGCNEIGSLSTQCD-NEGKCQCKPGVTGRFCDQCLDGFYDFSTNGCKNCGCETSGSLNNQPRCDSSSGSCSCKLNVEGRQCDKCKPGYFDLSTENQFGCTPCFCFGHSSICN 513          

HSP 8 Score: 72.4034 bits (176), Expect = 6.701e-12
Identity = 62/213 (29.11%), Postives = 90/213 (42.25%), Query Frame = 2
Query: 4478 CICNALTFGNHCQNPISGYYKEYFNLPNSTKSGSMRTGNRILINLKKCNCNGYSKVCDSVTGD--CQNCMGNREGNKCQLCREGFYKNDKNYDQCEPCQCPS-AHYNFAQNCTRIESSLELKCQCRIGYSGKSCENCQQGFYGNPI---KGIPCKSCDCNQQGSQS-------LNCNEF-GICQCSPGVLGIKCDQCAPNY--VVEKKTCQSC 5068
            CIC   T G+ C+    GYY +                     + +KC C           GD  C  C     G +C  C +G++ N K+  +C  C C      N   NC +I    +   +C     G +CENC+ G++G+ +   KG  C+SC C   G++        L CN+  G C C P V+GI+CDQCA  +  +     CQ C
Sbjct:  752 CICEHNTAGDTCERCARGYYGDALQGTEE--------------DCQKCPCPNDGPCILHADGDVICTECPNGYTGRRCDECSDGYFGNPKDGTECVECACSGNTDPNSIGNCDKITGECK---KCIFNTHGFNCENCKPGYWGDALIEPKG-NCQSCGCFAAGTRRPNNDYTLLECNQQDGQCDCLPNVIGIQCDQCAHGFYNITSGLGCQEC 946          

HSP 9 Score: 70.8626 bits (172), Expect = 1.982e-11
Identity = 76/287 (26.48%), Postives = 116/287 (40.42%), Query Frame = 2
Query: 3281 CKCAQNVARRDCSKC-----DVGYFGLDVTGCKKCPPCYNGQVCN-------------NEGICV-CPPNTIGNLCNKCSEDSWDFNETIGCKKCNCYINGSYSNICNKISGICACKTAFFGSKCDRCNEGYYGFP--NCQPCSCAENGTKSNELTKCDKITGQCQCKQNVIGTKCKVCRKGTFPSDGTYEGGCFSCFCFGVSEKCHAILNHRIVENSIYEYHIFDEKNSLESGKDYSTIHLN--ANYPRRFGWPLTMFRPIYVNVMKLFNSHDLSLFYRSIFMNVSV 4072
            C+C  N    DC++C     D  +         +C  C   Q+ N             + G C+ C  NT G  C +C  + W       C  C C   GS S  C+   G C CK    G  CD+C +G+Y F    C+ C C  +G+ +N+  +CD  +G C CK NV G +C  C+ G F      + GC  CFCFG S  C+    +  +  S     +FD+     +G++   +     A   +      T   P+Y    + F     S + + +   + V
Sbjct:  310 CRCEHNTQGADCNECLPFYNDRPWRSGTSVEANECIACNCSQLSNRCYFDQQLFEETGHGGHCIDCQGNTQGVHCEQCIANHWRRPGENYCVACGCNEIGSLSTQCDN-EGKCQCKPGVTGRFCDQCLDGFYDFSTNGCKNCGCETSGSLNNQ-PRCDSSSGSCSCKLNVEGRQCDKCKPGYFDLSTENQFGCTPCFCFGHSSICNTADGYFAMNVS----SVFDQDKQKWAGQNRIGLQDTQWAELDKAVAVSDTDNSPVYFVAPEQFLGDQRSSYNQDLVFTLKV 590          

HSP 10 Score: 55.8398 bits (133), Expect = 6.957e-7
Identity = 41/146 (28.08%), Postives = 60/146 (41.10%), Query Frame = 2
Query: 2246 KCNCPPGFNGLSCESCESGYRRVNNVLYQGQCEACACYNHSNTCDSLNGECQNCTHNTAGAHCEDCASGYYGDAKSKNLNSCKKCPCPRLDYQMTELCSSYSSENYVCHK------CLHNTSGVHCDRCIEGYYGNPKKKISCKRC 2665
            +C+C P   G+ C+ C  G+  + + L   +C      +  NTCD   G+CQ C     G  C+ CA  ++G     + N C+ C C  +            SEN  C        C  N  G  CD+C E  YG  +  + C  C
Sbjct:  915 QCDCLPNVIGIQCDQCAHGFYNITSGLGCQECNCDPLGSEGNTCDVNTGQCQ-CKPGVTGQRCDRCADYHFG----FSANGCQPCDCEYI-----------GSENQQCDVNSGQCLCKENVEGRRCDQCAENRYGITQGCLPCDDC 1044          
BLAST of Laminin subunit alpha-2 vs. Ensembl Celegans
Match: epi-1 (Laminin-like protein epi-1 [Source:UniProtKB/Swiss-Prot;Acc:Q21313])

HSP 1 Score: 294.278 bits (752), Expect = 6.082e-79
Identity = 184/561 (32.80%), Postives = 273/561 (48.66%), Query Frame = 2
Query:   95 RIFIIFILLIVHKAHSQDDEPEILSVNVDGLLMENAKITSSATCG--TGGP--EIFCRLVDEIAIQRL-----------------INP---DSHVLCDVCDNRNETKRHPIEFAKSDDDNLWWQSPSMAQGLKYQNVNVTIDLKQVYQIVYILLKMGDSPRPGNWILERSLD-GEIYMPWIFFAETPYSCYNLFQRQYPDLKLTTNAKPSSLADDEMFCTTYYSQPKSLNSGEIIISLINGRKSIMNEEYLSIKSVPQTLINFLSARYIRFRFLKHLTLAADLMTHKGYLEQSIYNRYYYSLRNIEIGGKCICNNHADKCDKVIENGISVAKCNCKHNTCGSNCETCCPLFNQRPWKPVAV-----CEECNCNRKSNECSYNQTVATLQLSVNKMGRMEGGGVCINCQENTEGINCEKCIKGFYRPWNVLATELYPCTPCQCHGLGTIGSCVSNGEDIGDQKPGDCICKKGYEGVNCDLCSIGYERYPNGECLPCPCSIDGSVRTSFYRCKPPCNCKVHVNSDDLCKTCKNGYFNLDSANPEGCEPCYCFGITNQCSSLSA 1687
            +   + + L+    +SQ   P  ++++          IT+++TCG   G P  EI+C L        L                  NP     H  C  C+  NE   HP      D +N WW SP +++GL++  VN+TIDL+Q + + Y+ ++M +SPRPG+W+LERS D G+ Y PW  FAE    C   F  +        +  P S  DD + C T  +  + L + E++I ++  R S  + ++    +  + L NF  A  +R R L   TL   LM    + + ++  RY+Y+++ I IGG+C+CN HA  CD +         C C+HNTCG  CE CCP F Q+ W+         CE CNC  +SNEC Y+  V   + S++  G  EGGGVC NC+ENTEG+NC KC  G++RP  V   E  PC  C C      G+C         ++ G C C   + G +CD C+ GY   P  +C PC C+++G++          C CK        C+TC +GY N+ +    GC  C C    ++  + SA
Sbjct:   12 KALFLIVTLLAQFTYSQVLTPSQITIS------HRKPITATSTCGEIQGQPVTEIYCSLTGSTQYTPLNSYSYQDDEQQKSWSQYENPMVRGGHG-CGHCNAGNENS-HPAA-NMVDGNNSWWMSPPLSRGLQHNEVNITIDLEQEFHVAYVWIQMANSPRPGSWVLERSTDHGKTYQPWFNFAENAAECMRRFGME--------SLSPIS-EDDSVTCRTDMASLQPLENAEMVIRILEHRPS--SRQF----ATSEALQNFTRATNVRLRLLGTRTLQGHLMDMNEWRDPTVTRRYFYAIKEIMIGGRCVCNGHAVTCDILEPQRPKSLLCRCEHNTCGDMCERCCPGFVQKQWQAATAHNNFTCEACNCFGRSNECEYDAEVDLNKQSIDSQGNYEGGGVCKNCRENTEGVNCNKCSFGYFRPEGVTWNEPQPCKVCDCDPDKHTGACA--------EETGKCECLPRFVGEDCDQCASGYYDAP--KCKPCECNVNGTIGDVCLPEDGQCPCKAGFGG-TFCETCADGYTNVTA----GCVECVCDATGSEHGNCSA 533          

HSP 2 Score: 285.419 bits (729), Expect = 2.596e-76
Identity = 225/745 (30.20%), Postives = 324/745 (43.49%), Query Frame = 2
Query: 1010 AKCNCKHNTCGSNCETCCPLFNQRPWKPVAVCEECNCNRKSNECSYNQTVATLQLSVNKMGRMEGGGVCINCQENTEGINCEKCIKGF--YRPWNVLATELYPCTPCQCHGLGTIGSCVSNGEDIGDQKPGDCICKKGYEGVNCDLCSIGYERYPNGECLPCPCSIDGSVRTSFYRCKPPCNCKVHVNSDDLCKTCKNGYFNLDSANPEGCEPCYCFGITNQC-SSLSAKNLKISDLKGWKLTTFTGEKIALPKFTSFQYLTSENSYIDERFNNPTVYYWTAPPPYLGNWITSYGTIFRYVVKIELQSTLKGSLIDSPDVIIKCGDFRLFHSVSIEDRRLQRQVFIYIKPTEWKIGKLTPD-KAATKEEFISCLVKVDKLLIKAKYYSNQKSIELLNITLSRGEVHL--ALDEMPHIEKCNCPPGFNGLSCESCESGYRRVNNVLYQGQCEACACYNHSNTCDSLNGECQNCTHNTAGAHCEDCASGYYGDAKSKNLNSCKKCPCPRLDYQMTELCSSYSSENYVCH-KCLHNTSGVHCDRCIEGYYGNPK-KKISCKRCKCNNN-----QESCDPVTGECR-CSYNTMGTECQLCKHGFYGDALT-KSCKKCDCDSLGSTSENCDKLTGKCDCRTNFVNRQCDSCTSGL--YLKDKKCIPCNCEIQGRISSEKFCNTTSGQCFCLENVNGDRCEKCVEGYFNYP--NCKKCLCSPH-ALSADCDLNNGKCKCGSNVINRICDKC 3184
             +C CK    G  CE C P +   P      C +C CN    +C                   E  G C  C  + EG  C++C+     Y P       L  C  C CH  G+ G     G  + D + G C+C++   G  CD C  G+  +P+  C  C C+  G+           C CK +V     C+ CK G F+L + NP GC  C+CFG+T+ C SS+    +   D+  +  T   G  +   K  +  Y + E S        P   Y+  P     ++ TSYG    + +    +   K    D+ DV +   +  + +  S +    + Q  +  K        LT + K  T+EE +  L  +  + +KA Y+ + K+  L    L   E +   ++ +   +E+C CP  + G SC+ C SGY RV +  + G C  C C  HS TCD   G C +C HNT G HCE C  G+YG+A + +   C  C CP             S E  +    C    +G  CDRC  G++G+P+    SC  C+CN N       SC P +G+C  C  NT G  C+ C   FYGDA+T K+C  C+C   G  S+ CD  +G C+C+ N     CD C      + K + C  C+C   G  +    CN  +GQC C     G RCE C  GY+NY    C KC C    ++   CD+  G+C C        CD+C
Sbjct: 1443 GQCKCKPGVIGRRCERCAPGYYNFPE-----CIKCQCN-AGQQCD------------------ERTGQCF-CPPHVEGQTCDRCVSNAFGYDP-------LIGCQKCGCHPQGSEG-----GNLVCDPESGQCLCRESMGGRQCDRCLAGFYGFPH--CYGCSCNRAGTTEEICDATNAQCKCKENVYGG-RCEACKAGTFDLSAENPLGCVNCFCFGVTDSCRSSMYPVTIMSVDMSSFLTTDDNG--MVDNKDDTVIYTSEETS--------PNSVYFNVPIEK-KDYTTSYGLKLTFKLSTVPRGGRKSMNADA-DVRLTGANMTIEYWASEQPTNPEEQFTVKCKLVPENF--LTAEGKTVTREELMKVLHSLQNITLKASYFDHPKTSTLYEFGLEISEPNGVDSVIKASSVEQCQCPAPYTGPSCQLCASGYHRVQSGSFLGACVPCECNGHSATCDPDTGICTDCEHNTNGDHCEFCNEGHYGNATNGSPYDCMACACPFAPTNNFAKSCDVSEEGQLLQCNCKPGYTGDRCDRCASGFFGHPQISGESCSPCQCNGNNNLTDSRSCHPNSGDCYLCEQNTDGRHCESCAAWFYGDAVTAKNCSSCECSQCG--SQYCDNKSGGCECKINVEGDSCDRCKPDHWGFSKCQGCQGCHC---GTAAFNTQCNVENGQCTCRPGATGMRCEHCEHGYWNYGEHGCDKCDCEADLSMGTVCDVRTGQCHCQEGATGSRCDQC 2128          

HSP 3 Score: 241.891 bits (616), Expect = 3.854e-63
Identity = 167/515 (32.43%), Postives = 237/515 (46.02%), Query Frame = 2
Query: 2339 CEACACYNHSNTCD-----SLN-------------GECQNCTHNTAGAHCEDCASGYYGDAKSKNLNSCKKCPCPRLDYQMTELCSSYSSENYVCHKCLHNTSGVHCDRCIEGYYGNPKKKISCKRCKCNNNQ---ESCDPVTGECRCSYNTMGTECQLCKHGFYGDALTKSCKKCDCDSLGSTSENCDKLTGKCDCRTNFVNRQCDSCTSGLYLKDKKCIPCNCEIQGRISSEKFCNTTSGQCFCLENVNGDRCEKCVEGYFNYPNCKKCLCSPHAL-SADCDLNNGKCKCGSNVINRICDKCENLHYWNNRTDCVPCNCG-RGSLNPKCDMETGNCKCAQNVARRDCSKCDVGYFGL---------------DVTGCKKCPPCYNGQVCNNEGICVCPPNTIGNLCNKCSEDSWD--FNETIGCKKCNCYINGSYS--NICNKISGICACKTAFFGSKCDRCNEGYYGFPN-----CQPCSCAENGTKSNELTKCDKITGQCQCKQNVIGTKC 3742
            CEAC C+  SN C+      LN             G C+NC  NT G +C  C+ GY+   + + +   +  PC   D    +   + + E   C +CL    G  CD+C  GYY  PK    CK C+CN N    + C P  G+C C     GT C+ C  G+    +T  C +C CD+ GS   NC   TG+C+C+  +    CD C  G +  D  C  CNC+  G  +    C+ T+GQC C E   GD+C++C   ++ YPNCK C C    + S +CD  +G+C C  N   R CDKC    Y  N  DC  C C   G+    CD   G C C  N     C +C   ++                 D  GC K  P   G++C+      C  +  G +C++C    WD  ++   GC+ C+C +NG+ S  N C+  +G C CK    G +CD+C +G+Y   +     C+ C C   G    E   CD  +GQC+C+  V G +C
Sbjct:  354 CEACNCFGRSNECEYDAEVDLNKQSIDSQGNYEGGGVCKNCRENTEGVNCNKCSFGYF---RPEGVTWNEPQPCKVCDCDPDKHTGACAEETGKC-ECLPRFVGEDCDQCASGYYDAPK----CKPCECNVNGTIGDVCLPEDGQCPCKAGFGGTFCETCADGYTN--VTAGCVECVCDATGSEHGNCSASTGQCECKPAYAGLSCDKCQVGYFGDD--CKFCNCDPMG--TEGGVCDQTTGQCLCKEGFAGDKCDRCDIAFYGYPNCKACACDGAGITSPECDATSGQCPCNGNFTGRTCDKCAAGFY--NYPDCRGCECLLSGAKGQTCD-SNGQCYCKGNFEGERCDRCKPNFYNFPICEECNCNPSGVTRDFQGCDKVSP---GELCS------CRKHVTGRICDQCKPTFWDLQYHHEDGCRSCDCNVNGTISGLNTCDLKTGQCMCKKNADGRRCDQCADGFYRLNSYNQMGCESCHCDIGGALRAE---CDITSGQCKCRPRVTGLRC 839          

HSP 4 Score: 240.736 bits (613), Expect = 9.784e-63
Identity = 188/633 (29.70%), Postives = 283/633 (44.71%), Query Frame = 2
Query: 3221 VPCNC-GRGSLNPKCDMETGNCKCAQNVARRDCSKCDVGYFGLDVTGCKKCPPCYNGQVCNNE-GICVCPPNTIGNLCNKCSEDSWDFNETIGCKKCNCYINGSYSN--ICNKISGICACKTAFFGSKCDRCNEGYYGFPNCQPCSCAENGTKSNELTKCDKITGQCQCKQNVIGTKCKVCRKGTFPSDGTYEGGCFSCFCFGVSEKCHAILNHRIVENSIYEYHIFDEKNSLESGKDYSTIHLN-ANYPRRFGWPLTMFRPIYVNVMKLFNSHDLSLFYRSIFMNVSVDCLDNKCGREIPEQTEVFMESYNGLFGMRYXXXXXXXXXXXXXXDFNEHSKNGKWVISQYQNDILDKFIILEDSNVINSNLTRDIFMMALLNVTSLKVKLYTDKVNPPLIKIKIITYKVMETTQAIGKRVTAVEKCICNALTFGNHCQNPISGYYKEYFNLPNSTKSGSMRTGNRILINLKKCNCNGYSKVCDSVTGDCQNCMGNREGNKCQLCREGFYKNDKN---YDQCEPCQCPSAHY-NFAQNCTRIESSLELKCQCRIGYSGKSCENCQQGFYGNP-IKGIPCKSCDCNQQG----SQSLNCNEFGICQCSPGVLGIKCDQCAPNY---VVEKKTCQSC 5068
            + C+C  +GS + +C+   G CKC   V  R C +C  GY+  +   C KC  C  GQ C+   G C CPP+  G  C++C  +++ ++  IGC+KC C+  GS     +C+  SG C C+ +  G +CDRC  G+YGFP+C  CSC   GT + E+  CD    QC+CK+NV G +C+ C+ GTF        GC +CFCFGV++ C + +    + +      +  + N +   KD + I+ +    P    + + + +  Y     L  +  LS   R    +++ D              +V +   N    + Y                +E   N +   +     + + F+  E   V    L +   + +L N+T LK   +       L +  +   +       I  + ++VE+C C A   G  CQ   SGY++         +SGS       L     C CNG+S  CD  TG C +C  N  G+ C+ C EG Y N  N   YD C  C CP A   NFA++C   E    L+C C+ GY+G  C+ C  GF+G+P I G  C  C CN       S+S + N      C     G  C+ CA  +    V  K C SC
Sbjct: 1424 LSCDCVAQGSESFQCEQYGGQCKCKPGVIGRRCERCAPGYY--NFPECIKCQ-CNAGQQCDERTGQCFCPPHVEGQTCDRCVSNAFGYDPLIGCQKCGCHPQGSEGGNLVCDPESGQCLCRESMGGRQCDRCLAGFYGFPHCYGCSCNRAGT-TEEI--CDATNAQCKCKENVYGGRCEACKAGTFDLSAENPLGCVNCFCFGVTDSCRSSMYPVTIMSVDMSSFLTTDDNGMVDNKDDTVIYTSEETSPNSVYFNVPIEKKDYTTSYGLKLTFKLSTVPRGGRKSMNAD-------------ADVRLTGAN--MTIEYWA--------------SEQPTNPEEQFTVKCKLVPENFLTAEGKTVTREELMK--VLHSLQNIT-LKASYFDHPKTSTLYEFGLEISEPNGVDSVI--KASSVEQCQCPAPYTGPSCQLCASGYHR--------VQSGSF------LGACVPCECNGHSATCDPDTGICTDCEHNTNGDHCEFCNEGHYGNATNGSPYD-CMACACPFAPTNNFAKSCDVSEEGQLLQCNCKPGYTGDRCDRCASGFFGHPQISGESCSPCQCNGNNNLTDSRSCHPNSGDCYLCEQNTDGRHCESCAAWFYGDAVTAKNCSSC 2001          

HSP 5 Score: 221.09 bits (562), Expect = 9.145e-57
Identity = 168/528 (31.82%), Postives = 243/528 (46.02%), Query Frame = 2
Query: 2348 CACYNHSNTCDSLNGE------CQNCTHNTAGAHCEDCASGY----YGDAKSKNLNSCKKCPC----------PRLDYQMTELCSSYSSENY-VCHKCLHNTSGVHCDRCIEGYYGNPK-----KKISCKRCKCNNNQE--SCDPVTGECRCSYNTMGTECQLCKHGFYGDALTKSCKKCDCDSLGSTSENCDKLTGKCDCRTNFVNRQCDSCTSGLYLKDKKCIPCNCEIQGRISSEKFCNTTSGQCFCLENVNGDRCEKCVEGYFNYPNCKKCLCSPHALSAD-CDLNNGKCKCGSNVINRICDKCENLHYWNNRTDCVPCNC-GRGSLNPKCDMETGNCKCAQNVARRDCSKCDVGYFGL-DVTGCKKCPPCYNGQVCNNEGICVCPPNTIGNLCNKCSEDSWDFNETIGCKKCNCYINGSYSNI--CNKISG--ICACKTAFFGSKCDRCNEGYYGFP-----NCQPCSCAENGTKSNELTKCDKITGQCQCKQNVIGTKCKVCRKGTFPSDGTYEGGCFSCFC 3811
            C C  H+ TCD L  +      C+ C HNT G  CE C  G+    +  A + N  +C+ C C            +D     + S  + E   VC  C  NT GV+C++C  GY+  P+     +   CK C C+ ++   +C   TG+C C    +G +C  C  G+Y DA    CK C+C+  G+  + C    G+C C+  F    C++C  G       C+ C C+  G  S    C+ ++GQC C     G  C+KC  GYF   +CK C C P       CD   G+C C        CD+C+   Y     +C  C C G G  +P+CD  +G C C  N   R C KC  G++   D  GC+       GQ C++ G C C  N  G  C++C  + ++F     C++CNC  +G   +   C+K+S   +C+C+    G  CD+C   ++         C+ C C  NGT S  L  CD  TGQC CK+N  G +C  C  G +  +   + GC SC C
Sbjct:  298 CVCNGHAVTCDILEPQRPKSLLCR-CEHNTCGDMCERCCPGFVQKQWQAATAHNNFTCEACNCFGRSNECEYDAEVDLNKQSIDSQGNYEGGGVCKNCRENTEGVNCNKCSFGYF-RPEGVTWNEPQPCKVCDCDPDKHTGACAEETGKCECLPRFVGEDCDQCASGYY-DA--PKCKPCECNVNGTIGDVCLPEDGQCPCKAGFGGTFCETCADGYTNVTAGCVECVCDATG--SEHGNCSASTGQCECKPAYAGLSCDKCQVGYFG-DDCKFCNCDPMGTEGGVCDQTTGQCLCKEGFAGDKCDRCDIAFY--GYPNCKACACDGAGITSPECDATSGQCPCNGNFTGRTCDKCAAGFYNYPDCRGCECLLSGAKGQTCDSNGQCYCKGNFEGERCDRCKPNFYNFPI---CEECNCNPSGVTRDFQGCDKVSPGELCSCRKHVTGRICDQCKPTFWDLQYHHEDGCRSCDCNVNGTISG-LNTCDLKTGQCMCKKNADGRRCDQCADGFYRLNSYNQMGCESCHC 811          

HSP 6 Score: 180.259 bits (456), Expect = 1.942e-44
Identity = 138/434 (31.80%), Postives = 205/434 (47.24%), Query Frame = 2
Query: 2246 KCNCPPGFNGLSCESCESGYRRVNNVLYQGQCEACACYNHS---NTCDSLNGECQNCTHNTAGAHCEDCASGYYGDAKSKNLNSCKKCPCPRLDYQMTELCSSYSSENYVCHKCLHNTSGVHCDRCIEGYYGNPKKKISCKRCKCN---NNQESCDPVTGECRCSYNTMGTECQLCKHGFYGDALTKSCKKCDCDSLGSTSENCDKLTGKCDCRTNFVNRQCDSCTSGLYLKDKKCIPCNCEIQGRISSEKFCNTTSGQCFCLENVNGDRCEKCVEGYFNYPNCKKCLCSPHALSAD---CD-LNNGK-CKCGSNVINRICDKCENLHY---WNNRTDCVPCNC---GRGSLNPKCDMETGNCKCAQNVARRDCSKCDVGYFGLDV---TGCKKCPPCYNGQVCNNE-----GICVCPPNTIGNLCNKCSEDSW 3472
            KC C P F G  C+ C SGY          +C+ C C  +    + C   +G+C  C     G  CE CA GY     +     C +C C     +    CS+ + +   C +C    +G+ CD+C  GY+G+      CK C C+        CD  TG+C C     G +C  C   FYG     +CK C CD  G TS  CD  +G+C C  NF  R CD C +G Y     C  C C + G  +  + C+ ++GQC+C  N  G+RC++C   ++N+P C++C C+P  ++ D   CD ++ G+ C C  +V  RICD+C+   +   +++   C  C+C   G  S    CD++TG C C +N   R C +C  G++ L+     GC+ C  C  G     E     G C C P   G  C++  E+ +
Sbjct:  444 KCECLPRFVGEDCDQCASGYYDAP------KCKPCECNVNGTIGDVCLPEDGQCP-CKAGFGGTFCETCADGY-----TNVTAGCVECVCDATGSEHGN-CSASTGQ---C-ECKPAYAGLSCDKCQVGYFGD-----DCKFCNCDPMGTEGGVCDQTTGQCLCKEGFAGDKCDRCDIAFYG---YPNCKACACDGAGITSPECDATSGQCPCNGNFTGRTCDKCAAGFY-NYPDCRGCECLLSG--AKGQTCD-SNGQCYCKGNFEGERCDRCKPNFYNFPICEECNCNPSGVTRDFQGCDKVSPGELCSCRKHVTGRICDQCKPTFWDLQYHHEDGCRSCDCNVNGTISGLNTCDLKTGQCMCKKNADGRRCDQCADGFYRLNSYNQMGCESC-HCDIGGALRAECDITSGQCKCRPRVTGLRCDQPIENHY 847          

HSP 7 Score: 163.696 bits (413), Expect = 1.901e-39
Identity = 129/418 (30.86%), Postives = 186/418 (44.50%), Query Frame = 2
Query: 2624 YYGNPKKKISCKRCKCNNNQESCD------PVTGECRCSYNTMGTECQLCKHGFYG---DALTK----SCKKCDCDSLGSTSE-------NCDKLT----------GKC-DCRTNFVNRQCDSCTSGLYLKD-------KKCIPCNCEIQGRISSEKFCNTTSGQCFCLENVNGDRCEKCVEGYFNYPNCKKCLCSPHALSAD-CDLNNGKCKCGSNVINRICDKCENLHYWNNRTDCVPCNC-GRGSLNPKCDMETGNCKCAQNVARRDCSKCDVGYFGLDVTGCKKCPPCYNGQVCN-NEGICVCPPNTIGNLCNKCSEDSWDFNETIGCKKCNCYINGSYSNICNKISGICACKTAFFGSKCDRCNEGYYGFPNCQPCSCAENGTKSNELTKCDKITGQCQCKQNVIGTKCKVCR 3754
            Y+   K+ +   RC CN +  +CD      P +  CRC +NT G  C+ C  GF      A T     +C+ C+C   G ++E       + +K +          G C +CR N     C+ C+ G +  +       + C  C+C+      +   C   +G+C CL    G+ C++C  GY++ P CK C C+ +    D C   +G+C C +      C+ C +  Y N    CV C C   GS +  C   TG C+C    A   C KC VGYFG D   C   P    G VC+   G C+C     G+ C++C    + +     CK C C   G  S  C+  SG C C   F G  CD+C  G+Y +P+C+ C C  +G K      CD   GQC CK N  G +C  C+
Sbjct:  285 YFYAIKEIMIGGRCVCNGHAVTCDILEPQRPKSLLCRCEHNTCGDMCERCCPGFVQKQWQAATAHNNFTCEACNC--FGRSNECEYDAEVDLNKQSIDSQGNYEGGGVCKNCRENTEGVNCNKCSFGYFRPEGVTWNEPQPCKVCDCDPDKHTGA---CAEETGKCECLPRFVGEDCDQCASGYYDAPKCKPCECNVNGTIGDVCLPEDGQCPCKAGFGGTFCETCAD-GYTNVTAGCVECVCDATGSEHGNCSASTGQCECKPAYAGLSCDKCQVGYFGDDCKFCNCDPMGTEGGVCDQTTGQCLCKEGFAGDKCDRCDIAFYGYPN---CKACACDGAGITSPECDATSGQCPCNGNFTGRTCDKCAAGFYNYPDCRGCECLLSGAKGQ---TCDS-NGQCYCKGNFEGERCDRCK 689          

HSP 8 Score: 148.288 bits (373), Expect = 8.027e-35
Identity = 118/387 (30.49%), Postives = 169/387 (43.67%), Query Frame = 2
Query: 2231 MPHIEKCNCPPGFNGLSCESCESGYRRVNNVLYQGQCEACACYNHSNTCDSLNGECQNCTHNTAGAHCEDCASGYYGDAKSKNLNSCKKCPCPRLDYQMTELCSSYSSENYVCHK------CLHNTSGVHCDRCIEGYYGNPKKKISCKRCKCNN---NQESCDPVTGECRCSYNTMGTECQLCKHGFYGDALTKSCKKCDCDSLGSTSENCDKLTGKCDCRTNFVNRQCDSCTSGLYLKDKKCIPCNCEIQGRISSEKFCNTTS-GQ-CFCLENVNGDRCEKCVEGYFNYP-----NCKKCLCSPHALSAD---CDLNNGKCKCGSNVINRICDKCENLHYW---NNRTDCVPCNCG-RGSLNPKCDMETGNCKCAQNVARRDCSK 3322
            +P   +C C  GF G  CE+C  GY  V     +  C+A     H N C +  G+C+ C    AG  C+ C  GY+GD        CK C C  +            +E  VC +      C    +G  CDRC   +YG P    +CK C C+        CD  +G+C C+ N  G  C  C  GFY       C+ C+C   G+  + CD   G+C C+ NF   +CD C    Y     C  CNC   G     + C+  S G+ C C ++V G  C++C   +++        C+ C C+ +   +    CDL  G+C C  N   R CD+C +  Y     N+  C  C+C   G+L  +CD+ +G CKC   V    C +
Sbjct:  485 LPEDGQCPCKAGFGGTFCETCADGYTNVTAGCVECVCDATGS-EHGN-CSASTGQCE-CKPAYAGLSCDKCQVGYFGD-------DCKFCNCDPM-----------GTEGGVCDQTTGQCLCKEGFAGDKCDRCDIAFYGYP----NCKACACDGAGITSPECDATSGQCPCNGNFTGRTCDKCAAGFYN---YPDCRGCECLLSGAKGQTCDS-NGQCYCKGNFEGERCDRCKPNFY-NFPICEECNCNPSGVTRDFQGCDKVSPGELCSCRKHVTGRICDQCKPTFWDLQYHHEDGCRSCDCNVNGTISGLNTCDLKTGQCMCKKNADGRRCDQCADGFYRLNSYNQMGCESCHCDIGGALRAECDITSGQCKCRPRVTGLRCDQ 841          

HSP 9 Score: 144.821 bits (364), Expect = 8.543e-34
Identity = 102/338 (30.18%), Postives = 155/338 (45.86%), Query Frame = 2
Query: 2573 KCLHNTSGVHCDRCIEGYYGNPKKKI--SCKRCKCNNNQESCDPVTGECR-CSYNTMGTECQLCKHGFYGDALTKS---CKKCDCDSLGST--SENCDKLTG----KCDCRTNFVNRQCDSCTSGLY----LKDKKCIPCNCEIQGRISSEKFCNTTSGQCF-CLENVNGDRCEKCVEGYFN----YPNCKKCLCSPHALSADCDLNNGKCKCGSNVINRICDKCENLHYWNNR-TDCVPCNCGRGSLNPKCDMETGNCKCAQNVARRDCSKCDVGYFGLDVTGCKKC---PPCYNGQVCN-NEGICVCPPNTIGNLCNKCSEDSWDFNETIGCKKCN 3508
            +C    +G  C  C  GY+         +C  C+CN +  +CDP TG C  C +NT G  C+ C  G YG+A   S   C  C C    +   +++CD        +C+C+  +   +CD C SG +    +  + C PC C     ++  + C+  SG C+ C +N +G  CE C   ++       NC  C CS    S  CD  +G C+C  NV    CD+C+  H+  ++   C  C+CG  + N +C++E G C C        C  C+ GY+     GC KC        G VC+   G C C     G+ C++C   S+    T GC++C+
Sbjct: 1809 QCPAPYTGPSCQLCASGYHRVQSGSFLGACVPCECNGHSATCDPDTGICTDCEHNTNGDHCEFCNEGHYGNATNGSPYDCMACACPFAPTNNFAKSCDVSEEGQLLQCNCKPGYTGDRCDRCASGFFGHPQISGESCSPCQCNGNNNLTDSRSCHPNSGDCYLCEQNTDGRHCESCAAWFYGDAVTAKNCSSCECS-QCGSQYCDNKSGGCECKINVEGDSCDRCKPDHWGFSKCQGCQGCHCGTAAFNTQCNVENGQCTCRPGATGMRCEHCEHGYWNYGEHGCDKCDCEADLSMGTVCDVRTGQCHCQEGATGSRCDQCLP-SYLRIPTYGCRRCD 2144          

HSP 10 Score: 136.732 bits (343), Expect = 3.000e-31
Identity = 108/369 (29.27%), Postives = 154/369 (41.73%), Query Frame = 2
Query: 2708 ECRCSYNTMGTECQLCKHGFY---GDALTKSCKKCDCDSLGSTSENCDKLTGKC-DCRTNFVNRQCDSCTSGLYLKDK-----KCIPCNCEIQGRISSEKFCNTTSG----QCFCLENVNGDRCEKCVEGYFNYPNCKKCLCSPHALSADCDLNNGKCKCGSNVINRICDKCENLHYWNNRTDCVPCNCGRGSLNPKCDMETGNCK-CAQNVARRDCSKCDVGYFGLDVTGCKKCPPCY----NGQVCNNE-GICVCPPNTIGNLCNKCSEDSWDFNETIGCKKCNCYINGSYSNICNKISGICACKTAFFGSKCDRCNEGY--YGFPNCQPCSCAENGTKSNELTKCDKITGQCQCKQNVIGTKCKVC 3751
            +C+C     G  CQLC  G++     +   +C  C+C+   +T   CD  TG C DC  N     C+ C  G Y          C+ C C      +  K C+ +      QC C     GDRC++C  G+F +P      CSP             C+C  N               NN TD           +  C   +G+C  C QN   R C  C   ++G  VT  K C  C       Q C+N+ G C C  N  G+ C++C  D W F++  GC+ C+C    +++  CN  +G C C+    G +C+ C  GY  YG   C  C C  + +     T CD  TGQC C++   G++C  C
Sbjct: 1807 QCQCPAPYTGPSCQLCASGYHRVQSGSFLGACVPCECNGHSAT---CDPDTGICTDCEHNTNGDHCEFCNEGHYGNATNGSPYDCMACACPFAPTNNFAKSCDVSEEGQLLQCNCKPGYTGDRCDRCASGFFGHPQISGESCSP-------------CQCNGN---------------NNLTD-----------SRSCHPNSGDCYLCEQNTDGRHCESCAAWFYGDAVTA-KNCSSCECSQCGSQYCDNKSGGCECKINVEGDSCDRCKPDHWGFSKCQGCQGCHCG-TAAFNTQCNVENGQCTCRPGATGMRCEHCEHGYWNYGEHGCDKCDCEADLSMG---TVCDVRTGQCHCQEGATGSRCDQC 2128          

HSP 11 Score: 103.605 bits (257), Expect = 3.119e-21
Identity = 92/299 (30.77%), Postives = 123/299 (41.14%), Query Frame = 2
Query: 3002 QCFCLENVNGDRCEKCVEGYFNYPN------CKKCLCSPHALSADCDLNNGKC-KCGSNVINRICDKCENLHYWNNRT----DCVPCNCGRGSLN---PKCDM-ETGN---CKCAQNVARRDCSKCDVGYFGLDVTGCKKCPPCY--------NGQVCN-NEGIC-VCPPNTIGNLCNKCSEDSWDFNETIGCKKCN-CYINGSYSNICNKISGICACKTAFFGSKCDRCNEGYYGFPNCQPCSCAENGTKSNELTKCDKITGQCQCKQNVIGTKCKVCRKGTFPSDGTYEGGCFSCFC 3811
            QC C     G  C+ C  GY    +      C  C C+ H  SA CD + G C  C  N     C+ C   HY N       DC+ C C     N     CD+ E G    C C        C +C  G+FG      + C PC         + + C+ N G C +C  NT G  C  C+  +W + + +  K C+ C  +   S  C+  SG C CK    G  CDRC   ++GF  CQ C     GT +   T+C+   GQC C+    G +C+ C  G +      E GC  C C
Sbjct: 1807 QCQCPAPYTGPSCQLCASGYHRVQSGSFLGACVPCECNGH--SATCDPDTGICTDCEHNTNGDHCEFCNEGHYGNATNGSPYDCMACACPFAPTNNFAKSCDVSEEGQLLQCNCKPGYTGDRCDRCASGFFGHPQISGESCSPCQCNGNNNLTDSRSCHPNSGDCYLCEQNTDGRHCESCA--AWFYGDAVTAKNCSSCECSQCGSQYCDNKSGGCECKINVEGDSCDRCKPDHWGFSKCQGCQGCHCGTAAFN-TQCNVENGQCTCRPGATGMRCEHCEHGYW---NYGEHGCDKCDC 2097          

HSP 12 Score: 100.523 bits (249), Expect = 2.536e-20
Identity = 163/813 (20.05%), Postives = 311/813 (38.25%), Query Frame = 2
Query: 4481 ICNALTFGNHCQNPISGYYKEYFNLPNSTKSGSMRTGNRILINLKKCNCNG-YSKVCDSVTGDCQNCMGNREGNKCQLCREGFYKNDKNYDQCEPCQCPSAHYNFAQNCTRIESSLELKCQCRIGYSGKSCENCQQGFYGNPIKGIPCKSCDCNQQGSQSLNCN-EFGICQCSPGVLGIKCDQCAPNYV-VEKKTCQSCYS------GCTKDLLVRIDTLNETVINFKWKTLPSTLDLR----LNKINISIQMSSELLNSINKFYKLKNEIKNFSIQFQ----KMKDDAKEKYGE-----------IEKLKTRYNKVLEDLRSTFTDINETISGHEQLGISNELIKNATAYLETIKNIYKEM--PNITLAASVLKDVLKYVDELNQIIKYTQSHIQSDQINNLKILKNKTIMADEINTNNKEYLNTMSTKKKEHELYIILINERMKDLQKIFRKMTKQRDNLRKKIQKLDA----ISKSFQDEKDLISINVREIEDLMKNLSSNHLVSKSLIIPDTLKKHVEQQLN---------KSSNLIKKLTKDFNFLHNAEQAKEAYSNITRDI----LAVDYAINQTKKELDFNRSNMNIDSLKKLLAEFNSNKSEIVENIKNIDKEHEKLLKQYKNCSYXXXXXXXXXXXXSSEIP-----------TGFYDVEILKRNLSXXXXXXXXXXXXFILPINQTILNLGTPNVKSGLDTRN---LEKLIKVVDNQYRDLVNESSFVENKIKDLRKSIKSLRERLQKARVMSELI----HGAAARSVE---PIRHVVRCVRHY-VTYYLPTSNAFSLEFYM 6712
            +C   T G HC++  + +Y +     N +                 C C+   S+ CD+ +G C+ C  N EG+ C  C+   +   K    C+ C C +A +N   N   +E+    +C CR G +G  CE+C+ G++     G  C  CDC    S    C+   G C C  G  G +CDQC P+Y+ +    C+ C        G   +L + ID L   + N    T+      R     N IN   +M ++  NS    +    +I   S Q Q    + K  ++                ++++  R  +  + +RS         S  + + +   L+K A   L T++    +            L+++ K + E  + +   +   ++ +       K    +A  +N+  +    + S   K + +  +L   ++++L        ++ +  + + QKL+     I+++ +D+++ ++  V  + +   +++     +K  +  D  +K V+ QL          +++ L +    + +    A +A  A+SN+T  +      +D A      E  F  S  N    K    E       + + +    KE EKL KQ +  +   +KL+   E + + IP               +VE LK  +     E     +       +      +      L  RN   L KL  V+ +++ +L   SS    K+  +   +  ++E +  AR  +  I    H     S++   P R V R   H  +++Y  T     +  + 
Sbjct: 1971 LCEQNTDGRHCESCAAWFYGDAVTAKNCSS----------------CECSQCGSQYCDNKSGGCE-CKINVEGDSCDRCKPDHWGFSK-CQGCQGCHCGTAAFNTQCN---VENG---QCTCRPGATGMRCEHCEHGYWNYGEHG--CDKCDCEADLSMGTVCDVRTGQCHCQEGATGSRCDQCLPSYLRIPTYGCRRCDECVHHLIGDVDNLELEIDVLGTAIANISSATIVGARLARNKKEFNDINEITKMLNDEENSFGNVFGDAQDILTNSTQIQNKLVRTKTHSQNSVSSAKNITLNGTEFLQEVMKRAQRARQSVRSLAEIALAIGSSSKAVNVDPRLLKEAEETLMTLEAASADQYPEKAQTVPGKLEEIQKKIQEETEKLDKQKETFEAQK-------KRAEELAAYLNSAQQLLKESKSKADKSNNIAKMLQLTKVENLVAAITDDLERVEAAKGEFQKLNVAIGNITENLKDKREEMTHAVTTLNETRNDVAEALEAAKKRVRRD--EKSVDMQLVNAKAHELHLQATTLRQTFDNNKDNTDQAVEAANAFSNLTDTLKNAKAQIDNAYEALSAEPAFAESVQNARD-KPFPDETKEKIDALSKTVSQDLKETEKLKKQLEQLTELSEKLRKRKEAVKAGIPKYSKNTLDSIDEKVQEVEKLKAEIDANIEETRAKISEIAGKAEEITEKANSAMEGIRLARRNSVQLNKLAPVIVSKFEELKKLSSARSAKVDSVSDKVSQIKEMIAVARDAANRIKLGAHFEKGSSLDLNIPQR-VTRSAAHADISFYFRTEQEHGIPLFF 2746          

HSP 13 Score: 70.0922 bits (170), Expect = 3.417e-11
Identity = 52/166 (31.33%), Postives = 72/166 (43.37%), Query Frame = 2
Query: 4613 KKCNCNGYSK---VCDSVTGDCQNCMGNREGNKCQLCREGFYKNDKNYDQCEPCQCPSAHYNFAQNCTRIESSLELKCQCRIGYSGKSCENCQQGFYGNPIKGIPCKSCDCNQQGSQSLNCNEFGICQCSPGVLGIKCDQCAPNYVVEKKTCQSC---YSGCTKDL 5092
            K CNC+       VCD  TG C  C     G+KC  C   FY     Y  C+ C C  A    +  C         +C C   ++G++C+ C  GFY  P     C+ C+C   G++   C+  G C C     G +CD+C PN+      C+ C    SG T+D 
Sbjct:  562 KFCNCDPMGTEGGVCDQTTGQCL-CKEGFAGDKCDRCDIAFY----GYPNCKACACDGAGIT-SPECDATSG----QCPCNGNFTGRTCDKCAAGFYNYP----DCRGCECLLSGAKGQTCDSNGQCYCKGNFEGERCDRCKPNF-YNFPICEECNCNPSGVTRDF 712          

HSP 14 Score: 67.0106 bits (162), Expect = 3.631e-10
Identity = 59/204 (28.92%), Postives = 87/204 (42.65%), Query Frame = 2
Query: 1004 SVAKCNCKHNTCGSNCETCCPLFNQRPWKPVAVCEECNCNRKSNECSYNQTVATLQLSVNKMGRMEGGGVCINCQENTEGINCEKCIKGFYRPWNVLATELYPCTPCQCHGLGTIGSCVSNGEDIGDQKPGDCICKKGYEGVNCDLCSIGYER---YPNGECLPCPCSIDGSVRTSFYRCKPPCNCKVHVNSDDLCKTCKNGYF 1606
            S  +C CK N  G  C+ C P F   P     +CEECNCN            + +        ++  G +C +C+++  G  C++C   F   W++       C  C C+  GTI     +G +  D K G C+CKK  +G  CD C+ G+ R   Y    C  C C I G++R         C C+  V      +  +N YF
Sbjct:  670 SNGQCYCKGNFEGERCDRCKPNFYNFP-----ICEECNCNP-----------SGVTRDFQGCDKVSPGELC-SCRKHVTGRICDQCKPTF---WDLQYHHEDGCRSCDCNVNGTI-----SGLNTCDLKTGQCMCKKNADGRRCDQCADGFYRLNSYNQMGCESCHCDIGGALRAECDITSGQCKCRPRVTGLRCDQPIENHYF 848          

HSP 15 Score: 65.4698 bits (158), Expect = 9.206e-10
Identity = 65/208 (31.25%), Postives = 91/208 (43.75%), Query Frame = 2
Query: 4475 KCICNALTFGNHCQNPISGYYKEYFNLPNSTKSGSMRTGNRILINLKKCNCNGYSKVCDSVTGDCQNCMGNREGNKCQLCREGFYKNDKNYDQCEPCQC-PSAHYNFAQNCTRIESSLELKCQCRIGYSGKSCENCQQGFYGNPIKGIP-CKSCDCNQQGSQS-LNCNEF--GICQCSPGVLGIKCDQCAPNYV----VEKKTCQSCY 5071
            +C CN    G  C    +G+Y    N P+      + +G +              + CDS  G C  C GN EG +C  C+  FY    N+  CE C C PS      Q C ++ S  EL C CR   +G+ C+ C+  F+         C+SCDCN  G+ S LN  +   G C C     G +CDQCA  +       +  C+SC+
Sbjct:  628 QCPCNGNFTGRTCDKCAAGFY----NYPDCRGCECLLSGAK-------------GQTCDS-NGQCY-CKGNFEGERCDRCKPNFY----NFPICEECNCNPSGVTRDFQGCDKV-SPGEL-CSCRKHVTGRICDQCKPTFWDLQYHHEDGCRSCDCNVNGTISGLNTCDLKTGQCMCKKNADGRRCDQCADGFYRLNSYNQMGCESCH 810          

HSP 16 Score: 65.0846 bits (157), Expect = 1.309e-9
Identity = 44/141 (31.21%), Postives = 64/141 (45.39%), Query Frame = 2
Query: 4619 CNCNGYSKVCDSVTGDCQNCMGNREGNKCQLCREGFYKNDKNYDQCEPCQCPSAHYNFAQNCTRIESSLELKCQCRIGYSGKSCENCQQGFYGNPIKGIPCKSCDCNQQGSQSLNCN-EFGICQCSPGVLGIKCDQCAPNY 5038
            C+ + ++  C   TG C+ C+    G  C  C  G+Y   K    C+PC+C     N       +    + +C C+ G+ G  CE C  G Y N   G  C  C C+  GS+  NC+   G C+C P   G+ CD+C   Y
Sbjct:  429 CDPDKHTGACAEETGKCE-CLPRFVGEDCDQCASGYYDAPK----CKPCEC-----NVNGTIGDVCLPEDGQCPCKAGFGGTFCETCADG-YTNVTAG--CVECVCDATGSEHGNCSASTGQCECKPAYAGLSCDKCQVGY 556          

HSP 17 Score: 59.6918 bits (143), Expect = 5.830e-8
Identity = 43/142 (30.28%), Postives = 61/142 (42.96%), Query Frame = 2
Query: 4661 GDCQNCMGNREGNKCQLCREGFYKNDK-NYDQCEPCQC----PSAHYNFAQNCTRIESSLELKCQCRIGYSGKSCENCQQGFYGNPIKGIPCKSCDCNQQGSQSLNC-NEFGICQCSPGVLGIKCDQCAPNYVVEKKTCQSC 5068
            G C+NC  N EG  C  C  G+++ +   +++ +PC+     P  H       T        KC+C   + G+ C+ C  G+Y  P     CK C+CN  G+    C  E G C C  G  G  C+ CA  Y      C  C
Sbjct:  389 GVCKNCRENTEGVNCNKCSFGYFRPEGVTWNEPQPCKVCDCDPDKHTGACAEETG-------KCECLPRFVGEDCDQCASGYYDAP----KCKPCECNVNGTIGDVCLPEDGQCPCKAGFGGTFCETCADGYTNVTAGCVEC 519          

HSP 18 Score: 58.9214 bits (141), Expect = 9.559e-8
Identity = 61/229 (26.64%), Postives = 86/229 (37.55%), Query Frame = 2
Query: 1010 AKCNCKHNTCGSNCETCCPLFNQRPWKPVAVCEECNCNRKSNECSYNQTVATLQLSVNKMGRMEGGGVCINCQENTEGINCEKCIKGFYRPWNVLATELYPCTPCQCHGLGTIGSCVSNGEDIGDQKPGDCICKKGYEGVNCDLCSIGYERYPNGECLPCPCSIDGSVRTSFYRCKPPCNCKVHVNSDDLCKTCKNGYFN----------LDSANPEGCEP---CYCFG 1657
             +C CK    G+ CETC   +        A C EC C+   +E   N + +T Q                 C+    G++C+KC  G++            C  C C  +GT G        + DQ  G C+CK+G+ G  CD C I +  YPN  C  C C   G            C C  +  +   C  C  G++N          L  A  + C+    CYC G
Sbjct:  489 GQCPCKAGFGGTFCETCADGYTNV----TAGCVECVCDATGSE-HGNCSASTGQCE---------------CKPAYAGLSCDKCQVGYFGD---------DCKFCNCDPMGTEGG-------VCDQTTGQCLCKEGFAGDKCDRCDIAFYGYPN--CKACACDGAGITSPECDATSGQCPCNGNF-TGRTCDKCAAGFYNYPDCRGCECLLSGAKGQTCDSNGQCYCKG 678          

HSP 19 Score: 58.151 bits (139), Expect = 1.594e-7
Identity = 44/139 (31.65%), Postives = 65/139 (46.76%), Query Frame = 2
Query: 4616 KCNCNG-YSKVCDSVTGDCQNCMGNREGNKCQLCREGFYKNDKNYDQCEPCQCPSAHYNFAQNCTRIESSLELKCQCRIGYSGKSCENCQQGFYGNPIKGIPCKSCDCNQQGSQSLNCNE-FGICQCSPGVLGIKCDQC 5026
            +CN NG    VC    G C  C     G  C+ C +G+         C  C C +       NC    S+   +C+C+  Y+G SC+ CQ G++G+      CK C+C+  G++   C++  G C C  G  G KCD+C
Sbjct:  473 ECNVNGTIGDVCLPEDGQCP-CKAGFGGTFCETCADGYTNVTAG---CVECVCDATGSEHG-NC----SASTGQCECKPAYAGLSCDKCQVGYFGD-----DCKFCNCDPMGTEGGVCDQTTGQCLCKEGFAGDKCDRC 597          

HSP 20 Score: 55.8398 bits (133), Expect = 7.325e-7
Identity = 68/261 (26.05%), Postives = 106/261 (40.61%), Query Frame = 2
Query:  914 YYSLRNIEIGGKCI---CNNHADKCDKVIENGISVAKCNCKHNTCGSNCETCCP-----LFNQRPWKPVA-VCEECNCNRKSNECSYNQTVATLQLSVNKMGRMEGGGVCINCQENTEGINCEKCIKGFYRPWNVLATELYPCTPCQCHG---LGTIGSCVSNGEDIGDQKPGDC-ICKKGYEGVNCDLCSIGY--ERYPNGECLPCPCSIDGSVRTSFYRCKPPCNCKVHVNSDDLCKTCKNGYFNLDSANPEGCEPCYC 1651
            Y+ +++    G C+   CN H+  CD   + GI     +C+HNT G +CE C         N  P+  +A  C     N  +  C  ++    LQ                NC+    G  C++C  GF+    +       C+PCQC+G   L    SC  N         GDC +C++  +G +C+ C+  +  +      C  C CS  GS           C CK++V  D  C  CK  ++       +GC+ C+C
Sbjct: 1826 YHRVQSGSFLGACVPCECNGHSATCDP--DTGICT---DCEHNTNGDHCEFCNEGHYGNATNGSPYDCMACACPFAPTNNFAKSCDVSEEGQLLQC---------------NCKPGYTGDRCDRCASGFFGHPQISGES---CSPCQCNGNNNLTDSRSCHPNS--------GDCYLCEQNTDGRHCESCAAWFYGDAVTAKNCSSCECSQCGSQYCD--NKSGGCECKINVEGDS-CDRCKPDHWGFSKC--QGCQGCHC 2050          

HSP 21 Score: 55.0694 bits (131), Expect = 1.408e-6
Identity = 44/151 (29.14%), Postives = 72/151 (47.68%), Query Frame = 2
Query: 4613 KKCNCN--GYSK---VCDSVT-GDCQNCMGNREGNKCQLCREGFYKNDKNY-DQCEPCQCPSAHYNFAQNCTRIESSLELKCQCRIGYSGKSCENCQQGFYG-NPIKGIPCKSCDCNQQGSQSLNCN-EFGICQCSPGVLGIKCDQCAPNY 5038
            ++CNCN  G ++    CD V+ G+  +C  +  G  C  C+  F+    ++ D C  C C         N   +++    +C C+    G+ C+ C  GFY  N    + C+SC C+  G+    C+   G C+C P V G++CDQ   N+
Sbjct:  699 EECNCNPSGVTRDFQGCDKVSPGELCSCRKHVTGRICDQCKPTFWDLQYHHEDGCRSCDCNVNGTISGLNTCDLKTG---QCMCKKNADGRRCDQCADGFYRLNSYNQMGCESCHCDIGGALRAECDITSGQCKCRPRVTGLRCDQPIENH 846          
BLAST of Laminin subunit alpha-2 vs. Ensembl Celegans
Match: epi-1 (Laminin-like protein epi-1 [Source:UniProtKB/Swiss-Prot;Acc:Q21313])

HSP 1 Score: 293.893 bits (751), Expect = 6.603e-79
Identity = 184/561 (32.80%), Postives = 273/561 (48.66%), Query Frame = 2
Query:   95 RIFIIFILLIVHKAHSQDDEPEILSVNVDGLLMENAKITSSATCG--TGGP--EIFCRLVDEIAIQRL-----------------INP---DSHVLCDVCDNRNETKRHPIEFAKSDDDNLWWQSPSMAQGLKYQNVNVTIDLKQVYQIVYILLKMGDSPRPGNWILERSLD-GEIYMPWIFFAETPYSCYNLFQRQYPDLKLTTNAKPSSLADDEMFCTTYYSQPKSLNSGEIIISLINGRKSIMNEEYLSIKSVPQTLINFLSARYIRFRFLKHLTLAADLMTHKGYLEQSIYNRYYYSLRNIEIGGKCICNNHADKCDKVIENGISVAKCNCKHNTCGSNCETCCPLFNQRPWKPVAV-----CEECNCNRKSNECSYNQTVATLQLSVNKMGRMEGGGVCINCQENTEGINCEKCIKGFYRPWNVLATELYPCTPCQCHGLGTIGSCVSNGEDIGDQKPGDCICKKGYEGVNCDLCSIGYERYPNGECLPCPCSIDGSVRTSFYRCKPPCNCKVHVNSDDLCKTCKNGYFNLDSANPEGCEPCYCFGITNQCSSLSA 1687
            +   + + L+    +SQ   P  ++++          IT+++TCG   G P  EI+C L        L                  NP     H  C  C+  NE   HP      D +N WW SP +++GL++  VN+TIDL+Q + + Y+ ++M +SPRPG+W+LERS D G+ Y PW  FAE    C   F  +        +  P S  DD + C T  +  + L + E++I ++  R S  + ++    +  + L NF  A  +R R L   TL   LM    + + ++  RY+Y+++ I IGG+C+CN HA  CD +         C C+HNTCG  CE CCP F Q+ W+         CE CNC  +SNEC Y+  V   + S++  G  EGGGVC NC+ENTEG+NC KC  G++RP  V   E  PC  C C      G+C         ++ G C C   + G +CD C+ GY   P  +C PC C+++G++          C CK        C+TC +GY N+ +    GC  C C    ++  + SA
Sbjct:   12 KALFLIVTLLAQFTYSQVLTPSQITIS------HRKPITATSTCGEIQGQPVTEIYCSLTGSTQYTPLNSYSYQDDEQQKSWSQYENPMVRGGHG-CGHCNAGNENS-HPAA-NMVDGNNSWWMSPPLSRGLQHNEVNITIDLEQEFHVAYVWIQMANSPRPGSWVLERSTDHGKTYQPWFNFAENAAECMRRFGME--------SLSPIS-EDDSVTCRTDMASLQPLENAEMVIRILEHRPS--SRQF----ATSEALQNFTRATNVRLRLLGTRTLQGHLMDMNEWRDPTVTRRYFYAIKEIMIGGRCVCNGHAVTCDILEPQRPKSLLCRCEHNTCGDMCERCCPGFVQKQWQAATAHNNFTCEACNCFGRSNECEYDAEVDLNKQSIDSQGNYEGGGVCKNCRENTEGVNCNKCSFGYFRPEGVTWNEPQPCKVCDCDPDKHTGACA--------EETGKCECLPRFVGEDCDQCASGYYDAP--KCKPCECNVNGTIGDVCLPEDGQCPCKAGFGG-TFCETCADGYTNVTA----GCVECVCDATGSEHGNCSA 533          

HSP 2 Score: 285.419 bits (729), Expect = 2.771e-76
Identity = 225/745 (30.20%), Postives = 324/745 (43.49%), Query Frame = 2
Query: 1010 AKCNCKHNTCGSNCETCCPLFNQRPWKPVAVCEECNCNRKSNECSYNQTVATLQLSVNKMGRMEGGGVCINCQENTEGINCEKCIKGF--YRPWNVLATELYPCTPCQCHGLGTIGSCVSNGEDIGDQKPGDCICKKGYEGVNCDLCSIGYERYPNGECLPCPCSIDGSVRTSFYRCKPPCNCKVHVNSDDLCKTCKNGYFNLDSANPEGCEPCYCFGITNQC-SSLSAKNLKISDLKGWKLTTFTGEKIALPKFTSFQYLTSENSYIDERFNNPTVYYWTAPPPYLGNWITSYGTIFRYVVKIELQSTLKGSLIDSPDVIIKCGDFRLFHSVSIEDRRLQRQVFIYIKPTEWKIGKLTPD-KAATKEEFISCLVKVDKLLIKAKYYSNQKSIELLNITLSRGEVHL--ALDEMPHIEKCNCPPGFNGLSCESCESGYRRVNNVLYQGQCEACACYNHSNTCDSLNGECQNCTHNTAGAHCEDCASGYYGDAKSKNLNSCKKCPCPRLDYQMTELCSSYSSENYVCH-KCLHNTSGVHCDRCIEGYYGNPK-KKISCKRCKCNNN-----QESCDPVTGECR-CSYNTMGTECQLCKHGFYGDALT-KSCKKCDCDSLGSTSENCDKLTGKCDCRTNFVNRQCDSCTSGL--YLKDKKCIPCNCEIQGRISSEKFCNTTSGQCFCLENVNGDRCEKCVEGYFNYP--NCKKCLCSPH-ALSADCDLNNGKCKCGSNVINRICDKC 3184
             +C CK    G  CE C P +   P      C +C CN    +C                   E  G C  C  + EG  C++C+     Y P       L  C  C CH  G+ G     G  + D + G C+C++   G  CD C  G+  +P+  C  C C+  G+           C CK +V     C+ CK G F+L + NP GC  C+CFG+T+ C SS+    +   D+  +  T   G  +   K  +  Y + E S        P   Y+  P     ++ TSYG    + +    +   K    D+ DV +   +  + +  S +    + Q  +  K        LT + K  T+EE +  L  +  + +KA Y+ + K+  L    L   E +   ++ +   +E+C CP  + G SC+ C SGY RV +  + G C  C C  HS TCD   G C +C HNT G HCE C  G+YG+A + +   C  C CP             S E  +    C    +G  CDRC  G++G+P+    SC  C+CN N       SC P +G+C  C  NT G  C+ C   FYGDA+T K+C  C+C   G  S+ CD  +G C+C+ N     CD C      + K + C  C+C   G  +    CN  +GQC C     G RCE C  GY+NY    C KC C    ++   CD+  G+C C        CD+C
Sbjct: 1432 GQCKCKPGVIGRRCERCAPGYYNFPE-----CIKCQCN-AGQQCD------------------ERTGQCF-CPPHVEGQTCDRCVSNAFGYDP-------LIGCQKCGCHPQGSEG-----GNLVCDPESGQCLCRESMGGRQCDRCLAGFYGFPH--CYGCSCNRAGTTEEICDATNAQCKCKENVYGG-RCEACKAGTFDLSAENPLGCVNCFCFGVTDSCRSSMYPVTIMSVDMSSFLTTDDNG--MVDNKDDTVIYTSEETS--------PNSVYFNVPIEK-KDYTTSYGLKLTFKLSTVPRGGRKSMNADA-DVRLTGANMTIEYWASEQPTNPEEQFTVKCKLVPENF--LTAEGKTVTREELMKVLHSLQNITLKASYFDHPKTSTLYEFGLEISEPNGVDSVIKASSVEQCQCPAPYTGPSCQLCASGYHRVQSGSFLGACVPCECNGHSATCDPDTGICTDCEHNTNGDHCEFCNEGHYGNATNGSPYDCMACACPFAPTNNFAKSCDVSEEGQLLQCNCKPGYTGDRCDRCASGFFGHPQISGESCSPCQCNGNNNLTDSRSCHPNSGDCYLCEQNTDGRHCESCAAWFYGDAVTAKNCSSCECSQCG--SQYCDNKSGGCECKINVEGDSCDRCKPDHWGFSKCQGCQGCHC---GTAAFNTQCNVENGQCTCRPGATGMRCEHCEHGYWNYGEHGCDKCDCEADLSMGTVCDVRTGQCHCQEGATGSRCDQC 2117          

HSP 3 Score: 241.891 bits (616), Expect = 4.150e-63
Identity = 167/515 (32.43%), Postives = 237/515 (46.02%), Query Frame = 2
Query: 2339 CEACACYNHSNTCD-----SLN-------------GECQNCTHNTAGAHCEDCASGYYGDAKSKNLNSCKKCPCPRLDYQMTELCSSYSSENYVCHKCLHNTSGVHCDRCIEGYYGNPKKKISCKRCKCNNNQ---ESCDPVTGECRCSYNTMGTECQLCKHGFYGDALTKSCKKCDCDSLGSTSENCDKLTGKCDCRTNFVNRQCDSCTSGLYLKDKKCIPCNCEIQGRISSEKFCNTTSGQCFCLENVNGDRCEKCVEGYFNYPNCKKCLCSPHAL-SADCDLNNGKCKCGSNVINRICDKCENLHYWNNRTDCVPCNCG-RGSLNPKCDMETGNCKCAQNVARRDCSKCDVGYFGL---------------DVTGCKKCPPCYNGQVCNNEGICVCPPNTIGNLCNKCSEDSWD--FNETIGCKKCNCYINGSYS--NICNKISGICACKTAFFGSKCDRCNEGYYGFPN-----CQPCSCAENGTKSNELTKCDKITGQCQCKQNVIGTKC 3742
            CEAC C+  SN C+      LN             G C+NC  NT G +C  C+ GY+   + + +   +  PC   D    +   + + E   C +CL    G  CD+C  GYY  PK    CK C+CN N    + C P  G+C C     GT C+ C  G+    +T  C +C CD+ GS   NC   TG+C+C+  +    CD C  G +  D  C  CNC+  G  +    C+ T+GQC C E   GD+C++C   ++ YPNCK C C    + S +CD  +G+C C  N   R CDKC    Y  N  DC  C C   G+    CD   G C C  N     C +C   ++                 D  GC K  P   G++C+      C  +  G +C++C    WD  ++   GC+ C+C +NG+ S  N C+  +G C CK    G +CD+C +G+Y   +     C+ C C   G    E   CD  +GQC+C+  V G +C
Sbjct:  354 CEACNCFGRSNECEYDAEVDLNKQSIDSQGNYEGGGVCKNCRENTEGVNCNKCSFGYF---RPEGVTWNEPQPCKVCDCDPDKHTGACAEETGKC-ECLPRFVGEDCDQCASGYYDAPK----CKPCECNVNGTIGDVCLPEDGQCPCKAGFGGTFCETCADGYTN--VTAGCVECVCDATGSEHGNCSASTGQCECKPAYAGLSCDKCQVGYFGDD--CKFCNCDPMG--TEGGVCDQTTGQCLCKEGFAGDKCDRCDIAFYGYPNCKACACDGAGITSPECDATSGQCPCNGNFTGRTCDKCAAGFY--NYPDCRGCECLLSGAKGQTCD-SNGQCYCKGNFEGERCDRCKPNFYNFPICEECNCNPSGVTRDFQGCDKVSP---GELCS------CRKHVTGRICDQCKPTFWDLQYHHEDGCRSCDCNVNGTISGLNTCDLKTGQCMCKKNADGRRCDQCADGFYRLNSYNQMGCESCHCDIGGALRAE---CDITSGQCKCRPRVTGLRC 839          

HSP 4 Score: 240.736 bits (613), Expect = 9.854e-63
Identity = 188/633 (29.70%), Postives = 283/633 (44.71%), Query Frame = 2
Query: 3221 VPCNC-GRGSLNPKCDMETGNCKCAQNVARRDCSKCDVGYFGLDVTGCKKCPPCYNGQVCNNE-GICVCPPNTIGNLCNKCSEDSWDFNETIGCKKCNCYINGSYSN--ICNKISGICACKTAFFGSKCDRCNEGYYGFPNCQPCSCAENGTKSNELTKCDKITGQCQCKQNVIGTKCKVCRKGTFPSDGTYEGGCFSCFCFGVSEKCHAILNHRIVENSIYEYHIFDEKNSLESGKDYSTIHLN-ANYPRRFGWPLTMFRPIYVNVMKLFNSHDLSLFYRSIFMNVSVDCLDNKCGREIPEQTEVFMESYNGLFGMRYXXXXXXXXXXXXXXDFNEHSKNGKWVISQYQNDILDKFIILEDSNVINSNLTRDIFMMALLNVTSLKVKLYTDKVNPPLIKIKIITYKVMETTQAIGKRVTAVEKCICNALTFGNHCQNPISGYYKEYFNLPNSTKSGSMRTGNRILINLKKCNCNGYSKVCDSVTGDCQNCMGNREGNKCQLCREGFYKNDKN---YDQCEPCQCPSAHY-NFAQNCTRIESSLELKCQCRIGYSGKSCENCQQGFYGNP-IKGIPCKSCDCNQQG----SQSLNCNEFGICQCSPGVLGIKCDQCAPNY---VVEKKTCQSC 5068
            + C+C  +GS + +C+   G CKC   V  R C +C  GY+  +   C KC  C  GQ C+   G C CPP+  G  C++C  +++ ++  IGC+KC C+  GS     +C+  SG C C+ +  G +CDRC  G+YGFP+C  CSC   GT + E+  CD    QC+CK+NV G +C+ C+ GTF        GC +CFCFGV++ C + +    + +      +  + N +   KD + I+ +    P    + + + +  Y     L  +  LS   R    +++ D              +V +   N    + Y                +E   N +   +     + + F+  E   V    L +   + +L N+T LK   +       L +  +   +       I  + ++VE+C C A   G  CQ   SGY++         +SGS       L     C CNG+S  CD  TG C +C  N  G+ C+ C EG Y N  N   YD C  C CP A   NFA++C   E    L+C C+ GY+G  C+ C  GF+G+P I G  C  C CN       S+S + N      C     G  C+ CA  +    V  K C SC
Sbjct: 1413 LSCDCVAQGSESFQCEQYGGQCKCKPGVIGRRCERCAPGYY--NFPECIKCQ-CNAGQQCDERTGQCFCPPHVEGQTCDRCVSNAFGYDPLIGCQKCGCHPQGSEGGNLVCDPESGQCLCRESMGGRQCDRCLAGFYGFPHCYGCSCNRAGT-TEEI--CDATNAQCKCKENVYGGRCEACKAGTFDLSAENPLGCVNCFCFGVTDSCRSSMYPVTIMSVDMSSFLTTDDNGMVDNKDDTVIYTSEETSPNSVYFNVPIEKKDYTTSYGLKLTFKLSTVPRGGRKSMNAD-------------ADVRLTGAN--MTIEYWA--------------SEQPTNPEEQFTVKCKLVPENFLTAEGKTVTREELMK--VLHSLQNIT-LKASYFDHPKTSTLYEFGLEISEPNGVDSVI--KASSVEQCQCPAPYTGPSCQLCASGYHR--------VQSGSF------LGACVPCECNGHSATCDPDTGICTDCEHNTNGDHCEFCNEGHYGNATNGSPYD-CMACACPFAPTNNFAKSCDVSEEGQLLQCNCKPGYTGDRCDRCASGFFGHPQISGESCSPCQCNGNNNLTDSRSCHPNSGDCYLCEQNTDGRHCESCAAWFYGDAVTAKNCSSC 1990          

HSP 5 Score: 221.09 bits (562), Expect = 9.058e-57
Identity = 168/528 (31.82%), Postives = 243/528 (46.02%), Query Frame = 2
Query: 2348 CACYNHSNTCDSLNGE------CQNCTHNTAGAHCEDCASGY----YGDAKSKNLNSCKKCPC----------PRLDYQMTELCSSYSSENY-VCHKCLHNTSGVHCDRCIEGYYGNPK-----KKISCKRCKCNNNQE--SCDPVTGECRCSYNTMGTECQLCKHGFYGDALTKSCKKCDCDSLGSTSENCDKLTGKCDCRTNFVNRQCDSCTSGLYLKDKKCIPCNCEIQGRISSEKFCNTTSGQCFCLENVNGDRCEKCVEGYFNYPNCKKCLCSPHALSAD-CDLNNGKCKCGSNVINRICDKCENLHYWNNRTDCVPCNC-GRGSLNPKCDMETGNCKCAQNVARRDCSKCDVGYFGL-DVTGCKKCPPCYNGQVCNNEGICVCPPNTIGNLCNKCSEDSWDFNETIGCKKCNCYINGSYSNI--CNKISG--ICACKTAFFGSKCDRCNEGYYGFP-----NCQPCSCAENGTKSNELTKCDKITGQCQCKQNVIGTKCKVCRKGTFPSDGTYEGGCFSCFC 3811
            C C  H+ TCD L  +      C+ C HNT G  CE C  G+    +  A + N  +C+ C C            +D     + S  + E   VC  C  NT GV+C++C  GY+  P+     +   CK C C+ ++   +C   TG+C C    +G +C  C  G+Y DA    CK C+C+  G+  + C    G+C C+  F    C++C  G       C+ C C+  G  S    C+ ++GQC C     G  C+KC  GYF   +CK C C P       CD   G+C C        CD+C+   Y     +C  C C G G  +P+CD  +G C C  N   R C KC  G++   D  GC+       GQ C++ G C C  N  G  C++C  + ++F     C++CNC  +G   +   C+K+S   +C+C+    G  CD+C   ++         C+ C C  NGT S  L  CD  TGQC CK+N  G +C  C  G +  +   + GC SC C
Sbjct:  298 CVCNGHAVTCDILEPQRPKSLLCR-CEHNTCGDMCERCCPGFVQKQWQAATAHNNFTCEACNCFGRSNECEYDAEVDLNKQSIDSQGNYEGGGVCKNCRENTEGVNCNKCSFGYF-RPEGVTWNEPQPCKVCDCDPDKHTGACAEETGKCECLPRFVGEDCDQCASGYY-DA--PKCKPCECNVNGTIGDVCLPEDGQCPCKAGFGGTFCETCADGYTNVTAGCVECVCDATG--SEHGNCSASTGQCECKPAYAGLSCDKCQVGYFG-DDCKFCNCDPMGTEGGVCDQTTGQCLCKEGFAGDKCDRCDIAFY--GYPNCKACACDGAGITSPECDATSGQCPCNGNFTGRTCDKCAAGFYNYPDCRGCECLLSGAKGQTCDSNGQCYCKGNFEGERCDRCKPNFYNFPI---CEECNCNPSGVTRDFQGCDKVSPGELCSCRKHVTGRICDQCKPTFWDLQYHHEDGCRSCDCNVNGTISG-LNTCDLKTGQCMCKKNADGRRCDQCADGFYRLNSYNQMGCESCHC 811          

HSP 6 Score: 180.259 bits (456), Expect = 1.973e-44
Identity = 138/434 (31.80%), Postives = 205/434 (47.24%), Query Frame = 2
Query: 2246 KCNCPPGFNGLSCESCESGYRRVNNVLYQGQCEACACYNHS---NTCDSLNGECQNCTHNTAGAHCEDCASGYYGDAKSKNLNSCKKCPCPRLDYQMTELCSSYSSENYVCHKCLHNTSGVHCDRCIEGYYGNPKKKISCKRCKCN---NNQESCDPVTGECRCSYNTMGTECQLCKHGFYGDALTKSCKKCDCDSLGSTSENCDKLTGKCDCRTNFVNRQCDSCTSGLYLKDKKCIPCNCEIQGRISSEKFCNTTSGQCFCLENVNGDRCEKCVEGYFNYPNCKKCLCSPHALSAD---CD-LNNGK-CKCGSNVINRICDKCENLHY---WNNRTDCVPCNC---GRGSLNPKCDMETGNCKCAQNVARRDCSKCDVGYFGLDV---TGCKKCPPCYNGQVCNNE-----GICVCPPNTIGNLCNKCSEDSW 3472
            KC C P F G  C+ C SGY          +C+ C C  +    + C   +G+C  C     G  CE CA GY     +     C +C C     +    CS+ + +   C +C    +G+ CD+C  GY+G+      CK C C+        CD  TG+C C     G +C  C   FYG     +CK C CD  G TS  CD  +G+C C  NF  R CD C +G Y     C  C C + G  +  + C+ ++GQC+C  N  G+RC++C   ++N+P C++C C+P  ++ D   CD ++ G+ C C  +V  RICD+C+   +   +++   C  C+C   G  S    CD++TG C C +N   R C +C  G++ L+     GC+ C  C  G     E     G C C P   G  C++  E+ +
Sbjct:  444 KCECLPRFVGEDCDQCASGYYDAP------KCKPCECNVNGTIGDVCLPEDGQCP-CKAGFGGTFCETCADGY-----TNVTAGCVECVCDATGSEHGN-CSASTGQ---C-ECKPAYAGLSCDKCQVGYFGD-----DCKFCNCDPMGTEGGVCDQTTGQCLCKEGFAGDKCDRCDIAFYG---YPNCKACACDGAGITSPECDATSGQCPCNGNFTGRTCDKCAAGFY-NYPDCRGCECLLSG--AKGQTCD-SNGQCYCKGNFEGERCDRCKPNFYNFPICEECNCNPSGVTRDFQGCDKVSPGELCSCRKHVTGRICDQCKPTFWDLQYHHEDGCRSCDCNVNGTISGLNTCDLKTGQCMCKKNADGRRCDQCADGFYRLNSYNQMGCESC-HCDIGGALRAECDITSGQCKCRPRVTGLRCDQPIENHY 847          

HSP 7 Score: 163.696 bits (413), Expect = 1.821e-39
Identity = 129/418 (30.86%), Postives = 186/418 (44.50%), Query Frame = 2
Query: 2624 YYGNPKKKISCKRCKCNNNQESCD------PVTGECRCSYNTMGTECQLCKHGFYG---DALTK----SCKKCDCDSLGSTSE-------NCDKLT----------GKC-DCRTNFVNRQCDSCTSGLYLKD-------KKCIPCNCEIQGRISSEKFCNTTSGQCFCLENVNGDRCEKCVEGYFNYPNCKKCLCSPHALSAD-CDLNNGKCKCGSNVINRICDKCENLHYWNNRTDCVPCNC-GRGSLNPKCDMETGNCKCAQNVARRDCSKCDVGYFGLDVTGCKKCPPCYNGQVCN-NEGICVCPPNTIGNLCNKCSEDSWDFNETIGCKKCNCYINGSYSNICNKISGICACKTAFFGSKCDRCNEGYYGFPNCQPCSCAENGTKSNELTKCDKITGQCQCKQNVIGTKCKVCR 3754
            Y+   K+ +   RC CN +  +CD      P +  CRC +NT G  C+ C  GF      A T     +C+ C+C   G ++E       + +K +          G C +CR N     C+ C+ G +  +       + C  C+C+      +   C   +G+C CL    G+ C++C  GY++ P CK C C+ +    D C   +G+C C +      C+ C +  Y N    CV C C   GS +  C   TG C+C    A   C KC VGYFG D   C   P    G VC+   G C+C     G+ C++C    + +     CK C C   G  S  C+  SG C C   F G  CD+C  G+Y +P+C+ C C  +G K      CD   GQC CK N  G +C  C+
Sbjct:  285 YFYAIKEIMIGGRCVCNGHAVTCDILEPQRPKSLLCRCEHNTCGDMCERCCPGFVQKQWQAATAHNNFTCEACNC--FGRSNECEYDAEVDLNKQSIDSQGNYEGGGVCKNCRENTEGVNCNKCSFGYFRPEGVTWNEPQPCKVCDCDPDKHTGA---CAEETGKCECLPRFVGEDCDQCASGYYDAPKCKPCECNVNGTIGDVCLPEDGQCPCKAGFGGTFCETCAD-GYTNVTAGCVECVCDATGSEHGNCSASTGQCECKPAYAGLSCDKCQVGYFGDDCKFCNCDPMGTEGGVCDQTTGQCLCKEGFAGDKCDRCDIAFYGYPN---CKACACDGAGITSPECDATSGQCPCNGNFTGRTCDKCAAGFYNYPDCRGCECLLSGAKGQ---TCDS-NGQCYCKGNFEGERCDRCK 689          

HSP 8 Score: 148.288 bits (373), Expect = 8.436e-35
Identity = 118/387 (30.49%), Postives = 169/387 (43.67%), Query Frame = 2
Query: 2231 MPHIEKCNCPPGFNGLSCESCESGYRRVNNVLYQGQCEACACYNHSNTCDSLNGECQNCTHNTAGAHCEDCASGYYGDAKSKNLNSCKKCPCPRLDYQMTELCSSYSSENYVCHK------CLHNTSGVHCDRCIEGYYGNPKKKISCKRCKCNN---NQESCDPVTGECRCSYNTMGTECQLCKHGFYGDALTKSCKKCDCDSLGSTSENCDKLTGKCDCRTNFVNRQCDSCTSGLYLKDKKCIPCNCEIQGRISSEKFCNTTS-GQ-CFCLENVNGDRCEKCVEGYFNYP-----NCKKCLCSPHALSAD---CDLNNGKCKCGSNVINRICDKCENLHYW---NNRTDCVPCNCG-RGSLNPKCDMETGNCKCAQNVARRDCSK 3322
            +P   +C C  GF G  CE+C  GY  V     +  C+A     H N C +  G+C+ C    AG  C+ C  GY+GD        CK C C  +            +E  VC +      C    +G  CDRC   +YG P    +CK C C+        CD  +G+C C+ N  G  C  C  GFY       C+ C+C   G+  + CD   G+C C+ NF   +CD C    Y     C  CNC   G     + C+  S G+ C C ++V G  C++C   +++        C+ C C+ +   +    CDL  G+C C  N   R CD+C +  Y     N+  C  C+C   G+L  +CD+ +G CKC   V    C +
Sbjct:  485 LPEDGQCPCKAGFGGTFCETCADGYTNVTAGCVECVCDATGS-EHGN-CSASTGQCE-CKPAYAGLSCDKCQVGYFGD-------DCKFCNCDPM-----------GTEGGVCDQTTGQCLCKEGFAGDKCDRCDIAFYGYP----NCKACACDGAGITSPECDATSGQCPCNGNFTGRTCDKCAAGFYN---YPDCRGCECLLSGAKGQTCDS-NGQCYCKGNFEGERCDRCKPNFY-NFPICEECNCNPSGVTRDFQGCDKVSPGELCSCRKHVTGRICDQCKPTFWDLQYHHEDGCRSCDCNVNGTISGLNTCDLKTGQCMCKKNADGRRCDQCADGFYRLNSYNQMGCESCHCDIGGALRAECDITSGQCKCRPRVTGLRCDQ 841          

HSP 9 Score: 145.206 bits (365), Expect = 8.466e-34
Identity = 102/338 (30.18%), Postives = 155/338 (45.86%), Query Frame = 2
Query: 2573 KCLHNTSGVHCDRCIEGYYGNPKKKI--SCKRCKCNNNQESCDPVTGECR-CSYNTMGTECQLCKHGFYGDALTKS---CKKCDCDSLGST--SENCDKLTG----KCDCRTNFVNRQCDSCTSGLY----LKDKKCIPCNCEIQGRISSEKFCNTTSGQCF-CLENVNGDRCEKCVEGYFN----YPNCKKCLCSPHALSADCDLNNGKCKCGSNVINRICDKCENLHYWNNR-TDCVPCNCGRGSLNPKCDMETGNCKCAQNVARRDCSKCDVGYFGLDVTGCKKC---PPCYNGQVCN-NEGICVCPPNTIGNLCNKCSEDSWDFNETIGCKKCN 3508
            +C    +G  C  C  GY+         +C  C+CN +  +CDP TG C  C +NT G  C+ C  G YG+A   S   C  C C    +   +++CD        +C+C+  +   +CD C SG +    +  + C PC C     ++  + C+  SG C+ C +N +G  CE C   ++       NC  C CS    S  CD  +G C+C  NV    CD+C+  H+  ++   C  C+CG  + N +C++E G C C        C  C+ GY+     GC KC        G VC+   G C C     G+ C++C   S+    T GC++C+
Sbjct: 1798 QCPAPYTGPSCQLCASGYHRVQSGSFLGACVPCECNGHSATCDPDTGICTDCEHNTNGDHCEFCNEGHYGNATNGSPYDCMACACPFAPTNNFAKSCDVSEEGQLLQCNCKPGYTGDRCDRCASGFFGHPQISGESCSPCQCNGNNNLTDSRSCHPNSGDCYLCEQNTDGRHCESCAAWFYGDAVTAKNCSSCECS-QCGSQYCDNKSGGCECKINVEGDSCDRCKPDHWGFSKCQGCQGCHCGTAAFNTQCNVENGQCTCRPGATGMRCEHCEHGYWNYGEHGCDKCDCEADLSMGTVCDVRTGQCHCQEGATGSRCDQCLP-SYLRIPTYGCRRCD 2133          

HSP 10 Score: 136.732 bits (343), Expect = 2.828e-31
Identity = 108/369 (29.27%), Postives = 154/369 (41.73%), Query Frame = 2
Query: 2708 ECRCSYNTMGTECQLCKHGFY---GDALTKSCKKCDCDSLGSTSENCDKLTGKC-DCRTNFVNRQCDSCTSGLYLKDK-----KCIPCNCEIQGRISSEKFCNTTSG----QCFCLENVNGDRCEKCVEGYFNYPNCKKCLCSPHALSADCDLNNGKCKCGSNVINRICDKCENLHYWNNRTDCVPCNCGRGSLNPKCDMETGNCK-CAQNVARRDCSKCDVGYFGLDVTGCKKCPPCY----NGQVCNNE-GICVCPPNTIGNLCNKCSEDSWDFNETIGCKKCNCYINGSYSNICNKISGICACKTAFFGSKCDRCNEGY--YGFPNCQPCSCAENGTKSNELTKCDKITGQCQCKQNVIGTKCKVC 3751
            +C+C     G  CQLC  G++     +   +C  C+C+   +T   CD  TG C DC  N     C+ C  G Y          C+ C C      +  K C+ +      QC C     GDRC++C  G+F +P      CSP             C+C  N               NN TD           +  C   +G+C  C QN   R C  C   ++G  VT  K C  C       Q C+N+ G C C  N  G+ C++C  D W F++  GC+ C+C    +++  CN  +G C C+    G +C+ C  GY  YG   C  C C  + +     T CD  TGQC C++   G++C  C
Sbjct: 1796 QCQCPAPYTGPSCQLCASGYHRVQSGSFLGACVPCECNGHSAT---CDPDTGICTDCEHNTNGDHCEFCNEGHYGNATNGSPYDCMACACPFAPTNNFAKSCDVSEEGQLLQCNCKPGYTGDRCDRCASGFFGHPQISGESCSP-------------CQCNGN---------------NNLTD-----------SRSCHPNSGDCYLCEQNTDGRHCESCAAWFYGDAVTA-KNCSSCECSQCGSQYCDNKSGGCECKINVEGDSCDRCKPDHWGFSKCQGCQGCHCG-TAAFNTQCNVENGQCTCRPGATGMRCEHCEHGYWNYGEHGCDKCDCEADLSMG---TVCDVRTGQCHCQEGATGSRCDQC 2117          

HSP 11 Score: 103.605 bits (257), Expect = 3.065e-21
Identity = 92/299 (30.77%), Postives = 123/299 (41.14%), Query Frame = 2
Query: 3002 QCFCLENVNGDRCEKCVEGYFNYPN------CKKCLCSPHALSADCDLNNGKC-KCGSNVINRICDKCENLHYWNNRT----DCVPCNCGRGSLN---PKCDM-ETGN---CKCAQNVARRDCSKCDVGYFGLDVTGCKKCPPCY--------NGQVCN-NEGIC-VCPPNTIGNLCNKCSEDSWDFNETIGCKKCN-CYINGSYSNICNKISGICACKTAFFGSKCDRCNEGYYGFPNCQPCSCAENGTKSNELTKCDKITGQCQCKQNVIGTKCKVCRKGTFPSDGTYEGGCFSCFC 3811
            QC C     G  C+ C  GY    +      C  C C+ H  SA CD + G C  C  N     C+ C   HY N       DC+ C C     N     CD+ E G    C C        C +C  G+FG      + C PC         + + C+ N G C +C  NT G  C  C+  +W + + +  K C+ C  +   S  C+  SG C CK    G  CDRC   ++GF  CQ C     GT +   T+C+   GQC C+    G +C+ C  G +      E GC  C C
Sbjct: 1796 QCQCPAPYTGPSCQLCASGYHRVQSGSFLGACVPCECNGH--SATCDPDTGICTDCEHNTNGDHCEFCNEGHYGNATNGSPYDCMACACPFAPTNNFAKSCDVSEEGQLLQCNCKPGYTGDRCDRCASGFFGHPQISGESCSPCQCNGNNNLTDSRSCHPNSGDCYLCEQNTDGRHCESCA--AWFYGDAVTAKNCSSCECSQCGSQYCDNKSGGCECKINVEGDSCDRCKPDHWGFSKCQGCQGCHCGTAAFN-TQCNVENGQCTCRPGATGMRCEHCEHGYW---NYGEHGCDKCDC 2086          

HSP 12 Score: 100.523 bits (249), Expect = 2.665e-20
Identity = 163/813 (20.05%), Postives = 311/813 (38.25%), Query Frame = 2
Query: 4481 ICNALTFGNHCQNPISGYYKEYFNLPNSTKSGSMRTGNRILINLKKCNCNG-YSKVCDSVTGDCQNCMGNREGNKCQLCREGFYKNDKNYDQCEPCQCPSAHYNFAQNCTRIESSLELKCQCRIGYSGKSCENCQQGFYGNPIKGIPCKSCDCNQQGSQSLNCN-EFGICQCSPGVLGIKCDQCAPNYV-VEKKTCQSCYS------GCTKDLLVRIDTLNETVINFKWKTLPSTLDLR----LNKINISIQMSSELLNSINKFYKLKNEIKNFSIQFQ----KMKDDAKEKYGE-----------IEKLKTRYNKVLEDLRSTFTDINETISGHEQLGISNELIKNATAYLETIKNIYKEM--PNITLAASVLKDVLKYVDELNQIIKYTQSHIQSDQINNLKILKNKTIMADEINTNNKEYLNTMSTKKKEHELYIILINERMKDLQKIFRKMTKQRDNLRKKIQKLDA----ISKSFQDEKDLISINVREIEDLMKNLSSNHLVSKSLIIPDTLKKHVEQQLN---------KSSNLIKKLTKDFNFLHNAEQAKEAYSNITRDI----LAVDYAINQTKKELDFNRSNMNIDSLKKLLAEFNSNKSEIVENIKNIDKEHEKLLKQYKNCSYXXXXXXXXXXXXSSEIP-----------TGFYDVEILKRNLSXXXXXXXXXXXXFILPINQTILNLGTPNVKSGLDTRN---LEKLIKVVDNQYRDLVNESSFVENKIKDLRKSIKSLRERLQKARVMSELI----HGAAARSVE---PIRHVVRCVRHY-VTYYLPTSNAFSLEFYM 6712
            +C   T G HC++  + +Y +     N +                 C C+   S+ CD+ +G C+ C  N EG+ C  C+   +   K    C+ C C +A +N   N   +E+    +C CR G +G  CE+C+ G++     G  C  CDC    S    C+   G C C  G  G +CDQC P+Y+ +    C+ C        G   +L + ID L   + N    T+      R     N IN   +M ++  NS    +    +I   S Q Q    + K  ++                ++++  R  +  + +RS         S  + + +   L+K A   L T++    +            L+++ K + E  + +   +   ++ +       K    +A  +N+  +    + S   K + +  +L   ++++L        ++ +  + + QKL+     I+++ +D+++ ++  V  + +   +++     +K  +  D  +K V+ QL          +++ L +    + +    A +A  A+SN+T  +      +D A      E  F  S  N    K    E       + + +    KE EKL KQ +  +   +KL+   E + + IP               +VE LK  +     E     +       +      +      L  RN   L KL  V+ +++ +L   SS    K+  +   +  ++E +  AR  +  I    H     S++   P R V R   H  +++Y  T     +  + 
Sbjct: 1960 LCEQNTDGRHCESCAAWFYGDAVTAKNCSS----------------CECSQCGSQYCDNKSGGCE-CKINVEGDSCDRCKPDHWGFSK-CQGCQGCHCGTAAFNTQCN---VENG---QCTCRPGATGMRCEHCEHGYWNYGEHG--CDKCDCEADLSMGTVCDVRTGQCHCQEGATGSRCDQCLPSYLRIPTYGCRRCDECVHHLIGDVDNLELEIDVLGTAIANISSATIVGARLARNKKEFNDINEITKMLNDEENSFGNVFGDAQDILTNSTQIQNKLVRTKTHSQNSVSSAKNITLNGTEFLQEVMKRAQRARQSVRSLAEIALAIGSSSKAVNVDPRLLKEAEETLMTLEAASADQYPEKAQTVPGKLEEIQKKIQEETEKLDKQKETFEAQK-------KRAEELAAYLNSAQQLLKESKSKADKSNNIAKMLQLTKVENLVAAITDDLERVEAAKGEFQKLNVAIGNITENLKDKREEMTHAVTTLNETRNDVAEALEAAKKRVRRD--EKSVDMQLVNAKAHELHLQATTLRQTFDNNKDNTDQAVEAANAFSNLTDTLKNAKAQIDNAYEALSAEPAFAESVQNARD-KPFPDETKEKIDALSKTVSQDLKETEKLKKQLEQLTELSEKLRKRKEAVKAGIPKYSKNTLDSIDEKVQEVEKLKAEIDANIEETRAKISEIAGKAEEITEKANSAMEGIRLARRNSVQLNKLAPVIVSKFEELKKLSSARSAKVDSVSDKVSQIKEMIAVARDAANRIKLGAHFEKGSSLDLNIPQR-VTRSAAHADISFYFRTEQEHGIPLFF 2735          

HSP 13 Score: 70.0922 bits (170), Expect = 3.593e-11
Identity = 52/166 (31.33%), Postives = 72/166 (43.37%), Query Frame = 2
Query: 4613 KKCNCNGYSK---VCDSVTGDCQNCMGNREGNKCQLCREGFYKNDKNYDQCEPCQCPSAHYNFAQNCTRIESSLELKCQCRIGYSGKSCENCQQGFYGNPIKGIPCKSCDCNQQGSQSLNCNEFGICQCSPGVLGIKCDQCAPNYVVEKKTCQSC---YSGCTKDL 5092
            K CNC+       VCD  TG C  C     G+KC  C   FY     Y  C+ C C  A    +  C         +C C   ++G++C+ C  GFY  P     C+ C+C   G++   C+  G C C     G +CD+C PN+      C+ C    SG T+D 
Sbjct:  562 KFCNCDPMGTEGGVCDQTTGQCL-CKEGFAGDKCDRCDIAFY----GYPNCKACACDGAGIT-SPECDATSG----QCPCNGNFTGRTCDKCAAGFYNYP----DCRGCECLLSGAKGQTCDSNGQCYCKGNFEGERCDRCKPNF-YNFPICEECNCNPSGVTRDF 712          

HSP 14 Score: 67.0106 bits (162), Expect = 3.723e-10
Identity = 59/204 (28.92%), Postives = 87/204 (42.65%), Query Frame = 2
Query: 1004 SVAKCNCKHNTCGSNCETCCPLFNQRPWKPVAVCEECNCNRKSNECSYNQTVATLQLSVNKMGRMEGGGVCINCQENTEGINCEKCIKGFYRPWNVLATELYPCTPCQCHGLGTIGSCVSNGEDIGDQKPGDCICKKGYEGVNCDLCSIGYER---YPNGECLPCPCSIDGSVRTSFYRCKPPCNCKVHVNSDDLCKTCKNGYF 1606
            S  +C CK N  G  C+ C P F   P     +CEECNCN            + +        ++  G +C +C+++  G  C++C   F   W++       C  C C+  GTI     +G +  D K G C+CKK  +G  CD C+ G+ R   Y    C  C C I G++R         C C+  V      +  +N YF
Sbjct:  670 SNGQCYCKGNFEGERCDRCKPNFYNFP-----ICEECNCNP-----------SGVTRDFQGCDKVSPGELC-SCRKHVTGRICDQCKPTF---WDLQYHHEDGCRSCDCNVNGTI-----SGLNTCDLKTGQCMCKKNADGRRCDQCADGFYRLNSYNQMGCESCHCDIGGALRAECDITSGQCKCRPRVTGLRCDQPIENHYF 848          

HSP 15 Score: 65.4698 bits (158), Expect = 9.518e-10
Identity = 65/208 (31.25%), Postives = 91/208 (43.75%), Query Frame = 2
Query: 4475 KCICNALTFGNHCQNPISGYYKEYFNLPNSTKSGSMRTGNRILINLKKCNCNGYSKVCDSVTGDCQNCMGNREGNKCQLCREGFYKNDKNYDQCEPCQC-PSAHYNFAQNCTRIESSLELKCQCRIGYSGKSCENCQQGFYGNPIKGIP-CKSCDCNQQGSQS-LNCNEF--GICQCSPGVLGIKCDQCAPNYV----VEKKTCQSCY 5071
            +C CN    G  C    +G+Y    N P+      + +G +              + CDS  G C  C GN EG +C  C+  FY    N+  CE C C PS      Q C ++ S  EL C CR   +G+ C+ C+  F+         C+SCDCN  G+ S LN  +   G C C     G +CDQCA  +       +  C+SC+
Sbjct:  628 QCPCNGNFTGRTCDKCAAGFY----NYPDCRGCECLLSGAK-------------GQTCDS-NGQCY-CKGNFEGERCDRCKPNFY----NFPICEECNCNPSGVTRDFQGCDKV-SPGEL-CSCRKHVTGRICDQCKPTFWDLQYHHEDGCRSCDCNVNGTISGLNTCDLKTGQCMCKKNADGRRCDQCADGFYRLNSYNQMGCESCH 810          

HSP 16 Score: 65.0846 bits (157), Expect = 1.376e-9
Identity = 44/141 (31.21%), Postives = 64/141 (45.39%), Query Frame = 2
Query: 4619 CNCNGYSKVCDSVTGDCQNCMGNREGNKCQLCREGFYKNDKNYDQCEPCQCPSAHYNFAQNCTRIESSLELKCQCRIGYSGKSCENCQQGFYGNPIKGIPCKSCDCNQQGSQSLNCN-EFGICQCSPGVLGIKCDQCAPNY 5038
            C+ + ++  C   TG C+ C+    G  C  C  G+Y   K    C+PC+C     N       +    + +C C+ G+ G  CE C  G Y N   G  C  C C+  GS+  NC+   G C+C P   G+ CD+C   Y
Sbjct:  429 CDPDKHTGACAEETGKCE-CLPRFVGEDCDQCASGYYDAPK----CKPCEC-----NVNGTIGDVCLPEDGQCPCKAGFGGTFCETCADG-YTNVTAG--CVECVCDATGSEHGNCSASTGQCECKPAYAGLSCDKCQVGY 556          

HSP 17 Score: 59.3066 bits (142), Expect = 6.233e-8
Identity = 43/142 (30.28%), Postives = 61/142 (42.96%), Query Frame = 2
Query: 4661 GDCQNCMGNREGNKCQLCREGFYKNDK-NYDQCEPCQC----PSAHYNFAQNCTRIESSLELKCQCRIGYSGKSCENCQQGFYGNPIKGIPCKSCDCNQQGSQSLNC-NEFGICQCSPGVLGIKCDQCAPNYVVEKKTCQSC 5068
            G C+NC  N EG  C  C  G+++ +   +++ +PC+     P  H       T        KC+C   + G+ C+ C  G+Y  P     CK C+CN  G+    C  E G C C  G  G  C+ CA  Y      C  C
Sbjct:  389 GVCKNCRENTEGVNCNKCSFGYFRPEGVTWNEPQPCKVCDCDPDKHTGACAEETG-------KCECLPRFVGEDCDQCASGYYDAP----KCKPCECNVNGTIGDVCLPEDGQCPCKAGFGGTFCETCADGYTNVTAGCVEC 519          

HSP 18 Score: 58.9214 bits (141), Expect = 9.966e-8
Identity = 61/229 (26.64%), Postives = 86/229 (37.55%), Query Frame = 2
Query: 1010 AKCNCKHNTCGSNCETCCPLFNQRPWKPVAVCEECNCNRKSNECSYNQTVATLQLSVNKMGRMEGGGVCINCQENTEGINCEKCIKGFYRPWNVLATELYPCTPCQCHGLGTIGSCVSNGEDIGDQKPGDCICKKGYEGVNCDLCSIGYERYPNGECLPCPCSIDGSVRTSFYRCKPPCNCKVHVNSDDLCKTCKNGYFN----------LDSANPEGCEP---CYCFG 1657
             +C CK    G+ CETC   +        A C EC C+   +E   N + +T Q                 C+    G++C+KC  G++            C  C C  +GT G        + DQ  G C+CK+G+ G  CD C I +  YPN  C  C C   G            C C  +  +   C  C  G++N          L  A  + C+    CYC G
Sbjct:  489 GQCPCKAGFGGTFCETCADGYTNV----TAGCVECVCDATGSE-HGNCSASTGQCE---------------CKPAYAGLSCDKCQVGYFGD---------DCKFCNCDPMGTEGG-------VCDQTTGQCLCKEGFAGDKCDRCDIAFYGYPN--CKACACDGAGITSPECDATSGQCPCNGNF-TGRTCDKCAAGFYNYPDCRGCECLLSGAKGQTCDSNGQCYCKG 678          

HSP 19 Score: 58.151 bits (139), Expect = 1.541e-7
Identity = 44/139 (31.65%), Postives = 65/139 (46.76%), Query Frame = 2
Query: 4616 KCNCNG-YSKVCDSVTGDCQNCMGNREGNKCQLCREGFYKNDKNYDQCEPCQCPSAHYNFAQNCTRIESSLELKCQCRIGYSGKSCENCQQGFYGNPIKGIPCKSCDCNQQGSQSLNCNE-FGICQCSPGVLGIKCDQC 5026
            +CN NG    VC    G C  C     G  C+ C +G+         C  C C +       NC    S+   +C+C+  Y+G SC+ CQ G++G+      CK C+C+  G++   C++  G C C  G  G KCD+C
Sbjct:  473 ECNVNGTIGDVCLPEDGQCP-CKAGFGGTFCETCADGYTNVTAG---CVECVCDATGSEHG-NC----SASTGQCECKPAYAGLSCDKCQVGYFGD-----DCKFCNCDPMGTEGGVCDQTTGQCLCKEGFAGDKCDRC 597          

HSP 20 Score: 55.8398 bits (133), Expect = 7.573e-7
Identity = 68/261 (26.05%), Postives = 106/261 (40.61%), Query Frame = 2
Query:  914 YYSLRNIEIGGKCI---CNNHADKCDKVIENGISVAKCNCKHNTCGSNCETCCP-----LFNQRPWKPVA-VCEECNCNRKSNECSYNQTVATLQLSVNKMGRMEGGGVCINCQENTEGINCEKCIKGFYRPWNVLATELYPCTPCQCHG---LGTIGSCVSNGEDIGDQKPGDC-ICKKGYEGVNCDLCSIGY--ERYPNGECLPCPCSIDGSVRTSFYRCKPPCNCKVHVNSDDLCKTCKNGYFNLDSANPEGCEPCYC 1651
            Y+ +++    G C+   CN H+  CD   + GI     +C+HNT G +CE C         N  P+  +A  C     N  +  C  ++    LQ                NC+    G  C++C  GF+    +       C+PCQC+G   L    SC  N         GDC +C++  +G +C+ C+  +  +      C  C CS  GS           C CK++V  D  C  CK  ++       +GC+ C+C
Sbjct: 1815 YHRVQSGSFLGACVPCECNGHSATCDP--DTGICT---DCEHNTNGDHCEFCNEGHYGNATNGSPYDCMACACPFAPTNNFAKSCDVSEEGQLLQC---------------NCKPGYTGDRCDRCASGFFGHPQISGES---CSPCQCNGNNNLTDSRSCHPNS--------GDCYLCEQNTDGRHCESCAAWFYGDAVTAKNCSSCECSQCGSQYCD--NKSGGCECKINVEGDS-CDRCKPDHWGFSKC--QGCQGCHC 2039          

HSP 21 Score: 55.0694 bits (131), Expect = 1.396e-6
Identity = 44/151 (29.14%), Postives = 72/151 (47.68%), Query Frame = 2
Query: 4613 KKCNCN--GYSK---VCDSVT-GDCQNCMGNREGNKCQLCREGFYKNDKNY-DQCEPCQCPSAHYNFAQNCTRIESSLELKCQCRIGYSGKSCENCQQGFYG-NPIKGIPCKSCDCNQQGSQSLNCN-EFGICQCSPGVLGIKCDQCAPNY 5038
            ++CNCN  G ++    CD V+ G+  +C  +  G  C  C+  F+    ++ D C  C C         N   +++    +C C+    G+ C+ C  GFY  N    + C+SC C+  G+    C+   G C+C P V G++CDQ   N+
Sbjct:  699 EECNCNPSGVTRDFQGCDKVSPGELCSCRKHVTGRICDQCKPTFWDLQYHHEDGCRSCDCNVNGTISGLNTCDLKTG---QCMCKKNADGRRCDQCADGFYRLNSYNQMGCESCHCDIGGALRAECDITSGQCKCRPRVTGLRCDQPIENH 846          
BLAST of Laminin subunit alpha-2 vs. Ensembl Celegans
Match: epi-1 (Laminin-like protein epi-1 [Source:UniProtKB/Swiss-Prot;Acc:Q21313])

HSP 1 Score: 293.893 bits (751), Expect = 6.934e-79
Identity = 184/561 (32.80%), Postives = 273/561 (48.66%), Query Frame = 2
Query:   95 RIFIIFILLIVHKAHSQDDEPEILSVNVDGLLMENAKITSSATCG--TGGP--EIFCRLVDEIAIQRL-----------------INP---DSHVLCDVCDNRNETKRHPIEFAKSDDDNLWWQSPSMAQGLKYQNVNVTIDLKQVYQIVYILLKMGDSPRPGNWILERSLD-GEIYMPWIFFAETPYSCYNLFQRQYPDLKLTTNAKPSSLADDEMFCTTYYSQPKSLNSGEIIISLINGRKSIMNEEYLSIKSVPQTLINFLSARYIRFRFLKHLTLAADLMTHKGYLEQSIYNRYYYSLRNIEIGGKCICNNHADKCDKVIENGISVAKCNCKHNTCGSNCETCCPLFNQRPWKPVAV-----CEECNCNRKSNECSYNQTVATLQLSVNKMGRMEGGGVCINCQENTEGINCEKCIKGFYRPWNVLATELYPCTPCQCHGLGTIGSCVSNGEDIGDQKPGDCICKKGYEGVNCDLCSIGYERYPNGECLPCPCSIDGSVRTSFYRCKPPCNCKVHVNSDDLCKTCKNGYFNLDSANPEGCEPCYCFGITNQCSSLSA 1687
            +   + + L+    +SQ   P  ++++          IT+++TCG   G P  EI+C L        L                  NP     H  C  C+  NE   HP      D +N WW SP +++GL++  VN+TIDL+Q + + Y+ ++M +SPRPG+W+LERS D G+ Y PW  FAE    C   F  +        +  P S  DD + C T  +  + L + E++I ++  R S  + ++    +  + L NF  A  +R R L   TL   LM    + + ++  RY+Y+++ I IGG+C+CN HA  CD +         C C+HNTCG  CE CCP F Q+ W+         CE CNC  +SNEC Y+  V   + S++  G  EGGGVC NC+ENTEG+NC KC  G++RP  V   E  PC  C C      G+C         ++ G C C   + G +CD C+ GY   P  +C PC C+++G++          C CK        C+TC +GY N+ +    GC  C C    ++  + SA
Sbjct:   12 KALFLIVTLLAQFTYSQVLTPSQITIS------HRKPITATSTCGEIQGQPVTEIYCSLTGSTQYTPLNSYSYQDDEQQKSWSQYENPMVRGGHG-CGHCNAGNENS-HPAA-NMVDGNNSWWMSPPLSRGLQHNEVNITIDLEQEFHVAYVWIQMANSPRPGSWVLERSTDHGKTYQPWFNFAENAAECMRRFGME--------SLSPIS-EDDSVTCRTDMASLQPLENAEMVIRILEHRPS--SRQF----ATSEALQNFTRATNVRLRLLGTRTLQGHLMDMNEWRDPTVTRRYFYAIKEIMIGGRCVCNGHAVTCDILEPQRPKSLLCRCEHNTCGDMCERCCPGFVQKQWQAATAHNNFTCEACNCFGRSNECEYDAEVDLNKQSIDSQGNYEGGGVCKNCRENTEGVNCNKCSFGYFRPEGVTWNEPQPCKVCDCDPDKHTGACA--------EETGKCECLPRFVGEDCDQCASGYYDAP--KCKPCECNVNGTIGDVCLPEDGQCPCKAGFGG-TFCETCADGYTNVTA----GCVECVCDATGSEHGNCSA 533          

HSP 2 Score: 285.034 bits (728), Expect = 3.139e-76
Identity = 225/745 (30.20%), Postives = 324/745 (43.49%), Query Frame = 2
Query: 1010 AKCNCKHNTCGSNCETCCPLFNQRPWKPVAVCEECNCNRKSNECSYNQTVATLQLSVNKMGRMEGGGVCINCQENTEGINCEKCIKGF--YRPWNVLATELYPCTPCQCHGLGTIGSCVSNGEDIGDQKPGDCICKKGYEGVNCDLCSIGYERYPNGECLPCPCSIDGSVRTSFYRCKPPCNCKVHVNSDDLCKTCKNGYFNLDSANPEGCEPCYCFGITNQC-SSLSAKNLKISDLKGWKLTTFTGEKIALPKFTSFQYLTSENSYIDERFNNPTVYYWTAPPPYLGNWITSYGTIFRYVVKIELQSTLKGSLIDSPDVIIKCGDFRLFHSVSIEDRRLQRQVFIYIKPTEWKIGKLTPD-KAATKEEFISCLVKVDKLLIKAKYYSNQKSIELLNITLSRGEVHL--ALDEMPHIEKCNCPPGFNGLSCESCESGYRRVNNVLYQGQCEACACYNHSNTCDSLNGECQNCTHNTAGAHCEDCASGYYGDAKSKNLNSCKKCPCPRLDYQMTELCSSYSSENYVCH-KCLHNTSGVHCDRCIEGYYGNPK-KKISCKRCKCNNN-----QESCDPVTGECR-CSYNTMGTECQLCKHGFYGDALT-KSCKKCDCDSLGSTSENCDKLTGKCDCRTNFVNRQCDSCTSGL--YLKDKKCIPCNCEIQGRISSEKFCNTTSGQCFCLENVNGDRCEKCVEGYFNYP--NCKKCLCSPH-ALSADCDLNNGKCKCGSNVINRICDKC 3184
             +C CK    G  CE C P +   P      C +C CN    +C                   E  G C  C  + EG  C++C+     Y P       L  C  C CH  G+ G     G  + D + G C+C++   G  CD C  G+  +P+  C  C C+  G+           C CK +V     C+ CK G F+L + NP GC  C+CFG+T+ C SS+    +   D+  +  T   G  +   K  +  Y + E S        P   Y+  P     ++ TSYG    + +    +   K    D+ DV +   +  + +  S +    + Q  +  K        LT + K  T+EE +  L  +  + +KA Y+ + K+  L    L   E +   ++ +   +E+C CP  + G SC+ C SGY RV +  + G C  C C  HS TCD   G C +C HNT G HCE C  G+YG+A + +   C  C CP             S E  +    C    +G  CDRC  G++G+P+    SC  C+CN N       SC P +G+C  C  NT G  C+ C   FYGDA+T K+C  C+C   G  S+ CD  +G C+C+ N     CD C      + K + C  C+C   G  +    CN  +GQC C     G RCE C  GY+NY    C KC C    ++   CD+  G+C C        CD+C
Sbjct: 1423 GQCKCKPGVIGRRCERCAPGYYNFPE-----CIKCQCN-AGQQCD------------------ERTGQCF-CPPHVEGQTCDRCVSNAFGYDP-------LIGCQKCGCHPQGSEG-----GNLVCDPESGQCLCRESMGGRQCDRCLAGFYGFPH--CYGCSCNRAGTTEEICDATNAQCKCKENVYGG-RCEACKAGTFDLSAENPLGCVNCFCFGVTDSCRSSMYPVTIMSVDMSSFLTTDDNG--MVDNKDDTVIYTSEETS--------PNSVYFNVPIEK-KDYTTSYGLKLTFKLSTVPRGGRKSMNADA-DVRLTGANMTIEYWASEQPTNPEEQFTVKCKLVPENF--LTAEGKTVTREELMKVLHSLQNITLKASYFDHPKTSTLYEFGLEISEPNGVDSVIKASSVEQCQCPAPYTGPSCQLCASGYHRVQSGSFLGACVPCECNGHSATCDPDTGICTDCEHNTNGDHCEFCNEGHYGNATNGSPYDCMACACPFAPTNNFAKSCDVSEEGQLLQCNCKPGYTGDRCDRCASGFFGHPQISGESCSPCQCNGNNNLTDSRSCHPNSGDCYLCEQNTDGRHCESCAAWFYGDAVTAKNCSSCECSQCG--SQYCDNKSGGCECKINVEGDSCDRCKPDHWGFSKCQGCQGCHC---GTAAFNTQCNVENGQCTCRPGATGMRCEHCEHGYWNYGEHGCDKCDCEADLSMGTVCDVRTGQCHCQEGATGSRCDQC 2108          

HSP 3 Score: 241.891 bits (616), Expect = 4.471e-63
Identity = 167/515 (32.43%), Postives = 237/515 (46.02%), Query Frame = 2
Query: 2339 CEACACYNHSNTCD-----SLN-------------GECQNCTHNTAGAHCEDCASGYYGDAKSKNLNSCKKCPCPRLDYQMTELCSSYSSENYVCHKCLHNTSGVHCDRCIEGYYGNPKKKISCKRCKCNNNQ---ESCDPVTGECRCSYNTMGTECQLCKHGFYGDALTKSCKKCDCDSLGSTSENCDKLTGKCDCRTNFVNRQCDSCTSGLYLKDKKCIPCNCEIQGRISSEKFCNTTSGQCFCLENVNGDRCEKCVEGYFNYPNCKKCLCSPHAL-SADCDLNNGKCKCGSNVINRICDKCENLHYWNNRTDCVPCNCG-RGSLNPKCDMETGNCKCAQNVARRDCSKCDVGYFGL---------------DVTGCKKCPPCYNGQVCNNEGICVCPPNTIGNLCNKCSEDSWD--FNETIGCKKCNCYINGSYS--NICNKISGICACKTAFFGSKCDRCNEGYYGFPN-----CQPCSCAENGTKSNELTKCDKITGQCQCKQNVIGTKC 3742
            CEAC C+  SN C+      LN             G C+NC  NT G +C  C+ GY+   + + +   +  PC   D    +   + + E   C +CL    G  CD+C  GYY  PK    CK C+CN N    + C P  G+C C     GT C+ C  G+    +T  C +C CD+ GS   NC   TG+C+C+  +    CD C  G +  D  C  CNC+  G  +    C+ T+GQC C E   GD+C++C   ++ YPNCK C C    + S +CD  +G+C C  N   R CDKC    Y  N  DC  C C   G+    CD   G C C  N     C +C   ++                 D  GC K  P   G++C+      C  +  G +C++C    WD  ++   GC+ C+C +NG+ S  N C+  +G C CK    G +CD+C +G+Y   +     C+ C C   G    E   CD  +GQC+C+  V G +C
Sbjct:  354 CEACNCFGRSNECEYDAEVDLNKQSIDSQGNYEGGGVCKNCRENTEGVNCNKCSFGYF---RPEGVTWNEPQPCKVCDCDPDKHTGACAEETGKC-ECLPRFVGEDCDQCASGYYDAPK----CKPCECNVNGTIGDVCLPEDGQCPCKAGFGGTFCETCADGYTN--VTAGCVECVCDATGSEHGNCSASTGQCECKPAYAGLSCDKCQVGYFGDD--CKFCNCDPMG--TEGGVCDQTTGQCLCKEGFAGDKCDRCDIAFYGYPNCKACACDGAGITSPECDATSGQCPCNGNFTGRTCDKCAAGFY--NYPDCRGCECLLSGAKGQTCD-SNGQCYCKGNFEGERCDRCKPNFYNFPICEECNCNPSGVTRDFQGCDKVSP---GELCS------CRKHVTGRICDQCKPTFWDLQYHHEDGCRSCDCNVNGTISGLNTCDLKTGQCMCKKNADGRRCDQCADGFYRLNSYNQMGCESCHCDIGGALRAE---CDITSGQCKCRPRVTGLRC 839          

HSP 4 Score: 240.35 bits (612), Expect = 1.044e-62
Identity = 188/633 (29.70%), Postives = 283/633 (44.71%), Query Frame = 2
Query: 3221 VPCNC-GRGSLNPKCDMETGNCKCAQNVARRDCSKCDVGYFGLDVTGCKKCPPCYNGQVCNNE-GICVCPPNTIGNLCNKCSEDSWDFNETIGCKKCNCYINGSYSN--ICNKISGICACKTAFFGSKCDRCNEGYYGFPNCQPCSCAENGTKSNELTKCDKITGQCQCKQNVIGTKCKVCRKGTFPSDGTYEGGCFSCFCFGVSEKCHAILNHRIVENSIYEYHIFDEKNSLESGKDYSTIHLN-ANYPRRFGWPLTMFRPIYVNVMKLFNSHDLSLFYRSIFMNVSVDCLDNKCGREIPEQTEVFMESYNGLFGMRYXXXXXXXXXXXXXXDFNEHSKNGKWVISQYQNDILDKFIILEDSNVINSNLTRDIFMMALLNVTSLKVKLYTDKVNPPLIKIKIITYKVMETTQAIGKRVTAVEKCICNALTFGNHCQNPISGYYKEYFNLPNSTKSGSMRTGNRILINLKKCNCNGYSKVCDSVTGDCQNCMGNREGNKCQLCREGFYKNDKN---YDQCEPCQCPSAHY-NFAQNCTRIESSLELKCQCRIGYSGKSCENCQQGFYGNP-IKGIPCKSCDCNQQG----SQSLNCNEFGICQCSPGVLGIKCDQCAPNY---VVEKKTCQSC 5068
            + C+C  +GS + +C+   G CKC   V  R C +C  GY+  +   C KC  C  GQ C+   G C CPP+  G  C++C  +++ ++  IGC+KC C+  GS     +C+  SG C C+ +  G +CDRC  G+YGFP+C  CSC   GT + E+  CD    QC+CK+NV G +C+ C+ GTF        GC +CFCFGV++ C + +    + +      +  + N +   KD + I+ +    P    + + + +  Y     L  +  LS   R    +++ D              +V +   N    + Y                +E   N +   +     + + F+  E   V    L +   + +L N+T LK   +       L +  +   +       I  + ++VE+C C A   G  CQ   SGY++         +SGS       L     C CNG+S  CD  TG C +C  N  G+ C+ C EG Y N  N   YD C  C CP A   NFA++C   E    L+C C+ GY+G  C+ C  GF+G+P I G  C  C CN       S+S + N      C     G  C+ CA  +    V  K C SC
Sbjct: 1404 LSCDCVAQGSESFQCEQYGGQCKCKPGVIGRRCERCAPGYY--NFPECIKCQ-CNAGQQCDERTGQCFCPPHVEGQTCDRCVSNAFGYDPLIGCQKCGCHPQGSEGGNLVCDPESGQCLCRESMGGRQCDRCLAGFYGFPHCYGCSCNRAGT-TEEI--CDATNAQCKCKENVYGGRCEACKAGTFDLSAENPLGCVNCFCFGVTDSCRSSMYPVTIMSVDMSSFLTTDDNGMVDNKDDTVIYTSEETSPNSVYFNVPIEKKDYTTSYGLKLTFKLSTVPRGGRKSMNAD-------------ADVRLTGAN--MTIEYWA--------------SEQPTNPEEQFTVKCKLVPENFLTAEGKTVTREELMK--VLHSLQNIT-LKASYFDHPKTSTLYEFGLEISEPNGVDSVI--KASSVEQCQCPAPYTGPSCQLCASGYHR--------VQSGSF------LGACVPCECNGHSATCDPDTGICTDCEHNTNGDHCEFCNEGHYGNATNGSPYD-CMACACPFAPTNNFAKSCDVSEEGQLLQCNCKPGYTGDRCDRCASGFFGHPQISGESCSPCQCNGNNNLTDSRSCHPNSGDCYLCEQNTDGRHCESCAAWFYGDAVTAKNCSSC 1981          

HSP 5 Score: 220.705 bits (561), Expect = 9.596e-57
Identity = 168/528 (31.82%), Postives = 243/528 (46.02%), Query Frame = 2
Query: 2348 CACYNHSNTCDSLNGE------CQNCTHNTAGAHCEDCASGY----YGDAKSKNLNSCKKCPC----------PRLDYQMTELCSSYSSENY-VCHKCLHNTSGVHCDRCIEGYYGNPK-----KKISCKRCKCNNNQE--SCDPVTGECRCSYNTMGTECQLCKHGFYGDALTKSCKKCDCDSLGSTSENCDKLTGKCDCRTNFVNRQCDSCTSGLYLKDKKCIPCNCEIQGRISSEKFCNTTSGQCFCLENVNGDRCEKCVEGYFNYPNCKKCLCSPHALSAD-CDLNNGKCKCGSNVINRICDKCENLHYWNNRTDCVPCNC-GRGSLNPKCDMETGNCKCAQNVARRDCSKCDVGYFGL-DVTGCKKCPPCYNGQVCNNEGICVCPPNTIGNLCNKCSEDSWDFNETIGCKKCNCYINGSYSNI--CNKISG--ICACKTAFFGSKCDRCNEGYYGFP-----NCQPCSCAENGTKSNELTKCDKITGQCQCKQNVIGTKCKVCRKGTFPSDGTYEGGCFSCFC 3811
            C C  H+ TCD L  +      C+ C HNT G  CE C  G+    +  A + N  +C+ C C            +D     + S  + E   VC  C  NT GV+C++C  GY+  P+     +   CK C C+ ++   +C   TG+C C    +G +C  C  G+Y DA    CK C+C+  G+  + C    G+C C+  F    C++C  G       C+ C C+  G  S    C+ ++GQC C     G  C+KC  GYF   +CK C C P       CD   G+C C        CD+C+   Y     +C  C C G G  +P+CD  +G C C  N   R C KC  G++   D  GC+       GQ C++ G C C  N  G  C++C  + ++F     C++CNC  +G   +   C+K+S   +C+C+    G  CD+C   ++         C+ C C  NGT S  L  CD  TGQC CK+N  G +C  C  G +  +   + GC SC C
Sbjct:  298 CVCNGHAVTCDILEPQRPKSLLCR-CEHNTCGDMCERCCPGFVQKQWQAATAHNNFTCEACNCFGRSNECEYDAEVDLNKQSIDSQGNYEGGGVCKNCRENTEGVNCNKCSFGYF-RPEGVTWNEPQPCKVCDCDPDKHTGACAEETGKCECLPRFVGEDCDQCASGYY-DA--PKCKPCECNVNGTIGDVCLPEDGQCPCKAGFGGTFCETCADGYTNVTAGCVECVCDATG--SEHGNCSASTGQCECKPAYAGLSCDKCQVGYFG-DDCKFCNCDPMGTEGGVCDQTTGQCLCKEGFAGDKCDRCDIAFY--GYPNCKACACDGAGITSPECDATSGQCPCNGNFTGRTCDKCAAGFYNYPDCRGCECLLSGAKGQTCDSNGQCYCKGNFEGERCDRCKPNFYNFPI---CEECNCNPSGVTRDFQGCDKVSPGELCSCRKHVTGRICDQCKPTFWDLQYHHEDGCRSCDCNVNGTISG-LNTCDLKTGQCMCKKNADGRRCDQCADGFYRLNSYNQMGCESCHC 811          

HSP 6 Score: 180.259 bits (456), Expect = 1.972e-44
Identity = 138/434 (31.80%), Postives = 205/434 (47.24%), Query Frame = 2
Query: 2246 KCNCPPGFNGLSCESCESGYRRVNNVLYQGQCEACACYNHS---NTCDSLNGECQNCTHNTAGAHCEDCASGYYGDAKSKNLNSCKKCPCPRLDYQMTELCSSYSSENYVCHKCLHNTSGVHCDRCIEGYYGNPKKKISCKRCKCN---NNQESCDPVTGECRCSYNTMGTECQLCKHGFYGDALTKSCKKCDCDSLGSTSENCDKLTGKCDCRTNFVNRQCDSCTSGLYLKDKKCIPCNCEIQGRISSEKFCNTTSGQCFCLENVNGDRCEKCVEGYFNYPNCKKCLCSPHALSAD---CD-LNNGK-CKCGSNVINRICDKCENLHY---WNNRTDCVPCNC---GRGSLNPKCDMETGNCKCAQNVARRDCSKCDVGYFGLDV---TGCKKCPPCYNGQVCNNE-----GICVCPPNTIGNLCNKCSEDSW 3472
            KC C P F G  C+ C SGY          +C+ C C  +    + C   +G+C  C     G  CE CA GY     +     C +C C     +    CS+ + +   C +C    +G+ CD+C  GY+G+      CK C C+        CD  TG+C C     G +C  C   FYG     +CK C CD  G TS  CD  +G+C C  NF  R CD C +G Y     C  C C + G  +  + C+ ++GQC+C  N  G+RC++C   ++N+P C++C C+P  ++ D   CD ++ G+ C C  +V  RICD+C+   +   +++   C  C+C   G  S    CD++TG C C +N   R C +C  G++ L+     GC+ C  C  G     E     G C C P   G  C++  E+ +
Sbjct:  444 KCECLPRFVGEDCDQCASGYYDAP------KCKPCECNVNGTIGDVCLPEDGQCP-CKAGFGGTFCETCADGY-----TNVTAGCVECVCDATGSEHGN-CSASTGQ---C-ECKPAYAGLSCDKCQVGYFGD-----DCKFCNCDPMGTEGGVCDQTTGQCLCKEGFAGDKCDRCDIAFYG---YPNCKACACDGAGITSPECDATSGQCPCNGNFTGRTCDKCAAGFY-NYPDCRGCECLLSG--AKGQTCD-SNGQCYCKGNFEGERCDRCKPNFYNFPICEECNCNPSGVTRDFQGCDKVSPGELCSCRKHVTGRICDQCKPTFWDLQYHHEDGCRSCDCNVNGTISGLNTCDLKTGQCMCKKNADGRRCDQCADGFYRLNSYNQMGCESC-HCDIGGALRAECDITSGQCKCRPRVTGLRCDQPIENHY 847          

HSP 7 Score: 163.696 bits (413), Expect = 1.930e-39
Identity = 129/418 (30.86%), Postives = 186/418 (44.50%), Query Frame = 2
Query: 2624 YYGNPKKKISCKRCKCNNNQESCD------PVTGECRCSYNTMGTECQLCKHGFYG---DALTK----SCKKCDCDSLGSTSE-------NCDKLT----------GKC-DCRTNFVNRQCDSCTSGLYLKD-------KKCIPCNCEIQGRISSEKFCNTTSGQCFCLENVNGDRCEKCVEGYFNYPNCKKCLCSPHALSAD-CDLNNGKCKCGSNVINRICDKCENLHYWNNRTDCVPCNC-GRGSLNPKCDMETGNCKCAQNVARRDCSKCDVGYFGLDVTGCKKCPPCYNGQVCN-NEGICVCPPNTIGNLCNKCSEDSWDFNETIGCKKCNCYINGSYSNICNKISGICACKTAFFGSKCDRCNEGYYGFPNCQPCSCAENGTKSNELTKCDKITGQCQCKQNVIGTKCKVCR 3754
            Y+   K+ +   RC CN +  +CD      P +  CRC +NT G  C+ C  GF      A T     +C+ C+C   G ++E       + +K +          G C +CR N     C+ C+ G +  +       + C  C+C+      +   C   +G+C CL    G+ C++C  GY++ P CK C C+ +    D C   +G+C C +      C+ C +  Y N    CV C C   GS +  C   TG C+C    A   C KC VGYFG D   C   P    G VC+   G C+C     G+ C++C    + +     CK C C   G  S  C+  SG C C   F G  CD+C  G+Y +P+C+ C C  +G K      CD   GQC CK N  G +C  C+
Sbjct:  285 YFYAIKEIMIGGRCVCNGHAVTCDILEPQRPKSLLCRCEHNTCGDMCERCCPGFVQKQWQAATAHNNFTCEACNC--FGRSNECEYDAEVDLNKQSIDSQGNYEGGGVCKNCRENTEGVNCNKCSFGYFRPEGVTWNEPQPCKVCDCDPDKHTGA---CAEETGKCECLPRFVGEDCDQCASGYYDAPKCKPCECNVNGTIGDVCLPEDGQCPCKAGFGGTFCETCAD-GYTNVTAGCVECVCDATGSEHGNCSASTGQCECKPAYAGLSCDKCQVGYFGDDCKFCNCDPMGTEGGVCDQTTGQCLCKEGFAGDKCDRCDIAFYGYPN---CKACACDGAGITSPECDATSGQCPCNGNFTGRTCDKCAAGFYNYPDCRGCECLLSGAKGQ---TCDS-NGQCYCKGNFEGERCDRCK 689          

HSP 8 Score: 148.288 bits (373), Expect = 8.574e-35
Identity = 118/387 (30.49%), Postives = 169/387 (43.67%), Query Frame = 2
Query: 2231 MPHIEKCNCPPGFNGLSCESCESGYRRVNNVLYQGQCEACACYNHSNTCDSLNGECQNCTHNTAGAHCEDCASGYYGDAKSKNLNSCKKCPCPRLDYQMTELCSSYSSENYVCHK------CLHNTSGVHCDRCIEGYYGNPKKKISCKRCKCNN---NQESCDPVTGECRCSYNTMGTECQLCKHGFYGDALTKSCKKCDCDSLGSTSENCDKLTGKCDCRTNFVNRQCDSCTSGLYLKDKKCIPCNCEIQGRISSEKFCNTTS-GQ-CFCLENVNGDRCEKCVEGYFNYP-----NCKKCLCSPHALSAD---CDLNNGKCKCGSNVINRICDKCENLHYW---NNRTDCVPCNCG-RGSLNPKCDMETGNCKCAQNVARRDCSK 3322
            +P   +C C  GF G  CE+C  GY  V     +  C+A     H N C +  G+C+ C    AG  C+ C  GY+GD        CK C C  +            +E  VC +      C    +G  CDRC   +YG P    +CK C C+        CD  +G+C C+ N  G  C  C  GFY       C+ C+C   G+  + CD   G+C C+ NF   +CD C    Y     C  CNC   G     + C+  S G+ C C ++V G  C++C   +++        C+ C C+ +   +    CDL  G+C C  N   R CD+C +  Y     N+  C  C+C   G+L  +CD+ +G CKC   V    C +
Sbjct:  485 LPEDGQCPCKAGFGGTFCETCADGYTNVTAGCVECVCDATGS-EHGN-CSASTGQCE-CKPAYAGLSCDKCQVGYFGD-------DCKFCNCDPM-----------GTEGGVCDQTTGQCLCKEGFAGDKCDRCDIAFYGYP----NCKACACDGAGITSPECDATSGQCPCNGNFTGRTCDKCAAGFYN---YPDCRGCECLLSGAKGQTCDS-NGQCYCKGNFEGERCDRCKPNFY-NFPICEECNCNPSGVTRDFQGCDKVSPGELCSCRKHVTGRICDQCKPTFWDLQYHHEDGCRSCDCNVNGTISGLNTCDLKTGQCMCKKNADGRRCDQCADGFYRLNSYNQMGCESCHCDIGGALRAECDITSGQCKCRPRVTGLRCDQ 841          

HSP 9 Score: 144.821 bits (364), Expect = 8.824e-34
Identity = 102/338 (30.18%), Postives = 155/338 (45.86%), Query Frame = 2
Query: 2573 KCLHNTSGVHCDRCIEGYYGNPKKKI--SCKRCKCNNNQESCDPVTGECR-CSYNTMGTECQLCKHGFYGDALTKS---CKKCDCDSLGST--SENCDKLTG----KCDCRTNFVNRQCDSCTSGLY----LKDKKCIPCNCEIQGRISSEKFCNTTSGQCF-CLENVNGDRCEKCVEGYFN----YPNCKKCLCSPHALSADCDLNNGKCKCGSNVINRICDKCENLHYWNNR-TDCVPCNCGRGSLNPKCDMETGNCKCAQNVARRDCSKCDVGYFGLDVTGCKKC---PPCYNGQVCN-NEGICVCPPNTIGNLCNKCSEDSWDFNETIGCKKCN 3508
            +C    +G  C  C  GY+         +C  C+CN +  +CDP TG C  C +NT G  C+ C  G YG+A   S   C  C C    +   +++CD        +C+C+  +   +CD C SG +    +  + C PC C     ++  + C+  SG C+ C +N +G  CE C   ++       NC  C CS    S  CD  +G C+C  NV    CD+C+  H+  ++   C  C+CG  + N +C++E G C C        C  C+ GY+     GC KC        G VC+   G C C     G+ C++C   S+    T GC++C+
Sbjct: 1789 QCPAPYTGPSCQLCASGYHRVQSGSFLGACVPCECNGHSATCDPDTGICTDCEHNTNGDHCEFCNEGHYGNATNGSPYDCMACACPFAPTNNFAKSCDVSEEGQLLQCNCKPGYTGDRCDRCASGFFGHPQISGESCSPCQCNGNNNLTDSRSCHPNSGDCYLCEQNTDGRHCESCAAWFYGDAVTAKNCSSCECS-QCGSQYCDNKSGGCECKINVEGDSCDRCKPDHWGFSKCQGCQGCHCGTAAFNTQCNVENGQCTCRPGATGMRCEHCEHGYWNYGEHGCDKCDCEADLSMGTVCDVRTGQCHCQEGATGSRCDQCLP-SYLRIPTYGCRRCD 2124          

HSP 10 Score: 136.732 bits (343), Expect = 3.073e-31
Identity = 108/369 (29.27%), Postives = 154/369 (41.73%), Query Frame = 2
Query: 2708 ECRCSYNTMGTECQLCKHGFY---GDALTKSCKKCDCDSLGSTSENCDKLTGKC-DCRTNFVNRQCDSCTSGLYLKDK-----KCIPCNCEIQGRISSEKFCNTTSG----QCFCLENVNGDRCEKCVEGYFNYPNCKKCLCSPHALSADCDLNNGKCKCGSNVINRICDKCENLHYWNNRTDCVPCNCGRGSLNPKCDMETGNCK-CAQNVARRDCSKCDVGYFGLDVTGCKKCPPCY----NGQVCNNE-GICVCPPNTIGNLCNKCSEDSWDFNETIGCKKCNCYINGSYSNICNKISGICACKTAFFGSKCDRCNEGY--YGFPNCQPCSCAENGTKSNELTKCDKITGQCQCKQNVIGTKCKVC 3751
            +C+C     G  CQLC  G++     +   +C  C+C+   +T   CD  TG C DC  N     C+ C  G Y          C+ C C      +  K C+ +      QC C     GDRC++C  G+F +P      CSP             C+C  N               NN TD           +  C   +G+C  C QN   R C  C   ++G  VT  K C  C       Q C+N+ G C C  N  G+ C++C  D W F++  GC+ C+C    +++  CN  +G C C+    G +C+ C  GY  YG   C  C C  + +     T CD  TGQC C++   G++C  C
Sbjct: 1787 QCQCPAPYTGPSCQLCASGYHRVQSGSFLGACVPCECNGHSAT---CDPDTGICTDCEHNTNGDHCEFCNEGHYGNATNGSPYDCMACACPFAPTNNFAKSCDVSEEGQLLQCNCKPGYTGDRCDRCASGFFGHPQISGESCSP-------------CQCNGN---------------NNLTD-----------SRSCHPNSGDCYLCEQNTDGRHCESCAAWFYGDAVTA-KNCSSCECSQCGSQYCDNKSGGCECKINVEGDSCDRCKPDHWGFSKCQGCQGCHCG-TAAFNTQCNVENGQCTCRPGATGMRCEHCEHGYWNYGEHGCDKCDCEADLSMG---TVCDVRTGQCHCQEGATGSRCDQC 2108          

HSP 11 Score: 103.605 bits (257), Expect = 3.090e-21
Identity = 92/299 (30.77%), Postives = 123/299 (41.14%), Query Frame = 2
Query: 3002 QCFCLENVNGDRCEKCVEGYFNYPN------CKKCLCSPHALSADCDLNNGKC-KCGSNVINRICDKCENLHYWNNRT----DCVPCNCGRGSLN---PKCDM-ETGN---CKCAQNVARRDCSKCDVGYFGLDVTGCKKCPPCY--------NGQVCN-NEGIC-VCPPNTIGNLCNKCSEDSWDFNETIGCKKCN-CYINGSYSNICNKISGICACKTAFFGSKCDRCNEGYYGFPNCQPCSCAENGTKSNELTKCDKITGQCQCKQNVIGTKCKVCRKGTFPSDGTYEGGCFSCFC 3811
            QC C     G  C+ C  GY    +      C  C C+ H  SA CD + G C  C  N     C+ C   HY N       DC+ C C     N     CD+ E G    C C        C +C  G+FG      + C PC         + + C+ N G C +C  NT G  C  C+  +W + + +  K C+ C  +   S  C+  SG C CK    G  CDRC   ++GF  CQ C     GT +   T+C+   GQC C+    G +C+ C  G +      E GC  C C
Sbjct: 1787 QCQCPAPYTGPSCQLCASGYHRVQSGSFLGACVPCECNGH--SATCDPDTGICTDCEHNTNGDHCEFCNEGHYGNATNGSPYDCMACACPFAPTNNFAKSCDVSEEGQLLQCNCKPGYTGDRCDRCASGFFGHPQISGESCSPCQCNGNNNLTDSRSCHPNSGDCYLCEQNTDGRHCESCA--AWFYGDAVTAKNCSSCECSQCGSQYCDNKSGGCECKINVEGDSCDRCKPDHWGFSKCQGCQGCHCGTAAFN-TQCNVENGQCTCRPGATGMRCEHCEHGYW---NYGEHGCDKCDC 2077          

HSP 12 Score: 100.138 bits (248), Expect = 2.947e-20
Identity = 163/813 (20.05%), Postives = 311/813 (38.25%), Query Frame = 2
Query: 4481 ICNALTFGNHCQNPISGYYKEYFNLPNSTKSGSMRTGNRILINLKKCNCNG-YSKVCDSVTGDCQNCMGNREGNKCQLCREGFYKNDKNYDQCEPCQCPSAHYNFAQNCTRIESSLELKCQCRIGYSGKSCENCQQGFYGNPIKGIPCKSCDCNQQGSQSLNCN-EFGICQCSPGVLGIKCDQCAPNYV-VEKKTCQSCYS------GCTKDLLVRIDTLNETVINFKWKTLPSTLDLR----LNKINISIQMSSELLNSINKFYKLKNEIKNFSIQFQ----KMKDDAKEKYGE-----------IEKLKTRYNKVLEDLRSTFTDINETISGHEQLGISNELIKNATAYLETIKNIYKEM--PNITLAASVLKDVLKYVDELNQIIKYTQSHIQSDQINNLKILKNKTIMADEINTNNKEYLNTMSTKKKEHELYIILINERMKDLQKIFRKMTKQRDNLRKKIQKLDA----ISKSFQDEKDLISINVREIEDLMKNLSSNHLVSKSLIIPDTLKKHVEQQLN---------KSSNLIKKLTKDFNFLHNAEQAKEAYSNITRDI----LAVDYAINQTKKELDFNRSNMNIDSLKKLLAEFNSNKSEIVENIKNIDKEHEKLLKQYKNCSYXXXXXXXXXXXXSSEIP-----------TGFYDVEILKRNLSXXXXXXXXXXXXFILPINQTILNLGTPNVKSGLDTRN---LEKLIKVVDNQYRDLVNESSFVENKIKDLRKSIKSLRERLQKARVMSELI----HGAAARSVE---PIRHVVRCVRHY-VTYYLPTSNAFSLEFYM 6712
            +C   T G HC++  + +Y +     N +                 C C+   S+ CD+ +G C+ C  N EG+ C  C+   +   K    C+ C C +A +N   N   +E+    +C CR G +G  CE+C+ G++     G  C  CDC    S    C+   G C C  G  G +CDQC P+Y+ +    C+ C        G   +L + ID L   + N    T+      R     N IN   +M ++  NS    +    +I   S Q Q    + K  ++                ++++  R  +  + +RS         S  + + +   L+K A   L T++    +            L+++ K + E  + +   +   ++ +       K    +A  +N+  +    + S   K + +  +L   ++++L        ++ +  + + QKL+     I+++ +D+++ ++  V  + +   +++     +K  +  D  +K V+ QL          +++ L +    + +    A +A  A+SN+T  +      +D A      E  F  S  N    K    E       + + +    KE EKL KQ +  +   +KL+   E + + IP               +VE LK  +     E     +       +      +      L  RN   L KL  V+ +++ +L   SS    K+  +   +  ++E +  AR  +  I    H     S++   P R V R   H  +++Y  T     +  + 
Sbjct: 1951 LCEQNTDGRHCESCAAWFYGDAVTAKNCSS----------------CECSQCGSQYCDNKSGGCE-CKINVEGDSCDRCKPDHWGFSK-CQGCQGCHCGTAAFNTQCN---VENG---QCTCRPGATGMRCEHCEHGYWNYGEHG--CDKCDCEADLSMGTVCDVRTGQCHCQEGATGSRCDQCLPSYLRIPTYGCRRCDECVHHLIGDVDNLELEIDVLGTAIANISSATIVGARLARNKKEFNDINEITKMLNDEENSFGNVFGDAQDILTNSTQIQNKLVRTKTHSQNSVSSAKNITLNGTEFLQEVMKRAQRARQSVRSLAEIALAIGSSSKAVNVDPRLLKEAEETLMTLEAASADQYPEKAQTVPGKLEEIQKKIQEETEKLDKQKETFEAQK-------KRAEELAAYLNSAQQLLKESKSKADKSNNIAKMLQLTKVENLVAAITDDLERVEAAKGEFQKLNVAIGNITENLKDKREEMTHAVTTLNETRNDVAEALEAAKKRVRRD--EKSVDMQLVNAKAHELHLQATTLRQTFDNNKDNTDQAVEAANAFSNLTDTLKNAKAQIDNAYEALSAEPAFAESVQNARD-KPFPDETKEKIDALSKTVSQDLKETEKLKKQLEQLTELSEKLRKRKEAVKAGIPKYSKNTLDSIDEKVQEVEKLKAEIDANIEETRAKISEIAGKAEEITEKANSAMEGIRLARRNSVQLNKLAPVIVSKFEELKKLSSARSAKVDSVSDKVSQIKEMIAVARDAANRIKLGAHFEKGSSLDLNIPQR-VTRSAAHADISFYFRTEQEHGIPLFF 2726          

HSP 13 Score: 70.0922 bits (170), Expect = 3.652e-11
Identity = 52/166 (31.33%), Postives = 72/166 (43.37%), Query Frame = 2
Query: 4613 KKCNCNGYSK---VCDSVTGDCQNCMGNREGNKCQLCREGFYKNDKNYDQCEPCQCPSAHYNFAQNCTRIESSLELKCQCRIGYSGKSCENCQQGFYGNPIKGIPCKSCDCNQQGSQSLNCNEFGICQCSPGVLGIKCDQCAPNYVVEKKTCQSC---YSGCTKDL 5092
            K CNC+       VCD  TG C  C     G+KC  C   FY     Y  C+ C C  A    +  C         +C C   ++G++C+ C  GFY  P     C+ C+C   G++   C+  G C C     G +CD+C PN+      C+ C    SG T+D 
Sbjct:  562 KFCNCDPMGTEGGVCDQTTGQCL-CKEGFAGDKCDRCDIAFY----GYPNCKACACDGAGIT-SPECDATSG----QCPCNGNFTGRTCDKCAAGFYNYP----DCRGCECLLSGAKGQTCDSNGQCYCKGNFEGERCDRCKPNF-YNFPICEECNCNPSGVTRDF 712          

HSP 14 Score: 66.6254 bits (161), Expect = 3.914e-10
Identity = 59/204 (28.92%), Postives = 87/204 (42.65%), Query Frame = 2
Query: 1004 SVAKCNCKHNTCGSNCETCCPLFNQRPWKPVAVCEECNCNRKSNECSYNQTVATLQLSVNKMGRMEGGGVCINCQENTEGINCEKCIKGFYRPWNVLATELYPCTPCQCHGLGTIGSCVSNGEDIGDQKPGDCICKKGYEGVNCDLCSIGYER---YPNGECLPCPCSIDGSVRTSFYRCKPPCNCKVHVNSDDLCKTCKNGYF 1606
            S  +C CK N  G  C+ C P F   P     +CEECNCN            + +        ++  G +C +C+++  G  C++C   F   W++       C  C C+  GTI     +G +  D K G C+CKK  +G  CD C+ G+ R   Y    C  C C I G++R         C C+  V      +  +N YF
Sbjct:  670 SNGQCYCKGNFEGERCDRCKPNFYNFP-----ICEECNCNP-----------SGVTRDFQGCDKVSPGELC-SCRKHVTGRICDQCKPTF---WDLQYHHEDGCRSCDCNVNGTI-----SGLNTCDLKTGQCMCKKNADGRRCDQCADGFYRLNSYNQMGCESCHCDIGGALRAECDITSGQCKCRPRVTGLRCDQPIENHYF 848          

HSP 15 Score: 65.4698 bits (158), Expect = 1.018e-9
Identity = 65/208 (31.25%), Postives = 91/208 (43.75%), Query Frame = 2
Query: 4475 KCICNALTFGNHCQNPISGYYKEYFNLPNSTKSGSMRTGNRILINLKKCNCNGYSKVCDSVTGDCQNCMGNREGNKCQLCREGFYKNDKNYDQCEPCQC-PSAHYNFAQNCTRIESSLELKCQCRIGYSGKSCENCQQGFYGNPIKGIP-CKSCDCNQQGSQS-LNCNEF--GICQCSPGVLGIKCDQCAPNYV----VEKKTCQSCY 5071
            +C CN    G  C    +G+Y    N P+      + +G +              + CDS  G C  C GN EG +C  C+  FY    N+  CE C C PS      Q C ++ S  EL C CR   +G+ C+ C+  F+         C+SCDCN  G+ S LN  +   G C C     G +CDQCA  +       +  C+SC+
Sbjct:  628 QCPCNGNFTGRTCDKCAAGFY----NYPDCRGCECLLSGAK-------------GQTCDS-NGQCY-CKGNFEGERCDRCKPNFY----NFPICEECNCNPSGVTRDFQGCDKV-SPGEL-CSCRKHVTGRICDQCKPTFWDLQYHHEDGCRSCDCNVNGTISGLNTCDLKTGQCMCKKNADGRRCDQCADGFYRLNSYNQMGCESCH 810          

HSP 16 Score: 65.0846 bits (157), Expect = 1.353e-9
Identity = 44/141 (31.21%), Postives = 64/141 (45.39%), Query Frame = 2
Query: 4619 CNCNGYSKVCDSVTGDCQNCMGNREGNKCQLCREGFYKNDKNYDQCEPCQCPSAHYNFAQNCTRIESSLELKCQCRIGYSGKSCENCQQGFYGNPIKGIPCKSCDCNQQGSQSLNCN-EFGICQCSPGVLGIKCDQCAPNY 5038
            C+ + ++  C   TG C+ C+    G  C  C  G+Y   K    C+PC+C     N       +    + +C C+ G+ G  CE C  G Y N   G  C  C C+  GS+  NC+   G C+C P   G+ CD+C   Y
Sbjct:  429 CDPDKHTGACAEETGKCE-CLPRFVGEDCDQCASGYYDAPK----CKPCEC-----NVNGTIGDVCLPEDGQCPCKAGFGGTFCETCADG-YTNVTAG--CVECVCDATGSEHGNCSASTGQCECKPAYAGLSCDKCQVGY 556          

HSP 17 Score: 59.3066 bits (142), Expect = 6.232e-8
Identity = 43/142 (30.28%), Postives = 61/142 (42.96%), Query Frame = 2
Query: 4661 GDCQNCMGNREGNKCQLCREGFYKNDK-NYDQCEPCQC----PSAHYNFAQNCTRIESSLELKCQCRIGYSGKSCENCQQGFYGNPIKGIPCKSCDCNQQGSQSLNC-NEFGICQCSPGVLGIKCDQCAPNYVVEKKTCQSC 5068
            G C+NC  N EG  C  C  G+++ +   +++ +PC+     P  H       T        KC+C   + G+ C+ C  G+Y  P     CK C+CN  G+    C  E G C C  G  G  C+ CA  Y      C  C
Sbjct:  389 GVCKNCRENTEGVNCNKCSFGYFRPEGVTWNEPQPCKVCDCDPDKHTGACAEETG-------KCECLPRFVGEDCDQCASGYYDAP----KCKPCECNVNGTIGDVCLPEDGQCPCKAGFGGTFCETCADGYTNVTAGCVEC 519          

HSP 18 Score: 58.5362 bits (140), Expect = 1.075e-7
Identity = 61/229 (26.64%), Postives = 86/229 (37.55%), Query Frame = 2
Query: 1010 AKCNCKHNTCGSNCETCCPLFNQRPWKPVAVCEECNCNRKSNECSYNQTVATLQLSVNKMGRMEGGGVCINCQENTEGINCEKCIKGFYRPWNVLATELYPCTPCQCHGLGTIGSCVSNGEDIGDQKPGDCICKKGYEGVNCDLCSIGYERYPNGECLPCPCSIDGSVRTSFYRCKPPCNCKVHVNSDDLCKTCKNGYFN----------LDSANPEGCEP---CYCFG 1657
             +C CK    G+ CETC   +        A C EC C+   +E   N + +T Q                 C+    G++C+KC  G++            C  C C  +GT G        + DQ  G C+CK+G+ G  CD C I +  YPN  C  C C   G            C C  +  +   C  C  G++N          L  A  + C+    CYC G
Sbjct:  489 GQCPCKAGFGGTFCETCADGYTNV----TAGCVECVCDATGSE-HGNCSASTGQCE---------------CKPAYAGLSCDKCQVGYFGD---------DCKFCNCDPMGTEGG-------VCDQTTGQCLCKEGFAGDKCDRCDIAFYGYPN--CKACACDGAGITSPECDATSGQCPCNGNF-TGRTCDKCAAGFYNYPDCRGCECLLSGAKGQTCDSNGQCYCKG 678          

HSP 19 Score: 58.151 bits (139), Expect = 1.541e-7
Identity = 44/139 (31.65%), Postives = 65/139 (46.76%), Query Frame = 2
Query: 4616 KCNCNG-YSKVCDSVTGDCQNCMGNREGNKCQLCREGFYKNDKNYDQCEPCQCPSAHYNFAQNCTRIESSLELKCQCRIGYSGKSCENCQQGFYGNPIKGIPCKSCDCNQQGSQSLNCNE-FGICQCSPGVLGIKCDQC 5026
            +CN NG    VC    G C  C     G  C+ C +G+         C  C C +       NC    S+   +C+C+  Y+G SC+ CQ G++G+      CK C+C+  G++   C++  G C C  G  G KCD+C
Sbjct:  473 ECNVNGTIGDVCLPEDGQCP-CKAGFGGTFCETCADGYTNVTAG---CVECVCDATGSEHG-NC----SASTGQCECKPAYAGLSCDKCQVGYFGD-----DCKFCNCDPMGTEGGVCDQTTGQCLCKEGFAGDKCDRC 597          

HSP 20 Score: 55.8398 bits (133), Expect = 7.636e-7
Identity = 68/261 (26.05%), Postives = 106/261 (40.61%), Query Frame = 2
Query:  914 YYSLRNIEIGGKCI---CNNHADKCDKVIENGISVAKCNCKHNTCGSNCETCCP-----LFNQRPWKPVA-VCEECNCNRKSNECSYNQTVATLQLSVNKMGRMEGGGVCINCQENTEGINCEKCIKGFYRPWNVLATELYPCTPCQCHG---LGTIGSCVSNGEDIGDQKPGDC-ICKKGYEGVNCDLCSIGY--ERYPNGECLPCPCSIDGSVRTSFYRCKPPCNCKVHVNSDDLCKTCKNGYFNLDSANPEGCEPCYC 1651
            Y+ +++    G C+   CN H+  CD   + GI     +C+HNT G +CE C         N  P+  +A  C     N  +  C  ++    LQ                NC+    G  C++C  GF+    +       C+PCQC+G   L    SC  N         GDC +C++  +G +C+ C+  +  +      C  C CS  GS           C CK++V  D  C  CK  ++       +GC+ C+C
Sbjct: 1806 YHRVQSGSFLGACVPCECNGHSATCDP--DTGICT---DCEHNTNGDHCEFCNEGHYGNATNGSPYDCMACACPFAPTNNFAKSCDVSEEGQLLQC---------------NCKPGYTGDRCDRCASGFFGHPQISGES---CSPCQCNGNNNLTDSRSCHPNS--------GDCYLCEQNTDGRHCESCAAWFYGDAVTAKNCSSCECSQCGSQYCD--NKSGGCECKINVEGDS-CDRCKPDHWGFSKC--QGCQGCHC 2030          

HSP 21 Score: 55.0694 bits (131), Expect = 1.432e-6
Identity = 44/151 (29.14%), Postives = 72/151 (47.68%), Query Frame = 2
Query: 4613 KKCNCN--GYSK---VCDSVT-GDCQNCMGNREGNKCQLCREGFYKNDKNY-DQCEPCQCPSAHYNFAQNCTRIESSLELKCQCRIGYSGKSCENCQQGFYG-NPIKGIPCKSCDCNQQGSQSLNCN-EFGICQCSPGVLGIKCDQCAPNY 5038
            ++CNCN  G ++    CD V+ G+  +C  +  G  C  C+  F+    ++ D C  C C         N   +++    +C C+    G+ C+ C  GFY  N    + C+SC C+  G+    C+   G C+C P V G++CDQ   N+
Sbjct:  699 EECNCNPSGVTRDFQGCDKVSPGELCSCRKHVTGRICDQCKPTFWDLQYHHEDGCRSCDCNVNGTISGLNTCDLKTG---QCMCKKNADGRRCDQCADGFYRLNSYNQMGCESCHCDIGGALRAECDITSGQCKCRPRVTGLRCDQPIENH 846          
BLAST of Laminin subunit alpha-2 vs. Ensembl Fly
Match: wb (gene:FBgn0261563 transcript:FBtr0305063)

HSP 1 Score: 743.806 bits (1919), Expect = 0.000e+0
Identity = 566/1920 (29.48%), Postives = 868/1920 (45.21%), Query Frame = 2
Query:  188 LMENAKITSSATCGTGGPEIFCRLVDEIAIQRLINPDSHVLCDVCD--NRNETKRHPIE---------FAKSDDDNLWWQSPSMAQGLKYQNVNVTIDLKQVYQIVYILLKMGDSPRPGNWILERSLDGEIYMPWIFFAETPYSCYNLFQRQYPDLKLTTNAKPSSLADDEMFCTTYYSQPKSLNSGEIIISLINGRKSIMNEEYLSIKSVPQTLINFLSARYIRFRFLKHLTLAADLMTHKGYLEQ-SIYNRYYYSLRNIEIGGKCICNNHADKCDKVIENGISVAKCNCKHNTCGSNCETCCPLFNQRPWKPVAVCEECNCNRKSNECSYNQTVATLQLSVNKMGRMEGGGVCINCQENTEGINCEKCIKGFYRPWNVLATELYPCTPCQCHGLGTIGSCVSNGEDIGDQKPGDCICKKGYEGVNCDLCSIGYERYPNGECLPCPCSIDGSVRTSFYRCKPPCNCKVHVNSDDLCKTCKNGYFNLDSANPEGCEPCYCFGITNQCSSLSAKNLKISDLKGWKLTTFTGEK-IALPKFTSFQYLTSENSYIDERFNNPTVYYWTAPPPYLGNWITSYGTIFRYVVKIE-LQSTLKGSLIDSPDVII--KCGDFRLFHSVSIEDRRLQRQV------FIYIKPTEWKI--------GKLTPDKAATKEEFISCLVKVDKLLIKAKYYSNQKSIELLNITLSRGEVHLALDEMPHIEKCNCPPGFNGLSCESCESGYRRV--NNVLYQ--GQCEACACYNHSNTCDSLNGECQNCTHNTAGAHCEDCASGYYGDAKSKNLNSCKKCPCPRLD-------------YQMTELCSSYS---SENYVCHKCLHNTSGVHCDRCIEGYYGNPKKK-ISCKRCKCNNNQESCDPVTGEC-RCSYNTMGTECQLCKHGFYGDALTKSCKKCDCDSLGSTSENCDKLTGKCDCRTNFVNRQCDSCTSGLYLKDKKCIPCNCEIQGRISSEKFCNTTSGQCFCLENVNGDRCEKCVEGYFNY--------------------------------PN------CKKCLCSP-HALSADCDLNNGKCKCGSNVINRICDKCENLHYWN--NRTDCVPCNCG-RGSLNPKCDMETGNCKCAQNVARRDCSKCDVGYFGLDVTGCKKCPPCYN-GQVCN-NEGICVCPPNTIGNLCNKCSEDSWDFNETIGCKKCNCYINGSYSNICNKISGICACKTAFFGSKCDRCNEGYYGFPNCQPCSCAENG--TKSNELTKCDKITGQCQCKQNVIGTKCKVCRKGTFPSDGTYEGGCFSCFCFGVSEKC--------------------HAILNHRIVENSIYEYHIF---------DEKNSLESGKDYSTIHLNANYPRRFGWPLTMFRPIYVNVMKLFNSHDLSLFYRSIFMNVSVDCLDNKCGREIPEQTE-VFMESYNGLFGMRYXXXXXXXXXXXXXXDFNEHSKNGKWVISQYQNDILDKFIILED---SNVINSNLTRDIFMMALLNVTSLKVKLYT----DKVNPPLIKIKIITYKVMETTQAIGKRVTAVEKCICNALTFGNHCQNPISGYYKEYFNLPNSTKSGSMRTGNRILINLKKCNCNGYSKVCDSVTGDCQNCMGNREGNKCQLCREGFYKNDKNYDQCEPCQCPSAHYNFAQNCTRIESSLELKCQCRIGYSGKSCENCQQGFYGNPIK--GIPCKSCDCNQQGSQSLNCN-EFGICQCSPGVLGIKCDQC-APNYVVEKKTCQSCYSGCTKDLLVRID----TLNETVINFKWKTLPS---------TLDLRLNKINISIQMSSELLNSINKFYKLKNEIKNFSIQFQKMKDDAKEKYGEIEKLKTRYNKVLED-----LRS----TFTDINETISGHEQLGISNELIKNATAYLETIK 5464
            ++  A+I+ +ATCG  G E +C+ V                C +C+  + +  K+  I+          + S  +  WWQSP++  G +++ V + +DLKQ +QI  + LK  +SPRP +WILE+SLDG  + PW +F  +   C    QR++ +L    N K     D E+ C+T +S+P  L +G +  SL+  R    ++        P+ L+ F++ RYIR R     + A    +    L+  S+    +YSL  +++  +  CN HA++  +  ++   + +C C+HNTCG+ CE CCPLF  RP++    CE C C   +  C+Y+  +                G+C +C  NT GI CE C  GFYR  +   T+  PC PC C+   + G C S+G        G C C +G++G NC+ C+ GY      +C  C C   GS+  S   C   C CK++V     C  C  GYF+L + N EGC  C+C G++  C S   + L    L  WK+T     K I++P       L   N       +     YW A   YLGN +TSYG+  + V+  + ++    G     P+VI+  K G    F   S++   +   V      + ++ PT   I        G     ++ T+ +F+S LV +D +LI+A ++++Q    L    +  G V L       +E+C CP G+ GLSCE C  G++R+  N   +Q   +C  C C  HSN+CD  +G C +C HNT G  CE C  GYYG+      N CK+C CP  +             Y   +L   +       Y+C +C    +G HC  C +GY+GNP++   SC+RC C      C+  TGEC  C  NT G  C+ CK G++GD     C  C C + GS S  CD   G+C C+  +  ++CD C  G    + +C  CNC+  G +  ++ C+  +GQC C E V G +C +C +GYF                                  PN      C++C CS   +LS+DCD   G+C C +NV  R CDKC   H WN      C  C C   GS   +C+  TG C C   V  + C++C  G+FG    GC++C  C + GQVC+ + G C+CP  T G  C +C   +W +   +GC++C C   GS    C+   G C C+  + G KCD C  GY+G+P C+ C C   G  T+++    CD   GQC CK  V+G KC  C + TF        GC  CFCFG S +C                      I  H  V +S YEY +           E   ++   D S +  +       G     + P+Y  +   F     S +   ++  +  +       R I  Q   V + +++ L                  +DF E+ +       +Y  ++  +  + E     +  +  + R+  M AL N+  + ++ +      +V    + +    Y +  +T  I K    VE+C C     G  CQ+P   +Y+      N+T   S+   + ++     C+CNG S  CD  TG CQNC GN  G+ C  C EGFY +  +   C+ C CP  + NFA+ C   +   E+ C C+ GY+G+ CE CQ G++G+P++     C+ C+C+  G Q+  C+ E G C C  GV G+KCD+C A  + +    C+ C   CT  LL  ++     L   + N     +P+         +   + N  +     +   L   +    LK E    +++FQ  K  A     E      R + V +      LRS    T +D++        L +   L K A  YL+ I+
Sbjct:  160 VVPRAQISVNATCGQNGAEEYCKQVGAKP------------CGICNAHSSDRAKQRSIQSLISSGSGSGSGSGFEEGWWQSPTLQGGRQFEYVTILLDLKQTFQIFSVWLKSANSPRPASWILEKSLDGINFEPWQYFGLSDADC----QRRW-NLS-GQNGKYVFQNDTEIICSTQFSKPGPLENGVLHASLLKNRPGATDQS-------PE-LMKFITTRYIRIRLQGMHSTANQDNSLDWLLDSPSLEKHSFYSLSQLKVSARLDCNGHANRSHESPDD--PLMQCICQHNTCGAQCEQCCPLFQDRPYQMGGECEICQCYGHAESCTYDPFLDK--------------GICQSCSNNTAGIECEFCEMGFYRELDAPLTD--PCLPCSCNPARSTGGCQSDG--------GSCNCLEGFQGKNCEECAPGYY---GDDCKRCECDERGSL-GSTGSCSGVCQCKLNVEGS-TCSECAPGYFDLSAENAEGCTSCWCSGVSQTCHSAKLQTLAFETLNDWKITDIQRVKPISIPVDAETNRLIFAN-----ELDEVEAIYWQASLGYLGNRLTSYGSRLQLVLSWDVIRGDRSGKPTTGPNVILVGKNGLKIAFGDESLDGLGINLNVTLTEVGWYHVPPTVVDIKTRLRRTEGGDYHGESVTRSQFLSVLVSLDAVLIRAAFHTDQGETSLERAVIYSGGVELGGKSSSQVEQCLCPAGYTGLSCEGCAFGFKRIYENTSDHQILSKCIPCPCNGHSNSCDLQSGNCGDCMHNTFGDRCERCQLGYYGNPLQGTPNDCKRCACPLSEDSNNFSPSCQLKSYNYMDLNPQFELIEHAEYICTQCPEGYTGDHCQVCDDGYFGNPRQPGSSCQRCDCAGG--PCNVTTGECITCRGNTEGWHCERCKLGYWGDPAV-GCDPCHCHTEGSESGLCDSTDGQCLCKPRYAGQKCDECDVGYANVELRCPSCNCDPLGSLVQDR-CDPHTGQCHCKEGVMGAKCHECQDGYFGMNAVAYRMDDLAALRQNSDSDDDEWELVPDTEDPNSESTVACEECHCSSVGSLSSDCDKRTGQCACLANVTGRRCDKCRPGH-WNLTAGEGCRDCRCDPHGSRGHECNPWTGQCDCKIGVGGQHCNECTEGFFGFSTEGCQRCSACRSEGQVCDPHNGRCICPKFTRGLGCGQCVPGTWGWQARLGCRECECDHIGSIGQQCSTGDGQCQCREGYSGRKCDTCAIGYFGYPECRRCGCDAEGSFTQADGSIACDS-NGQCPCKSLVVGLKCDTCMQSTFGLSAQNPEGCTRCFCFGRSGECEQSDLSWGHIRMAESRNLSVQQIRPHS-VPSSDYEYIVVVQMEGSSFHREDAEIQRMNDLSLVPKSTGNV-SIGAYGQFYHPLYFQLPPQFYGDRTSSYGGFLYFTLITEGAHKPLERNILGQYPLVQLHAHSKLL-----------------LDFYEYEE------FEYSLNVTHRVPLHESFWKYHHTSQAVDRNTLMAALQNIRHIFIRAFAFADFQEVVLQNVHMDAAIY-IKGSTNLIAK---GVERCKCPKRFDGLSCQDPGRSFYR----WRNTTIVESVFIED-LIGRAAPCHCNGRSSDCDRETGVCQNCRGNTGGDHCHQCAEGFYGDPNSPHGCQACPCPETNRNFARGCNVWDG--EVSCVCKPGYTGRLCERCQAGYFGDPMRYPNTTCQPCNCHPDGIQTEGCDVETGRCYCREGVTGLKCDKCQAERHHLVDNGCKIC-DNCTLLLLDYMELVGNKLRRGMHNMDLTGIPAPYRKLSEYESAYEKWNGRHWDFSQTKRRLQDYDSADILKLEAHAENLKFQSRKAVATIGKREFAIKSMREDAVTQQHSVGLLRSEILQTLSDLHGYGKSAHYLSLPTAL-KQARFYLQAIR 1973          
BLAST of Laminin subunit alpha-2 vs. Ensembl Fly
Match: wb (gene:FBgn0261563 transcript:FBtr0302731)

HSP 1 Score: 741.88 bits (1914), Expect = 0.000e+0
Identity = 566/1920 (29.48%), Postives = 868/1920 (45.21%), Query Frame = 2
Query:  188 LMENAKITSSATCGTGGPEIFCRLVDEIAIQRLINPDSHVLCDVCD--NRNETKRHPIE---------FAKSDDDNLWWQSPSMAQGLKYQNVNVTIDLKQVYQIVYILLKMGDSPRPGNWILERSLDGEIYMPWIFFAETPYSCYNLFQRQYPDLKLTTNAKPSSLADDEMFCTTYYSQPKSLNSGEIIISLINGRKSIMNEEYLSIKSVPQTLINFLSARYIRFRFLKHLTLAADLMTHKGYLEQ-SIYNRYYYSLRNIEIGGKCICNNHADKCDKVIENGISVAKCNCKHNTCGSNCETCCPLFNQRPWKPVAVCEECNCNRKSNECSYNQTVATLQLSVNKMGRMEGGGVCINCQENTEGINCEKCIKGFYRPWNVLATELYPCTPCQCHGLGTIGSCVSNGEDIGDQKPGDCICKKGYEGVNCDLCSIGYERYPNGECLPCPCSIDGSVRTSFYRCKPPCNCKVHVNSDDLCKTCKNGYFNLDSANPEGCEPCYCFGITNQCSSLSAKNLKISDLKGWKLTTFTGEK-IALPKFTSFQYLTSENSYIDERFNNPTVYYWTAPPPYLGNWITSYGTIFRYVVKIE-LQSTLKGSLIDSPDVII--KCGDFRLFHSVSIEDRRLQRQV------FIYIKPTEWKI--------GKLTPDKAATKEEFISCLVKVDKLLIKAKYYSNQKSIELLNITLSRGEVHLALDEMPHIEKCNCPPGFNGLSCESCESGYRRV--NNVLYQ--GQCEACACYNHSNTCDSLNGECQNCTHNTAGAHCEDCASGYYGDAKSKNLNSCKKCPCPRLD-------------YQMTELCSSYS---SENYVCHKCLHNTSGVHCDRCIEGYYGNPKKK-ISCKRCKCNNNQESCDPVTGEC-RCSYNTMGTECQLCKHGFYGDALTKSCKKCDCDSLGSTSENCDKLTGKCDCRTNFVNRQCDSCTSGLYLKDKKCIPCNCEIQGRISSEKFCNTTSGQCFCLENVNGDRCEKCVEGYFNY--------------------------------PN------CKKCLCSP-HALSADCDLNNGKCKCGSNVINRICDKCENLHYWN--NRTDCVPCNCG-RGSLNPKCDMETGNCKCAQNVARRDCSKCDVGYFGLDVTGCKKCPPCYN-GQVCN-NEGICVCPPNTIGNLCNKCSEDSWDFNETIGCKKCNCYINGSYSNICNKISGICACKTAFFGSKCDRCNEGYYGFPNCQPCSCAENG--TKSNELTKCDKITGQCQCKQNVIGTKCKVCRKGTFPSDGTYEGGCFSCFCFGVSEKC--------------------HAILNHRIVENSIYEYHIF---------DEKNSLESGKDYSTIHLNANYPRRFGWPLTMFRPIYVNVMKLFNSHDLSLFYRSIFMNVSVDCLDNKCGREIPEQTE-VFMESYNGLFGMRYXXXXXXXXXXXXXXDFNEHSKNGKWVISQYQNDILDKFIILED---SNVINSNLTRDIFMMALLNVTSLKVKLYT----DKVNPPLIKIKIITYKVMETTQAIGKRVTAVEKCICNALTFGNHCQNPISGYYKEYFNLPNSTKSGSMRTGNRILINLKKCNCNGYSKVCDSVTGDCQNCMGNREGNKCQLCREGFYKNDKNYDQCEPCQCPSAHYNFAQNCTRIESSLELKCQCRIGYSGKSCENCQQGFYGNPIK--GIPCKSCDCNQQGSQSLNCN-EFGICQCSPGVLGIKCDQC-APNYVVEKKTCQSCYSGCTKDLLVRID----TLNETVINFKWKTLPS---------TLDLRLNKINISIQMSSELLNSINKFYKLKNEIKNFSIQFQKMKDDAKEKYGEIEKLKTRYNKVLED-----LRS----TFTDINETISGHEQLGISNELIKNATAYLETIK 5464
            ++  A+I+ +ATCG  G E +C+ V                C +C+  + +  K+  I+          + S  +  WWQSP++  G +++ V + +DLKQ +QI  + LK  +SPRP +WILE+SLDG  + PW +F  +   C    QR++ +L    N K     D E+ C+T +S+P  L +G +  SL+  R    ++        P+ L+ F++ RYIR R     + A    +    L+  S+    +YSL  +++  +  CN HA++  +  ++   + +C C+HNTCG+ CE CCPLF  RP++    CE C C   +  C+Y+  +                G+C +C  NT GI CE C  GFYR  +   T+  PC PC C+   + G C S+G        G C C +G++G NC+ C+ GY      +C  C C   GS+  S   C   C CK++V     C  C  GYF+L + N EGC  C+C G++  C S   + L    L  WK+T     K I++P       L   N       +     YW A   YLGN +TSYG+  + V+  + ++    G     P+VI+  K G    F   S++   +   V      + ++ PT   I        G     ++ T+ +F+S LV +D +LI+A ++++Q    L    +  G V L       +E+C CP G+ GLSCE C  G++R+  N   +Q   +C  C C  HSN+CD  +G C +C HNT G  CE C  GYYG+      N CK+C CP  +             Y   +L   +       Y+C +C    +G HC  C +GY+GNP++   SC+RC C      C+  TGEC  C  NT G  C+ CK G++GD     C  C C + GS S  CD   G+C C+  +  ++CD C  G    + +C  CNC+  G +  ++ C+  +GQC C E V G +C +C +GYF                                  PN      C++C CS   +LS+DCD   G+C C +NV  R CDKC   H WN      C  C C   GS   +C+  TG C C   V  + C++C  G+FG    GC++C  C + GQVC+ + G C+CP  T G  C +C   +W +   +GC++C C   GS    C+   G C C+  + G KCD C  GY+G+P C+ C C   G  T+++    CD   GQC CK  V+G KC  C + TF        GC  CFCFG S +C                      I  H  V +S YEY +           E   ++   D S +  +       G     + P+Y  +   F     S +   ++  +  +       R I  Q   V + +++ L                  +DF E+ +       +Y  ++  +  + E     +  +  + R+  M AL N+  + ++ +      +V    + +    Y +  +T  I K    VE+C C     G  CQ+P   +Y+      N+T   S+   + ++     C+CNG S  CD  TG CQNC GN  G+ C  C EGFY +  +   C+ C CP  + NFA+ C   +   E+ C C+ GY+G+ CE CQ G++G+P++     C+ C+C+  G Q+  C+ E G C C  GV G+KCD+C A  + +    C+ C   CT  LL  ++     L   + N     +P+         +   + N  +     +   L   +    LK E    +++FQ  K  A     E      R + V +      LRS    T +D++        L +   L K A  YL+ I+
Sbjct:  160 VVPRAQISVNATCGQNGAEEYCKQVGAKP------------CGICNAHSSDRAKQRSIQSLISSGSGSGSGSGFEEGWWQSPTLQGGRQFEYVTILLDLKQTFQIFSVWLKSANSPRPASWILEKSLDGINFEPWQYFGLSDADC----QRRW-NLS-GQNGKYVFQNDTEIICSTQFSKPGPLENGVLHASLLKNRPGATDQS-------PE-LMKFITTRYIRIRLQGMHSTANQDNSLDWLLDSPSLEKHSFYSLSQLKVSARLDCNGHANRSHESPDD--PLMQCICQHNTCGAQCEQCCPLFQDRPYQMGGECEICQCYGHAESCTYDPFLDK--------------GICQSCSNNTAGIECEFCEMGFYRELDAPLTD--PCLPCSCNPARSTGGCQSDG--------GSCNCLEGFQGKNCEECAPGYY---GDDCKRCECDERGSL-GSTGSCSGVCQCKLNVEGS-TCSECAPGYFDLSAENAEGCTSCWCSGVSQTCHSAKLQTLAFETLNDWKITDIQRVKPISIPVDAETNRLIFAN-----ELDEVEAIYWQASLGYLGNRLTSYGSRLQLVLSWDVIRGDRSGKPTTGPNVILVGKNGLKIAFGDESLDGLGINLNVTLTEVGWYHVPPTVVDIKTRLRRTEGGDYHGESVTRSQFLSVLVSLDAVLIRAAFHTDQGETSLERAVIYSGGVELGGKSSSQVEQCLCPAGYTGLSCEGCAFGFKRIYENTSDHQILSKCIPCPCNGHSNSCDLQSGNCGDCMHNTFGDRCERCQLGYYGNPLQGTPNDCKRCACPLSEDSNNFSPSCQLKSYNYMDLNPQFELIEHAEYICTQCPEGYTGDHCQVCDDGYFGNPRQPGSSCQRCDCAGG--PCNVTTGECITCRGNTEGWHCERCKLGYWGDPAV-GCDPCHCHTEGSESGLCDSTDGQCLCKPRYAGQKCDECDVGYANVELRCPSCNCDPLGSLVQDR-CDPHTGQCHCKEGVMGAKCHECQDGYFGMNAVAYRMDDLAALRQNSDSDDDEWELVPDTEDPNSESTVACEECHCSSVGSLSSDCDKRTGQCACLANVTGRRCDKCRPGH-WNLTAGEGCRDCRCDPHGSRGHECNPWTGQCDCKIGVGGQHCNECTEGFFGFSTEGCQRCSACRSEGQVCDPHNGRCICPKFTRGLGCGQCVPGTWGWQARLGCRECECDHIGSIGQQCSTGDGQCQCREGYSGRKCDTCAIGYFGYPECRRCGCDAEGSFTQADGSIACDS-NGQCPCKSLVVGLKCDTCMQSTFGLSAQNPEGCTRCFCFGRSGECEQSDLSWGHIRMAESRNLSVQQIRPHS-VPSSDYEYIVVVQMEGSSFHREDAEIQRMNDLSLVPKSTGNV-SIGAYGQFYHPLYFQLPPQFYGDRTSSYGGFLYFTLITEGAHKPLERNILGQYPLVQLHAHSKLL-----------------LDFYEYEE------FEYSLNVTHRVPLHESFWKYHHTSQAVDRNTLMAALQNIRHIFIRAFAFADFQEVVLQNVHMDAAIY-IKGSTNLIAK---GVERCKCPKRFDGLSCQDPGRSFYR----WRNTTIVESVFIED-LIGRAAPCHCNGRSSDCDRETGVCQNCRGNTGGDHCHQCAEGFYGDPNSPHGCQACPCPETNRNFARGCNVWDG--EVSCVCKPGYTGRLCERCQAGYFGDPMRYPNTTCQPCNCHPDGIQTEGCDVETGRCYCREGVTGLKCDKCQAERHHLVDNGCKIC-DNCTLLLLDYMELVGNKLRRGMHNMDLTGIPAPYRKLSEYESAYEKWNGRHWDFSQTKRRLQDYDSADILKLEAHAENLKFQSRKAVATIGKREFAIKSMREDAVTQQHSVGLLRSEILQTLSDLHGYGKSAHYLSLPTAL-KQARFYLQAIR 1973          
BLAST of Laminin subunit alpha-2 vs. Ensembl Fly
Match: LanB2 (gene:FBgn0267348 transcript:FBtr0345031)

HSP 1 Score: 393.275 bits (1009), Expect = 1.187e-110
Identity = 297/1005 (29.55%), Postives = 464/1005 (46.17%), Query Frame = 2
Query:  386 WWQSPSMAQGLKYQN-VNVTIDLKQVYQIVYILLKMGDSPRPGNW-ILERSLDGEIYMPWIFFAETPYSCYNLFQRQYPDLKLTTNAKPSSLADDEMFCTTYYSQPKSLNSGEIIISLINGRKSIMNEEYLSIKSVPQTLINFLSARYIRFRFLKHLTLAADLMTHKGYLEQSIYNRYYYSLRNIEIGGKCICNNHADKC-DKVIENGISVAKCNCKHNTCGSNCETCCPLFNQRPWK-----PVAVCEECNCNRKSNECSYNQTVATLQLSVNKMGRMEGGGVCINCQENTEGINCEKCIKGFYRPWNVLATELYPCTPCQCHGLGTIG-SCVSNGEDIGDQKPGDCICKKGYEGVNCDLCSIGYERYPNGECLPCPCSIDGSVRTSFYRCKPPCN-------CKVHVNSDDLCKTCKNGYFNLDSANPEGCEPCYCFGITNQCSSLSAKNLKISDLKG--------WKLTTFTGEKIALPKFTSFQYLTSENSYIDERFNNPTVYYWTAPPPYLGNWITSYGTIFRYVVKIELQSTLKGSLIDSPDVIIKCGDFRLFHSV-----SIEDRRLQRQVFIYIKPTEWKIGKLTPDKAATKEEFISCLVKVDKLLIKAKYYSNQKSIELLNITLSRGEVHLALDEMPHIEKCNCPPGFNGLSCESCESGYRRVNNVLYQG---QCEACACYNHSNTCDSLNGECQNCTHNTAGAHCEDCASGYYGDAKSKNLNSCKKCPCPRLDYQMTELCSSYSSENYVCHKCLHNTSGVHCDRCIEGYYGNPKKKI----SCKRCKCNNNQE-----SCDPVTGEC-RCSYNTMGTECQLCKHGFYGDALT---KSCKKCDCDSLGSTSEN-----CDKLTGKCDCRTNFVNRQCDSCTSGLY--LKDKKCIPCNCEIQGRISSEKFCNTTSGQCFCLENVNGDRCEKCVEGYFNYPN--CKKCLCSPHALSA-DCDLNNGKCKCGSNVINRICDKCENLHYWNNR--TDCVPC 3229
            WWQS +M +G+++ N VN+T+ L + Y I Y+ + +  SPRP ++ I +R+ +   ++P+ F++ T    Y+L     PD +     +  + A     CT+ YS    L  GEI  S + GR S +N E          L  +++A  IR    +  T   +L     + +  +   Y+Y++ +I +G +C CN HA KC      +G     C C+HNT G +C+ C PL+N   WK      V  C+ CNCN  +++C ++          N   R   GG C++C+EN +G NCE+C + FY     +  + Y C  C C  +G+    C S+G+         C CK G  G  CD C   Y ++    C  C C   GS + +     P C+       CK +V     C  CK G+FNLD  N  GC PC+C+G T++C  ++A    I  +          W        ++ + K+  +       +  +E        Y+ AP  +LG+   SY    ++ +++  Q    G      DVI++    R+   +      I D+ ++   F   +  ++   +  P ++A    F+S L  +  + I+A Y    ++I L ++ L       A      IE+C CP G+ G  CESC  GYR  ++    G    C  C C+ H++ CDS  G C  C HNT G +C+ CA G+YG+A     N CK+CPCP         C   + +  +C +C     G  C++C +G++G+P   +    +CK C CN N +     +C+  TGEC +C +NT G  C  C  G +GD L      C +C C   G+  +      CD++TG+C C+ N + R C  C  G +       C  C C+  G  +S   C+  SGQC C   V G RC++C   ++ + +  CK C C         CD  NG+C C  NV  R CD+C+   Y  +R   DC  C
Sbjct:  130 WWQSETMFEGIQHPNYVNLTLHLGKSYDITYVRI-LFRSPRPESFTIYKRTSESGPWIPYQFYSATCRDTYSL-----PDSRAIRKGEGEAHA----LCTSEYSDISPLRDGEIAFSTLEGRPSGINFERSG------ELQEWVTATDIRITLDRLNTFGDEL-----FGDSQVLKSYFYAISDIAVGARCKCNGHASKCVPSTGMHGERTLVCECRHNTDGPDCDRCLPLYNDLKWKRSTSTEVNECKACNCNGLADKCFFD---------ANLFNRTGHGGHCLDCRENRDGPNCERCKENFY-----MRDDGY-CVNCACDPVGSRSLQCNSHGK---------CQCKPGVTGDKCDRCDNNYYQFGPHGCQQCGCDSGGSHQNT-----PACDTETGICFCKENVEGR-RCNECKPGFFNLDKNNRFGCTPCFCYGHTSEC--MTAPGYSIVSVTSNFNKFKERWTAADLNQREVDI-KYNQYSRSIGTTAQGNEHV------YFQAPDRFLGDQRASYNRDLKFKLQLVGQVANTG----VSDVILEGAGSRISLPIFAQGNGIPDQGVKEYTFRLHEHHDY---QWQPSQSARG--FLSILSNLTAIKIRATYSVQGEAI-LDDVELQTAHRGAAGHPATWIEQCTCPEGYLGQFCESCAPGYR--HSPARGGPFMPCIPCDCHGHADICDSETGRCI-CQHNTHGDNCDQCAKGFYGNALGGTPNDCKRCPCPN-----DGACLQINEDTVICTECPKGYFGSRCEQCSDGFFGDPTGLLGEVQTCKSCDCNGNVDPNAVGNCNRTTGECLKCIHNTAGEHCDQCLSGHFGDPLALPHGRCDRCSCYEAGTEQDEQSITRCDQVTGQCQCKPNVIGRDCGECQPGYFNIRSGNGCENCLCDPVGSYNST--CDRYSGQCHCRPGVMGQRCDQCENYFYGFSSEGCKPCECDESGSKGFQCD-QNGQCPCNDNVEGRRCDRCKENKYDRHRGCIDCPDC 1053          

HSP 2 Score: 146.747 bits (369), Expect = 2.137e-34
Identity = 161/615 (26.18%), Postives = 240/615 (39.02%), Query Frame = 2
Query: 3281 CKCAQNVARRDCSKC-----DVGYFGLDVTGCKKCPPC----------YNGQVCN---NEGICV-CPPNTIGNLCNKCSEDSWDFNETIGCKKCNCYINGSYSNICNKISGICACKTAFFGSKCDRCNEGYYGFP--NCQPCSCAENGTKSNELTKCDKITGQCQCKQNVIGTKCKVCRKGTFPSDGTYEGGCFSCFCFGVSEKCHAILNHRIVENSIYEYHIFDEK-NSLESGKDYSTIHLNANYPRRFGWPLTMFRPIYVNVMKLFNSHDLSLFYRSIFMNVSVDCLDNKCGREIPEQTEVFMESYNGLFGMRYXXXXXXXXXXXXXXDFNEHSKNGKWVISQYQNDILDKFIILEDSNVINSNLTRDIFMMALLNVTSLKVKL-YTDKVNPPLIKIKIITYKVMETTQAIGKRVTAVEKCICNALTFGNHCQNPISGYYKEYFNLPNSTKSGSMRTGNRILINLKKCNCNGYSKVCDSVTGDCQNCMGNREGNKCQLCREGFYKN--DKNYDQCEPCQCPSAHYNFAQNCTRIESSLELKCQCRIGYSGKSCENCQQGFYGNPIKGI----PCKSCDCNQQGSQSL--NCNE-FGIC-QCSPGVLGIKCDQC 5026
            C+C  N    DC +C     D+ +     T   +C  C          ++  + N   + G C+ C  N  G  C +C E+ +  ++   C  C C   GS S  CN   G C CK    G KCDRC+  YY F    CQ C C   G+  N    CD  TG C CK+NV G +C  C+ G F  D     GC  CFC+G + +C     + IV +    ++ F E+  + +  +    I  N  Y R  G        +Y      F     + + R +   + +       G      ++V +E       +                        G  +  Q   +   +     D     S   R  F+  L N+T++K++  Y+ +    L  +++ T        A G   T +E+C C     G  C++   GY           +    R G    +    C+C+G++ +CDS TG C  C  N  G+ C  C +GFY N      + C+ C CP+        C +I     +  +C  GY G  CE C  GF+G+P   +     CKSCDCN     +   NCN   G C +C     G  CDQC
Sbjct:  322 CECRHNTDGPDCDRCLPLYNDLKWKRSTSTEVNECKACNCNGLADKCFFDANLFNRTGHGGHCLDCRENRDGPNCERCKENFYMRDDGY-CVNCACDPVGSRSLQCNS-HGKCQCKPGVTGDKCDRCDNNYYQFGPHGCQQCGCDSGGSHQN-TPACDTETGICFCKENVEGRRCNECKPGFFNLDKNNRFGCTPCFCYGHTSECMTAPGYSIV-SVTSNFNKFKERWTAADLNQREVDIKYN-QYSRSIGTTAQGNEHVYFQAPDRFLGDQRASYNRDLKFKLQLVGQVANTG-----VSDVILEGAGSRISLPIFA-------------------QGNGIPDQGVKEYTFRLHEHHDYQWQPSQSARG-FLSILSNLTAIKIRATYSVQGEAILDDVELQTAH----RGAAGHPATWIEQCTCPEGYLGQFCESCAPGY-----------RHSPARGG--PFMPCIPCDCHGHADICDSETGRCI-CQHNTHGDNCDQCAKGFYGNALGGTPNDCKRCPCPNDGA-----CLQINEDTVICTECPKGYFGSRCEQCSDGFFGDPTGLLGEVQTCKSCDCNGNVDPNAVGNCNRTTGECLKCIHNTAGEHCDQC 883          

HSP 3 Score: 145.591 bits (366), Expect = 5.220e-34
Identity = 105/340 (30.88%), Postives = 159/340 (46.76%), Query Frame = 2
Query: 2594 GVHCDRCIEGYYGNPKKK---ISCKRCKCNNNQESCDPVTGECRCSYNTMGTECQLCKHGFYGDALTKS---CKKCDCDSLGSTSENCDKLTGKCDCRTNFVNRQCDSCT-------SGLYLKDKKCIPCNCEIQGRISSEKFCNTTSGQCF-CLENVNGDRCEKCVEGYFNYP------NCKKCLCSPHALSAD------CDLNNGKCKCGSNVINRICDKCENLHYWNNRT--DCVPCNCGR-GSLNPKCDMETGNCKCAQNVARRDCSKCDVGYFGLDVTGCKKC---PPCYNGQVCNNEGICVCPPNTIGNLCNKCSEDSWDFNETIGCKKC-NCY 3514
            G  C+ C  GY  +P +    + C  C C+ + + CD  TG C C +NT G  C  C  GFYG+AL  +   CK+C C + G+  +  +      +C   +   +C+ C+       +GL  + + C  C+C      ++   CN T+G+C  C+ N  G+ C++C+ G+F  P       C +C C       D      CD   G+C+C  NVI R C +C+   Y+N R+   C  C C   GS N  CD  +G C C   V  + C +C+  ++G    GCK C        G  C+  G C C  N  G  C++C E+ +D +   GC  C +CY
Sbjct:  718 GQFCESCAPGYRHSPARGGPFMPCIPCDCHGHADICDSETGRCICQHNTHGDNCDQCAKGFYGNALGGTPNDCKRCPCPNDGACLQINEDTVICTECPKGYFGSRCEQCSDGFFGDPTGLLGEVQTCKSCDCNGNVDPNAVGNCNRTTGECLKCIHNTAGEHCDQCLSGHFGDPLALPHGRCDRCSCYEAGTEQDEQSITRCDQVTGQCQCKPNVIGRDCGECQ-PGYFNIRSGNGCENCLCDPVGSYNSTCDRYSGQCHCRPGVMGQRCDQCENYFYGFSSEGCKPCECDESGSKGFQCDQNGQCPCNDNVEGRRCDRCKENKYDRHR--GCIDCPDCY 1054          

HSP 4 Score: 142.895 bits (359), Expect = 3.141e-33
Identity = 105/357 (29.41%), Postives = 162/357 (45.38%), Query Frame = 2
Query: 2855 KCDCRTNFVNRQCDSCTSGLYLKDKK------CIPCNCEIQGRISSEKFCNTTSGQCFCLENVNGDRCEKCVEGYFN-----YPN-CKKCLCSPHALSADCDLNNGKC-KCGSNVINRICDKCENLHYWN------NRTDCVPCNCGRGSLNPK----CDMETGNC-KCAQNVARRDCSKCDVGYFG----LDVTGCKKCPPCYNGQVCNNE----------GICVCPPNTIGNLCNKCSEDSWDFNETIGCKKCNCYINGSYSNICNKISGICACKTAFFGSKCDRCNEGYYGFPN--CQPCSCAENGTKSNELTKCDKITGQCQCKQNVIGTKCKVCRKGTFPSDGTYEGGCFSC 3805
            +C C   ++ + C+SC  G      +      CIPC+C     I     C++ +G+C C  N +GD C++C +G++       PN CK+C C         + +   C +C        C++C +  + +          C  C+C  G+++P     C+  TG C KC  N A   C +C  G+FG    L    C +C  CY      +E          G C C PN IG  C +C    ++     GC+ C C   GSY++ C++ SG C C+    G +CD+C   +YGF +  C+PC C E+G+K     +CD+  GQC C  NV G +C  C++  +        GC  C
Sbjct:  709 QCTCPEGYLGQFCESCAPGYRHSPARGGPFMPCIPCDCHGHADI-----CDSETGRCICQHNTHGDNCDQCAKGFYGNALGGTPNDCKRCPCPNDGACLQINEDTVICTECPKGYFGSRCEQCSDGFFGDPTGLLGEVQTCKSCDCN-GNVDPNAVGNCNRTTGECLKCIHNTAGEHCDQCLSGHFGDPLALPHGRCDRCS-CYEAGTEQDEQSITRCDQVTGQCQCKPNVIGRDCGECQPGYFNIRSGNGCENCLCDPVGSYNSTCDRYSGQCHCRPGVMGQRCDQCENYFYGFSSEGCKPCECDESGSKG---FQCDQ-NGQCPCNDNVEGRRCDRCKENKY----DRHRGCIDC 1050          

HSP 5 Score: 112.849 bits (281), Expect = 4.117e-24
Identity = 156/656 (23.78%), Postives = 266/656 (40.55%), Query Frame = 2
Query: 4475 KCICNALTFGNHCQNPISGYYKEYFNLPNST-------KSGSMRTGNRILINLKKCNCNGYSKVCDSVTGDCQNCMGNREGNKCQLCREGFYKNDKNYDQCEPCQC-PSAHYNFAQNCTRIESSLELKCQCRIGYSGKSCENCQQGFYGNPIKGIPCKSCDCNQQGSQSLNCNEFGICQCSPGVLGIKCDQCAPNYVVEKK---TCQSCYS----------------GCTKDLLVRIDTLNETVINFKWKTLPSTL-----DLR-------------LNKINISIQMSSELLNSINKFYKLKN-EI----KNFSIQFQKMKDDAKEKYGEIEKLKTRYNKVLEDLRS---TFTDINETIS--GHEQLGISNELIKNATAYLETIKNIYKEMPNI-TLAASVLKDVLKYVDELNQIIKYTQSHIQSDQINNLKILKNKTIMADEINTNNKEYLNTMSTKKKEHELYIILINERMKDLQKIFRKMTKQRDNLRKKIQKLD----AISKSFQDEKDLISINVREIEDLMKNLSSNHLVSKSLIIPDTLKKHVEQ---QLNKSSNLIKKLTKDFNFLH----NAEQAKEAYSNITRDILAVDYAINQTKKELD-----FNRSNMNIDSLKKLLAEFNSNKSEIVENIKNIDKEHEKLLKQ 6226
            KCI N  T G HC   +SG++ +   LP+         ++G+ +    I               CD VTG CQ C  N  G  C  C+ G++ N ++ + CE C C P   YN    C R       +C CR G  G+ C+ C+  FYG   +G  CK C+C++ GS+   C++ G C C+  V G +CD+C  N     +    C  CY+                  T D + R    N+     K K +   +     D R             ++ ++  +    E L S +KF    N EI    +N++I  Q  ++  KE    ++ L     + L   +     F   +E IS    E   ++++L   A   L+  K+    +     LA S +   LK   EL   +    SH++      ++  K     A+E+       LN ++ ++ + E+ I         L+K      ++ D L K+I +L      +   F+ E++L    ++  E   + L    L+ ++    D   K VEQ    L +++N  +KL    + +     +AE+A +   NI ++I   +  I+Q ++ LD      N +  N    +   AE  S  +E++    N  K   + L++
Sbjct:  870 KCIHN--TAGEHCDQCLSGHFGDPLALPHGRCDRCSCYEAGTEQDEQSIT-------------RCDQVTGQCQ-CKPNVIGRDCGECQPGYF-NIRSGNGCENCLCDPVGSYN--STCDRYSG----QCHCRPGVMGQRCDQCENYFYGFSSEG--CKPCECDESGSKGFQCDQNGQCPCNDNVEGRRCDRCKENKYDRHRGCIDCPDCYNLVQDAADLHRAKLFNLSQTLDEIARTPVTNDDEFEAKLKAVQEKVAVLAQDARDNSGDGGQTYAEVIDDLHKHLDSVREHLVSADKFQADANGEIDRARQNYTILDQITENAKKELQQALDLLNDEGAQALARAKEKSVEFGQQSEQISDISREARALADKLESEAQFDLKNAKDAKDAVEKAHQLAKSAIDLQLKIGTELRSEVGLELSHVKQSLGTVVQTSKEALRKANEVYDTALTLLNDVN-RQTQPEIDI-------SQLKKDAVAANERADELLKQITELSNSNGELFADFETEQELTEALLKRAE--QQQLEDIELLERAKAAHDKATKAVEQGDNTLKEANNTYEKLAGFQSDVQRSSESAEKALQTVPNIEKEIQNAESLISQAEEALDGANKNANEAKKNAQEAQLKYAEQASKDAELIRRKANETKVAARNLRE 1490          

HSP 6 Score: 91.6633 bits (226), Expect = 1.199e-17
Identity = 80/263 (30.42%), Postives = 103/263 (39.16%), Query Frame = 2
Query: 2660 RCKCNNNQESCDPVTGE-------CRCSYNTMGTECQLCKHGFYGDALTK--------SCKKCDCDSLGSTSENCDKLTGKCDCRTNFVNRQCDSCTSGLYLKDKKCIPCNCEIQGRISSEKFCNTTSGQCF-CLENVNGDRCEKCVEGYFNYPN--CKKCLCSP-HALSADCDLNNGKCKCGSNVINRICDKCENLHYWNNRTDCVPCNCGRGSLN---PKCDMETGNCKCAQNVARRDCSKCDVGYFGLDVTGCKKCPPCY 3382
            RCKCN +   C P TG        C C +NT G +C  C    Y D   K         CK C          NC+ L  KC    N  NR                                     G C  C EN +G  CE+C E ++   +  C  C C P  + S  C+ ++GKC+C   V    CD+C+N +Y      C  C C  G  +   P CD ETG C C +NV  R C++C  G+F LD      C PC+
Sbjct:  298 RCKCNGHASKCVPSTGMHGERTLVCECRHNTDGPDCDRCLP-LYNDLKWKRSTSTEVNECKAC----------NCNGLADKCFFDANLFNR---------------------------------TGHGGHCLDCRENRDGPNCERCKENFYMRDDGYCVNCACDPVGSRSLQCN-SHGKCQCKPGVTGDKCDRCDNNYYQFGPHGCQQCGCDSGGSHQNTPACDTETGICFCKENVEGRRCNECKPGFFNLDKNNRFGCTPCF 515          

HSP 7 Score: 69.3218 bits (168), Expect = 6.732e-11
Identity = 49/154 (31.82%), Postives = 69/154 (44.81%), Query Frame = 2
Query: 4613 KKCNCNGYSKVC---------DSVTGDCQNCMGNREGNKCQLCREGFYKNDKNYDQCEPCQCPSAHYNFAQNCTRIESSLELKCQCRIGYSGKSCENCQQGFYGNPIKGIPCKSCDCNQQGSQ--SLNCN-EFGICQCSPGVLGIKCDQCAPNY 5038
            K CNCNG +  C             G C +C  NR+G  C+ C+E FY  D  Y  C  C C             ++ +   KCQC+ G +G  C+ C   +Y     G  C+ C C+  GS   +  C+ E GIC C   V G +C++C P +
Sbjct:  357 KACNCNGLADKCFFDANLFNRTGHGGHCLDCRENRDGPNCERCKENFYMRDDGY--CVNCACDPV------GSRSLQCNSHGKCQCKPGVTGDKCDRCDNNYYQFGPHG--CQQCGCDSGGSHQNTPACDTETGICFCKENVEGRRCNECKPGF 500          

HSP 8 Score: 59.3066 bits (142), Expect = 7.784e-8
Identity = 37/81 (45.68%), Postives = 44/81 (54.32%), Query Frame = 2
Query: 4841 CRIGYSGKSCENCQQGFYGNPIKGIPCKSCDCNQQGSQSLNCNEFGICQCSPGVLGIKCDQCAPNYV-VEKKTCQSCYSGC 5080
            CR    G +CE C++ FY     G  C +C C+  GS+SL CN  G CQC PGV G KCD+C  NY       CQ C  GC
Sbjct:  387 CRENRDGPNCERCKENFYMRD-DGY-CVNCACDPVGSRSLQCNSHGKCQCKPGVTGDKCDRCDNNYYQFGPHGCQQC--GC 463          
BLAST of Laminin subunit alpha-2 vs. Ensembl Fly
Match: LanB2 (gene:FBgn0267348 transcript:FBtr0076382)

HSP 1 Score: 393.275 bits (1009), Expect = 1.187e-110
Identity = 297/1005 (29.55%), Postives = 464/1005 (46.17%), Query Frame = 2
Query:  386 WWQSPSMAQGLKYQN-VNVTIDLKQVYQIVYILLKMGDSPRPGNW-ILERSLDGEIYMPWIFFAETPYSCYNLFQRQYPDLKLTTNAKPSSLADDEMFCTTYYSQPKSLNSGEIIISLINGRKSIMNEEYLSIKSVPQTLINFLSARYIRFRFLKHLTLAADLMTHKGYLEQSIYNRYYYSLRNIEIGGKCICNNHADKC-DKVIENGISVAKCNCKHNTCGSNCETCCPLFNQRPWK-----PVAVCEECNCNRKSNECSYNQTVATLQLSVNKMGRMEGGGVCINCQENTEGINCEKCIKGFYRPWNVLATELYPCTPCQCHGLGTIG-SCVSNGEDIGDQKPGDCICKKGYEGVNCDLCSIGYERYPNGECLPCPCSIDGSVRTSFYRCKPPCN-------CKVHVNSDDLCKTCKNGYFNLDSANPEGCEPCYCFGITNQCSSLSAKNLKISDLKG--------WKLTTFTGEKIALPKFTSFQYLTSENSYIDERFNNPTVYYWTAPPPYLGNWITSYGTIFRYVVKIELQSTLKGSLIDSPDVIIKCGDFRLFHSV-----SIEDRRLQRQVFIYIKPTEWKIGKLTPDKAATKEEFISCLVKVDKLLIKAKYYSNQKSIELLNITLSRGEVHLALDEMPHIEKCNCPPGFNGLSCESCESGYRRVNNVLYQG---QCEACACYNHSNTCDSLNGECQNCTHNTAGAHCEDCASGYYGDAKSKNLNSCKKCPCPRLDYQMTELCSSYSSENYVCHKCLHNTSGVHCDRCIEGYYGNPKKKI----SCKRCKCNNNQE-----SCDPVTGEC-RCSYNTMGTECQLCKHGFYGDALT---KSCKKCDCDSLGSTSEN-----CDKLTGKCDCRTNFVNRQCDSCTSGLY--LKDKKCIPCNCEIQGRISSEKFCNTTSGQCFCLENVNGDRCEKCVEGYFNYPN--CKKCLCSPHALSA-DCDLNNGKCKCGSNVINRICDKCENLHYWNNR--TDCVPC 3229
            WWQS +M +G+++ N VN+T+ L + Y I Y+ + +  SPRP ++ I +R+ +   ++P+ F++ T    Y+L     PD +     +  + A     CT+ YS    L  GEI  S + GR S +N E          L  +++A  IR    +  T   +L     + +  +   Y+Y++ +I +G +C CN HA KC      +G     C C+HNT G +C+ C PL+N   WK      V  C+ CNCN  +++C ++          N   R   GG C++C+EN +G NCE+C + FY     +  + Y C  C C  +G+    C S+G+         C CK G  G  CD C   Y ++    C  C C   GS + +     P C+       CK +V     C  CK G+FNLD  N  GC PC+C+G T++C  ++A    I  +          W        ++ + K+  +       +  +E        Y+ AP  +LG+   SY    ++ +++  Q    G      DVI++    R+   +      I D+ ++   F   +  ++   +  P ++A    F+S L  +  + I+A Y    ++I L ++ L       A      IE+C CP G+ G  CESC  GYR  ++    G    C  C C+ H++ CDS  G C  C HNT G +C+ CA G+YG+A     N CK+CPCP         C   + +  +C +C     G  C++C +G++G+P   +    +CK C CN N +     +C+  TGEC +C +NT G  C  C  G +GD L      C +C C   G+  +      CD++TG+C C+ N + R C  C  G +       C  C C+  G  +S   C+  SGQC C   V G RC++C   ++ + +  CK C C         CD  NG+C C  NV  R CD+C+   Y  +R   DC  C
Sbjct:  130 WWQSETMFEGIQHPNYVNLTLHLGKSYDITYVRI-LFRSPRPESFTIYKRTSESGPWIPYQFYSATCRDTYSL-----PDSRAIRKGEGEAHA----LCTSEYSDISPLRDGEIAFSTLEGRPSGINFERSG------ELQEWVTATDIRITLDRLNTFGDEL-----FGDSQVLKSYFYAISDIAVGARCKCNGHASKCVPSTGMHGERTLVCECRHNTDGPDCDRCLPLYNDLKWKRSTSTEVNECKACNCNGLADKCFFD---------ANLFNRTGHGGHCLDCRENRDGPNCERCKENFY-----MRDDGY-CVNCACDPVGSRSLQCNSHGK---------CQCKPGVTGDKCDRCDNNYYQFGPHGCQQCGCDSGGSHQNT-----PACDTETGICFCKENVEGR-RCNECKPGFFNLDKNNRFGCTPCFCYGHTSEC--MTAPGYSIVSVTSNFNKFKERWTAADLNQREVDI-KYNQYSRSIGTTAQGNEHV------YFQAPDRFLGDQRASYNRDLKFKLQLVGQVANTG----VSDVILEGAGSRISLPIFAQGNGIPDQGVKEYTFRLHEHHDY---QWQPSQSARG--FLSILSNLTAIKIRATYSVQGEAI-LDDVELQTAHRGAAGHPATWIEQCTCPEGYLGQFCESCAPGYR--HSPARGGPFMPCIPCDCHGHADICDSETGRCI-CQHNTHGDNCDQCAKGFYGNALGGTPNDCKRCPCPN-----DGACLQINEDTVICTECPKGYFGSRCEQCSDGFFGDPTGLLGEVQTCKSCDCNGNVDPNAVGNCNRTTGECLKCIHNTAGEHCDQCLSGHFGDPLALPHGRCDRCSCYEAGTEQDEQSITRCDQVTGQCQCKPNVIGRDCGECQPGYFNIRSGNGCENCLCDPVGSYNST--CDRYSGQCHCRPGVMGQRCDQCENYFYGFSSEGCKPCECDESGSKGFQCD-QNGQCPCNDNVEGRRCDRCKENKYDRHRGCIDCPDC 1053          

HSP 2 Score: 146.747 bits (369), Expect = 2.137e-34
Identity = 161/615 (26.18%), Postives = 240/615 (39.02%), Query Frame = 2
Query: 3281 CKCAQNVARRDCSKC-----DVGYFGLDVTGCKKCPPC----------YNGQVCN---NEGICV-CPPNTIGNLCNKCSEDSWDFNETIGCKKCNCYINGSYSNICNKISGICACKTAFFGSKCDRCNEGYYGFP--NCQPCSCAENGTKSNELTKCDKITGQCQCKQNVIGTKCKVCRKGTFPSDGTYEGGCFSCFCFGVSEKCHAILNHRIVENSIYEYHIFDEK-NSLESGKDYSTIHLNANYPRRFGWPLTMFRPIYVNVMKLFNSHDLSLFYRSIFMNVSVDCLDNKCGREIPEQTEVFMESYNGLFGMRYXXXXXXXXXXXXXXDFNEHSKNGKWVISQYQNDILDKFIILEDSNVINSNLTRDIFMMALLNVTSLKVKL-YTDKVNPPLIKIKIITYKVMETTQAIGKRVTAVEKCICNALTFGNHCQNPISGYYKEYFNLPNSTKSGSMRTGNRILINLKKCNCNGYSKVCDSVTGDCQNCMGNREGNKCQLCREGFYKN--DKNYDQCEPCQCPSAHYNFAQNCTRIESSLELKCQCRIGYSGKSCENCQQGFYGNPIKGI----PCKSCDCNQQGSQSL--NCNE-FGIC-QCSPGVLGIKCDQC 5026
            C+C  N    DC +C     D+ +     T   +C  C          ++  + N   + G C+ C  N  G  C +C E+ +  ++   C  C C   GS S  CN   G C CK    G KCDRC+  YY F    CQ C C   G+  N    CD  TG C CK+NV G +C  C+ G F  D     GC  CFC+G + +C     + IV +    ++ F E+  + +  +    I  N  Y R  G        +Y      F     + + R +   + +       G      ++V +E       +                        G  +  Q   +   +     D     S   R  F+  L N+T++K++  Y+ +    L  +++ T        A G   T +E+C C     G  C++   GY           +    R G    +    C+C+G++ +CDS TG C  C  N  G+ C  C +GFY N      + C+ C CP+        C +I     +  +C  GY G  CE C  GF+G+P   +     CKSCDCN     +   NCN   G C +C     G  CDQC
Sbjct:  322 CECRHNTDGPDCDRCLPLYNDLKWKRSTSTEVNECKACNCNGLADKCFFDANLFNRTGHGGHCLDCRENRDGPNCERCKENFYMRDDGY-CVNCACDPVGSRSLQCNS-HGKCQCKPGVTGDKCDRCDNNYYQFGPHGCQQCGCDSGGSHQN-TPACDTETGICFCKENVEGRRCNECKPGFFNLDKNNRFGCTPCFCYGHTSECMTAPGYSIV-SVTSNFNKFKERWTAADLNQREVDIKYN-QYSRSIGTTAQGNEHVYFQAPDRFLGDQRASYNRDLKFKLQLVGQVANTG-----VSDVILEGAGSRISLPIFA-------------------QGNGIPDQGVKEYTFRLHEHHDYQWQPSQSARG-FLSILSNLTAIKIRATYSVQGEAILDDVELQTAH----RGAAGHPATWIEQCTCPEGYLGQFCESCAPGY-----------RHSPARGG--PFMPCIPCDCHGHADICDSETGRCI-CQHNTHGDNCDQCAKGFYGNALGGTPNDCKRCPCPNDGA-----CLQINEDTVICTECPKGYFGSRCEQCSDGFFGDPTGLLGEVQTCKSCDCNGNVDPNAVGNCNRTTGECLKCIHNTAGEHCDQC 883          

HSP 3 Score: 145.591 bits (366), Expect = 5.220e-34
Identity = 105/340 (30.88%), Postives = 159/340 (46.76%), Query Frame = 2
Query: 2594 GVHCDRCIEGYYGNPKKK---ISCKRCKCNNNQESCDPVTGECRCSYNTMGTECQLCKHGFYGDALTKS---CKKCDCDSLGSTSENCDKLTGKCDCRTNFVNRQCDSCT-------SGLYLKDKKCIPCNCEIQGRISSEKFCNTTSGQCF-CLENVNGDRCEKCVEGYFNYP------NCKKCLCSPHALSAD------CDLNNGKCKCGSNVINRICDKCENLHYWNNRT--DCVPCNCGR-GSLNPKCDMETGNCKCAQNVARRDCSKCDVGYFGLDVTGCKKC---PPCYNGQVCNNEGICVCPPNTIGNLCNKCSEDSWDFNETIGCKKC-NCY 3514
            G  C+ C  GY  +P +    + C  C C+ + + CD  TG C C +NT G  C  C  GFYG+AL  +   CK+C C + G+  +  +      +C   +   +C+ C+       +GL  + + C  C+C      ++   CN T+G+C  C+ N  G+ C++C+ G+F  P       C +C C       D      CD   G+C+C  NVI R C +C+   Y+N R+   C  C C   GS N  CD  +G C C   V  + C +C+  ++G    GCK C        G  C+  G C C  N  G  C++C E+ +D +   GC  C +CY
Sbjct:  718 GQFCESCAPGYRHSPARGGPFMPCIPCDCHGHADICDSETGRCICQHNTHGDNCDQCAKGFYGNALGGTPNDCKRCPCPNDGACLQINEDTVICTECPKGYFGSRCEQCSDGFFGDPTGLLGEVQTCKSCDCNGNVDPNAVGNCNRTTGECLKCIHNTAGEHCDQCLSGHFGDPLALPHGRCDRCSCYEAGTEQDEQSITRCDQVTGQCQCKPNVIGRDCGECQ-PGYFNIRSGNGCENCLCDPVGSYNSTCDRYSGQCHCRPGVMGQRCDQCENYFYGFSSEGCKPCECDESGSKGFQCDQNGQCPCNDNVEGRRCDRCKENKYDRHR--GCIDCPDCY 1054          

HSP 4 Score: 142.895 bits (359), Expect = 3.141e-33
Identity = 105/357 (29.41%), Postives = 162/357 (45.38%), Query Frame = 2
Query: 2855 KCDCRTNFVNRQCDSCTSGLYLKDKK------CIPCNCEIQGRISSEKFCNTTSGQCFCLENVNGDRCEKCVEGYFN-----YPN-CKKCLCSPHALSADCDLNNGKC-KCGSNVINRICDKCENLHYWN------NRTDCVPCNCGRGSLNPK----CDMETGNC-KCAQNVARRDCSKCDVGYFG----LDVTGCKKCPPCYNGQVCNNE----------GICVCPPNTIGNLCNKCSEDSWDFNETIGCKKCNCYINGSYSNICNKISGICACKTAFFGSKCDRCNEGYYGFPN--CQPCSCAENGTKSNELTKCDKITGQCQCKQNVIGTKCKVCRKGTFPSDGTYEGGCFSC 3805
            +C C   ++ + C+SC  G      +      CIPC+C     I     C++ +G+C C  N +GD C++C +G++       PN CK+C C         + +   C +C        C++C +  + +          C  C+C  G+++P     C+  TG C KC  N A   C +C  G+FG    L    C +C  CY      +E          G C C PN IG  C +C    ++     GC+ C C   GSY++ C++ SG C C+    G +CD+C   +YGF +  C+PC C E+G+K     +CD+  GQC C  NV G +C  C++  +        GC  C
Sbjct:  709 QCTCPEGYLGQFCESCAPGYRHSPARGGPFMPCIPCDCHGHADI-----CDSETGRCICQHNTHGDNCDQCAKGFYGNALGGTPNDCKRCPCPNDGACLQINEDTVICTECPKGYFGSRCEQCSDGFFGDPTGLLGEVQTCKSCDCN-GNVDPNAVGNCNRTTGECLKCIHNTAGEHCDQCLSGHFGDPLALPHGRCDRCS-CYEAGTEQDEQSITRCDQVTGQCQCKPNVIGRDCGECQPGYFNIRSGNGCENCLCDPVGSYNSTCDRYSGQCHCRPGVMGQRCDQCENYFYGFSSEGCKPCECDESGSKG---FQCDQ-NGQCPCNDNVEGRRCDRCKENKY----DRHRGCIDC 1050          

HSP 5 Score: 112.849 bits (281), Expect = 4.117e-24
Identity = 156/656 (23.78%), Postives = 266/656 (40.55%), Query Frame = 2
Query: 4475 KCICNALTFGNHCQNPISGYYKEYFNLPNST-------KSGSMRTGNRILINLKKCNCNGYSKVCDSVTGDCQNCMGNREGNKCQLCREGFYKNDKNYDQCEPCQC-PSAHYNFAQNCTRIESSLELKCQCRIGYSGKSCENCQQGFYGNPIKGIPCKSCDCNQQGSQSLNCNEFGICQCSPGVLGIKCDQCAPNYVVEKK---TCQSCYS----------------GCTKDLLVRIDTLNETVINFKWKTLPSTL-----DLR-------------LNKINISIQMSSELLNSINKFYKLKN-EI----KNFSIQFQKMKDDAKEKYGEIEKLKTRYNKVLEDLRS---TFTDINETIS--GHEQLGISNELIKNATAYLETIKNIYKEMPNI-TLAASVLKDVLKYVDELNQIIKYTQSHIQSDQINNLKILKNKTIMADEINTNNKEYLNTMSTKKKEHELYIILINERMKDLQKIFRKMTKQRDNLRKKIQKLD----AISKSFQDEKDLISINVREIEDLMKNLSSNHLVSKSLIIPDTLKKHVEQ---QLNKSSNLIKKLTKDFNFLH----NAEQAKEAYSNITRDILAVDYAINQTKKELD-----FNRSNMNIDSLKKLLAEFNSNKSEIVENIKNIDKEHEKLLKQ 6226
            KCI N  T G HC   +SG++ +   LP+         ++G+ +    I               CD VTG CQ C  N  G  C  C+ G++ N ++ + CE C C P   YN    C R       +C CR G  G+ C+ C+  FYG   +G  CK C+C++ GS+   C++ G C C+  V G +CD+C  N     +    C  CY+                  T D + R    N+     K K +   +     D R             ++ ++  +    E L S +KF    N EI    +N++I  Q  ++  KE    ++ L     + L   +     F   +E IS    E   ++++L   A   L+  K+    +     LA S +   LK   EL   +    SH++      ++  K     A+E+       LN ++ ++ + E+ I         L+K      ++ D L K+I +L      +   F+ E++L    ++  E   + L    L+ ++    D   K VEQ    L +++N  +KL    + +     +AE+A +   NI ++I   +  I+Q ++ LD      N +  N    +   AE  S  +E++    N  K   + L++
Sbjct:  870 KCIHN--TAGEHCDQCLSGHFGDPLALPHGRCDRCSCYEAGTEQDEQSIT-------------RCDQVTGQCQ-CKPNVIGRDCGECQPGYF-NIRSGNGCENCLCDPVGSYN--STCDRYSG----QCHCRPGVMGQRCDQCENYFYGFSSEG--CKPCECDESGSKGFQCDQNGQCPCNDNVEGRRCDRCKENKYDRHRGCIDCPDCYNLVQDAADLHRAKLFNLSQTLDEIARTPVTNDDEFEAKLKAVQEKVAVLAQDARDNSGDGGQTYAEVIDDLHKHLDSVREHLVSADKFQADANGEIDRARQNYTILDQITENAKKELQQALDLLNDEGAQALARAKEKSVEFGQQSEQISDISREARALADKLESEAQFDLKNAKDAKDAVEKAHQLAKSAIDLQLKIGTELRSEVGLELSHVKQSLGTVVQTSKEALRKANEVYDTALTLLNDVN-RQTQPEIDI-------SQLKKDAVAANERADELLKQITELSNSNGELFADFETEQELTEALLKRAE--QQQLEDIELLERAKAAHDKATKAVEQGDNTLKEANNTYEKLAGFQSDVQRSSESAEKALQTVPNIEKEIQNAESLISQAEEALDGANKNANEAKKNAQEAQLKYAEQASKDAELIRRKANETKVAARNLRE 1490          

HSP 6 Score: 91.6633 bits (226), Expect = 1.199e-17
Identity = 80/263 (30.42%), Postives = 103/263 (39.16%), Query Frame = 2
Query: 2660 RCKCNNNQESCDPVTGE-------CRCSYNTMGTECQLCKHGFYGDALTK--------SCKKCDCDSLGSTSENCDKLTGKCDCRTNFVNRQCDSCTSGLYLKDKKCIPCNCEIQGRISSEKFCNTTSGQCF-CLENVNGDRCEKCVEGYFNYPN--CKKCLCSP-HALSADCDLNNGKCKCGSNVINRICDKCENLHYWNNRTDCVPCNCGRGSLN---PKCDMETGNCKCAQNVARRDCSKCDVGYFGLDVTGCKKCPPCY 3382
            RCKCN +   C P TG        C C +NT G +C  C    Y D   K         CK C          NC+ L  KC    N  NR                                     G C  C EN +G  CE+C E ++   +  C  C C P  + S  C+ ++GKC+C   V    CD+C+N +Y      C  C C  G  +   P CD ETG C C +NV  R C++C  G+F LD      C PC+
Sbjct:  298 RCKCNGHASKCVPSTGMHGERTLVCECRHNTDGPDCDRCLP-LYNDLKWKRSTSTEVNECKAC----------NCNGLADKCFFDANLFNR---------------------------------TGHGGHCLDCRENRDGPNCERCKENFYMRDDGYCVNCACDPVGSRSLQCN-SHGKCQCKPGVTGDKCDRCDNNYYQFGPHGCQQCGCDSGGSHQNTPACDTETGICFCKENVEGRRCNECKPGFFNLDKNNRFGCTPCF 515          

HSP 7 Score: 69.3218 bits (168), Expect = 6.732e-11
Identity = 49/154 (31.82%), Postives = 69/154 (44.81%), Query Frame = 2
Query: 4613 KKCNCNGYSKVC---------DSVTGDCQNCMGNREGNKCQLCREGFYKNDKNYDQCEPCQCPSAHYNFAQNCTRIESSLELKCQCRIGYSGKSCENCQQGFYGNPIKGIPCKSCDCNQQGSQ--SLNCN-EFGICQCSPGVLGIKCDQCAPNY 5038
            K CNCNG +  C             G C +C  NR+G  C+ C+E FY  D  Y  C  C C             ++ +   KCQC+ G +G  C+ C   +Y     G  C+ C C+  GS   +  C+ E GIC C   V G +C++C P +
Sbjct:  357 KACNCNGLADKCFFDANLFNRTGHGGHCLDCRENRDGPNCERCKENFYMRDDGY--CVNCACDPV------GSRSLQCNSHGKCQCKPGVTGDKCDRCDNNYYQFGPHG--CQQCGCDSGGSHQNTPACDTETGICFCKENVEGRRCNECKPGF 500          

HSP 8 Score: 59.3066 bits (142), Expect = 7.784e-8
Identity = 37/81 (45.68%), Postives = 44/81 (54.32%), Query Frame = 2
Query: 4841 CRIGYSGKSCENCQQGFYGNPIKGIPCKSCDCNQQGSQSLNCNEFGICQCSPGVLGIKCDQCAPNYV-VEKKTCQSCYSGC 5080
            CR    G +CE C++ FY     G  C +C C+  GS+SL CN  G CQC PGV G KCD+C  NY       CQ C  GC
Sbjct:  387 CRENRDGPNCERCKENFYMRD-DGY-CVNCACDPVGSRSLQCNSHGKCQCKPGVTGDKCDRCDNNYYQFGPHGCQQC--GC 463          
BLAST of Laminin subunit alpha-2 vs. Ensembl Fly
Match: LanA (gene:FBgn0002526 transcript:FBtr0077014)

HSP 1 Score: 313.538 bits (802), Expect = 9.129e-85
Identity = 201/552 (36.41%), Postives = 289/552 (52.36%), Query Frame = 2
Query:  188 LMENAKITSSATCG--TGGPEIFCRLVDEIAIQRLINPD--SHVLCDVCDNRNETKRHPIEFAKSDDDNLWWQSPSMAQGLKYQNVNVTIDLKQVYQIVYILLKMGDSPRPGNWILERSLD-GEIYMPWIFFAETPYSCYNLFQRQYPDLKLTTNAKPSSLADDEMFCTTYYSQPKSLNSGEIIISLINGRKSIMNEEYLSIKSVPQTLINFLSARYIRFRFLKHLTLAADLMTHKGYLEQSIYNRYYYSLRNIEIGGKCICNNHADKCD-KVIENGISVAKCNCKHNTCGSNCETCCPLFNQRPWK------PVAVCEECNCNRKSNECSYNQTVATLQLSVNKMGRMEGGGVCINCQENTEGINCEKCIKGFYRPWNVLATELYPCTPCQCHGLGTIGSCVSNGEDIGDQKPGDCICKKGYEGVNCDLCSIGYERYPNGECLPCPCSIDGSVRTSFYRCKPP----CNCKVHVNSDDLCKTCKNGYFNLDSANPEGCEPCYC---FGITNQCSSLSAKNLKISDLKGWKLTTFTGEKIALPKFTSFQYLT 1786
            L    KI ++ATCG  T GPE++C+LV        I+       +CD CD     + HP E A  D    WWQSP +++G+K+  VN+TI+ +Q + + Y+ ++MG+SPRPG W LE+S D G+ + PW  F++TP  C   F +           KP +  DD++ CTT YS+   L +GEI + L+N R S  N  Y +       L  +  A  +R R L+   L   LM+     + ++  RY+YS+++I IGG+C+CN HAD CD K  ++ + +  C C+H+TCG  C  CCP F Q+ W+      P   CE CNC+  SNEC Y++ V    LS++  G  +GGGVC NCQ NT GINC KC   +YRP      E   C+PCQC    + G C        +++ G+C C+  ++  +CD C+ GY  YPN  C  C C+++G   T+ Y C+      C CK++  +   CK C  GY+      PE C+ C C     ITN C      N+   + K   LT F G+     K   F Y T
Sbjct:   31 LATGRKIYATATCGQDTDGPELYCKLVGANTEHDHIDYSVIQGQVCDYCDPTVPERNHPPENA-IDGTEAWWQSPPLSRGMKFNEVNLTINFEQEFHVAYLFIRMGNSPRPGLWTLEKSTDYGKTWTPWQHFSDTPADCETYFGKD--------TYKPIT-RDDDVICTTEYSKIVPLENGEIPVMLLNERPSSTN--YFN----STVLQEWTRATNVRIRLLRTKNLLGHLMS-VARQDPTVTRRYFYSIKDISIGGRCMCNGHADTCDVKDPKSPVRILACRCQHHTCGIQCNECCPGFEQKKWRQNTNARPFN-CEPCNCHGHSNECKYDEEVNRKGLSLDIHGHYDGGGVCQNCQHNTVGINCNKCKPKYYRPKGKHWNETDVCSPCQCDYFFSTGHC--------EEETGNCECRAAFQPPSCDSCAYGYYGYPN--CRECECNLNG---TNGYHCEAESGQQCPCKINF-AGAYCKQCAEGYYGF----PE-CKACECNKIGSITNDC------NVTTGECKC--LTNFGGDNCERCKHGYFNYPT 537          

HSP 2 Score: 298.13 bits (762), Expect = 5.229e-80
Identity = 225/704 (31.96%), Postives = 320/704 (45.45%), Query Frame = 2
Query: 1208 GVCINCQENTEGINCEKCIKGFYRPWNVLATELYPCTPCQCHGLGTIGSCVSNGEDIGDQKPGDCICKKGYEGVNCDLCSIGYERYPNGECLPCPCSIDGSVRTSFYRCKPPCNCKVHVNSDDLCKTCKNGYFNLDSANPEGCEPCYCFGITNQCSSLSAKNLKISDLKGWKLTT--FTGEKIALPKFT--SFQYLTSENS----YIDERFNNPTVYYWTAPPPYLG--NWITSYGTIFRYVVKIELQSTLKGSLIDSPDVIIKCGDFRLFHSVSIEDRRLQRQVFIYIKPTEWKIGKLTPDKAATKEEFISCLVKVDKLLIKAKYYSNQKSIELLNITLSRGEVHL---ALDEMPHIEKCNCPPGFNGLSCESCESGYRRVNNVLYQGQCEACACYNHSNTCDSLNGECQNCTHNTAGAHCEDCASGYYGDAKSKNLNSCKKCPCPRLDYQMTELCSS---YSSENYVCHKCLHNTSGVHCDRCIEGYYGNPKK-KISCKRCKCNNN-----QESCDPVTGEC-RCSYNTMGTECQLCKHGFYGDALT-KSCKKCDCDSLGSTSENCDKLTGKCDCRTNFVNRQCDSCTSGLYLKDK--KCIPCNCEIQGRISSEKFCNTTSGQCFCLENVNGDRCEKCVEGYFNYP--NCKKCLCSP-HALSADCDLNNGKCKCGSNVINRICDKCENLHYWNNRTDCVPCN 3232
            G C+ C  N  G  CEKC    Y    V+      C  C C+ +G     ++NG    D   G C C++  EG  CD+CS GY  +P+  C  C C   G+      +    C CK +V   D C  C +G +NL  +NP+GC  C+CFG T++C S   +   +S LK   +TT  F  E I    +   + + L +E +    +     N+    Y+      L   N I++YG    Y   +   S   G  I +PDVI+      L H+ S E           +   E     ++  K  ++ +F+  L  +  + I+A Y+       L ++ L+  +         +   +E+C+CPPG++G SCE C  GY R  +  Y G C  C C  HS TCD   G C  C H T G HCE C SGYYG+A +     C  C CP L +      +S     S + +  +C    +G  C+ C  G+YG P+     CK C+C+ N     Q SCD  TGEC RC  NT G  C LC  GFYGDA+  K+C+ CDCD LG  ++ CD   G C C  N +  +CD C    Y  +    C  C+C   G  S+   C+  +G C C   V G +C++C   ++ Y    C  C C+  ++    C+ N GKC+C   VI   CD C N         C  CN
Sbjct: 1434 GECM-CPPNVIGDLCEKCAPNTYGFHQVIG-----CEECACNPMG-----IANGNSQCDLFNGTCECRQNIEGRACDVCSNGYFNFPH--CEQCSCHKPGTELEVCDKIDGACFCKKNVVGRD-CDQCVDGTYNLQESNPDGCTTCFCFGKTSRCDSAYLRVYNVSLLKHVSITTPEFHEESIKFDMWPVPADEILLNETTLKADFTLREVNDERPAYFGVLDYLLNQNNHISAYGGDLAYT--LHFTSGFDGKYIVAPDVILFSEHNALVHT-SYEQPSRNEPFTNRVNIVESNFQTIS-GKPVSRADFMMVLRDLKVIFIRANYWEQTLVTHLSDVYLTLADEDADGTGEYQFLAVERCSCPPGYSGHSCEDCAPGYYRDPSGPYGGYCIPCECNGHSETCDCATGICSKCQHGTEGDHCERCVSGYYGNATNGTPGDCMICACP-LPFDSNNFATSCEISESGDQIHCECKPGYTGPRCESCANGFYGEPESIGQVCKPCECSGNINPEDQGSCDTRTGECLRCLNNTFGAACNLCAPGFYGDAIKLKNCQSCDCDDLG--TQTCDPFVGVCTCHENVIGDRCDRCKPDHYGFESGVGCRACDC---GAASNSTQCDPHTGHCACKSGVTGRQCDRCAVDHWKYEKDGCTPCNCNQGYSRGFGCNPNTGKCQCLPGVIGDRCDACPNRWVLIKDEGCQECN 2113          

HSP 3 Score: 244.202 bits (622), Expect = 1.101e-63
Identity = 182/546 (33.33%), Postives = 250/546 (45.79%), Query Frame = 2
Query: 2240 IEKCNCPPGFNGLSCESCESGYR----RVNNVLYQGQCEACACYNHSNTCD----------SLN--------GECQNCTHNTAGAHCEDCASGYYGDAKSKNLNSCKKCPCPRLDYQMTELCSSYSSENYVCHKCLHNTSGVHCDRCIEGYYGNPKKKISCKRCKCN---NNQESCDPVTGE-CRCSYNTMGTECQLCKHGFYGDALTKSCKKCDCDSLGSTSENCDKLTGKCDCRTNFVNRQCDSCTSGLYLKDKKCIPCNCEIQGRISSEKFCNTTSGQCFCLENVNGDRCEKCVEGYFNYPNCKKCLCSPHALSA-DCDLNNGKCKCGSNVINRICDKCENLHYWNNRTDCVPCNC-GRGSLNPKCDMETGNCKCAQNVARRDCSKCDVGYFGLDVTGCKKCPPCYNGQVCNNEG--------ICVCPPNTIGNLCNKCSEDSWDFN--ETIGCKKCNCYINGSYS--NICNKISGICACKTAFFGSKCDRCNEGYYGFPN-----CQPCSCAENGTKSNELTKCDKITGQCQCKQNVIGTKC 3742
            I  C C     G+ C  C  G+     R N       CE C C+ HSN C           SL+        G CQNC HNT G +C  C   YY   K K+ N    C   + DY  +       + N  C       S   CD C  GYYG P    +C+ C+CN    N   C+  +G+ C C  N  G  C+ C  G+YG      CK C+C+ +GS + +C+  TG+C C TNF    C+ C  G Y     C  C+C+ QG  +  + CN  SGQC C E   G RC++C+ G++NYP+CK C CS    SA  CD N GKC C +N   + C  C   +Y  +  DC+PC+C   GS    C+ + G C C  N   R C  C  G++  +   C+ C     G +    G        +C C     G +CN+C    W+ N   T GC+ C+C+ +G+ S  + C   SG C CK    G +C  C +G +   +     C+ CSC   G+     + CDKI+GQC+C   + G  C
Sbjct:  293 ILACRCQHHTCGIQCNECCPGFEQKKWRQNTNARPFNCEPCNCHGHSNECKYDEEVNRKGLSLDIHGHYDGGGVCQNCQHNTVGINCNKCKPKYY-RPKGKHWNETDVCSPCQCDYFFSTGHCEEETGNCECRAAFQPPS---CDSCAYGYYGYP----NCRECECNLNGTNGYHCEAESGQQCPCKINFAGAYCKQCAEGYYG---FPECKACECNKIGSITNDCNVTTGECKCLTNFGGDNCERCKHG-YFNYPTCSYCDCDNQG--TESEICNKQSGQCICREGFGGPRCDQCLPGFYNYPDCKPCNCSSTGSSAITCD-NTGKCNCLNNFAGKQCTLCTAGYY--SYPDCLPCHCDSHGSQGVSCNSD-GQCLCQPNFDGRQCDSCKEGFY--NFPSCEDCNCDPAGVIDKFAGCGSVPVGELCKCKERVTGRICNECKPLYWNLNISNTEGCEICDCWTDGTISALDTCTSKSGQCPCKPHTQGRRCQECRDGTFDLDSASLFGCKDCSCDVGGSWQ---SVCDKISGQCKCHPRITGLAC 815          

HSP 4 Score: 239.965 bits (611), Expect = 1.818e-62
Identity = 199/677 (29.39%), Postives = 299/677 (44.17%), Query Frame = 2
Query: 3221 VPCNCG-RGSLNPKCDMETGNCKCAQNVARRDCSKCDVGYFGLDVTGCKKCPPCYNGQVCN-NEGICVCPPNTIGNLCNKCSEDSWDFNETIGCKKCNCYING--SYSNICNKISGICACKTAFFGSKCDRCNEGYYGFPNCQPCSCAENGTKSNELTKCDKITGQCQCKQNVIGTKCKVCRKGTFPSDGTYEGGCFSCFCFGVSEKCH---------AILNH-RIVENSIYEYHI-FDEKNSLESGKDYSTIHLNANYPRRFGWPLTMFRPIYVNVMKLFNSHDLSLFYRSIFMNVSVDCLDNKCGREIPEQTEVFMESYNGLFGMRYXXXXXXXXXXXXXXDFNEHSKNGKWVISQYQNDILDKFIILEDS--NVINSNLTRDIFMMALLNVTSLKVKL-YTDKVNPPLIKIKIITYKVMETTQAIGK---RVTAVEKCICNALTFGNHCQNPISGYYKEYFNLPNSTKSGSMRTGNRILINLKKCNCNGYSKVCDSVTGDCQNCMGNREGNKCQLCREGFYKNDKN--YDQCEPCQCPSAH--YNFAQNCTRIESSLELKCQCRIGYSGKSCENCQQGFYGNPIK-GIPCKSCDCNQQGSQSLNCNEFGICQCSPG--------VLGIKCDQCAPNY---VVEKKTCQSC----YSGCTKDLLVRIDTLNETVI 5128
            +PCNC   GS + +C    G C+C  NV  R C  C   Y+G     CK C  C N  +C    G C+CPPN IG+LC KC+ +++ F++ IGC++C C   G  + ++ C+  +G C C+    G  CD C+ GY+ FP+C+ CSC + GT   EL  CDKI G C CK+NV+G  C  C  GT+    +   GC +CFCFG + +C          ++L H  I     +E  I FD           +   L A++  R    +   RP Y  V+    + +  +      +  ++       G+ I     +    +N L    Y                 + S+N  +          ++  I+E +   +    ++R  FMM L ++  + ++  Y ++    L+      Y  +    A G    +  AVE+C C     G+ C++   GYY++    P+    G              C CNG+S+ CD  TG C  C    EG+ C+ C  G+Y N  N     C  C CP      NFA +C   ES  ++ C+C+ GY+G  CE+C  GFYG P   G  CK C+C    S ++N  + G C    G          G  C+ CAP +    ++ K CQSC        T D  V + T +E VI
Sbjct: 1373 LPCNCDYAGSTSFECHPFGGQCQCKPNVIERTCGACRSRYYGF--PDCKPCK-CPNSAMCEPTTGECMCPPNVIGDLCEKCAPNTYGFHQVIGCEECACNPMGIANGNSQCDLFNGTCECRQNIEGRACDVCSNGYFNFPHCEQCSCHKPGT---ELEVCDKIDGACFCKKNVVGRDCDQCVDGTYNLQESNPDGCTTCFCFGKTSRCDSAYLRVYNVSLLKHVSITTPEFHEESIKFDMWPVPADEILLNETTLKADFTLR---EVNDERPAYFGVLDYLLNQNNHISAYGGDLAYTLHFTSGFDGKYIVAPDVILFSEHNALVHTSY----------------EQPSRNEPFT---------NRVNIVESNFQTISGKPVSRADFMMVLRDLKVIFIRANYWEQT---LVTHLSDVYLTLADEDADGTGEYQFLAVERCSCPPGYSGHSCEDCAPGYYRD----PSGPYGGY----------CIPCECNGHSETCDCATGICSKCQHGTEGDHCERCVSGYYGNATNGTPGDCMICACPLPFDSNNFATSCEISESGDQIHCECKPGYTGPRCESCANGFYGEPESIGQVCKPCEC----SGNINPEDQGSCDTRTGECLRCLNNTFGAACNLCAPGFYGDAIKLKNCQSCDCDDLGTQTCDPFVGVCTCHENVI 1994          

HSP 5 Score: 229.95 bits (585), Expect = 1.960e-59
Identity = 170/534 (31.84%), Postives = 240/534 (44.94%), Query Frame = 2
Query: 2348 CACYNHSNTCDSLNGECQ------NCTHNTAGAHCEDCASGYYGDAKSKNLNS----CKKCPCP------RLDYQMTELCSSYSSENY-----VCHKCLHNTSGVHCDRCIEGYYGNPKKKI-----SCKRCKCNN--NQESCDPVTGECRCSYNTMGTECQLCKHGFYGDALTKSCKKCDCDSLGSTSENCDKLTGK-CDCRTNFVNRQCDSCTSGLYLKDKKCIPCNCEIQGRISSEKFCNTTSGQCFCLENVNGDRCEKCVEGYFNYPNCKKCLCSPHALSAD-CDLNNGKCKCGSNVINRICDKCENLHYWNNRTDCVPCNCGR-GSLNPKCDMETGNCKCAQNVARRDCSKCDVGYFGLDVTGCKKCPPCY------NGQVCNNEGICVCPPNTIGNLCNKCSEDSWDFNETIGCKKCNCYINGSYSNICN----KISGICACKTAFFGSKCDRCNEGYYGF-----PNCQPCSCAENGTKSNELTKCDKITGQCQCKQNVIGTKCKVCRKGTFPSDGTYEGGCFSCFC 3811
            C C  H++TCD  + +         C H+T G  C +C  G+      +N N+    C+ C C       + D ++     S     +     VC  C HNT G++C++C   YY  PK K       C  C+C+   +   C+  TG C C        C  C +G+YG     +C++C+C+  G+   +C+  +G+ C C+ NF    C  C  G Y    +C  C C   G I+++  CN T+G+C CL N  GD CE+C  GYFNYP C  C C      ++ C+  +G+C C        CD+C  L  + N  DC PCNC   GS    CD  TG C C  N A + C+ C  GY+         C PC+       G  CN++G C+C PN  G  C+ C E  ++F     C+ CNC   G            +  +C CK    G  C+ C   Y+         C+ C C  +GT S  L  C   +GQC CK +  G +C+ CR GTF  D     GC  C C
Sbjct:  273 CMCNGHADTCDVKDPKSPVRILACRCQHHTCGIQCNECCPGFEQKKWRQNTNARPFNCEPCNCHGHSNECKYDEEVNRKGLSLDIHGHYDGGGVCQNCQHNTVGINCNKCKPKYY-RPKGKHWNETDVCSPCQCDYFFSTGHCEEETGNCECRAAFQPPSCDSCAYGYYG---YPNCRECECNLNGTNGYHCEAESGQQCPCKINFAGAYCKQCAEGYY-GFPECKACECNKIGSITND--CNVTTGECKCLTNFGGDNCERCKHGYFNYPTCSYCDCDNQGTESEICNKQSGQCICREGFGGPRCDQC--LPGFYNYPDCKPCNCSSTGSSAITCD-NTGKCNCLNNFAGKQCTLCTAGYYSY-----PDCLPCHCDSHGSQGVSCNSDGQCLCQPNFDGRQCDSCKEGFYNFPS---CEDCNCDPAGVIDKFAGCGSVPVGELCKCKERVTGRICNECKPLYWNLNISNTEGCEICDCWTDGTIS-ALDTCTSKSGQCPCKPHTQGRRCQECRDGTFDLDSASLFGCKDCSC 787          

HSP 6 Score: 149.058 bits (375), Expect = 7.056e-35
Identity = 123/418 (29.43%), Postives = 186/418 (44.50%), Query Frame = 2
Query: 2660 RCKCNNNQESCD------PV-TGECRCSYNTMGTECQLCKHGFY-------GDALTKSCKKCDCDSLGSTSENCDKLT---------------GKC-DCRTNFVNRQCDSCTSGLYLKDKK-------CIPCNCEIQGRISSEKFCNTTSGQCFCLENVNGDRCEKCVEGYFNYPNCKKCLCSPHALSA-DCDLNNG-KCKCGSNVINRICDKCENLHYWNNRTDCVPCNCGR-GSLNPKCDMETGNCKCAQNVARRDCSKCDVGYFGLDVTGCKKCPPCYN----GQVCNNE-GICVCPPNTIGNLCNKCSEDSWDFNETIGCKKCNCYINGSYSNICNKISGICACKTAFFGSKCDRCNEGYYGFPNCQPCSCAENGTKSNELTKCDKITGQCQCKQNVIGTKCKVCRKG--TFPS 3772
            RC CN + ++CD      PV    CRC ++T G +C  C  GF         +A   +C+ C+C    +  +  +++                G C +C+ N V   C+ C    Y    K       C PC C+      S   C   +G C C        C+ C  GY+ YPNC++C C+ +  +   C+  +G +C C  N     C +C   +Y     +C  C C + GS+   C++ TG CKC  N    +C +C  GYF      C  C  C N     ++CN + G C+C     G  C++C    +++ +   CK CNC   GS +  C+  +G C C   F G +C  C  GYY +P+C PC C  +G++      C+   GQC C+ N  G +C  C++G   FPS
Sbjct:  272 RCMCNGHADTCDVKDPKSPVRILACRCQHHTCGIQCNECCPGFEQKKWRQNTNARPFNCEPCNCHGHSNECKYDEEVNRKGLSLDIHGHYDGGGVCQNCQHNTVGINCNKCKPKYYRPKGKHWNETDVCSPCQCDY---FFSTGHCEEETGNCECRAAFQPPSCDSCAYGYYGYPNCRECECNLNGTNGYHCEAESGQQCPCKINFAGAYCKQCAEGYY--GFPECKACECNKIGSITNDCNVTTGECKCLTNFGGDNCERCKHGYFNYPT--CSYC-DCDNQGTESEICNKQSGQCICREGFGGPRCDQCLPGFYNYPD---CKPCNCSSTGSSAITCDN-TGKCNCLNNFAGKQCTLCTAGYYSYPDCLPCHCDSHGSQG---VSCNS-DGQCLCQPNFDGRQCDSCKEGFYNFPS 673          

HSP 7 Score: 134.806 bits (338), Expect = 1.319e-30
Identity = 99/334 (29.64%), Postives = 146/334 (43.71%), Query Frame = 2
Query: 2855 KCDCRTNFVNRQCDSCTSGLYLKDKK-----CIPCNCEIQGRISSEKFCNTTSGQCF-CLENVNGDRCEKCVEGYFNYP------NCKKCLC----SPHALSADCDLNNG----KCKCGSNVINRICDKCENLHYWNNRT---DCVPCNCGRGSLNPK----CDMETGNC-KCAQNVARRDCSKCDVGYFGLDVTGCKKCPPC----YNGQVCNN-EGICVCPPNTIGNLCNKCSEDSWDFNETIGCKKCNCYINGSYSNICNKISGICACKTAFFGSKCDRCNEGYYGFP--NCQPCSCAENGTKSNELTKCDKITGQCQCKQNVIGTKCKVC 3751
            +C C   +    C+ C  G Y          CIPC C         + C+  +G C  C     GD CE+CV GY+         +C  C C      +  +  C+++       C+C        C+ C N  Y    +    C PC C  G++NP+    CD  TG C +C  N     C+ C  G++G D    K C  C       Q C+   G+C C  N IG+ C++C  D + F   +GC+ C+C    S S  C+  +G CACK+   G +CDRC   ++ +    C PC+C +  ++      C+  TG+CQC   VIG +C  C
Sbjct: 1775 RCSCPPGYSGHSCEDCAPGYYRDPSGPYGGYCIPCECN-----GHSETCDCATGICSKCQHGTEGDHCERCVSGYYGNATNGTPGDCMICACPLPFDSNNFATSCEISESGDQIHCECKPGYTGPRCESCANGFYGEPESIGQVCKPCECS-GNINPEDQGSCDTRTGECLRCLNNTFGAACNLCAPGFYG-DAIKLKNCQSCDCDDLGTQTCDPFVGVCTCHENVIGDRCDRCKPDHYGFESGVGCRACDCGA-ASNSTQCDPHTGHCACKSGVTGRQCDRCAVDHWKYEKDGCTPCNCNQGYSRG---FGCNPNTGKCQCLPGVIGDRCDAC 2097          

HSP 8 Score: 134.035 bits (336), Expect = 2.163e-30
Identity = 124/388 (31.96%), Postives = 172/388 (44.33%), Query Frame = 2
Query: 2243 EKCNCPPGFNGLSCESCESGYRRVNNVLYQGQCEACAC---YNHSNTCDSLNGECQNCTHNTAGAHCEDCASGYYGDAKSKNLNSCKKCPCPRLDYQMT--ELCSSYSSENYVCHKCLHNTSGVHCDRCIEGYYGNPKKKISCKRCKCNNNQES---CDPVTGECRCSYNTMGTECQLCKHGFYGDALTKSCKKCDCDSLGSTSENCDKLTGKCDCRTNFVNRQCDSCTSGLYLKDKKCIPCNCEIQGRISSEKFCNTTS-GQ-CFCLENVNGDRCEKCVEGYFNY-----PNCKKCLC-SPHALSA--DCDLNNGKCKCGSNVINRICDKCENLHYWNNRTD---CVPCNCG-RGSLNPKCDMETGNCKCAQNVARRDCSKCDVGYF 3340
            ++C C   F G  C+ C  GY          +C+AC C    + +N C+   GEC+ C  N  G +CE C  GY+      N  +C  C C   D Q T  E+C+  S +      C     G  CD+C+ G+Y  P     CK C C++   S   CD  TG+C C  N  G +C LC  G+Y       C  C CDS GS   +C+   G+C C+ NF  RQCDSC  G Y     C  CNC+  G I     C +   G+ C C E V G  C +C   Y+N        C+ C C +   +SA   C   +G+C C  +   R C +C +  +  +      C  C+C   GS    CD  +G CKC   +    C++    +F
Sbjct:  466 QQCPCKINFAGAYCKQCAEGYYGF------PECKACECNKIGSITNDCNVTTGECK-CLTNFGGDNCERCKHGYF------NYPTCSYCDC---DNQGTESEICNKQSGQCI----CREGFGGPRCDQCLPGFYNYP----DCKPCNCSSTGSSAITCDN-TGKCNCLNNFAGKQCTLCTAGYYS---YPDCLPCHCDSHGSQGVSCNS-DGQCLCQPNFDGRQCDSCKEGFY-NFPSCEDCNCDPAGVIDKFAGCGSVPVGELCKCKERVTGRICNECKPLYWNLNISNTEGCEICDCWTDGTISALDTCTSKSGQCPCKPHTQGRRCQECRDGTFDLDSASLFGCKDCSCDVGGSWQSVCDKISGQCKCHPRITGLACTQPLTTHF 823          

HSP 9 Score: 114.39 bits (285), Expect = 2.222e-24
Identity = 102/344 (29.65%), Postives = 144/344 (41.86%), Query Frame = 2
Query: 2246 KCNCPPGFNGLSCESCESGYRRVNNVLYQGQCEACACYNH---SNTCDSLNGECQNCTHNTAGAHCEDCASGYYGDAKSKNLNSCKKCPCPRLDYQMTELCSSYSSENYVCHKCLHNTSGVHCDRCIEGYYGNPKKKISCKRCKCNNNQE---SCDPVTGECRCSYNTMGTECQLCKHGFYGDALTKSCKKCDCDSLGSTSENCDKLTG--------KCDCRTNFVNRQCDSCTSGLYL-----KDKKCIPCNCEIQGRISSEKFCNTTSGQCFCLENVNGDRCEKCVEGYFNYPN-----CKKCLCS-PHALSADCDLNNGKCKCGSNVINRICDKCENLHYW 3202
            +C C   F G +CE C+ GY           C  C C N    S  C+  +G+C  C     G  C+ C  G+Y      N   CK C C       +   S+ + +N     CL+N +G  C  C  GYY  P     C  C C+++     SC+   G+C C  N  G +C  CK GFY      SC+ C+CD  G      DK  G         C C+     R C+ C   LY        + C  C+C   G IS+   C + SGQC C  +  G RC++C +G F+  +     CK C C    +  + CD  +G+CKC   +    C +    H++
Sbjct:  513 ECKCLTNFGGDNCERCKHGY------FNYPTCSYCDCDNQGTESEICNKQSGQCI-CREGFGGPRCDQCLPGFY------NYPDCKPCNC------SSTGSSAITCDNTGKCNCLNNFAGKQCTLCTAGYYSYP----DCLPCHCDSHGSQGVSCN-SDGQCLCQPNFDGRQCDSCKEGFYN---FPSCEDCNCDPAGVI----DKFAGCGSVPVGELCKCKERVTGRICNECKP-LYWNLNISNTEGCEICDCWTDGTISALDTCTSKSGQCPCKPHTQGRRCQECRDGTFDLDSASLFGCKDCSCDVGGSWQSVCDKISGQCKCHPRITGLACTQPLTTHFF 824          

HSP 10 Score: 108.227 bits (269), Expect = 1.307e-22
Identity = 69/203 (33.99%), Postives = 103/203 (50.74%), Query Frame = 2
Query: 2936 IPCNCEIQGRISSEKFCNTTSGQCFCLENVNGDRCEKCVEGYFNYPNCKKCLCSPHALSADCDLNNGKCKCGSNVINRICDKCE-NLHYWNNRTDCVPCNC---GRGSLNPKCDMETGNCKCAQNVARRDCSKCDVGYFGLDVTGCKKCP---PCYNGQVCNN-EGICVCPPNTIGNLCNKCSEDSWDFNET--IGCKKCNCY 3514
            +PCNC+  G  S E  C+   GQC C  NV    C  C   Y+ +P+CK C C   A+   C+   G+C C  NVI  +C+KC  N + ++    C  C C   G  + N +CD+  G C+C QN+  R C  C  GYF  +   C++C    P    +VC+  +G C C  N +G  C++C + +++  E+   GC  C C+
Sbjct: 1373 LPCNCDYAGSTSFE--CHPFGGQCQCKPNVIERTCGACRSRYYGFPDCKPCKCPNSAM---CEPTTGECMCPPNVIGDLCEKCAPNTYGFHQVIGCEECACNPMGIANGNSQCDLFNGTCECRQNIEGRACDVCSNGYF--NFPHCEQCSCHKPGTELEVCDKIDGACFCKKNVVGRDCDQCVDGTYNLQESNPDGCTTCFCF 1568          

HSP 11 Score: 96.6709 bits (239), Expect = 4.516e-19
Identity = 134/591 (22.67%), Postives = 227/591 (38.41%), Query Frame = 2
Query: 4613 KKCNCNGY-----SKVCDSVTGDCQNCMGNREGNKCQLCREGFYKNDKNYDQCEPC-----------------------------QCPSAHYNF-------AQNCTRIESSLEL-----KCQCRIGYSGKSCENCQQGFYGNPIKGIPCKSCDCNQQGSQSLNCNE-FGICQCSPGVLGIKCDQCAPNYVVEK----KTCQSCYSG---CTKDLLVRIDTLNE-----TVINFKWKTL------------------PSTLDLRLNK----------INISIQMSSELLNSINKFYKLKNEIKNFSIQFQ---KMKDDAKEKYGEIEKL--------KTRYNKVLEDLRSTFTDINETISGHEQLGISNELIKNATAYLETIKNIYKEMPNITL-------AASVLK-DVLKYVDELNQIIKYTQ-SHIQSDQINNLKILKNKTIMADEINTNNKEYLNTMSTKKKEHELYIILINERMKDLQKIFRKMTKQRDNLRKKIQKLDAISKSFQDEKDLISINVREIEDLMKNLSSNHLVSKSLIIPDTLKKHVEQQLNKSSNLIKKLTKDFNFLHNAEQAKEAYSNITRDILAV 6064
            K C C+G         CD+ TG+C  C+ N  G  C LC  GFY +      C+ C                             +C   HY F       A +C    +S +       C C+ G +G+ C+ C    +     G  C  C+CNQ  S+   CN   G CQC PGV+G +CD C   +V+ K    + C +C+      T  +  +ID++ E     T+  F  + L                  P+++DL  +K           + + Q++  L N+ +   +    + N ++ +    K  D AKE    +E L         T+ +  LE  +     IN         G S EL  N    LE  + +Y+E+  + L       + + LK D+ ++ D L  +  +++ S  +S  +    +   K     + +T +++ L      K        LIN  +  L +I +K+    DNLR  + +L++ +K+  +E     + VRE           H  + +L   D  ++   +   K+ +L  + T        A +A  AYS I   + A 
Sbjct: 1915 KPCECSGNINPEDQGSCDTRTGECLRCLNNTFGAACNLCAPGFYGDAIKLKNCQSCDCDDLGTQTCDPFVGVCTCHENVIGDRCDRCKPDHYGFESGVGCRACDCGAASNSTQCDPHTGHCACKSGVTGRQCDRCAVDHWKYEKDG--CTPCNCNQGYSRGFGCNPNTGKCQCLPGVIGDRCDACPNRWVLIKDEGCQECNNCHHALLDVTDRMRYQIDSVLEDFNSVTLAFFTSQKLNYYDQLADELEPKVKLLDPNSVDLSPSKKANSELESDAKSYAKQVNQTLANAFDIRERSSTTLGNITVAYDEAVKSADQAKEAIASVEALSKNLEAAASTKIDAALEQAQHILGQIN---------GTSIELTPNEQV-LEKARKLYEEVNTLVLPIKAQNKSLNALKNDIGEFSDHLEDLFNWSEASQAKSADVERRNVANQKAFDNSKFDTVSEQKLQAEKNIKDAGNF---LINGDLT-LNQINQKL----DNLRDALNELNSFNKNVDEE-----LPVRE---------DQHKEADALT--DQAEQKAAELAIKAQDLAAQYTDMTASAEPAIKAATAYSGIVEAVEAA 2469          

HSP 12 Score: 84.7297 bits (208), Expect = 2.092e-15
Identity = 76/259 (29.34%), Postives = 103/259 (39.77%), Query Frame = 2
Query: 3137 KCKCGSNVINRICDKCENLHYWNNRTD----CVPCNCGRGSLNPKCDMETGNC-KCAQNVARRDCSKCDVGYFGLDVTGCK------KCPPCYNG---------QVCNNEGICVCPPNTIGNLCNKCSEDSWDFNETIG--CKKCNCY--INGSYSNICNKISGICA-CKTAFFGSKCDRCNEGYYG----FPNCQPCSCAENGTKSNELTKCDKITGQCQCKQNVIGTKCKVCRKGTFPSDGTYEG-GCFSCFCFGVS 3823
            +C C        C+ C   +Y +        C+PC C   S    CD  TG C KC        C +C  GY+G    G         CP  ++              ++  C C P   G  C  C+   +   E+IG  CK C C   IN      C+  +G C  C    FG+ C+ C  G+YG      NCQ C C + GT++     CD   G C C +NVIG +C  C+   +   G   G GC +C C   S
Sbjct: 1775 RCSCPPGYSGHSCEDCAPGYYRDPSGPYGGYCIPCECNGHS--ETCDCATGICSKCQHGTEGDHCERCVSGYYGNATNGTPGDCMICACPLPFDSNNFATSCEISESGDQIHCECKPGYTGPRCESCANGFYGEPESIGQVCKPCECSGNINPEDQGSCDTRTGECLRCLNNTFGAACNLCAPGFYGDAIKLKNCQSCDCDDLGTQT-----CDPFVGVCTCHENVIGDRCDRCKPDHY---GFESGVGCRACDCGAAS 2023          

HSP 13 Score: 72.4034 bits (176), Expect = 1.044e-11
Identity = 68/234 (29.06%), Postives = 88/234 (37.61%), Query Frame = 2
Query: 1001 ISVAKCNCKHNTCGSNCETCCPLFNQRPWKPVAVCEECNCNRKSNECSYNQTVATLQLSVNKMGRMEGGGVCINCQENTEGINCEKCIKGFYRPWNVLATELYP-CTPCQCHGLGTIGSCVSNGEDIGDQKPGDCICKKGYEGVNCDLCSIGYERYPNGECLPCPCSIDGSVRTSFYRCKPPCNCKVHVNSDDL-CKTCKNGYFNLDSANPEGCEPCYCFGITNQCSSLSAKNL 1696
            ++  +C C  N  G NCE C   +   P      C  C+C+ +  E              NK       G CI C+E   G  C++C+ GFY          YP C PC C   G+      N         G C C   + G  C LC+ GY  YP  +CLPC C   GS   S   C     C    N D   C +CK G++N  S     C+P         C S+    L
Sbjct:  509 VTTGECKCLTNFGGDNCERCKHGYFNYP-----TCSYCDCDNQGTESEI----------CNKQS-----GQCI-CREGFGGPRCDQCLPGFYN---------YPDCKPCNCSSTGSSAITCDN--------TGKCNCLNNFAGKQCTLCTAGYYSYP--DCLPCHCDSHGSQGVS---CNSDGQCLCQPNFDGRQCDSCKEGFYNFPSCEDCNCDPAGVIDKFAGCGSVPVGEL 699          

HSP 14 Score: 70.8626 bits (172), Expect = 2.647e-11
Identity = 65/222 (29.28%), Postives = 93/222 (41.89%), Query Frame = 2
Query: 1010 AKCNCKHNTCGSNCETCCPLFNQRPWKPVAVCEECNCNRKSNECSYNQTVATLQLSVNKMGRMEGGGVCINCQENTEGINCEKCIKGFYRPWNVLATELYP-CTPCQCHGLGTIG-SCVSNGEDIGDQKPGDCICKKGYEGVNCDLCSIGYERYPNGECLPCPCSIDGSVRTSFYRCKPP-----CNCKVHVNSDDLCKTCKNGYFNLDSANPEGCEPCYCF 1654
             +C C+    G  C+ C P F   P      C+ CNC+          +  +  ++ +  G+        NC  N  G  C  C  G+Y          YP C PC C   G+ G SC S+G+         C+C+  ++G  CD C  G+  +P+  C  C C   G V   F  C        C CK  V +  +C  CK  Y+NL+ +N EGCE C C+
Sbjct:  558 GQCICREGFGGPRCDQCLPGFYNYP-----DCKPCNCS----------STGSSAITCDNTGK-------CNCLNNFAGKQCTLCTAGYYS---------YPDCLPCHCDSHGSQGVSCNSDGQ---------CLCQPNFDGRQCDSCKEGFYNFPS--CEDCNCDPAG-VIDKFAGCGSVPVGELCKCKERV-TGRICNECKPLYWNLNISNTEGCEICDCW 735          

HSP 15 Score: 70.4774 bits (171), Expect = 3.670e-11
Identity = 45/134 (33.58%), Postives = 60/134 (44.78%), Query Frame = 2
Query: 4637 SKVCDSVTGDCQNCMGNREGNKCQLCREGFYKNDKNYDQCEPCQCPSAHYNFAQNCTRIESSLELKCQCRIGYSGKSCENCQQGFYGNPIKGIPCKSCDCNQQGSQSLNCNEFGICQCSPGVLGIKCDQCAPNY 5038
            S++C+  +G C  C     G +C  C  GFY    NY  C+PC C S         + I      KC C   ++GK C  C  G+Y  P     C  C C+  GSQ ++CN  G C C P   G +CD C   +
Sbjct:  550 SEICNKQSGQCI-CREGFGGPRCDQCLPGFY----NYPDCKPCNCSST------GSSAITCDNTGKCNCLNNFAGKQCTLCTAGYYSYP----DCLPCHCDSHGSQGVSCNSDGQCLCQPNFDGRQCDSCKEGF 668          

HSP 16 Score: 68.5514 bits (166), Expect = 1.334e-10
Identity = 42/114 (36.84%), Postives = 53/114 (46.49%), Query Frame = 2
Query: 3473 DFNETIGCKKCNCYINGSYSNICNKISGICACKTAFFGSKCDRCNEGYYGFPNCQPCSCAENGTKSNELTKCDKITGQCQCKQNVIGTKCKVCRKGTFPSDGTYEG-GCFSCFC 3811
            D+N   G   CNC   GS S  C+   G C CK       C  C   YYGFP+C+PC C  +         C+  TG+C C  NVIG  C+ C   T+   G ++  GC  C C
Sbjct: 1367 DYNS--GALPCNCDYAGSTSFECHPFGGQCQCKPNVIERTCGACRSRYYGFPDCKPCKCPNSAM-------CEPTTGECMCPPNVIGDLCEKCAPNTY---GFHQVIGCEECAC 1468          

HSP 17 Score: 67.0106 bits (162), Expect = 3.933e-10
Identity = 57/195 (29.23%), Postives = 86/195 (44.10%), Query Frame = 2
Query: 4475 KCICNALTFGNHCQNPISGYYKEYFNLPNSTKSGSMRTGNRILINLKKCNCN--GYSKVCDSVTGDCQNCMGNREGNKCQLCREGFYKNDKNYDQCEPCQCPSAHYNFAQNCTRIESSLELKCQCRIGYSGKSCENCQQGFYGNPIKGIPCKSCDCNQQG--SQSLNCNEFGI---CQCSPGVLGIKCDQCAPNY 5038
            +CIC     G  C   + G+Y    N P+                 K CNC+  G S +    TG C NC+ N  G +C LC  G+Y    +Y  C PC C S H +   +C       + +C C+  + G+ C++C++GFY  P     C+ C+C+  G   +   C    +   C+C   V G  C++C P Y
Sbjct:  559 QCICREGFGGPRCDQCLPGFY----NYPD----------------CKPCNCSSTGSSAITCDNTGKC-NCLNNFAGKQCTLCTAGYY----SYPDCLPCHCDS-HGSQGVSCNS-----DGQCLCQPNFDGRQCDSCKEGFYNFP----SCEDCNCDPAGVIDKFAGCGSVPVGELCKCKERVTGRICNECKPLY 718          

HSP 18 Score: 67.0106 bits (162), Expect = 4.809e-10
Identity = 52/169 (30.77%), Postives = 70/169 (41.42%), Query Frame = 2
Query: 4604 INLKKCNCNGYSKVCD------------------SVTGDCQNCMGNREGNKCQLCREGFYKNDKNY----DQCEPCQCPSAHYNFAQNCTRIESSLELKCQCRIGYSGKSCENCQQGFYGNPIKGIPCKSCDCNQQGSQSLNCN-EFG-ICQCSPGVLGIKCDQCAPNY 5038
             N + CNC+G+S  C                      G CQNC  N  G  C  C+  +Y+    +    D C PCQC    Y F+      E+     C+CR  +   SC++C  G+YG P     C+ C+CN  G+   +C  E G  C C     G  C QCA  Y
Sbjct:  328 FNCEPCNCHGHSNECKYDEEVNRKGLSLDIHGHYDGGGVCQNCQHNTVGINCNKCKPKYYRPKGKHWNETDVCSPCQC---DYFFSTGHCEEETG---NCECRAAFQPPSCDSCAYGYYGYP----NCRECECNLNGTNGYHCEAESGQQCPCKINFAGAYCKQCAEGY 486          

HSP 19 Score: 61.2326 bits (147), Expect = 2.309e-8
Identity = 65/222 (29.28%), Postives = 93/222 (41.89%), Query Frame = 2
Query: 1004 SVAKCNCKHNTCGSNCETCCPLFNQRPWKPVAVCEECNCNRK---SNECSYNQTVATLQLSVNKMGRMEGGGVCINCQENTEGINCEKCIKGFYRPWNVLATELYP-CTPCQCHGLGTIGSCVSNGEDIGDQKPGDCICKKGYEGVNCDLCSIGYERYPNGECLPCPCSIDGSVRTSFYRCK--PPCNCKVHVNSDDLCKTCKNGYFNLDSANPEGCEPCYC 1651
            S  +C CK N  G+ C+ C   +   P      C+ C CN+    +N+C+                     G C  C  N  G NCE+C  G++          YP C+ C C   GT         +I +++ G CIC++G+ G  CD C  G+  YP  +C PC CS  GS   S   C     CNC ++  +   C  C  GY++        C PC+C
Sbjct:  464 SGQQCPCKINFAGAYCKQCAEGYYGFPE-----CKACECNKIGSITNDCNVTT------------------GEC-KCLTNFGGDNCERCKHGYFN---------YPTCSYCDCDNQGT-------ESEICNKQSGQCICREGFGGPRCDQCLPGFYNYP--DCKPCNCSSTGS---SAITCDNTGKCNC-LNNFAGKQCTLCTAGYYSYPD-----CLPCHC 634          

HSP 20 Score: 55.0694 bits (131), Expect = 1.849e-6
Identity = 88/335 (26.27%), Postives = 111/335 (33.13%), Query Frame = 2
Query:  914 YYSLRNIEIGGKCI---CNNHADKCDKVIENGISVAKCNCKHNTCGSNCETC--------------------CPL-FNQ--------------------RPWKPVAVCEECNCNRKSNECSYNQTVATLQLSVNKMGRMEGG-----GVCINCQENTEGINCEKCIKGFYRPWNVLATELYPCTPCQCHGLGT------IGSCVSNGEDIGDQ----KP-----------------------------GDCICKKGYEGVNCDLCSIGYERYPNGECLPCPCSIDGSVRTSFYRCKP---PCNCKVHVNSDDLCKTCKNGYFNLDSANPEGCEPC 1645
            YY   +   GG CI   CN H++ CD     GI      C+H T G +CE C                    CPL F+                     +P      CE C         S  Q     + S N     +G      G C+ C  NT G  C  C  GFY      A +L  C  C C  LGT      +G C  +   IGD+    KP                             G C CK G  G  CD C++ + +Y    C PC C+  G  R   + C P    C C   V   D C  C N +  +     EGC+ C
Sbjct: 1794 YYRDPSGPYGGYCIPCECNGHSETCD--CATGIC---SKCQHGTEGDHCERCVSGYYGNATNGTPGDCMICACPLPFDSNNFATSCEISESGDQIHCECKPGYTGPRCESCANGFYGEPESIGQVCKPCECSGNINPEDQGSCDTRTGECLRCLNNTFGAACNLCAPGFYGD----AIKLKNCQSCDCDDLGTQTCDPFVGVCTCHENVIGDRCDRCKPDHYGFESGVGCRACDCGAASNSTQCDPHTGHCACKSGVTGRQCDRCAVDHWKYEKDGCTPCNCN-QGYSRG--FGCNPNTGKCQCLPGVIG-DRCDACPNRWVLIKD---EGCQEC 2112          
BLAST of Laminin subunit alpha-2 vs. Ensembl Zebrafish
Match: lama1 (laminin, alpha 1 [Source:ZFIN;Acc:ZDB-GENE-060118-1])

HSP 1 Score: 694.115 bits (1790), Expect = 0.000e+0
Identity = 425/1222 (34.78%), Postives = 650/1222 (53.19%), Query Frame = 2
Query:   86 LKMRIFIIFILLIVH------KAHSQDDEPEILSVNVDGLLMENAKITSSATCGTGGPEIFCRLVDEIAIQRLINPDSHVLCDVCD--NRNETKRHPIEFAKSDDDNLWWQSPSMAQGLKYQNVNVTIDLKQVYQIVYILLKMGDSPRPGNWILERSLDGEIYMPWIFFAETPYSC---YNLFQRQYPDLKLTTNAKPSSLADDEMFCTTYYSQPKSLNSGEIIISLINGRKSIMNEEYLSIKSVPQTLINFLSARYIRFRFLKHLTLAADLMT----HKGYLEQSIYNRYYYSLRNIEIGGKCICNNHADKC--DKVIENGISVAKCNCKHNTCGSNCETCCPLFNQRPWKPVAV-----CEECNCNRKSNECSYNQTVATLQLSVNKMGRMEGGGVCINCQENTEGINCEKCIKGFYRPWNVLATELYPCTPCQCHGLGTIGS-CVSN----GEDIGDQKPGDCICKKGYEGVNCDLCSIGYERYPNGECLPCPCSIDGSVRTSFYRCKPPCNCKVHVNSDDLCKTCKNGYFNLDSANPEGCEPCYCFGITNQCSSLSAKNLKISDLKGWKLTTFTGEKIALPKFTSFQYLTSENSYIDERFNNP---TVYYWTAPPPYLGNWITSYGTIFRYVVKIEL-QSTLKGSLIDSPDVIIKCGDFRLFHSVS---IEDRRLQRQVFIYIKPTEWKIGKLTPDKAATKEEFISCLVKVDKLLIKAKYY-SNQKSIELLNITLSRGEVHLALDEMP-HIEKCNCPPGFNGLSCESCESGYRRVNNVLYQGQCEACACYNHSNTCDSLNGECQNCTHNTAGAHCEDCASGYYGDAKSKNLNSCKKCPCP--RLDYQMTELCSSYSSENYVCHKCLHNTSGVHCDRCIEGYYGNPK-KKISCKRCKCNNNQES-----CDPVTGEC-RCSYNTMGTECQLCKHGFYGDALT-KSCKKCDCDSLGSTSENCDKLTGKCDCRTNFVNRQCDSCTSGLYL--KDKKCIPCNCEIQGRISSEKFCNTTSGQCFCLENVNGDRCEKCVEGYFNYP--NCKKCLCSPHALSADCDLNNGKCKCGSNVINRICDKCENLHYWNNR-TDCVPCNCGR-GSLNPKCDMETGNCKCAQNVARRDCSKCDVGYFGL-DVTGCKKCPPCYNGQVCN---------NEGICVCPPNTIGNLCNKCSEDSWDFNE--TIGCKKCNCYINGSYSNICNKISGI 3559
            ++MR+ ++++L +V       +A  +   P IL+      L  NA+I+++ATCG   PE+FC+LV+ +  +R+ NP     C +CD  ++N  ++HPI  A  D  NLWWQSPS+  G ++  V VT+DL+QV+Q+ YI++K  +SPRPGNWILERSLDG  + PW F+A +   C   YN+  R  P         P+   DDE+ CT+YYS+   L  GEI  SLINGR S           +   L+ F SAR+IR R  +  TL ADLMT        ++  +  RYYYS+++I +GG CIC  HA  C  D V +      +C C+HNTCG +C  CCP ++Q PW+P  +     CE+CNC+ K+++C YNQTVA L+LS+N  G+  GGGVC+NC+ NT G+NCE C  G+YRP  V      PC  CQC   G++   C+ +      D G   PG C+CK+G+ G  CD C+ G+  +P   C  C CS+DGS  T    C   C CK +V     C  CK G++NL ++NPEGC  C+CFG+++ C S +  +  +    G         ++     + +  ++ EN  I  R  +    +V+ W AP P+L N +TSYG+   Y V  +  +  +  +L     VII+     L  + S   + +    ++VF+ + P  +        ++  ++E ++ L  V  L ++A+   S + ++ L +++L  G+ +  + ++   +E C CP G++G SCE C  G+ RV  +L+ G C  C C +H+  CD +NGEC  C HNT G HC+ C  G+YGDA     + C++C CP        +  C   +   ++C +C    +G  C RC +GY+G P      C  C+CN N +      CD  TGEC +C  +T G  C+ C+ G+YGDA+  K+C+ C C S GS S  C+ +TG+C+C+ N V + CD C  G +     + C PC C   G +S+   C+   G+C C+  V GD+C++C  GY+N+    C  C C+      +C+   G+C C  +     C++C+  H+ ++  + C  CNC   GS + +CD+ +G C CA   +   C +C +GY      + C   P     Q C+         + G C C  N  G  C++C   S+  +     GC  C C+     S++C ++SG+
Sbjct:    2 MEMRMKMLWLLALVFSSVICVEAQQRGLFPAILN------LASNAEISTNATCGDPDPEMFCKLVEHVPGRRIRNPQ----CRICDANSQNPKEQHPITNAI-DGTNLWWQSPSIKNGRQFHWVTVTLDLRQVFQVAYIIIKAANSPRPGNWILERSLDGVNFQPWQFYAISDTECLTRYNITPRIGP---------PTYKRDDEVICTSYYSRLVPLEHGEIHTSLINGRPSA--------DDLTPELLEFTSARFIRLRLQRIRTLNADLMTLSYRDPKDVDPIVTRRYYYSIKDISVGGMCICYGHAQSCPWDPVTKK----LQCVCEHNTCGESCNECCPGYHQEPWQPGTLSDGNTCEKCNCHNKADDCFYNQTVADLKLSMNTHGQFTGGGVCVNCRHNTAGVNCETCADGYYRPHQVSPYAEEPCVECQCDMRGSVSPVCIRDDNHANPDAG-LSPGQCVCKEGFAGEKCDRCAFGFRDFP--VCSRCECSLDGSHNTD--PCM-ECVCKANVMGSH-CDLCKQGFYNLQASNPEGCTECFCFGVSDVCESSTWFSSSVVHRDG------VLHRLHQTSISFWSPVSDENLIISNRSTDADPSSVWTWAAPEPFLNNKLTSYGSFLNYSVAYDTSEENVDKTLRSHFSVIIEGNGRTLRQAQSARLLLNAHTHQRVFVQMLPQIFIDSH--SGRSVQRDELMTVLADVAALRVRAELEDSAEGTLRLSHVSLGVGDSNSDVSKISLDVEHCECPWGYSGTSCELCIPGFYRVGGILFGGNCLPCECNDHATECD-INGECLGCAHNTTGPHCDQCLPGFYGDASEGTPDDCQRCSCPLTLASNNFSPTCQLQAPGEFICDQCQPGYTGDKCQRCADGYFGEPAVPGQRCSPCECNGNVDPSEAGRCDTHTGECLKCVGHTAGPHCERCRDGYYGDAIQEKNCQACGCYSNGSLSTICNLITGQCECKHNVVGKTCDRCQEGYHGINSGEGCRPCECNQSGALSAS--CD-EEGRCQCITGVTGDKCDRCHHGYYNFKENGCTACDCA--HTHGNCNDQTGECICPPHTHGLKCEQCDEGHWGHDGVSGCKVCNCSAVGSSSSQCDLSSGQCVCALQFSGLTCDRCALGYRNFPQCSACDCNPNGTRAQFCDEALGVCGCEDHGQCSCKDNVGGRGCDECKSGSFGLSALNPAGCSPCFCF---GLSDVCEELSGL 1167          

HSP 2 Score: 357.066 bits (915), Expect = 7.408e-98
Identity = 345/1238 (27.87%), Postives = 537/1238 (43.38%), Query Frame = 2
Query: 2573 KCLHNTSGVHCDRCIEGYY--GNPKKKISCKRCKCNNNQESCDPVTGEC-RCSYNTMGTECQLCKHGFYGDA---LTKSCKKCDCD-SLGST--SENCD-KLTGK--CD-CRTNFVNRQCDSCTSGLY----LKDKKCIPCNCEIQGRISSEKFCNTTSGQCF-CLENVNGDRCEKCVEGYFN----YPNCKKCLC-SPHALSADCDLNNGKCKCGSNVINRICDKC-ENLHYWNNRTDCVPCNCGR-GSLNPKCDMETGNCKCAQNVARRDCSKCDVGYFGLDVTGCKKCPPCYNGQVCNNE-GICVCPPNTIGNLCNKCSEDSWDFNETIGCKKCNCYINGSYSNICNKISGICACKTAFFGSKCDRCNEGYYGFPNCQPCSCAENGTKSN----ELTKCD-KITGQCQCKQNVIGTKCKVCRKGTFPSDGTYEGGCFSCFCFGVSEKCH---AILNHRIVENS----IYEYHIFDEKNSLESGKDYSTIHLNANYPRRFGWPLTMFRPIYVNVMKLFNSHDLSLFYRSIFMNVSVDCLDNKCGREIPEQTEVFMESYNGLFGMRYXXXXXXXXXXXXXXDFNEHS-KNGKWVISQYQNDILDKFIILEDSNVINSNLTRDIFMMALLNVTSLKVKL-YTDKVNPPLIK-IKIITYKVMETTQAIGKRVTAVEKCICNALTFGNHCQNPISGYYKEYFNLPNSTKSGSMRTGNRILINL-KKCNCNGYSKVCDSVTGDCQNCMGNREGNKCQLCREGFY-KNDKNYDQCEPCQCPSAHYNFAQNCTRIESSLELKC-QCRIGYSGKSCENCQQGFYGNPIK-GIPCKSCDCNQQGSQSLNCNEF-GICQCSPGVLGIKCDQCAPNYVVEKKTCQSCYSGCT--KDLLVRIDTLNETVINFKWKTLPSTLDLRLNKINISIQMSSELLNSINKFYKLKNEIKNFSIQFQKMKDDAKEKYGEIEKLKTRYNKVLEDLRSTFTDINETISGHEQLGISNELIKNATAYLETIKNIYKEMPNITLAASVLKDVL-KYVDELNQ--IIKYTQSHIQSDQINNLKILKNKTIMA------------DEINT---NNKEYLNTMSTKKKEHELYIILINER--------------MKDLQKIFRKMTKQRDNLRKKIQKLDAISKSFQDEKDLISINVREIEDLMKNLSS-NHLVSKSLIIPDTLKKHVEQQLNKSSNLIKKLTK--DFNFLHNAEQAKEAYS 6037
            +C    SG  C+ CI G+Y  G      +C  C+CN++   CD + GEC  C++NT G  C  C  GFYGDA       C++C C  +L S   S  C  +  G+  CD C+  +   +C  C  G +    +  ++C PC C      S    C+T +G+C  C+ +  G  CE+C +GY+       NC+ C C S  +LS  C+L  G+C+C  NV+ + CD+C E  H  N+   C PC C + G+L+  CD E G C+C   V    C +C  GY+     GC  C   +    CN++ G C+CPP+T G  C +C E  W  +   GCK CNC   GS S+ C+  SG C C   F G  CDRC  GY  FP C  C C  NGT++      L  C  +  GQC CK NV G  C  C+ G+F        GC  CFCFG+S+ C     ++   IV  S    +      D + +LE G  YS   +  +  +     L +  P Y  + + +N + L  +   +   ++    D   G  +  Q    +    G    + ++    S   N I    EH+    KW   +Y N + D+ +   D            FM  L N+  + +K  Y   +    I  I + T    +     G     VE C C     G  CQ    GYY++  +  N      M+  NR LI     C C+ +S+ CD  TG C  C  N  G  C +C  G+Y K   +   C  C CP    +F+  C  +E + + +C +C  GY G+ CE C  G++GNP + G  C+ C C++ GS    C+   G C+C PGV G  CDQC   +V+  + C SC   CT      +    ++ T +N     L     L      ++IQ  +  L S+  +    N+  ++  Q    ++ ++   G+I  L+ +   V ED         +  +  +QL             LE I NI+  +  +    S +   L + +DE N   +++ T   ++  +  NL   +N   +             DEI+    NN+     +ST    H L +  + E               ++D+Q     +T  R+N+     +++      Q+ +DL++  +   ED+    ++ + L +   +   +L+KHV+       +L+  LTK      ++ AE   +A S
Sbjct:  713 ECPWGYSGTSCELCIPGFYRVGGILFGGNCLPCECNDHATECD-INGECLGCAHNTTGPHCDQCLPGFYGDASEGTPDDCQRCSCPLTLASNNFSPTCQLQAPGEFICDQCQPGYTGDKCQRCADGYFGEPAVPGQRCSPCECNGNVDPSEAGRCDTHTGECLKCVGHTAGPHCERCRDGYYGDAIQEKNCQACGCYSNGSLSTICNLITGQCECKHNVVGKTCDRCQEGYHGINSGEGCRPCECNQSGALSASCD-EEGRCQCITGVTGDKCDRCHHGYYNFKENGCTACDCAHTHGNCNDQTGECICPPHTHGLKCEQCDEGHWGHDGVSGCKVCNCSAVGSSSSQCDLSSGQCVCALQFSGLTCDRCALGYRNFPQCSACDCNPNGTRAQFCDEALGVCGCEDHGQCSCKDNVGGRGCDECKSGSFGLSALNPAGCSPCFCFGLSDVCEELSGLVRAPIVLGSSPALLRVVSQSDLQGTLE-GVYYSDDEMLLDVDQLNKLSL-LTGPYYWRLPQKYNGNKLLSYGGRLSYTLTFFAQD---GVGLANQEPQVL--LRGGHLRKLVIYTDASAPANGIRSTQEHALTEHKW---KYFNSVSDEAVSHAD------------FMSVLSNLEYVIIKASYGSGLQQSRISNISMETALEADELPEGGDVARLVEICECPPGYAGLSCQECAPGYYRQAVSELN------MKGRNRPLIQPCVPCRCSNHSQSCDLHTGQCLGCQHNTAGEHCHVCAAGYYGKVQGSVSDCSLCTCPLRGQSFSSTCV-LEGAGDFRCDRCEEGYEGRYCERCAVGYFGNPSEPGGRCQVCACSESGSVHSVCDAHTGRCECKPGVRGHLCDQCEERHVLVHEQCVSCNDSCTGVLLDDLDALDVSITSVNLTGVILAPYSQL------MTIQNQTRELTSLMSW----NQTPDY--QLTAGEEHSRNLSGQITDLQQQVQSVFEDSGDVLLTSEQRFTQGKQL-------------LELINNIHSAIHGLVEQVSSVNVTLDEGLDEANSTFLLEETSETLEKIRSFNLTHCRNAAEIQLSSAVSVLEKVEDEISKPYRNNQIRRENISTTLNTHNLNLQQVQESLNTAKTHNNQSRRLLQDIQSNTHTLTISRNNVSSLNHEVET---QVQEAQDLLTDALNIAEDMDNGTTTLDELKNDLELWSPSLRKHVD-------SLVMDLTKRDALQLVYRAEDHAQALS 1884          

HSP 3 Score: 236.498 bits (602), Expect = 2.408e-61
Identity = 165/556 (29.68%), Postives = 250/556 (44.96%), Query Frame = 2
Query: 1208 GVCINCQENTEGINCEKCIKGFYRPWNVLATELYPCTPCQCHGLGTIGSCVSNGEDIGDQKPGDCICKKGYEGVNCDLCSIGYERYPNGECLPCPCSIDGSVRTSFYRCKPP-----------CNCKVHVNSDDLCKTCKNGYFNLDSANPEGCEPCYCFGITNQCSSLSAKNLKISDLKGWKLTTFTGEKIALPKFTSFQYLTSENSYID-ERFNNPTV----YYWTAPPPYLGNWITSYGTIFRYVVKIELQSTLKGSLIDSPDVIIKCGDFR---LFHSVSIEDRRLQRQVFIYIKPTEWKIGKLTPDKAATKEEFISCLVKVDKLLIKAKYYSNQKSIELLNITLSRGEVHLALDEMPH-------IEKCNCPPGFNGLSCESCESGYRR--VNNVLYQGQ-------CEACACYNHSNTCDSLNGECQNCTHNTAGAHCEDCASGYYGDAKSKNLNSCKKCPCPRLDYQMTELCSSYSSENYVCHKCLHNTSGVHCDRCIEGYYGNPKKKIS-CKRCKCNNN---QESCDPVTGECRCSYNTMGTECQLCK 2758
            G CI C  +T G+ CE+C +G +    V       C  C C  +G+  S             G C+C   + G+ CD C++GY  +P  +C  C C+ +G+ R  F  C              C+CK +V     C  CK+G F L + NP GC PC+CFG+++ C  LS        L           +  L       Y + +   +D ++ N  ++    YYW  P  Y GN + SYG    Y +    Q  + G     P V+++ G  R   ++   S     ++      +   +WK      D+A +  +F+S L  ++ ++IKA Y S  +   + NI++   E  L  DE+P        +E C CPPG+ GLSC+ C  GY R  V+ +  +G+       C  C C NHS +CD   G+C  C HNTAG HC  CA+GYYG  +  +++ C  C CP      +  C    + ++ C +C     G +C+RC  GY+GNP +    C+ C C+ +      CD  TG C C     G  C  C+
Sbjct: 1015 GECI-CPPHTHGLKCEQCDEGHWGHDGVSG-----CKVCNCSAVGSSSSQCD-------LSSGQCVCALQFSGLTCDRCALGYRNFP--QCSACDCNPNGT-RAQF--CDEALGVCGCEDHGQCSCKDNVGGRG-CDECKSGSFGLSALNPAGCSPCFCFGLSDVCEELSGLVRAPIVLGSSPALLRVVSQSDLQGTLEGVYYSDDEMLLDVDQLNKLSLLTGPYYWRLPQKYNGNKLLSYGGRLSYTLTFFAQDGV-GLANQEPQVLLRGGHLRKLVIYTDASAPANGIRSTQEHALTEHKWKYFNSVSDEAVSHADFMSVLSNLEYVIIKASYGSGLQQSRISNISM---ETALEADELPEGGDVARLVEICECPPGYAGLSCQECAPGYYRQAVSELNMKGRNRPLIQPCVPCRCSNHSQSCDLHTGQCLGCQHNTAGEHCHVCAAGYYGKVQG-SVSDCSLCTCPLRGQSFSSTCVLEGAGDFRCDRCEEGYEGRYCERCAVGYFGNPSEPGGRCQVCACSESGSVHSVCDAHTGRCECKPGVRGHLCDQCE 1546          

HSP 4 Score: 167.162 bits (422), Expect = 2.999e-40
Identity = 158/606 (26.07%), Postives = 259/606 (42.74%), Query Frame = 2
Query: 3407 GICV-CPPNTIGNLCNKCSEDSWDFNETIG-----CKKCNCYINGSYSNIC-------NKISGI----CACKTAFFGSKCDRCNEGYYGFPNCQPCSCAENGTKSNELTKCDKITGQCQCKQNVIGTKCKVCRKGTFPSDGTYEGGCFSCFCFGVSEKCHAI------------LNHRIVENSIYEYHIFDEKNSLESGK----DYSTIHLNANYPRRFGWPLTMFRPIYVNVMKLFNSHDLSLFYRSIFMNVSV--DCLDNKCGREIPEQTEVFMESYNGLFGMRYXXXXXXXXXXXXXXDFNEHSKNGKWVISQYQNDILDKFIILEDSNVINSNLTRDIFMMALLNVTSLKVKLYTDKVNPPLIKIKIITYKVMETTQAIGKRVTAVEKCICNALTFGNHCQNPISGYYKEYFNLPNSTKSGSMRTGNRILINLKKCNCNGYSKVCDSVTGDCQNCMGNREGNKCQLCREGFYKN--DKNYDQCEPCQCPS--AHYNFAQNCTRIESSLELKC-QCRIGYSGKSCENCQQGFYGNP-IKGIPCKSCDCNQ--QGSQSLNCNEF-GIC-QCSPGVLGIKCDQCAPNY---VVEKKTCQSCYSGC 5080
            G+CV C  NT G  C  C++  +  ++        C +C C + GS S +C       N  +G+    C CK  F G KCDRC  G+  FP C  C C+ +G+ + +         +C CK NV+G+ C +C++G +    +   GC  CFCFGVS+ C +             + HR+ + SI  +    ++N + S +    D S++           W      P   N +  + S          F+N SV  D  +    + +     V +E  NG          ++  + +  +  N H+    +V       +L +  I   S     ++ RD  M  L +V +L+V+   +      +++  ++  V ++   + K    VE C C     G  C+  I G+Y+           G +  G   L     C CN ++  CD + G+C  C  N  G  C  C  GFY +  +   D C+ C CP   A  NF+  C ++++  E  C QC+ GY+G  C+ C  G++G P + G  C  C+CN     S++  C+   G C +C     G  C++C   Y    +++K CQ+C  GC
Sbjct:  366 GVCVNCRHNTAGVNCETCADGYYRPHQVSPYAEEPCVECQCDMRGSVSPVCIRDDNHANPDAGLSPGQCVCKEGFAGEKCDRCAFGFRDFPVCSRCECSLDGSHNTDPCM------ECVCKANVMGSHCDLCKQGFYNLQASNPEGCTECFCFGVSDVCESSTWFSSSVVHRDGVLHRLHQTSISFWSPVSDENLIISNRSTDADPSSV-----------WTWAAPEPFLNNKLTSYGS----------FLNYSVAYDTSEENVDKTLRSHFSVIIEG-NG---------RTLRQAQSARLLLNAHTHQRVFV------QMLPQIFIDSHSG---RSVQRDELMTVLADVAALRVRAELEDSAEGTLRLSHVSLGVGDSNSDVSKISLDVEHCECPWGYSGTSCELCIPGFYR----------VGGILFGGNCL----PCECNDHATECD-INGECLGCAHNTTGPHCDQCLPGFYGDASEGTPDDCQRCSCPLTLASNNFSPTC-QLQAPGEFICDQCQPGYTGDKCQRCADGYFGEPAVPGQRCSPCECNGNVDPSEAGRCDTHTGECLKCVGHTAGPHCERCRDGYYGDAIQEKNCQAC--GC 907          

HSP 5 Score: 59.3066 bits (142), Expect = 1.117e-7
Identity = 58/223 (26.01%), Postives = 93/223 (41.70%), Query Frame = 2
Query: 4460 VTAVEKCICNALTFGNHCQNPISGYYKEYFNLPNSTKSGSMRTGNRILINLKKCNCNGYSKVC---DSVT---------------GDCQNCMGNREGNKCQLCREGFYKNDK----NYDQCEPCQCPSAHYNFAQNCTRIESSLEL-------KCQCRIGYSGKSCENCQQGFYGNPIKGIPCKSCDCNQQGSQSLN-CNEFGICQCSPGVLGIKCDQCAPNY 5038
            VT   +C+C   T G  C     GY++E +      + G++  GN      +KCNC+  +  C    +V                G C NC  N  G  C+ C +G+Y+  +      + C  CQC     + +  C R ++           +C C+ G++G+ C+ C  GF   P+    C  C+C+  GS + + C E   C C   V+G  CD C   +
Sbjct:  291 VTKKLQCVCEHNTCGESCNECCPGYHQEPW------QPGTLSDGN----TCEKCNCHNKADDCFYNQTVADLKLSMNTHGQFTGGGVCVNCRHNTAGVNCETCADGYYRPHQVSPYAEEPCVECQC-DMRGSVSPVCIRDDNHANPDAGLSPGQCVCKEGFAGEKCDRCAFGFRDFPV----CSRCECSLDGSHNTDPCME---CVCKANVMGSHCDLCKQGF 495          

HSP 6 Score: 55.8398 bits (133), Expect = 1.198e-6
Identity = 47/168 (27.98%), Postives = 68/168 (40.48%), Query Frame = 2
Query:  950 CICNNHADKCDKVIENGISVAKC-NCKHNTCGSNCETCCPLFNQRPWKPVAVCEECNCNRKSNECSYNQTVATLQLSVNKMGRMEGGG--VCINCQENTEGINCEKCIKGFYRPWNVLATELYPCTPCQCHGLGTIGSCVSNGEDIGDQKPGDCICKKGYEGVNCDLC 1444
            C C+NH+  CD      +   +C  C+HNT G +C  C   +  +    V+ C  C C  +    S++ T             +EG G   C  C+E  EG  CE+C  G++   +        C  C C   G++ S       + D   G C CK G  G  CD C
Sbjct: 1407 CRCSNHSQSCD------LHTGQCLGCQHNTAGEHCHVCAAGYYGKVQGSVSDCSLCTCPLRGQ--SFSSTCV-----------LEGAGDFRCDRCEEGYEGRYCERCAVGYFGNPSEPGGR---CQVCACSESGSVHS-------VCDAHTGRCECKPGVRGHLCDQC 1545          
BLAST of Laminin subunit alpha-2 vs. Ensembl Zebrafish
Match: CABZ01065423.1 (pep chromosome:GRCz11:20:1834262:1891596:1 gene:ENSDARG00000112019.1 transcript:ENSDART00000185316.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CABZ01065423.1)

HSP 1 Score: 456.062 bits (1172), Expect = 2.314e-140
Identity = 252/577 (43.67%), Postives = 332/577 (57.54%), Query Frame = 2
Query:  188 LMENAKITSSATCGTGGPEIFCRLVDEIAIQRLINPDSHVLCDVCD--NRNETKRHPIEFAKSDDDNLWWQSPSMAQGLKYQNVNVTIDLKQVYQIVYILLKMGDSPRPGNWILERSLDGEIYMPWIFFAETPYSC---YNLFQRQYPDLKLTTNAKPSSLADDEMFCTTYYSQPKSLNSGEIIISLINGRKSIMNEEYLSIKSVPQTLINFLSARYIRFRFLKHLTLAADLMTHKGY----LEQSIYNRYYYSLRNIEIGGKCICNNHADKCDKVIENGISVAKCNCKHNTCGSNCETCCPLFNQRPWKPVA-----VCEECNCNRKSNECSYNQTVATLQLSVNKMGRMEGGGVCINCQENTEGINCEKCIKGFYRPWNVLATELYPCTPCQCHGLGTIGS-CVSN-GEDIGDQKPGDCICKKGYEGVNCDLCSIGYERYPNGECLPCPCSIDGSVRTSFYRCKPPCNCKVHVNSDDLCKTCKNGYFNLDSANPEGCEPCYCFGITNQCSSLSAKNLKISDLKGWKLTTFTGEKI--ALPKFTSFQYLTSENSYIDERFNNPTVYYWTAPPPYLG 1864
            L   A+I ++ATCG  GPE++C+LV+ +  + + NP     C  CD  +  + +RHPI+FA  D  N WWQSPS+  G+   +V VT+DL+QV+QI Y++LK  +SPRPGNWILERSLDGE +MPW ++A T   C   YN+  R  P         PS   DDE+ CT++YS+   L +GEI  SLINGR S  +           TL+NF SAR+IR +F +  TL ADLMT   +    ++  +  RYYYS+++I +GG CIC  HA  C   +        C C+HNTCG +C+ CCP +NQ+PW         VCE+CNC+ KS EC YNQTVA  +LS+N  G  EGGGVC+ C ENT GINC+ CI G+YRP  V   E +PCTPC C   G + S C+ +  +   D   G CICK GY G  CD C  GY  +P  +C  C CS DGSV      C+PPC CK HV   D C  CK G+++L      GC+ CYC G+ + C+        ++D+ GW LT   GE +  A P   +   +T   S        P  YYW+AP  YLG
Sbjct:   23 LASMAEIKTNATCGETGPEMYCKLVEHVPGRPVKNPQ----CRTCDLNSDYDYERHPIKFAI-DGTNRWWQSPSIMNGMDLHHVTVTLDLQQVFQIAYVILKAANSPRPGNWILERSLDGETFMPWQYYAITDTECITRYNIIPRTGP---------PSYTHDDEVICTSFYSKIHPLENGEIHTSLINGRPSADDPS--------PTLLNFTSARFIRLQFQRIRTLNADLMTLALHDPRDIDPIVTRRYYYSIKDISVGGMCICYGHAKACP--LNTHTKKFSCECEHNTCGESCDRCCPAYNQKPWMAGTFLTRHVCEKCNCHNKSEECYYNQTVADAKLSLNIHGEYEGGGVCLGCSENTGGINCQSCIDGYYRPSGVSPLEPWPCTPCTCDLRGALHSTCIPDESQATTDLPVGSCICKPGYAGERCDRCVFGYAGFP--QCERCRCSSDGSVNQD--PCQPPCVCKEHVEGRD-CDRCKQGFYHLSGGRARGCDKCYCSGVASLCAESQWDYTNVTDMSGWYLTGADGEGLVWAEPSRETAHQVTVSQSDAQTHLTAP--YYWSAPSAYLG 568          

HSP 2 Score: 74.7146 bits (182), Expect = 1.418e-12
Identity = 74/265 (27.92%), Postives = 107/265 (40.38%), Query Frame = 2
Query: 2138 LIKAKYYSNQKSIELLNITLSRGEVHL-ALDEMPHIEKCNCPPGFNGLSCESCESGYRR----VNNVLYQGQCEACACYNHSNTCD----------SLN--------GECQNCTHNTAGAHCEDCASGYYGDAKSKNLN--SCKKCPCPRLDYQMTELC---SSYSSENYVCHKCL--HNTSGVHCDRCIEGYYGNPKKKISCKRCKCNN----NQESCDPVTGECRCSYNTMGTECQLCKHGFY--GDALTKSCKKCDCDSLGS 2824
            ++  +YY + K I +  + +  G      L+       C C     G SC+ C   Y +        L +  CE C C+N S  C           SLN        G C  C+ NT G +C+ C  GYY  +    L    C  C C  L   +   C    S ++ +     C+     +G  CDRC+ GY G P+    C+RC+C++    NQ+ C P    C C  +  G +C  CK GFY       + C KC C  + S
Sbjct:  246 IVTRRYYYSIKDISVGGMCICYGHAKACPLNTHTKKFSCECEHNTCGESCDRCCPAYNQKPWMAGTFLTRHVCEKCNCHNKSEECYYNQTVADAKLSLNIHGEYEGGGVCLGCSENTGGINCQSCIDGYYRPSGVSPLEPWPCTPCTC-DLRGALHSTCIPDESQATTDLPVGSCICKPGYAGERCDRCVFGYAGFPQ----CERCRCSSDGSVNQDPCQP---PCVCKEHVEGRDCDRCKQGFYHLSGGRARGCDKCYCSGVAS 502          

HSP 3 Score: 74.7146 bits (182), Expect = 1.455e-12
Identity = 49/157 (31.21%), Postives = 72/157 (45.86%), Query Frame = 2
Query: 3407 GICV-CPPNTIGNLCNKCSEDSWDFN-----ETIGCKKCNCYINGSYSNIC---------NKISGICACKTAFFGSKCDRCNEGYYGFPNCQPCSCAENGTKSNELTKCDKITGQCQCKQNVIGTKCKVCRKGTFPSDGTYEGGCFSCFCFGVSEKC 3832
            G+C+ C  NT G  C  C +  +  +     E   C  C C + G+  + C         +   G C CK  + G +CDRC  GY GFP C+ C C+ +G+ +      D     C CK++V G  C  C++G +   G    GC  C+C GV+  C
Sbjct:  353 GVCLGCSENTGGINCQSCIDGYYRPSGVSPLEPWPCTPCTCDLRGALHSTCIPDESQATTDLPVGSCICKPGYAGERCDRCVFGYAGFPQCERCRCSSDGSVNQ-----DPCQPPCVCKEHVEGRDCDRCKQGFYHLSGGRARGCDKCYCSGVASLC 504          

HSP 4 Score: 73.9442 bits (180), Expect = 2.492e-12
Identity = 63/229 (27.51%), Postives = 90/229 (39.30%), Query Frame = 2
Query: 2573 KCLHNTSGVHCDRCIEGYYGNPK------KKISCKRCKCNNNQESCDPVTGECRCSYNTMGTECQLCKHGFYGDALTKSCKKCDCDSLGSTSENCDKLTGKCDCRTNFVNRQCDSCTSGLY-------LKDKKCIPCNCEIQGRI-------SSEKFCNTTSGQCFCLENVNGDRCEKCVEGYFNYPNCKKCLCSPHALSADCDLNNGKCKCGSNVINRICDKCENLHY 3199
            +C HNT G  CDRC   Y   P        +  C++C C+N  E       EC  +      +  L  HG Y                G     C + TG  +C+         SC  G Y       L+   C PC C+++G +        S+   +   G C C     G+RC++CV GY  +P C++C CS    S + D     C C  +V  R CD+C+   Y
Sbjct:  285 ECEHNTCGESCDRCCPAYNQKPWMAGTFLTRHVCEKCNCHNKSE-------ECYYNQTVADAKLSLNIHGEYEG--------------GGVCLGCSENTGGINCQ---------SCIDGYYRPSGVSPLEPWPCTPCTCDLRGALHSTCIPDESQATTDLPVGSCICKPGYAGERCDRCVFGYAGFPQCERCRCSSDG-SVNQDPCQPPCVCKEHVEGRDCDRCKQGFY 482          
BLAST of Laminin subunit alpha-2 vs. Ensembl Zebrafish
Match: lamc1 (laminin, gamma 1 [Source:NCBI gene;Acc:286832])

HSP 1 Score: 427.557 bits (1098), Expect = 6.914e-122
Identity = 329/1099 (29.94%), Postives = 499/1099 (45.40%), Query Frame = 2
Query:   92 MRIFIIFILLIVHKAHS---------QDDEPE-ILSVNVDGLLMENAKITSSATCGTGGPEIFCRLVDEIAIQRLINPDSHVLCDVCDNRNETKRHPIEFAKSDDDNL---WWQSPSMAQGLKYQN-VNVTIDLKQVYQIVYILLKMGDSPRPGNWILERSLDGEIYMPWIFFAETPYSCYNLFQRQYPDLKLTTNAKPSSLADDEMFCTTYYSQPKSLNSGEIIISLINGRKSIMNEEYLSIKSVPQTLINFLSARYIRFRFLKHLTLAADLMTHKGYLEQSIYNRYYYSLRNIEIGGKCICNNHADKCDKVIENGISVAKCNCKHNTCGSNCETCCPLFNQRPWKPVAV-----CEECNCNRKSNECSYNQTVATLQLSVNKMGRMEG-GGVCINCQENTEGINCEKCIKGFYRPWNVLATELYPCTPCQCHGLGTIGSCVSNGEDIGDQKPGDCICKKGYEGVNCDLCSIGYERYPNGECLPCPCSIDGSVRTSFYRCKPPCNCKVHVNSDDLCKTCKNGYFNLDSANPEGCEPCYCFGITNQCSSLSAKNL-KIS-----DLKGWKLTTFTGEKIALPKFTSFQYLTSENSYIDERFNNPTVYYWTAPPPYLGNWITSYGTIFRYVVKIELQSTLKGSLIDSPDVIIKCGDFR-----LFHSVSIEDRRLQRQVFIYIKPTEWKIGKLTPDKAATKE-EFISCLVKVDKLLIKAKYYSNQKSIELLNITL---SRGEVHLALDEMPHIEKCNCPPGFNGLSCESCESGYRRVNNVLYQ-GQCEACACYNHSNTCDSLNGECQNCTHNTAGAHCEDCASGYYGDAKSKNLNSCKKCPCPRLDYQMTELCSSYSSEN-YVCHKCLHNTSGVHCDRCIEGYYGNPKKK----ISCKRCKCNNNQE-----SCDPVTGEC-RCSYNTMGTECQLCKHGFYGDA----LTKSCKKCDCDSLGSTSEN--CDKLTGKCDCRTNFVNRQCDSCTSGLY--LKDKKCIPCNCEIQGRISSEKFCNTTSGQCFCLENVNGDRCEKCVEGYFNYPN--CKKCLCSPH-ALSADCDLNNGKCKCGSNVINRICDKCENLHYWNNRT 3214
            M +F   +L  +  A S         +DD P+  +   V+     NA + ++ TCG+  PE FC       + +         C +C+  +    H   +    +  +   WWQS +M  G++Y N +N+T+ L + + I Y+ LK   S      I +RS +   + P+ +++ +    Y+   R +    + T        + +  CT  +S    L  G +  S + GR S  N +   +      L ++++A  IR    +  T   ++     + +  +   YYY++ +  +GG+C CN HA +C   ++N  S   CNCKHNT G++C  C P +N RPW+         C  CNCN KS EC ++           ++ R  G GG C NC +NT+G  CE+C+  +YR           C  C C+ +G++ +   N         G C CK G  G  CD C  GY       C PC C+  GS +    +    C CK +V+  + C  CK GYFNLD  NP+GC PC+CF  +  C S    ++ KI+     D +GWK        + +     +   + E S I E +      Y+ AP  +L N + SYG       +I+       + + + DV+++    R     +    S      Q  VF     T++      P +   K  +F   L  +  ++I+   YS Q +  L N++L    RG    A      +EKC CP G+ G  CE C+ G+RR    L +   CE C C  HS+TCD   G C NC HNTAG  CE C  G+YGD+   + + CK CPCP         C+     N  VC  C   T+G  C+ C +G++G+P  +     +C+ C CNNN +     +C+  +GEC +C YNT G  C  CK GFYGDA    +   CK C C   G+      C ++TG+C C  + +NR C +C  G Y     K C  CNC   G  + +  C+  SGQC C   V G  CE+C   +F + +  CK C C P  + SA C   +G+C C    +   CD CE  +++N  T
Sbjct:    1 MSLFSCLLLWTLWAACSHGAMDECIDEDDRPQRCMPEFVNAAF--NATVVATNTCGSP-PEEFCVQTGVTGVTKS--------CHICNAADPRLHHGAVYLTDYNQPVQPTWWQSQTMLAGIQYPNSINLTLHLGKSFDITYVRLKFHTSRPESFAIYKRSSEDGPWTPYQYYSGSCEKTYSKNNRGF----IRTGED-----EQQALCTDEFSDISPLYGGNVAFSTLEGRPSAYNFDNSPV------LQDWVTATDIRVTLNRLNTFGDEV-----FNDPKVLKSYYYAISDFAVGGRCKCNGHASEC---VKNEYSKLVCNCKHNTEGADCNVCKPFYNDRPWRRATAENPNECLPCNCNGKSAECYFDP----------ELYRATGHGGHCRNCADNTDGPKCERCLANYYR-----EASGQRCLSCGCNPVGSLSTQCDN--------TGRCSCKPGVMGDKCDRCQPGYHSLSEAGCRPCSCNPAGSTQECDVQTGR-CQCKENVDGFN-CDRCKLGYFNLDPQNPQGCTPCFCFQHSTVCESADGYSVHKITSTFDRDDEGWKGKQRDDSSVPV----QWSPSSGEISLISEDY---FPIYFVAPDKFLHNQLLSYGQNLTLNFRIQRHD----ARLSAEDVVLEGSGLRVAVPLIAQGNSYPGEETQTFVFRLHDTTDY------PWRPTIKHADFQKLLYNLTSIMIRGT-YSAQSAGYLDNVSLVTARRGPGTPAR----WVEKCTCPQGYLGQHCEQCDQGFRRSRPELRRFSTCERCNCNGHSDTCDPETGMC-NCQHNTAGLSCERCKDGFYGDSTVGSSSDCKACPCP-----AGATCAVVPKTNEVVCTNCPTGTTGKRCELCDDGFFGDPLGEKGPVRACRACSCNNNIDPNAVGNCNRESGECLKCIYNTAGVFCDRCKQGFYGDARAANVADKCKPCKCSPYGTVDRQTACSQVTGQCPCLPHVINRDCGACELGFYNLQSGKGCERCNCNPIGSTNGQ--CDIVSGQCECQPGVTGQHCERCEVNFFGFSSSGCKPCDCDPEGSESAQCK-EDGRCHCRPGFVGSRCDMCEENYFYNRST 1009          

HSP 2 Score: 166.777 bits (421), Expect = 2.390e-40
Identity = 116/346 (33.53%), Postives = 173/346 (50.00%), Query Frame = 2
Query: 2576 CLHNTSGVHCDRCIEGYYGNP---KKKISCKRCKCNNNQESCDPVTGECRCSYNTMGTECQLCKHGFYGDALTKS---CKKCDCDSLGSTSENCDKLTGKC--DCRTNFVNRQCDSCTSGLY---LKDK----KCIPCNCEIQGRISSEKFCNTTSGQCF-CLENVNGDRCEKCVEGYFN-------YPNCKKCLCSPHAL---SADCDLNNGKCKCGSNVINRICDKCENLHYWNNRT--DCVPCNCGR-GSLNPKCDMETGNCKCAQNVARRDCSKCDVGYFGLDVTGCKKC---PPCYNGQVCNNEGICVCPPNTIGNLCNKCSEDSWDFNETIGCKKC-NCY 3514
            C     G HC++C +G+  +    ++  +C+RC CN + ++CDP TG C C +NT G  C+ CK GFYGD+   S   CK C C + G+T     K       +C T    ++C+ C  G +   L +K     C  C+C      ++   CN  SG+C  C+ N  G  C++C +G++           CK C CSP+        C    G+C C  +VINR C  CE L ++N ++   C  CNC   GS N +CD+ +G C+C   V  + C +C+V +FG   +GCK C   P       C  +G C C P  +G+ C+ C E+ +    T GC++C NCY
Sbjct:  676 CPQGYLGQHCEQCDQGFRRSRPELRRFSTCERCNCNGHSDTCDPETGMCNCQHNTAGLSCERCKDGFYGDSTVGSSSDCKACPCPA-GATCAVVPKTNEVVCTNCPTGTTGKRCELCDDGFFGDPLGEKGPVRACRACSCNNNIDPNAVGNCNRESGECLKCIYNTAGVFCDRCKQGFYGDARAANVADKCKPCKCSPYGTVDRQTACSQVTGQCPCLPHVINRDCGACE-LGFYNLQSGKGCERCNCNPIGSTNGQCDIVSGQCECQPGVTGQHCERCEVNFFGFSSSGCKPCDCDPEGSESAQCKEDGRCHCRPGFVGSRCDMCEENYFYNRSTPGCQQCPNCY 1019          

HSP 3 Score: 162.54 bits (410), Expect = 4.581e-39
Identity = 154/569 (27.07%), Postives = 234/569 (41.12%), Query Frame = 2
Query: 3419 CPPNTIGNLCNKCSEDSWDFNETIGCKKCNCYINGSYSNICNKISGICACKTAFFGSKCDRCNEGYYGF--PNCQPCSCAENGTKSNELTKCDKITGQCQCKQNVIGTKCKVCRKGTFPSDGTYEGGCFSCFCFGVSEKCHAILNHRIVENSIYEYHIFDEKNSLESGKDYSTIHLNANYPRRFGWPLTM---FRPIYVNVMKLFNSHDLSLFYRSIFMNVSVDCLDNKCGREIPEQTEVFMESYNGLFGMRYXXXXXXXXXXXXXXDFNEHSKNGKWVISQ---YQNDILDKFII-LEDSN--VINSNLTRDIFMMALLNVTSLKVK-LYTDKVNPPLIKIKIITYKVMETTQAIGKRVTAVEKCICNALTFGNHCQNPISGYYKEYFNLPNSTKSGSMRTGNRILINLKKCNCNGYSKVCDSVTGDCQNCMGNREGNKCQLCREGFYKNDK--NYDQCEPCQCPSAHYNFAQNCTRIESSLELKC-QCRIGYSGKSCENCQQGFYGNPI--KGI--PCKSCDCNQQGSQSL--NCN-EFGIC-QCSPGVLGIKCDQCAPNYVVEKKT 5056
            C  NT G  C +C  + +       C  C C   GS S  C+  +G C+CK    G KCDRC  GY+      C+PCSC   G+      +CD  TG+CQCK+NV G  C  C+ G F  D     GC  CFCF  S  C +   + + + +      FD  +    GK      +   +    G    +   + PIY      F  + L  + +++ +N  +   D +   E     +V +E      G+R  V                       +I+Q   Y  +    F+  L D+        +    F   L N+TS+ ++  Y+ +    L  + ++T +     +  G     VEKC C     G HC+    G+ +    L             R     ++CNCNG+S  CD  TG C NC  N  G  C+ C++GFY +    +   C+ C CP+        C  +  + E+ C  C  G +GK CE C  GF+G+P+  KG    C++C CN     +   NCN E G C +C     G+ CD+C   +  + + 
Sbjct:  354 CADNTDGPKCERCLANYYREASGQRCLSCGCNPVGSLSTQCDN-TGRCSCKPGVMGDKCDRCQPGYHSLSEAGCRPCSCNPAGSTQ----ECDVQTGRCQCKENVDGFNCDRCKLGYFNLDPQNPQGCTPCFCFQHSTVCESADGYSVHKIT----STFDRDDEGWKGKQRDDSSVPVQWSPSSGEISLISEDYFPIYFVAPDKFLHNQLLSYGQNLTLNFRIQRHDARLSAE-----DVVLEGS----GLRVAVP----------------------LIAQGNSYPGEETQTFVFRLHDTTDYPWRPTIKHADFQKLLYNLTSIMIRGTYSAQSAGYLDNVSLVTAR-----RGPGTPARWVEKCTCPQGYLGQHCEQCDQGFRRSRPEL-------------RRFSTCERCNCNGHSDTCDPETGMC-NCQHNTAGLSCERCKDGFYGDSTVGSSSDCKACPCPA-----GATCAVVPKTNEVVCTNCPTGTTGKRCELCDDGFFGDPLGEKGPVRACRACSCNNNIDPNAVGNCNRESGECLKCIYNTAGVFCDRCKQGFYGDARA 858          

HSP 4 Score: 112.464 bits (280), Expect = 9.095e-24
Identity = 94/355 (26.48%), Postives = 150/355 (42.25%), Query Frame = 2
Query: 2855 KCDCRTNFVNRQCDSCTSGLYLKDKK------CIPCNCEIQGRISSEKFCNTTSGQCFCLENVNGDRCEKCVEGYF------NYPNCKKCLCSPHALSADCDLNNGKC--KCGSNVINRICDKCENLHYWNNRTD------CVPCNCGRGSLNPK----CDMETGNC-KCAQNVARRDCSKCDVGYFGLDVTG--CKKCPPCY--------NGQVCNN-EGICVCPPNTIGNLCNKCSEDSWDFNETIGCKKCNCYINGSYSNICNKISGICACKTAFFGSKCDRCNEGYYGFPN--CQPCSCAENGTKSNELTKCDKITGQCQCKQNVIGTKCKVCRKGTFPSDGTYEGGCFSC 3805
            KC C   ++ + C+ C  G      +      C  CNC           C+  +G C C  N  G  CE+C +G++      +  +CK C C   A  A     N      C +    + C+ C++  + +   +      C  C+C   +++P     C+ E+G C KC  N A   C +C  G++G         KC PC             C+   G C C P+ I   C  C    ++     GC++CNC   GS +  C+ +SG C C+    G  C+RC   ++GF +  C+PC C   G++S +     K  G+C C+   +G++C +C +  F +  T   GC  C
Sbjct:  673 KCTCPQGYLGQHCEQCDQGFRRSRPELRRFSTCERCNCN-----GHSDTCDPETGMCNCQHNTAGLSCERCKDGFYGDSTVGSSSDCKACPCPAGATCAVVPKTNEVVCTNCPTGTTGKRCELCDDGFFGDPLGEKGPVRACRACSCN-NNIDPNAVGNCNRESGECLKCIYNTAGVFCDRCKQGFYGDARAANVADKCKPCKCSPYGTVDRQTACSQVTGQCPCLPHVINRDCGACELGFYNLQSGKGCERCNCNPIGSTNGQCDIVSGQCECQPGVTGQHCERCEVNFFGFSSSGCKPCDCDPEGSESAQC----KEDGRCHCRPGFVGSRCDMCEENYFYNRST--PGCQQC 1015          

HSP 5 Score: 104.76 bits (260), Expect = 1.598e-21
Identity = 136/499 (27.25%), Postives = 201/499 (40.28%), Query Frame = 2
Query: 4475 KCICNALTFGNHCQNPISGYYKEYFNLPNSTKSGSMRTGNRILINLKKCNCNGYSKV-----CDSVTGDCQNCMGNREGNKCQLCREGFYKNDKNYDQCEPCQCPSAHYNFAQNCTRIESSLELKCQCRIGYSGKSCENCQQGFYGNPIKGIPCKSCDCNQQGSQSLNCNEFGICQCSPGVLGIKCDQCAPNYVVEKKT-----CQSCYSGCTK----------DLLVRIDTLNETVINFKWKTLPSTL--------DLRLNKINISIQMSSELL-----------NSINKFYKLKNEIKNFSIQFQKMKDDAKEKYG-------EIEKLKTRYNKVLEDLRSTFTDINETISGHEQLGISNELIKNATAYLETIKNIYKEMPNI-TLAASVLKDVLKY-------VDELNQIIKYTQSHIQSDQINNLKILKNKTIMADEINTNNKE---YLNTMS---TKKKEHELYIILINERMKDLQKIFRKMTKQRDNLRKKIQ 5791
            KCI N  T G  C     G+Y            G  R  N +    K C C+ Y  V     C  VTG C  C+ +     C  C  GFY N ++   CE C C        Q C  +      +C+C+ G +G+ CE C+  F+G    G  CK CDC+ +GS+S  C E G C C PG +G +CD C  NY   + T     C +CYS              DL   ID+L+ T      K     L        DL L +   S ++   LL           N  N+   +KN + N   Q  + ++  ++          E++K K   +KV   + +T  D N      E+   + +L +   A  + I+ I K+  +  T A ++LK  L         +DELN+  KY ++    D   NL+    K + A+     NK    Y N  S      K  E     I +   DL K+  K  K+ ++LR+ ++
Sbjct:  835 KCIYN--TAGVFCDRCKQGFY------------GDARAAN-VADKCKPCKCSPYGTVDRQTACSQVTGQCP-CLPHVINRDCGACELGFY-NLQSGKGCERCNCNPIGSTNGQ-CDIVSG----QCECQPGVTGQHCERCEVNFFGFSSSG--CKPCDCDPEGSESAQCKEDGRCHCRPGFVGSRCDMCEENYFYNRSTPGCQQCPNCYSLVRDKVNQQRQKLLDLQNLIDSLDNTETTVSDKAFEDRLKEAEKTIMDL-LEEAQASKEVDKGLLDRLNNINKTLNNQWNRLQNIKNTVDNTGAQADRARNRVRDAENLINTAREELDKAKEAISKVDIKIPTTSGDPNNMTLLAEE---ARKLSEKHKADADQIEKIAKDANDTSTKAYNMLKKALDGENKTSSDIDELNR--KYLEA---KDLAKNLEKQAAK-VHAEAEEAGNKALKIYANLTSLPPINTKTLEDDANKIKKEASDLDKLIDKTEKEYNDLREDLR 1299          

HSP 6 Score: 101.293 bits (251), Expect = 1.774e-20
Identity = 76/255 (29.80%), Postives = 116/255 (45.49%), Query Frame = 2
Query: 2660 RCKCNNNQESCDPVTGE-----CRCSYNTMGTECQLCKHGFYGDALTKSCKKCDCDSLGSTSENCDKLTGKCDCRTNFVNRQCDSCTSGLYLKDKKCIPCNCEIQGR---ISSEKFCNTT-SGQCF-CLENVNGDRCEKCVEGYFNYPNCKKCL---CSP-HALSADCDLNNGKCKCGSNVINRICDKCENLHYWNNRTDCVPCNCGRGSLNPKCDMETGNCKCAQNVARRDCSKCDVGYFGLDVTGCKKCPPCY 3382
            RCKCN +   C  V  E     C C +NT G +C +CK  FY D   +           +T+EN                               +C+PCNC  +        E +  T   G C  C +N +G +CE+C+  Y+   + ++CL   C+P  +LS  CD N G+C C   V+   CD+C+  ++  +   C PC+C       +CD++TG C+C +NV   +C +C +GYF LD    + C PC+
Sbjct:  269 RCKCNGHASEC--VKNEYSKLVCNCKHNTEGADCNVCKP-FYNDRPWRR----------ATAEN-----------------------------PNECLPCNCNGKSAECYFDPELYRATGHGGHCRNCADNTDGPKCERCLANYYREASGQRCLSCGCNPVGSLSTQCD-NTGRCSCKPGVMGDKCDRCQPGYHSLSEAGCRPCSCNPAGSTQECDVQTGRCQCKENVDGFNCDRCKLGYFNLDPQNPQGCTPCF 480          

HSP 7 Score: 71.2478 bits (173), Expect = 2.413e-11
Identity = 63/197 (31.98%), Postives = 85/197 (43.15%), Query Frame = 2
Query: 4517 NPISGYYKEYFNLPNSTKSGSMRTGNRILINLKKCNCNGYSKVC--DSVTGDCQNCMGNREGNKCQLCREGFYKNDK--------NYDQCEPCQC--PSAHYNFAQNCTRIESSLELKCQCRIGYSGKSCENCQQGFYGNPIKGIPCKSCDCNQQGSQSLNCNEFGICQCSPGVLGIKCDQCAPNY-VVEKKTCQSC 5068
            N ++ +  E FN P   KS      +  +    +C CNG++  C  +  +    NC  N EG  C +C+  FY ND+        N ++C PC C   SA   F     R          C     G  CE C   +Y     G  C SC CN  GS S  C+  G C C PGV+G KCD+C P Y  + +  C+ C
Sbjct:  238 NRLNTFGDEVFNDPKVLKSYYYAISDFAVGG--RCKCNGHASECVKNEYSKLVCNCKHNTEGADCNVCKP-FY-NDRPWRRATAENPNECLPCNCNGKSAECYFDPELYRATGHGGHCRNCADNTDGPKCERCLANYY-REASGQRCLSCGCNPVGSLSTQCDNTGRCSCKPGVMGDKCDRCQPGYHSLSEAGCRPC 429          

HSP 8 Score: 65.4698 bits (158), Expect = 1.343e-9
Identity = 55/192 (28.65%), Postives = 81/192 (42.19%), Query Frame = 2
Query: 4619 CNCNGYSKVC---------DSVTGDCQNCMGNREGNKCQLCREGFYKNDKNYDQCEPCQCPSAHYNFAQNCTRIESSLELKCQCRIGYSGKSCENCQQGFYGNPIKGIPCKSCDCNQQGSQSLNCNEFGICQCSPGVLGIKCDQCAPNYV-VEKKTCQSCYSGCTKDLLVRIDTLNETVINFKWKTLPSTLD 5164
            CNCNG S  C             G C+NC  N +G KC+ C   +Y+ + +  +C  C C     + +  C         +C C+ G  G  C+ CQ G++     G  C+ C CN  GS      + G CQC   V G  CD+C   Y  ++ +  Q    GCT     +  T+ E+   +    + ST D
Sbjct:  326 CNCNGKSAECYFDPELYRATGHGGHCRNCADNTDGPKCERCLANYYR-EASGQRCLSCGCNPVG-SLSTQCDNTG-----RCSCKPGVMGDKCDRCQPGYHSLSEAG--CRPCSCNPAGSTQECDVQTGRCQCKENVDGFNCDRCKLGYFNLDPQNPQ----GCTPCFCFQHSTVCESADGYSVHKITSTFD 504          
BLAST of Laminin subunit alpha-2 vs. Ensembl Zebrafish
Match: lamc3 (laminin, gamma 3 [Source:ZFIN;Acc:ZDB-GENE-060531-121])

HSP 1 Score: 367.081 bits (941), Expect = 2.238e-102
Identity = 294/1010 (29.11%), Postives = 447/1010 (44.26%), Query Frame = 2
Query:  311 CDVCD---NRNETKRHPIEFAKSDDDNLWWQSPSMAQGLKYQN-VNVTIDLKQVYQIVYILLKMGDSPRPGNWILERSLDGEIYMPWIFFAETPYSCYNLFQRQYPDLKLTTNAKPSSLADDEMFCTTYYSQPKSLNSGEIIISLINGRKSIMNEEYLSIKSVPQTLINFLSARYIRFRFLKHLTLAADLMTHKGYLEQSIYNRYYYSLRNIEIGGKCICNNHADKCDKVIENGISVAKCNCKHNTCGSNCETCCPLFNQRPWKPVAV-----CEECNCNRKSNECSYNQTVATLQLSVNKMGRMEGGGVCINCQENTEGINCEKCIKGFYRPWNVLATELYPCTPCQCHGLGTIG-SCVSNGEDIGDQKPGDCICKKGYEGVNCDLCSIGYERYPNGECLPCPCSIDGSVRTSFYRCKPPCNCKVHVNSDDLCKTCKNGYFNLDSANPEGCEPCYCFG------ITNQCSSLSAKNLKISDLKGWKLTTFTGEKIALPKFTSFQYLTSENSYIDERFNNPTVYYWTAPPPYLGNWITSYGTIFRYVVKIELQSTLKGSLIDSPDVIIKCGDFRLFHSVSIEDRRLQRQVFIYIKPTEWKIGKLTPDKAATKEEFISCLVKVDKLLIK---AKYYSNQKSIELLNITLSRGEVHLALDEMPH---IEKCNCPPGFNGLSCESCESGY-RRVNNVLYQGQCEACACYNHSNTCDSLNGECQNCTHNTAGAHCEDCASGYYGDAKSKNLNSCKKCPCPRLDYQMTELCSSYSSENYVCHKCLHNTSGVHCDRCIEGYYGNP----KKKISCKRCKCNNNQES-----CDPVTGEC-RCSYNTMGTECQLCKHGFYGDALT------KSCKKCDCDSLGSTSE--NCDKLTGKCDCRTNFVNRQCDSCTSGLY--LKDKKCIPCNCEIQGRISSEKFCNTTSGQCFCLENVNGDRCEKCVEGYFNYPN--CKKCLCSPHALSADCDLNNGKCKCGSNVINRICDKCENLHYWN 3205
            CD  D   NRN T  +  +F  +D++  WWQS SM  G++Y N VN+T+ L + ++I Y+ LK   S RP ++ + +  D     PW  +     SC   + R         + + + L      CT  +S    L  G +  S + GR S  N +   +      L ++++A  I     +  T   +      + +  +   Y+Y++ +  +GG+C CN HA +C  V E G SV  C C+HNT G +C+ C P +  RPW          C  CNC+  ++EC ++         V +      GG C+ C+ENT G +CE+C + ++R     ++ L PC  C C+ LG++   C ++G          C+C     GV CD+C  G+     G C  C C   GSV          C+CK +V     C  CK G FNL   NP+GC  C+CFG       +NQ + +   +  + D  GWK       + +L       YL     Y +E        ++ AP  YLGN + SYG         EL+  L  S+     V ++     +   +  +     +     I     ++ +   + + +  EF+  L  +  L I     + Y++Q S   L   + +       D +PH   +E C+CP GF G  C+ C  G+ R   +      C  C C  H  TC    G C  CT  T G HCE C  GYYG+A + +   C  CPCP      T       + + +C  C     GV C+ C +G+YGNP         C +C+CN N ++     CD +TG C +C  +T G  C+ C+ G+YG+AL       + CK C C+  G++    +C   TG C C  +   R C  C +G +       C  CNC   G +SS   C+  +GQC C   V G  C+ C  G+F + +  C+ C C P   ++    NNG C C +  +   CDKCE  +Y N
Sbjct:   76 CDAFDSELNRNAT--YLTDF-HTDEEPTWWQSQSMFYGVQYPNSVNITLHLGKAFEITYVRLKFYTS-RPESFAIYKRTDEN--GPWQPYQYYSASCRKTYGRDNKGFIRPGDNERTPL------CTDEFSDISPLTGGNVAFSTLEGRPSAYNFDQSLV------LQDWVTATDILISLDRLNTFGDEF-----FKDAKVLRSYFYAISDFSVGGRCKCNGHASEC-VVNEEGRSV--CVCEHNTAGVDCQLCAPFYQDRPWARATAHSANECVRCNCSGLADECVFD---------VEQYRSTGQGGRCLGCRENTAGPHCEQCRENYFR-----SSALQPCQNCNCNALGSVSLQCDADGV---------CVCWPSVSGVKCDICKSGFHSLGPGGCRLCDCDERGSVGVCSAE-DGRCHCKANVEGQS-CNRCKPGSFNLQLENPDGCNKCFCFGHSLACFSSNQYTPIYITSDFLEDPDGWKGVFSRAHEQSLIWKEGEVYLL---PYREENG------FYKAPDKYLGNMLLSYGRTLSMSFTAELEELLPRSVT----VRLEGSGMSVSADLHTQQEPYSQLEKTPINSFSLRLTEKHVNPSVSSFEFLRMLYNLTALHISNAGGQNYTSQLSRVSLESAVQKA---YHPDVLPHALWVEVCSCPAGFAGQFCQLCAPGFTRETPDGGPFSPCVPCNCNQHG-TCHPETGVCA-CTDFTTGRHCERCEDGYYGNALTGSPGDCLPCPCP----DRTTCAQVPETGDVICTNCPTGQRGVRCELCEDGFYGNPLGWGGTVQPCVKCQCNGNVDANAVGVCDHMTGRCLKCLGHTTGDHCEKCRLGYYGNALANQLNPERKCKPCACNVAGTSGSPNDCHPNTGNCVCLGHVTGRDCGQCEAGYFNLQPGLGCEMCNCNPIGSLSSA--CHPITGQCMCRTGVEGMSCDTCRMGFFGFSSRGCRACNCDPMGSTSMQCHNNGTCSCRNGFVGYKCDKCEQNYYQN 1010          

HSP 2 Score: 124.02 bits (310), Expect = 2.785e-27
Identity = 105/345 (30.43%), Postives = 148/345 (42.90%), Query Frame = 2
Query: 2576 CLHNTSGVHCDRCIEGYY-----GNPKKKISCKRCKCNNNQESCDPVTGECRCSYNTMGTECQLCKHGFYGDALTKS---CKKCDCDSLGSTSENCDKLTGKC-DCRTNFVNRQCDSCTSGLYLKD-------KKCIPCNCEIQGRISSEKFCNTTSGQCF-CLENVNGDRCEKCVEGYFNYP---------NCKKCLCSPHALSA---DCDLNNGKCKCGSNVINRICDKCENLHYWNNRT--DCVPCNCGR-GSLNPKCDMETGNCKCAQNVARRDCSKCDVGYFGLDVTGCKKC---PPCYNGQVCNNEGICVCPPNTIGNLCNKCSEDSWDFNETIGCKKC 3505
            C    +G  C  C  G+      G P     C  C CN +  +C P TG C C+  T G  C+ C+ G+YG+ALT S   C  C C    + ++  +     C +C T     +C+ C  G Y          + C+ C C      ++   C+  +G+C  CL +  GD CEKC  GY+             CK C C+    S    DC  N G C C  +V  R C +CE   Y+N +    C  CNC   GSL+  C   TG C C   V    C  C +G+FG    GC+ C   P       C+N G C C    +G  C+KC ++ +    +  C++C
Sbjct:  679 CPAGFAGQFCQLCAPGFTRETPDGGPFSP--CVPCNCNQHG-TCHPETGVCACTDFTTGRHCERCEDGYYGNALTGSPGDCLPCPCPDRTTCAQVPETGDVICTNCPTGQRGVRCELCEDGFYGNPLGWGGTVQPCVKCQCNGNVDANAVGVCDHMTGRCLKCLGHTTGDHCEKCRLGYYGNALANQLNPERKCKPCACNVAGTSGSPNDCHPNTGNCVCLGHVTGRDCGQCE-AGYFNLQPGLGCEMCNCNPIGSLSSACHPITGQCMCRTGVEGMSCDTCRMGFFGFSSRGCRACNCDPMGSTSMQCHNNGTCSCRNGFVGYKCDKCEQNYYQNRLSHQCEEC 1019          

HSP 3 Score: 117.087 bits (292), Expect = 3.530e-25
Identity = 100/349 (28.65%), Postives = 143/349 (40.97%), Query Frame = 2
Query: 2858 CDCRTNFVNRQCDSCTSGLYLKD------KKCIPCNCEIQGRISSEKFCNTTSGQCFCLENVNGDRCEKCVEGYFNYP------NCKKCLCSPHALSADC----DLNNGKCKCGSNVINRICDKCENLHY-----WNNRTD-CVPCNCGRGSLNPK----CDMETGNC-KCAQNVARRDCSKCDVGYFGLDVTGC----KKCPPCYNGQVCN-------------NEGICVCPPNTIGNLCNKCSEDSWDFNETIGCKKCNCYINGSYSNICNKISGICACKTAFFGSKCDRCNEGYYGFPN--CQPCSCAENGTKSNELTKCDKITGQCQCKQNVIGTKCKVCRKGTF 3766
            C C   F  + C  C  G   +         C+PCNC   G       C+  +G C C +   G  CE+C +GY+         +C  C C      A      D+    C  G   +   C+ CE+  Y     W      CV C C  G+++      CD  TG C KC  +     C KC +GY+G  +       +KC PC     CN             N G CVC  +  G  C +C    ++    +GC+ CNC   GS S+ C+ I+G C C+T   G  CD C  G++GF +  C+ C+C   G+ S    +C    G C C+   +G KC  C +  +
Sbjct:  677 CSCPAGFAGQFCQLCAPGFTRETPDGGPFSPCVPCNCNQHGT------CHPETGVCACTDFTTGRHCERCEDGYYGNALTGSPGDCLPCPCPDRTTCAQVPETGDVICTNCPTGQRGVR--CELCEDGFYGNPLGWGGTVQPCVKCQCN-GNVDANAVGVCDHMTGRCLKCLGHTTGDHCEKCRLGYYGNALANQLNPERKCKPC----ACNVAGTSGSPNDCHPNTGNCVCLGHVTGRDCGQCEAGYFNLQPGLGCEMCNCNPIGSLSSACHPITGQCMCRTGVEGMSCDTCRMGFFGFSSRGCRACNCDPMGSTS---MQCHN-NGTCSCRNGFVGYKCDKCEQNYY 1008          

HSP 4 Score: 114.775 bits (286), Expect = 1.428e-24
Identity = 143/565 (25.31%), Postives = 219/565 (38.76%), Query Frame = 2
Query: 3419 CPPNTIGNLCNKCSEDSWDFNETIGCKKCNCYINGSYSNICNKISGICACKTAFFGSKCDRCNEGYY--GFPNCQPCSCAENGTKSNELTKCDKITGQCQCKQNVIGTKCKVCRKGTFPSDGTYEGGCFSCFCFGVSEKCHAILNHRIVENSIYEYHIFDEKNSLESGKDYSTIHLNANYPRRFGWPLTMFRP---IYVNVMKLFNSHDLSLFYRSIFMNVSVDCLDNKCGREIPEQTEVFMESYNGLFGMRYXXXXXXXXXXXXXXDFNEHSKNGKWVISQYQNDILDKFIILEDSNVINSNLTRDIFMMALLNVTSLKV-----KLYTDKVNPPLIKIKIITYKVMETTQAIGKRVTAVEKCICNALTFGNHCQNPISGYYKEYFNLPNSTKSGSMRTGNRILINLKKCNCNGYSKVCDSVTGDCQNCMGNREGNKCQLCREGFYKN--DKNYDQCEPCQCPSAHYNFAQNCTRIESSLELKC-QCRIGYSGKSCENCQQGFYGNPIKG----IPCKSCDCNQQGSQSLNCNEFGIC--------QCSPGVLGIKCDQCAPNY 5038
            C  NT G  C +C E+ +  +    C+ CNC   GS S  C+   G+C C  +  G KCD C  G++  G   C+ C C E G+    +  C    G+C CK NV G  C  C+ G+F        GC  CFCFG S  C +   +      IY    F E      G  +S  H  +   +     L  +R     Y    K   +  LS + R++ M+ + +  +      +P    V +E      GM                  + H++   +  SQ +   ++ F +      +N +++   F+  L N+T+L +     + YT +    L ++ + +         +      VE C C A   G  CQ    G+ +E       T  G              CNCN +   C   TG C  C     G  C+ C +G+Y N    +   C PC CP         C ++  + ++ C  C  G  G  CE C+ GFYGNP+       PC  C CN     +++ N  G+C        +C     G  C++C   Y
Sbjct:  354 CRENTAGPHCEQCRENYFRSSALQPCQNCNCNALGSVSLQCDA-DGVCVCWPSVSGVKCDICKSGFHSLGPGGCRLCDCDERGS----VGVCSAEDGRCHCKANVEGQSCNRCKPGSFNLQLENPDGCNKCFCFGHSLACFSSNQY----TPIYITSDFLEDPDGWKGV-FSRAHEQSLIWKEGEVYLLPYREENGFYKAPDKYLGNMLLS-YGRTLSMSFTAELEE-----LLPRSVTVRLEGS----GMSVSA--------------DLHTQQEPY--SQLEKTPINSFSLRLTEKHVNPSVSSFEFLRMLYNLTALHISNAGGQNYTSQ----LSRVSLESAVQKAYHPDVLPHALWVEVCSCPAGFAGQFCQLCAPGFTRE-------TPDGG------PFSPCVPCNCNQHG-TCHPETGVCA-CTDFTTGRHCERCEDGYYGNALTGSPGDCLPCPCPD-----RTTCAQVPETGDVICTNCPTGQRGVRCELCEDGFYGNPLGWGGTVQPCVKCQCN----GNVDANAVGVCDHMTGRCLKCLGHTTGDHCEKCRLGY 854          

HSP 5 Score: 87.4261 bits (215), Expect = 3.000e-16
Identity = 64/214 (29.91%), Postives = 91/214 (42.52%), Query Frame = 2
Query: 4616 KCNCNG-----YSKVCDSVTGDCQNCMGNREGNKCQLCREGFYKND-----KNYDQCEPC---------------------------------QCPSAHYNFAQ-------NCTRIES------SLELKCQCRIGYSGKSCENCQQGFYGNPIKGIPCKSCDCNQQGSQSLNCNEFGICQCSPGVLGIKCDQCAPNYVVEK-----KTCQSCYS 5074
            KC CNG        VCD +TG C  C+G+  G+ C+ CR G+Y N          +C+PC                                 QC + ++N          NC  I S       +  +C CR G  G SC+ C+ GF+G   +G  C++C+C+  GS S+ C+  G C C  G +G KCD+C  NY   +     + C  CYS
Sbjct:  813 KCQCNGNVDANAVGVCDHMTGRCLKCLGHTTGDHCEKCRLGYYGNALANQLNPERKCKPCACNVAGTSGSPNDCHPNTGNCVCLGHVTGRDCGQCEAGYFNLQPGLGCEMCNCNPIGSLSSACHPITGQCMCRTGVEGMSCDTCRMGFFGFSSRG--CRACNCDPMGSTSMQCHNNGTCSCRNGFVGYKCDKCEQNYYQNRLSHQCEECPVCYS 1024          

HSP 6 Score: 64.3142 bits (155), Expect = 3.037e-9
Identity = 76/255 (29.80%), Postives = 105/255 (41.18%), Query Frame = 2
Query: 2660 RCKCNNNQESC---DPVTGECRCSYNTMGTECQLCKHGFYGD-----ALTKSCKKCDCDSLGSTSENCDKLTGKCDCRTNFVNRQCDSCTSGLYLKDKKCIPCNCEIQGRISSEKFCNT-TSGQCF-CLENVNGDRCEKCVEGYFNYPN---CKKCLCSP-HALSADCDLNNGKCKCGSNVINRICDKCENLHYWNNRTDCVPCNCG-RGSLNPKCDMETGNCKCAQNVARRDCSKCDVGYFGLDVT---GCKKC 3370
            RCKCN +   C   +     C C +NT G +CQLC   FY D     A   S  +C                 +C+C             SGL     +C+            E++ +T   G+C  C EN  G  CE+C E YF       C+ C C+   ++S  CD + G C C  +V    CD C++  +      C  C+C  RGS+   C  E G C C  NV  + C++C  G F L +    GC KC
Sbjct:  269 RCKCNGHASECVVNEEGRSVCVCEHNTAGVDCQLCA-PFYQDRPWARATAHSANEC----------------VRCNC-------------SGLA---DECV---------FDVEQYRSTGQGGRCLGCRENTAGPHCEQCRENYFRSSALQPCQNCNCNALGSVSLQCDAD-GVCVCWPSVSGVKCDICKSGFHSLGPGGCRLCDCDERGSVG-VCSAEDGRCHCKANVEGQSCNRCKPGSFNLQLENPDGCNKC 479          

HSP 7 Score: 57.7658 bits (138), Expect = 2.798e-7
Identity = 46/153 (30.07%), Postives = 75/153 (49.02%), Query Frame = 2
Query: 4616 KCNCNGYSKVCDSVTGDCQN---CMGNREGNKCQLCREGFYKND-------KNYDQCEPCQCPSAHYNFAQNCTRIESSLEL-KC-QCRIGYSGKSCENCQQGFYGNPIKGIPCKSCDCNQQGSQSLNCNEFGICQCSPGVLGIKCDQCAPNY 5038
            +C CNG++  C  V  + ++   C  N  G  CQLC   FY++         + ++C  C C         +  +  S+ +  +C  CR   +G  CE C++ ++ +     PC++C+CN  GS SL C+  G+C C P V G+KCD C   +
Sbjct:  269 RCKCNGHASEC-VVNEEGRSVCVCEHNTAGVDCQLCAP-FYQDRPWARATAHSANECVRCNCSGLADECVFDVEQYRSTGQGGRCLGCRENTAGPHCEQCRENYFRSSALQ-PCQNCNCNALGSVSLQCDADGVCVCWPSVSGVKCDICKSGF 418          

HSP 8 Score: 57.3806 bits (137), Expect = 3.916e-7
Identity = 42/148 (28.38%), Postives = 64/148 (43.24%), Query Frame = 2
Query: 4616 KCNCNGYSKVC---------DSVTGDCQNCMGNREGNKCQLCREGFYKNDKNYDQCEPCQCPSAHYNFAQNCTRIESSLELKCQCRIGYSGKSCENCQQGFYGNPIKGIPCKSCDCNQQGSQSLNCNEFGICQCSPGVLGIKCDQCAP 5032
            +CNC+G +  C             G C  C  N  G  C+ CRE ++++      C+ C C       A     ++   +  C C    SG  C+ C+ GF+     G  C+ CDC+++GS  +   E G C C   V G  C++C P
Sbjct:  325 RCNCSGLADECVFDVEQYRSTGQGGRCLGCRENTAGPHCEQCRENYFRSSA-LQPCQNCNCN------ALGSVSLQCDADGVCVCWPSVSGVKCDICKSGFHSLGPGG--CRLCDCDERGSVGVCSAEDGRCHCKANVEGQSCNRCKP 463          
BLAST of Laminin subunit alpha-2 vs. Ensembl Zebrafish
Match: lamc3 (laminin, gamma 3 [Source:ZFIN;Acc:ZDB-GENE-060531-121])

HSP 1 Score: 367.081 bits (941), Expect = 3.786e-102
Identity = 294/1010 (29.11%), Postives = 447/1010 (44.26%), Query Frame = 2
Query:  311 CDVCD---NRNETKRHPIEFAKSDDDNLWWQSPSMAQGLKYQN-VNVTIDLKQVYQIVYILLKMGDSPRPGNWILERSLDGEIYMPWIFFAETPYSCYNLFQRQYPDLKLTTNAKPSSLADDEMFCTTYYSQPKSLNSGEIIISLINGRKSIMNEEYLSIKSVPQTLINFLSARYIRFRFLKHLTLAADLMTHKGYLEQSIYNRYYYSLRNIEIGGKCICNNHADKCDKVIENGISVAKCNCKHNTCGSNCETCCPLFNQRPWKPVAV-----CEECNCNRKSNECSYNQTVATLQLSVNKMGRMEGGGVCINCQENTEGINCEKCIKGFYRPWNVLATELYPCTPCQCHGLGTIG-SCVSNGEDIGDQKPGDCICKKGYEGVNCDLCSIGYERYPNGECLPCPCSIDGSVRTSFYRCKPPCNCKVHVNSDDLCKTCKNGYFNLDSANPEGCEPCYCFG------ITNQCSSLSAKNLKISDLKGWKLTTFTGEKIALPKFTSFQYLTSENSYIDERFNNPTVYYWTAPPPYLGNWITSYGTIFRYVVKIELQSTLKGSLIDSPDVIIKCGDFRLFHSVSIEDRRLQRQVFIYIKPTEWKIGKLTPDKAATKEEFISCLVKVDKLLIK---AKYYSNQKSIELLNITLSRGEVHLALDEMPH---IEKCNCPPGFNGLSCESCESGY-RRVNNVLYQGQCEACACYNHSNTCDSLNGECQNCTHNTAGAHCEDCASGYYGDAKSKNLNSCKKCPCPRLDYQMTELCSSYSSENYVCHKCLHNTSGVHCDRCIEGYYGNP----KKKISCKRCKCNNNQES-----CDPVTGEC-RCSYNTMGTECQLCKHGFYGDALT------KSCKKCDCDSLGSTSE--NCDKLTGKCDCRTNFVNRQCDSCTSGLY--LKDKKCIPCNCEIQGRISSEKFCNTTSGQCFCLENVNGDRCEKCVEGYFNYPN--CKKCLCSPHALSADCDLNNGKCKCGSNVINRICDKCENLHYWN 3205
            CD  D   NRN T  +  +F  +D++  WWQS SM  G++Y N VN+T+ L + ++I Y+ LK   S RP ++ + +  D     PW  +     SC   + R         + + + L      CT  +S    L  G +  S + GR S  N +   +      L ++++A  I     +  T   +      + +  +   Y+Y++ +  +GG+C CN HA +C  V E G SV  C C+HNT G +C+ C P +  RPW          C  CNC+  ++EC ++         V +      GG C+ C+ENT G +CE+C + ++R     ++ L PC  C C+ LG++   C ++G          C+C     GV CD+C  G+     G C  C C   GSV          C+CK +V     C  CK G FNL   NP+GC  C+CFG       +NQ + +   +  + D  GWK       + +L       YL     Y +E        ++ AP  YLGN + SYG         EL+  L  S+     V ++     +   +  +     +     I     ++ +   + + +  EF+  L  +  L I     + Y++Q S   L   + +       D +PH   +E C+CP GF G  C+ C  G+ R   +      C  C C  H  TC    G C  CT  T G HCE C  GYYG+A + +   C  CPCP      T       + + +C  C     GV C+ C +G+YGNP         C +C+CN N ++     CD +TG C +C  +T G  C+ C+ G+YG+AL       + CK C C+  G++    +C   TG C C  +   R C  C +G +       C  CNC   G +SS   C+  +GQC C   V G  C+ C  G+F + +  C+ C C P   ++    NNG C C +  +   CDKCE  +Y N
Sbjct:   76 CDAFDSELNRNAT--YLTDF-HTDEEPTWWQSQSMFYGVQYPNSVNITLHLGKAFEITYVRLKFYTS-RPESFAIYKRTDEN--GPWQPYQYYSASCRKTYGRDNKGFIRPGDNERTPL------CTDEFSDISPLTGGNVAFSTLEGRPSAYNFDQSLV------LQDWVTATDILISLDRLNTFGDEF-----FKDAKVLRSYFYAISDFSVGGRCKCNGHASEC-VVNEEGRSV--CVCEHNTAGVDCQLCAPFYQDRPWARATAHSANECVRCNCSGLADECVFD---------VEQYRSTGQGGRCLGCRENTAGPHCEQCRENYFR-----SSALQPCQNCNCNALGSVSLQCDADGV---------CVCWPSVSGVKCDICKSGFHSLGPGGCRLCDCDERGSVGVCSAE-DGRCHCKANVEGQS-CNRCKPGSFNLQLENPDGCNKCFCFGHSLACFSSNQYTPIYITSDFLEDPDGWKGVFSRAHEQSLIWKEGEVYLL---PYREENG------FYKAPDKYLGNMLLSYGRTLSMSFTAELEELLPRSVT----VRLEGSGMSVSADLHTQQEPYSQLEKTPINSFSLRLTEKHVNPSVSSFEFLRMLYNLTALHISNAGGQNYTSQLSRVSLESAVQKA---YHPDVLPHALWVEVCSCPAGFAGQFCQLCAPGFTRETPDGGPFSPCVPCNCNQHG-TCHPETGVCA-CTDFTTGRHCERCEDGYYGNALTGSPGDCLPCPCP----DRTTCAQVPETGDVICTNCPTGQRGVRCELCEDGFYGNPLGWGGTVQPCVKCQCNGNVDANAVGVCDHMTGRCLKCLGHTTGDHCEKCRLGYYGNALANQLNPERKCKPCACNVAGTSGSPNDCHPNTGNCVCLGHVTGRDCGQCEAGYFNLQPGLGCEMCNCNPIGSLSSA--CHPITGQCMCRTGVEGMSCDTCRMGFFGFSSRGCRACNCDPMGSTSMQCHNNGTCSCRNGFVGYKCDKCEQNYYQN 1010          

HSP 2 Score: 123.635 bits (309), Expect = 3.491e-27
Identity = 105/345 (30.43%), Postives = 148/345 (42.90%), Query Frame = 2
Query: 2576 CLHNTSGVHCDRCIEGYY-----GNPKKKISCKRCKCNNNQESCDPVTGECRCSYNTMGTECQLCKHGFYGDALTKS---CKKCDCDSLGSTSENCDKLTGKC-DCRTNFVNRQCDSCTSGLYLKD-------KKCIPCNCEIQGRISSEKFCNTTSGQCF-CLENVNGDRCEKCVEGYFNYP---------NCKKCLCSPHALSA---DCDLNNGKCKCGSNVINRICDKCENLHYWNNRT--DCVPCNCGR-GSLNPKCDMETGNCKCAQNVARRDCSKCDVGYFGLDVTGCKKC---PPCYNGQVCNNEGICVCPPNTIGNLCNKCSEDSWDFNETIGCKKC 3505
            C    +G  C  C  G+      G P     C  C CN +  +C P TG C C+  T G  C+ C+ G+YG+ALT S   C  C C    + ++  +     C +C T     +C+ C  G Y          + C+ C C      ++   C+  +G+C  CL +  GD CEKC  GY+             CK C C+    S    DC  N G C C  +V  R C +CE   Y+N +    C  CNC   GSL+  C   TG C C   V    C  C +G+FG    GC+ C   P       C+N G C C    +G  C+KC ++ +    +  C++C
Sbjct:  679 CPAGFAGQFCQLCAPGFTRETPDGGPFSP--CVPCNCNQHG-TCHPETGVCACTDFTTGRHCERCEDGYYGNALTGSPGDCLPCPCPDRTTCAQVPETGDVICTNCPTGQRGVRCELCEDGFYGNPLGWGGTVQPCVKCQCNGNVDANAVGVCDHMTGRCLKCLGHTTGDHCEKCRLGYYGNALANQLNPERKCKPCACNVAGTSGSPNDCHPNTGNCVCLGHVTGRDCGQCE-AGYFNLQPGLGCEMCNCNPIGSLSSACHPITGQCMCRTGVEGMSCDTCRMGFFGFSSRGCRACNCDPMGSTSMQCHNNGTCSCRNGFVGYKCDKCEQNYYQNRLSHQCEEC 1019          

HSP 3 Score: 116.701 bits (291), Expect = 3.829e-25
Identity = 100/349 (28.65%), Postives = 143/349 (40.97%), Query Frame = 2
Query: 2858 CDCRTNFVNRQCDSCTSGLYLKD------KKCIPCNCEIQGRISSEKFCNTTSGQCFCLENVNGDRCEKCVEGYFNYP------NCKKCLCSPHALSADC----DLNNGKCKCGSNVINRICDKCENLHYWN------NRTDCVPCNCGRGSLNPK----CDMETGNC-KCAQNVARRDCSKCDVGYFGLDVTGC----KKCPPCYNGQVCN-------------NEGICVCPPNTIGNLCNKCSEDSWDFNETIGCKKCNCYINGSYSNICNKISGICACKTAFFGSKCDRCNEGYYGFPN--CQPCSCAENGTKSNELTKCDKITGQCQCKQNVIGTKCKVCRKGTF 3766
            C C   F  + C  C  G   +         C+PCNC   G       C+  +G C C +   G  CE+C +GY+         +C  C C      A      D+    C  G   +   C+ CE+  Y N          CV C C  G+++      CD  TG C KC  +     C KC +GY+G  +       +KC PC     CN             N G CVC  +  G  C +C    ++    +GC+ CNC   GS S+ C+ I+G C C+T   G  CD C  G++GF +  C+ C+C   G+ S    +C    G C C+   +G KC  C +  +
Sbjct:  677 CSCPAGFAGQFCQLCAPGFTRETPDGGPFSPCVPCNCNQHGT------CHPETGVCACTDFTTGRHCERCEDGYYGNALTGSPGDCLPCPCPDRTTCAQVPETGDVICTNCPTGQRGVR--CELCEDGFYGNPLGWGGTVQPCVKCQCN-GNVDANAVGVCDHMTGRCLKCLGHTTGDHCEKCRLGYYGNALANQLNPERKCKPC----ACNVAGTSGSPNDCHPNTGNCVCLGHVTGRDCGQCEAGYFNLQPGLGCEMCNCNPIGSLSSACHPITGQCMCRTGVEGMSCDTCRMGFFGFSSRGCRACNCDPMGSTS---MQCHN-NGTCSCRNGFVGYKCDKCEQNYY 1008          

HSP 4 Score: 114.775 bits (286), Expect = 1.510e-24
Identity = 143/565 (25.31%), Postives = 219/565 (38.76%), Query Frame = 2
Query: 3419 CPPNTIGNLCNKCSEDSWDFNETIGCKKCNCYINGSYSNICNKISGICACKTAFFGSKCDRCNEGYY--GFPNCQPCSCAENGTKSNELTKCDKITGQCQCKQNVIGTKCKVCRKGTFPSDGTYEGGCFSCFCFGVSEKCHAILNHRIVENSIYEYHIFDEKNSLESGKDYSTIHLNANYPRRFGWPLTMFRP---IYVNVMKLFNSHDLSLFYRSIFMNVSVDCLDNKCGREIPEQTEVFMESYNGLFGMRYXXXXXXXXXXXXXXDFNEHSKNGKWVISQYQNDILDKFIILEDSNVINSNLTRDIFMMALLNVTSLKV-----KLYTDKVNPPLIKIKIITYKVMETTQAIGKRVTAVEKCICNALTFGNHCQNPISGYYKEYFNLPNSTKSGSMRTGNRILINLKKCNCNGYSKVCDSVTGDCQNCMGNREGNKCQLCREGFYKN--DKNYDQCEPCQCPSAHYNFAQNCTRIESSLELKC-QCRIGYSGKSCENCQQGFYGNPIKG----IPCKSCDCNQQGSQSLNCNEFGIC--------QCSPGVLGIKCDQCAPNY 5038
            C  NT G  C +C E+ +  +    C+ CNC   GS S  C+   G+C C  +  G KCD C  G++  G   C+ C C E G+    +  C    G+C CK NV G  C  C+ G+F        GC  CFCFG S  C +   +      IY    F E      G  +S  H  +   +     L  +R     Y    K   +  LS + R++ M+ + +  +      +P    V +E      GM                  + H++   +  SQ +   ++ F +      +N +++   F+  L N+T+L +     + YT +    L ++ + +         +      VE C C A   G  CQ    G+ +E       T  G              CNCN +   C   TG C  C     G  C+ C +G+Y N    +   C PC CP         C ++  + ++ C  C  G  G  CE C+ GFYGNP+       PC  C CN     +++ N  G+C        +C     G  C++C   Y
Sbjct:  354 CRENTAGPHCEQCRENYFRSSALQPCQNCNCNALGSVSLQCDA-DGVCVCWPSVSGVKCDICKSGFHSLGPGGCRLCDCDERGS----VGVCSAEDGRCHCKANVEGQSCNRCKPGSFNLQLENPDGCNKCFCFGHSLACFSSNQY----TPIYITSDFLEDPDGWKGV-FSRAHEQSLIWKEGEVYLLPYREENGFYKAPDKYLGNMLLS-YGRTLSMSFTAELEE-----LLPRSVTVRLEGS----GMSVSA--------------DLHTQQEPY--SQLEKTPINSFSLRLTEKHVNPSVSSFEFLRMLYNLTALHISNAGGQNYTSQ----LSRVSLESAVQKAYHPDVLPHALWVEVCSCPAGFAGQFCQLCAPGFTRE-------TPDGG------PFSPCVPCNCNQHG-TCHPETGVCA-CTDFTTGRHCERCEDGYYGNALTGSPGDCLPCPCPD-----RTTCAQVPETGDVICTNCPTGQRGVRCELCEDGFYGNPLGWGGTVQPCVKCQCN----GNVDANAVGVCDHMTGRCLKCLGHTTGDHCEKCRLGY 854          

HSP 5 Score: 87.4261 bits (215), Expect = 3.157e-16
Identity = 64/214 (29.91%), Postives = 91/214 (42.52%), Query Frame = 2
Query: 4616 KCNCNG-----YSKVCDSVTGDCQNCMGNREGNKCQLCREGFYKND-----KNYDQCEPC---------------------------------QCPSAHYNFAQ-------NCTRIES------SLELKCQCRIGYSGKSCENCQQGFYGNPIKGIPCKSCDCNQQGSQSLNCNEFGICQCSPGVLGIKCDQCAPNYVVEK-----KTCQSCYS 5074
            KC CNG        VCD +TG C  C+G+  G+ C+ CR G+Y N          +C+PC                                 QC + ++N          NC  I S       +  +C CR G  G SC+ C+ GF+G   +G  C++C+C+  GS S+ C+  G C C  G +G KCD+C  NY   +     + C  CYS
Sbjct:  813 KCQCNGNVDANAVGVCDHMTGRCLKCLGHTTGDHCEKCRLGYYGNALANQLNPERKCKPCACNVAGTSGSPNDCHPNTGNCVCLGHVTGRDCGQCEAGYFNLQPGLGCEMCNCNPIGSLSSACHPITGQCMCRTGVEGMSCDTCRMGFFGFSSRG--CRACNCDPMGSTSMQCHNNGTCSCRNGFVGYKCDKCEQNYYQNRLSHQCEECPVCYS 1024          

HSP 6 Score: 64.6994 bits (156), Expect = 2.434e-9
Identity = 76/255 (29.80%), Postives = 105/255 (41.18%), Query Frame = 2
Query: 2660 RCKCNNNQESC---DPVTGECRCSYNTMGTECQLCKHGFYGD-----ALTKSCKKCDCDSLGSTSENCDKLTGKCDCRTNFVNRQCDSCTSGLYLKDKKCIPCNCEIQGRISSEKFCNT-TSGQCF-CLENVNGDRCEKCVEGYFNYPN---CKKCLCSP-HALSADCDLNNGKCKCGSNVINRICDKCENLHYWNNRTDCVPCNCG-RGSLNPKCDMETGNCKCAQNVARRDCSKCDVGYFGLDVT---GCKKC 3370
            RCKCN +   C   +     C C +NT G +CQLC   FY D     A   S  +C                 +C+C             SGL     +C+            E++ +T   G+C  C EN  G  CE+C E YF       C+ C C+   ++S  CD + G C C  +V    CD C++  +      C  C+C  RGS+   C  E G C C  NV  + C++C  G F L +    GC KC
Sbjct:  269 RCKCNGHASECVVNEEGRSVCVCEHNTAGVDCQLCA-PFYQDRPWARATAHSANEC----------------VRCNC-------------SGLA---DECV---------FDVEQYRSTGQGGRCLGCRENTAGPHCEQCRENYFRSSALQPCQNCNCNALGSVSLQCDAD-GVCVCWPSVSGVKCDICKSGFHSLGPGGCRLCDCDERGSVG-VCSAEDGRCHCKANVEGQSCNRCKPGSFNLQLENPDGCNKC 479          

HSP 7 Score: 57.7658 bits (138), Expect = 2.907e-7
Identity = 46/153 (30.07%), Postives = 75/153 (49.02%), Query Frame = 2
Query: 4616 KCNCNGYSKVCDSVTGDCQN---CMGNREGNKCQLCREGFYKND-------KNYDQCEPCQCPSAHYNFAQNCTRIESSLEL-KC-QCRIGYSGKSCENCQQGFYGNPIKGIPCKSCDCNQQGSQSLNCNEFGICQCSPGVLGIKCDQCAPNY 5038
            +C CNG++  C  V  + ++   C  N  G  CQLC   FY++         + ++C  C C         +  +  S+ +  +C  CR   +G  CE C++ ++ +     PC++C+CN  GS SL C+  G+C C P V G+KCD C   +
Sbjct:  269 RCKCNGHASEC-VVNEEGRSVCVCEHNTAGVDCQLCAP-FYQDRPWARATAHSANECVRCNCSGLADECVFDVEQYRSTGQGGRCLGCRENTAGPHCEQCRENYFRSSALQ-PCQNCNCNALGSVSLQCDADGVCVCWPSVSGVKCDICKSGF 418          

HSP 8 Score: 57.3806 bits (137), Expect = 4.734e-7
Identity = 42/148 (28.38%), Postives = 64/148 (43.24%), Query Frame = 2
Query: 4616 KCNCNGYSKVC---------DSVTGDCQNCMGNREGNKCQLCREGFYKNDKNYDQCEPCQCPSAHYNFAQNCTRIESSLELKCQCRIGYSGKSCENCQQGFYGNPIKGIPCKSCDCNQQGSQSLNCNEFGICQCSPGVLGIKCDQCAP 5032
            +CNC+G +  C             G C  C  N  G  C+ CRE ++++      C+ C C       A     ++   +  C C    SG  C+ C+ GF+     G  C+ CDC+++GS  +   E G C C   V G  C++C P
Sbjct:  325 RCNCSGLADECVFDVEQYRSTGQGGRCLGCRENTAGPHCEQCRENYFRSSA-LQPCQNCNCN------ALGSVSLQCDADGVCVCWPSVSGVKCDICKSGFHSLGPGG--CRLCDCDERGSVGVCSAEDGRCHCKANVEGQSCNRCKP 463          
BLAST of Laminin subunit alpha-2 vs. Ensembl Xenopus
Match: LAMA1 (laminin subunit alpha 1 [Source:NCBI gene;Acc:100488009])

HSP 1 Score: 794.653 bits (2051), Expect = 0.000e+0
Identity = 574/1735 (33.08%), Postives = 840/1735 (48.41%), Query Frame = 2
Query:  158 EILSVNVDGLLMENAKITSSATCGTGGPEIFCRLVDEIAIQRLINPDSHVLCDVCDNR--NETKRHPIEFAKSDDDNLWWQSPSMAQGLKYQNVNVTIDLKQVYQIVYILLKMGDSPRPGNWILERSLDGEIYMPWIFFAETPYSC---YNLFQRQYPDLKLTTNAKPSSLADDEMFCTTYYSQPKSLNSGEIIISLINGRKSIMNEEYLSIKSVPQTLINFLSARYIRFRFLKHLTLAADLMT--HKGY--LEQSIYNRYYYSLRNIEIGGKCICNNHADKCDKVIENGISVA-KCNCKHNTCGSNCETCCPLFNQRPWKPVAV-----CEECNCNRKSNECSYNQTVATLQLSVNKMGRMEGGGVCINCQENTEGINCEKCIKGFYRPWNVLATELYPCTPCQCHGLGTIGS--CVSNGEDIGDQKPGDCICKKGYEGVNCDLCSIGYERYPNGECLPCPCSIDGSVRTSFYRCKPPCNCKVHVNSDDLCKTCKNGYFNLDSANPEGCEPCYCFGITNQC-SSLSAKNL----KISDLKGWKLTTFTGEKIALPK---FTSFQYLTSENSYIDERFNNPTVYYWTAPPPYLGNWITSYGTIFRYVVKIELQSTLKGSLIDSPDV-IIKCGDFRLFHSVSIEDRRLQRQVF----IYIKPTEWKIGKLTPDKAATKEEFISCLVKVDKLLIKAKYYSNQKSI-ELLNITLSRGEVH-LALDEMPHIEKCNCPPGFNGLSCE-----SCESGYRRVNNVLYQGQCEACACYNHSNTCDSLNGECQNCTHNTAGAHCEDCASGYYGDAKSKNLNSCKKCPCPR--LDYQMTELCSSYSSENYVCHKCLHNTSGVHCDRCIEGYYGNPKKKIS-CKRCKCNNNQES-----CDPVTGEC-RCSYNTMGTECQLCKHGFYGDAL-TKSCKKCDCDSLGSTSENCDKLTGKCDCRTNFVNRQCDSCTSGLYLKDKKCIPCNCEIQGRISSEKFCNTTSGQCFCLENVNGDRCEKCVEGYFNYPNCKKCLCSPHALSADCDLNNGKCKCGSNVINRICDKCENLHY-WNNRTDCVPCNCGR-GSLNPKCDMETGNCKCAQNVARRDCSKCDVGYFGLDVTGCKKCPPCYNGQVCNN-EGICVCPPNTIGNLCNKCSEDSWDFNETIGCKKCNCYINGSYSNICNKISGICACKTAFFGSKCDRCNEGYYGFPNCQPCSCAENGTKS------NELTKCDKITGQCQCKQNVIGTKCKVCRKGTFPSDGTYEGGCFSCFCFGVSEKCHAILNHRIVENSIYEYHIFDEKNSLESGKDYSTIHLNANYPRRFGWPLTMFRPIYVNVMKLFNSHDLSLFYRSIFMNVSVDCLDNKCGREIPEQTEVFMESYNGLFGMRYXXXXXXXXXXXXXXDFNEH--SKNGKWVISQYQNDILDKF--------IILEDSN------VINSNLTRDIFMMALLNVTSLKVKL-YTDKVNPPLIKIKIITYKVMETTQAIGKRVT-AVEKCICNALTFGNHCQNPISGYYKEYFNLPNSTKSGSMRTGNRILINLKKCNCNGYSKVCDSVTGDCQNCMGNREGNKCQLCREGFY-KNDKNYDQCEPCQCPSAH-YNFAQNCTRIESSLELKCQ-CRIGYSGKSCENCQQGFYGNPIK-GIPCKSCDCNQQGSQSLNCNEF-GICQCSPGVLGIKCDQCAPNYVVEKKTCQSCYSGCTKDLLVRIDTLNETV 5125
            + L++      + NA I+++ATCG  GPE+FC+LV+ +  + + NP     C +CD    N  +RHPI  A  D  N WWQSPS+  G  Y  + +T+DLKQV+Q+ Y+++K  +SPRPGNWILERS+DG  +MPW ++A +   C   YN+  R  P         P+   D+E+ CT+YYS+   L  GEI  SLINGR S  +            L++F SARYIR R  +  TL ADLMT  H+    ++  +  RYYYS++++ +GG CIC  HA  C     + +S+  +C C+ NTCG +C  CCP ++Q PW+P  +     CE+CNC+ K+ +C Y+Q VA   +S+N   +  GGGVC+NC + T GINCE CI+G+YR   V   E  PC PC+C   G++ S   V +        PG C CK+GY G  CD C  G++ YPN  C+ C CS+ GSV      C   C CK +V  ++ C  CK G++NL   NPEGC  C+CFG++  C +SL    +    ++SD+ GW ++   G +   PK   F     ++  NS  D R    + ++W AP  YLGN + SYG   RY V  ++         DS D  +I  G+    H++S     +Q Q F      +K         +  K   ++  ++ L  ++ L I+A Y   + ++  L ++T+   + + +A      +E C CPPG+ G SCE     S   G+ RV   L+ G C+ C C  H+  CD ++G C +C HNT G HC+ C  GYYG+        C+ C CP        +  C   S    +C +C    SG  CD+C  GY+GNP      C  C CN N +      CD VTGEC +C  NT G+ C++C  GFYGDA+  K+C  C C    S S  C   TG C+C+ N + ++CD+C++ L       I   C +     S  F    S + FC   +   +C   V     +P                +  +G+      +++       + HY       C PCNC + GS++  C+ + G C C   VA   C  C  G++     GC  C   +    CN   G C+CPP+T+G  C+ C  + W  +  +GC  CNC I GS +  C+  SG C CK  F G  C+ C  G+  +P+C  C C  +GT+S        +  C++  G C CK NV+G+ C  C+ GTF        GC  CFC GVS+ C     +  +  S+          SL S +D +T  + + +P        M     + V +  NS        + +  +S   L NK            M SY G       V    +  ++ I DF  H   K G++       DI            I L ++N      V + +++R  FM  L NV  + +K  Y   ++   I    +   V  +    G+ V   +E C C     G  CQ+   GYYKE    P  T   S+R    ++     C CN +S++CD  TG CQ+C  N +G+ C +C  GFY +       C  C CP  +  +F+  C  +E   + +C  C  GY G+ CE C  G+YGNP + G  C+ CDCN  GS + +C+   G C C PGV G  CD C   +++  + C SC   CT  LL  +D+L+  +
Sbjct:   51 KTLALTPFSYALFNAHISTNATCGEMGPEMFCKLVEHVPGRPVRNPQ----CRICDQNSINPKERHPISNAI-DGTNDWWQSPSIQNGRVYHWITITLDLKQVFQVAYVIIKAANSPRPGNWILERSVDGVEFMPWQYYAISDTECLTRYNVTPRIGP---------PTYKRDNEVICTSYYSRLVPLEHGEIHTSLINGRPSADDPS--------PALLDFTSARYIRLRLQRIRTLNADLMTLSHRDLRDVDPIVTRRYYYSVKDLSVGGMCICYGHARSCPW---DEVSLKFQCQCERNTCGESCNECCPGYHQNPWRPGTISVGNKCEKCNCHNKAEDCYYDQGVADRNMSLNINNQYIGGGVCLNCTQFTAGINCETCIEGYYRQHKVSPYEDNPCIPCECDVFGSVNSVCVVDDNHAKPGSSPGQCQCKEGYTGTKCDQCKFGFKGYPN--CVRCNCSLVGSVNED--PCAEQCVCKDNVEGEN-CDRCKAGFYNLQERNPEGCTECFCFGVSGVCDASLYTVYILLMVQVSDVVGWHISDLQGTQRIQPKQDQFDGPHQISVNNS--DARKAFQSAFFWDAPSSYLGNKLVSYGGYLRYTVSYDIPE-------DSADSELISDGN---GHTLSTRGDGVQLQPFEEHTAELKLVPDNFVDFSTRKPVDRDRLMTVLANINHLKIRANYNLAKNTVTRLSSVTMDIAQPNVIAFLPAVQVENCECPPGYAGTSCEITSLPSNLPGFYRVGGTLFGGICQPCECNGHATECD-IHGVCFDCQHNTTGPHCDQCLPGYYGNPLYGTPQDCQPCTCPLSIPSNNFSPTCHLSSDGEVICDQCPPGYSGSQCDKCANGYFGNPTMPGGLCVPCDCNGNVDPSETGHCDSVTGECLKCIDNTAGSHCEICADGFYGDAVFAKNCTACRCHPNSSISATCHHETGLCECKINVLGQRCDTCSNFLMYIYIHYI---CRL---YVSLLFFKLGSMRAFCCV-ITCTKCTYLVGHLPGWPTSHSVHMGKVGGGYPINSFSGRSAAFRELLS-------HGHYGLTTGLGCHPCNCSQMGSISDACN-DLGQCPCVPGVAGLKCDICAHGFYAFQEGGCSPCDCAHTQNNCNPMTGECICPPHTLGPKCDSCEANYWGHDPELGCLNCNCSIAGSQTLQCDLSSGQCPCKDGFGGHNCNTCAFGFRQYPSCIACDCDPSGTQSAWCDDTQTVCSCEEDAGICACKGNVVGSYCNECKTGTFALRADNPLGCTPCFCSGVSQLCTETDGYVRIPISLIPDQPLLHVVSL-SNQDGTTDGVFSEFPE-------MLLDAGM-VQQRLNS-------EAFYWQLSDQFLGNK------------MMSYGGWLTY---VITYYAVGDSGISDFEPHILMKGGRFSKLVIYADIPPPANRLGSEIQISLTENNWKYFNAVSDRSVSRSDFMSVLENVDYILIKASYGYGLHQSRIANISMDIAVEASEMHSGREVAHLIEICECPLGYTGLSCQDCAPGYYKEK---PMET---SVRGSQSLIARCVPCQCNNHSEICDPDTGKCQDCRDNTDGHHCHVCASGFYGRVTGTIADCSLCACPKGNTQSFSPTCV-LEGISDFRCDACLPGYEGQYCERCSLGYYGNPNEPGGTCQKCDCNFSGSLNNDCDGMTGQCSCKPGVTGRLCDTCEIRHILLDQECISCDDDCTGPLLDDLDSLHMAM 1689          
BLAST of Laminin subunit alpha-2 vs. Ensembl Xenopus
Match: wdcp (WD repeat and coiled coil containing [Source:Xenbase;Acc:XB-GENE-5729803])

HSP 1 Score: 732.635 bits (1890), Expect = 0.000e+0
Identity = 456/1179 (38.68%), Postives = 622/1179 (52.76%), Query Frame = 2
Query:  188 LMENAKITSSATCGTGGPEIFCRLVDEIAIQRLINPDSHVLCDVCDNR--NETKRHPIEFAKSDDDNLWWQSPSMAQGLKYQNVNVTIDLKQVYQIVYILLKMGDSPRPGNWILERSLDGEIYMPWIFFAETPYSCYNLFQRQYPDLKLTTNAKPSSLADDEMFCTTYYSQPKSLNSGEIIISLINGRKSIMNEEYLSIKSVPQTLINFLSARYIRFRFLKHLTLAADLMTHKGYLEQSIY--------NRYYYSLRNIEIGGKCICNNHADKCDKVIENGISVAKCNCKHNTCGSNCETCCPLFNQRPWKPVAV-----CEECNCNRKSNECSYNQTVATLQLSVNKMGRMEGGGVCINCQENTEGINCEKCIKGFYRPWNVLATELYPCTPCQCHGLGTIGSCVSNGEDIGDQK--PGDCICKKGYEGVNCDLCSIGYERYPNGECLPCPCSIDGSVRTSFYRCKPPCNCKVHVNSDDLCKTCKNGYFNLDSANPEGCEPCYCFGITNQCSSLSAKNLKISDLKGWKLTTFTGEKIALPK---FTSFQYLTSENSYIDERFNN-PTVYYWTAPPPYLGNWITSYGTIFRYVVKIELQSTLKGSLIDS---PDVIIKCGDFRLFHSVSIEDRRLQRQVF------IYIKPTEWKIGKLTPDKAATKEEFISCLVKVDKLLIKAKYYSNQKSI-ELLNITLS-RGEVHLALDEMPHIEKCNCPPGFNGLSCESCESGYRRVNNVLYQGQCEACACYNHSNTCDSLNGECQNCTHNTAGAHCEDCASGYYGDAKSKNLNSCKKCPCP-RLDY-QMTELCSSYSSENYVCHKCLHNTSGVHCDRCIEGYYGNPKKK-ISCKRCKCNNNQES-----CDPVTGECR-CSYNTMGTECQLCKHGFYGDAL-TKSCKKCDCDSLGSTSENCDKLTGKCDCRTNFVNRQCDSC---TSGLYLKDKKCIPCNCEIQGRISSEKFCNTTSGQCFCLENVNGDRCEKCVEGYFNYP--NCKKCLCSPHALSADCDLNNGKCKCGSNVINRICDKCENLHY-WNNRTDCVPCNCGR-GSLNPKCDMETGNCKCAQNVARRDCSKCDVGYFGLDVTGCKKCPPCYN---------GQVCNNE----------GICVCPPNTIGNLCNKCSEDSWDFN--ETIGCKKCNCY 3514
            L  NA+IT++ATCG  G E FC+LV+ +  Q    P  +  C  CD +  N   RHPI  A  +  N WWQSPS+  G++Y  V VT+DL+QV+QI YI++K  +SPRPGNWILERSLDG  + PW ++A T   C   ++ +         A+ S   DDE+ CT++YS+   L +GEI  SLI GR S  +         P+ L+ F SARYIR R  +  TL ADLM     L QS Y         RY+YS+++I +GG CIC  HA  C          + C C+HNTCG +C+ CCP FNQ+PWK         CE CNC+ KS EC Y+Q VA  +LS++ +G   GGGVCINC  NT GINCE C+  FYRP  V  T+ YPC PC C  +G++       E    +   PG C CK G+ G  CD C++GY  YP  EC+ C CS+ GS  T+   C  PC CK +V   + C  CK GYFNL   NP+GC+ C+C G+++ C+       KI+D+ GW +T  +G     P    F     L+  N   D R    P VYYW+APP YL + +T+ G    Y +  +  +++K   +DS   P++II+    +    +S +   +Q   F      I + P  ++I     +   ++ EF+  L  V+KLLI+A Y + Q++I  L ++TL   G+   +      +E C CP GF+G SCESC  G RRVN  L+ G CE C CY H++ C  + GEC +C HNT G +C+ C  G+YG+        CK C CP  +D    +  C    +   VC  C    +G  C+RC EGYYG P +   SCK CKCNNN +      CD  TG C  C     G  C  C  G++GDAL  + C+ C+C   GS S +C+  TG+C CR N + RQCD C   T GL    + C+PCNC   G   S+ F    SGQC C   V G +C+ C  G++++    C  C C PH +  +CD + G C C  N I   CDKC   H+ ++  T C  CNC   GSL+ +C+ +TG C C  N +   CS C +GY        +K P C N          Q C+ E          G C C  N  G LC++C   ++  +    +GC  C C+
Sbjct:   23 LATNARITTNATCGEKGQETFCKLVEHVPGQ----PLRYSQCRTCDQKSSNPNLRHPISNA-INGKNSWWQSPSIQNGMQYHYVTVTLDLQQVFQIAYIIIKAANSPRPGNWILERSLDGVNFKPWQYYAITESECLTRYKVK------PQPAQASFAKDDEVICTSHYSKIHPLENGEIFTSLIIGRPSAEDPS-------PE-LLEFTSARYIRLRLQRIRTLNADLM----MLSQSTYKDIDPIVTRRYFYSIKDISVGGMCICYGHARSCP--FNLATKKSSCECEHNTCGDSCDRCCPGFNQKPWKAGTFLLKHECEPCNCHWKSEECYYDQQVADKRLSLDILGNYSGGGVCINCTSNTAGINCETCVDRFYRPKGVSPTQPYPCQPCSCDPIGSLHDICVKDEKQAPRGMLPGSCHCKSGFAGERCDKCAVGYIGYP--ECVRCNCSLIGS--TNKDPCVDPCICKDNVEGQN-CDQCKLGYFNLQKDNPQGCDQCFCSGVSSICTGSRLAYTKITDMNGWYVTDLSGYTRVAPAKDGFDGPHQLSITNR--DARAQGLPEVYYWSAPPTYLRSKVTAVGGHLSYTISYD--ASMKTDSVDSTNYPNIIIEGNGIK----ISSQQETIQLGPFEEITETIVLHPDSFRI--YGTEFQVSRREFMMVLANVNKLLIRATYSNGQEAIYRLSSVTLEVAGDPSSSGKTAFSVELCQCPSGFSGTSCESCLPGNRRVNGTLFGGSCEPCRCYGHTDRCHDVTGECLDCKHNTYGRYCDYCLPGFYGNPSEGTAEDCKPCSCPLTIDSNNFSPTCHLDKTRGLVCDSCRPGYTGQRCERCAEGYYGQPSEPGGSCKPCKCNNNLDLSTPGCCDSQTGACLVCKPGITGQYCNKCAEGYFGDALEARGCQSCNCHVNGSVSTSCNTETGQCQCRNNVIGRQCDECLPQTFGLQ-SAQGCVPCNCNSFG---SKSFDCDDSGQCRCQPGVTGKKCDHCDHGFYDFQEGGCTPCEC-PH-VGNNCDADTGHCVCPPNTIGEQCDKCAPNHWGYSIITGCKACNCSNPGSLSMQCNSDTGCCFCRPNFSGDKCSSCRLGY--------RKYPTCVNCGCMLAGSQPQTCDQETEKCSCAEQTGQCNCKINVEGVLCDRCKPSTFGLHVGNPLGCSSCYCF 1147          

HSP 2 Score: 242.276 bits (617), Expect = 6.737e-63
Identity = 163/458 (35.59%), Postives = 222/458 (48.47%), Query Frame = 2
Query: 2573 KCLHNTSGVHCDRCIEG-------YYGNPKKKISCKRCKCNNNQESCDPVTGEC-RCSYNTMGTECQLCKHGFYG---DALTKSCKKCDCDSLGSTSEN------CDKLTG-KCD-CRTNFVNRQCDSCTSGLYLKDKK----CIPCNCEIQGRISSEKFCNTTSGQCF-CLENVNGDRCEKCVEGYFN----YPNCKKCLCSPH-ALSADCDLNNGKCKCGSNVINRICDKCENLHY-WNNRTDCVPCNCGR-GSLNPKCDMETGNCKCAQNVARRDCSKCDVGYFGLDVTGCKKCPPCYNGQVCNNE-GICVCPPNTIGNLCNKCSEDSWDFNETIGCKKCNCYINGSYSNICNKISGICACKTAFFGSKCDRCNEGYYGFPNCQPCSCAENGT------KSNELTKCDKITGQCQCKQNVIGTKCKVCRKGTFPSDGTYEGGCFSCFCFGVSEKC 3832
            +C    SG  C+ C+ G        +G      SC+ C+C  + + C  VTGEC  C +NT G  C  C  GFYG   +   + CK C C  L   S N       DK  G  CD CR  +  ++C+ C  G Y +  +    C PC C     +S+   C++ +G C  C   + G  C KC EGYF        C+ C C  + ++S  C+   G+C+C +NVI R CD+C    +   +   CVPCNC   GS +  CD ++G C+C   V  + C  CD G++     GC  C   + G  C+ + G CVCPPNTIG  C+KC+ + W ++   GCK CNC   GS S  CN  +G C C+  F G KC  C  GY  +P C  C C   G+      +  E   C + TGQC CK NV G  C  C+  TF        GC SC+CFG++  C
Sbjct:  703 QCPSGFSGTSCESCLPGNRRVNGTLFGG-----SCEPCRCYGHTDRCHDVTGECLDCKHNTYGRYCDYCLPGFYGNPSEGTAEDCKPCSC-PLTIDSNNFSPTCHLDKTRGLVCDSCRPGYTGQRCERCAEGYYGQPSEPGGSCKPCKCNNNLDLSTPGCCDSQTGACLVCKPGITGQYCNKCAEGYFGDALEARGCQSCNCHVNGSVSTSCNTETGQCQCRNNVIGRQCDECLPQTFGLQSAQGCVPCNCNSFGSKSFDCD-DSGQCRCQPGVTGKKCDHCDHGFYDFQEGGCTPCECPHVGNNCDADTGHCVCPPNTIGEQCDKCAPNHWGYSIITGCKACNCSNPGSLSMQCNSDTGCCFCRPNFSGDKCSSCRLGYRKYPTCVNCGCMLAGSQPQTCDQETEKCSCAEQTGQCNCKINVEGVLCDRCKPSTFGLHVGNPLGCSSCYCFGLATHC 1153          

HSP 3 Score: 231.876 bits (590), Expect = 9.171e-60
Identity = 199/700 (28.43%), Postives = 286/700 (40.86%), Query Frame = 2
Query: 1007 VAKCNCKHNTCGSNCETCCPLFNQRPWKPVAVCEECNCNR---KSNECSYNQTVATLQLSVNKMGRMEGGGVCINCQENTEGINCEKCIKGFYRPWNVLATELYPCTPCQCHGLGT-----IGSCVSNGEDIGDQ-----------------------KPGD-----------CICKKGYEGVNCDLCSIGYERYPNGECLPCPCSIDGSV---------RTSFYRCKPPCNCKVHVNSDDLCKTCKNGYFNLDSANPEGCEPCYCFGITNQCSS--------LSAKN----LKISDLKGWKLTTFTGEKIALPKFTSFQYLTSENSYIDERFNNPTVYYWTAPPPYLGNWITSYGTIFRYVVKIELQSTLKGSLIDSPDVIIKCG---DFRLF--HSVSIEDRRLQRQVFIYIKPTEWKIGKLTPDKAATKEEFISCLVKVDKLLIKAKYYSNQKSIELLNITLSRGEVHLALDEMPH---IEKCNCPPGFNGLSCESCESGYRRVNNVL-------YQGQCEACACYNHSNTCDSLNGECQNCTHNTAGAHCEDCASGYYGDAKSKNLNSCKKCPCPRL--DYQMTELCSSYSSENYVCHKCLHNTSGVHCDRCIEGYYGNPK-KKISCKRCKCN---NNQESCDPVTGECRCSYNTMGTECQLC--KHGFYGDALTKSCKKCDCDSLGSTSENCDKL 2848
              +C C++N  G  C+ C P       +    C  CNCN    KS +C                   +  G C  CQ    G  C+ C  GFY        +   CTPC+C  +G       G CV     IG+Q                        PG            C C+  + G  C  C +GY +YP   C+ C C + GS          + S       CNCK++V    LC  CK   F L   NP GC  CYCFG+   C+         L+ K     L + DL     TT  G     P+  +      E+ + +        +YW  P  + G  +T+YG   +Y +  E +     S  + P VII+ G   + R+   +  + ++ +L R   I +   +WK       +  ++E+F+  L  +  +LIKA Y S  +   +  I+L   E   +    P    IEKC CP G++GLSCE+C  G+ RV             G C  C C  HS+ CD  +  CQ C HNTAG HCE CA G+YG  +  + + CK C CP L      +  C+   + +Y C  C     G +C+RC  GY GNP     SC+ C+CN   +    C P TG+C C   + G +C  C  +H   G      C  CD +  G   ++ ++L
Sbjct:  912 TGQCQCRNNVIGRQCDECLP--QTFGLQSAQGCVPCNCNSFGSKSFDC-------------------DDSGQC-RCQPGVTGKKCDHCDHGFYD------FQEGGCTPCECPHVGNNCDADTGHCVCPPNTIGEQCDKCAPNHWGYSIITGCKACNCSNPGSLSMQCNSDTGCCFCRPNFSGDKCSSCRLGYRKYPT--CVNCGCMLAGSQPQTCDQETEKCSCAEQTGQCNCKINVEGV-LCDRCKPSTFGLHVGNPLGCSSCYCFGLATHCTEADGLIRMWLTLKPDQTVLPLVDLTQQHRTT-KGVTYQHPEIVAMIDQVKEDLHAEP-------FYWRLPQQFEGRKLTAYGGKLKYAIYFEARDETGPSTYE-PQVIIRGGPHANHRIIVRNMAAPQNGQLTRHD-IEMTEHDWKYLGSVDGRPVSREDFMDVLYDIQYILIKAAYGSVLRQTRISEISLEVAEEGTSFTISPRAYLIEKCECPHGYSGLSCEACAPGFYRVAPATPGRRTGPTLGTCVPCQCNGHSDICDPQSSVCQACKHNTAGDHCERCAPGFYGIVRG-SPDDCKPCACPLLISSNNFSPTCTLQGTNDYRCTACPLGYEGQYCERCASGYTGNPGVPGGSCQECECNPYGSLSMICHPTTGQCTCKTGSTGLKCAGCTDRHAREGPV----CVFCDDECTGLLLDDLEQL 1565          

HSP 4 Score: 176.407 bits (446), Expect = 6.787e-43
Identity = 193/723 (26.69%), Postives = 283/723 (39.14%), Query Frame = 2
Query: 3086 CLCSPHALSADCDLNNGK--CKCGSNVINRICDKC---ENLHYWNNRT-----DCVPCNCGRGSLNPKCDMETGNCKCAQNVARRDCSKCDVGYFGLDVTGCKKCPPCYNGQVCNNEGICV-CPPNTIGNLCNKCSEDSW-----DFNETIGCKKCNCYINGSYSNICNK---------ISGICACKTAFFGSKCDRCNEGYYGFPNCQPCSCAENGTKSNELTKCDKITGQCQCKQNVIGTKCKVCRKGTFPSDGTYEGGCFSCFCFGVSEKCHAI---------LNHRIVENSIYEYHIFDEKNSLESGKDYSTIHLNA---NYPRRFGW--PLTMFRPIYVNV---MKLFNSHDLSLFYRSIFMNVSVDCLDNKCGREIPEQTEVFMESYNGLFGMRYXXXXXXXXXXXXXXDFNEHSKNGKWVISQYQNDILDKFIILEDSNVINSN---LTRDIFMMALLNVTSLKVKLYTDKVNPPLIKIKIITYKVMETTQAIGKRVTAVEKCICNALTFGNHCQNPISGYYKEYFNLPNSTKSGSMRTGNRILINLKKCNCNGYSKVCDSVTGDCQNCMGNREGNKCQLCREGFYKN--DKNYDQCEPCQCPSA--HYNFAQNCTRIESSLELKC-QCRIGYSGKSCENCQQGFYGNPIK-GIPCKSCDCNQQGSQSLNCNEFGICQ--------CSPGVLGIKCDQCAPNY---VVEKKTCQSC 5068
            C+C  HA S   +L   K  C+C  N     CD+C    N   W   T     +C PCNC           ++  C   Q VA +  S        LD+ G       Y+G      G+C+ C  NT G  C  C +  +        +   C+ C+C   GS  +IC K         + G C CK+ F G +CD+C  GY G+P C  C+C+  G+     T  D     C CK NV G  C  C+ G F        GC  CFC GVS  C            +N   V +      +   K+  +     S  + +A     P  + W  P T  R     V   +    S+D S+   S+      + +    G +I  Q E       G F                                    +I +  ++  DS  I      ++R  FMM L NV  L ++         + ++  +T +V     + GK   +VE C C +   G  C++ + G         N   +G++  G+      + C C G++  C  VTG+C +C  N  G  C  C  GFY N  +   + C+PC CP      NF+  C  ++ +  L C  CR GY+G+ CE C +G+YG P + G  CK C CN     +L+ +  G C         C PG+ G  C++CA  Y    +E + CQSC
Sbjct:  264 CICYGHARSCPFNLATKKSSCECEHNTCGDSCDRCCPGFNQKPWKAGTFLLKHECEPCNC---------HWKSEECYYDQQVADKRLS--------LDILGN------YSGG-----GVCINCTSNTAGINCETCVDRFYRPKGVSPTQPYPCQPCSCDPIGSLHDICVKDEKQAPRGMLPGSCHCKSGFAGERCDKCAVGYIGYPECVRCNCSLIGS-----TNKDPCVDPCICKDNVEGQNCDQCKLGYFNLQKDNPQGCDQCFCSGVSSICTGSRLAYTKITDMNGWYVTDLSGYTRVAPAKDGFDGPHQLSITNRDARAQGLPEVYYWSAPPTYLRSKVTAVGGHLSYTISYDASMKTDSVDSTNYPNIIIEGNGIKISSQQETIQL---GPF-----------------------------------EEITETIVLHPDSFRIYGTEFQVSRREFMMVLANVNKLLIRATYSNGQEAIYRLSSVTLEVAGDPSSSGKTAFSVELCQCPSGFSGTSCESCLPG---------NRRVNGTLFGGS-----CEPCRCYGHTDRCHDVTGECLDCKHNTYGRYCDYCLPGFYGNPSEGTAEDCKPCSCPLTIDSNNFSPTC-HLDKTRGLVCDSCRPGYTGQRCERCAEGYYGQPSEPGGSCKPCKCN----NNLDLSTPGCCDSQTGACLVCKPGITGQYCNKCAEGYFGDALEARGCQSC 896          

HSP 5 Score: 150.599 bits (379), Expect = 4.244e-35
Identity = 173/664 (26.05%), Postives = 286/664 (43.07%), Query Frame = 2
Query: 4313 LTRDIFMMALLNVTSLKVKLYTDKVNPPLIKIKIITYKVME--TTQAIGKRVTAVEKCICNALTFGNHCQNPISGYYKEYFNLPNSTKSGSMRTGNRILINLKKCNCNGYSKVCDSVTGDCQNCMGNREGNKCQLCREGFYKNDKNY-DQCEPCQCP--SAHYNFAQNCTRIESSLELKC-QCRIGYSGKSCENCQQGFYGNP-IKGIPCKSCDCNQQGSQSLNCNE-FGICQCSPGVLGIKCDQCAPNYVVEKKTCQSCYSGCTKDLLVRIDTLNETVINFKWK-TLPSTLDLRLNKINISIQMSSELLNSINKFYKLKNEIKNFSIQFQKMKDDAKEKYGEIEKLKTRYNKVLEDLRSTFTDINETISGHEQLGISNELIKNATAYLETIK-NIYKEMPNITLAAS---VLKDVLKYVDELNQIIKYTQSHIQSDQINNLKILKNKT-IMADEINTNNKEYLNTMSTKKKEHELYIILINERMKDLQKIFRKMTKQRDNLRKKIQKLDAISKSFQDEKDLISINVREIEDLMKNLSSNHLVSKSLIIPDTLKKHVEQQLNKSSNL-IKKLTKDFNFLHNAEQAKEAYSNITRDILAVDYAINQTKKELDFNRSNMNIDS---LKKLLAE-----FNSNKS-EIVENIKNIDKEHEKLLKQYK 6232
            ++R+ FM  L ++  + +K     V     +I  I+ +V E  T+  I  R   +EKC C     G  C+    G+Y+     P        RTG   L     C CNG+S +CD  +  CQ C  N  G+ C+ C  GFY   +   D C+PC CP   +  NF+  CT ++ + + +C  C +GY G+ CE C  G+ GNP + G  C+ C+CN  GS S+ C+   G C C  G  G+KC  C   +  E   C  C   CT  LL  ++ LN+ V++      LP          N + ++   LL+      +L           Q  +++      E+++L  R  KV  D   T  D   T    +QL    + +K      + +K N    +PN TL  S   + KD+   + EL +     Q +   D++   + L N+   +  E +  N++  N +  K       + L  E++ D+  + R+        R KI+  D +S    ++K++  + V++ + + K       V        T   ++ Q +N++ N+ +  LT         EQ  E  +N+T++I   D      + E   N++   IDS   L  +LAE     FN+  +     NIK++  + E   K+ K
Sbjct: 1300 VSREDFMDVLYDIQYILIKAAYGSV-LRQTRISEISLEVAEEGTSFTISPRAYLIEKCECPHGYSGLSCEACAPGFYRVAPATPGR------RTG-PTLGTCVPCQCNGHSDICDPQSSVCQACKHNTAGDHCERCAPGFYGIVRGSPDDCKPCACPLLISSNNFSPTCT-LQGTNDYRCTACPLGYEGQYCERCASGYTGNPGVPGGSCQECECNPYGSLSMICHPTTGQCTCKTGSTGLKCAGCTDRHAREGPVCVFCDDECTGLLLDDLEQLNQMVMSVNLSGPLPPPYKTLFTFGNQTQEL-KHLLSPQRAPERL----------LQLAQNNQDTLVIEMDELLNRAAKVTADGEQTGKDAERTNERAKQL---EDFVKETLRASKAVKLNETLGIPNKTLDKSFQELQKDIDSMMAELRRKSLRNQKNTADDELKAAEALLNRVKKLFLEAHKKNEDLNNEVKEK-------LGLFEEKLDDVWDLLREA-------RGKIKAADDLSTV--NQKNMTELEVKKKQGVEKGKKETESVLGDGDSIMTEVNNLAQIINEAENVKLPPLT---------EQLNEKINNLTQEIARRDLPEQILQAE---NQAAQLIDSSAVLDGILAEAKNLSFNATVAFNAYSNIKDLIDDAEDTAKEAK 1912          

HSP 6 Score: 125.561 bits (314), Expect = 1.505e-27
Identity = 107/337 (31.75%), Postives = 139/337 (41.25%), Query Frame = 2
Query: 2951 EIQGRISSEKFCNTTSGQCFCLENVNGDRCEKC------VEGYFNYPNCKKCLCSPHALSADCDLNNGKC-KCGSNVINRICDKCENLHYWN----NRTDCVPCNC----GRGSLNPKCDMETGNC----KCAQNVARRDCSKCDVGYFGLDVTGCKKCPPCYNGQVCNN-------------EGIC-VCPPNTIGNLCNKCSEDSW-DFNETIGCKKCNCYINGSYSNICNKISGICACKTAFFGSKCDRCNEGYYGFPNCQ---PCSCAENGTKSNELTKCDKITGQCQCKQNVIGTKCKVCRKGTFPSDGTYEGGCFSCFCFGVSEKCHAILNH 3850
            E+ G  SS      +   C C    +G  CE C      V G     +C+ C C  H  +  C    G+C  C  N   R CD C    Y N       DC PC+C       + +P C ++         C      + C +C  GY+G        C PC     CNN              G C VC P   G  CNKC+E  + D  E  GC+ CNC++NGS S  CN  +G C C+    G +CD C    +G  + Q   PC+C   G+KS +   CD  +GQC+C+  V G KC  C  G +      EGGC  C C  V   C A   H
Sbjct:  684 EVAGDPSSSGKTAFSVELCQCPSGFSGTSCESCLPGNRRVNGTLFGGSCEPCRCYGH--TDRCHDVTGECLDCKHNTYGRYCDYCLPGFYGNPSEGTAEDCKPCSCPLTIDSNNFSPTCHLDKTRGLVCDSCRPGYTGQRCERCAEGYYGQPSEPGGSCKPCK----CNNNLDLSTPGCCDSQTGACLVCKPGITGQYCNKCAEGYFGDALEARGCQSCNCHVNGSVSTSCNTETGQCQCRNNVIGRQCDECLPQTFGLQSAQGCVPCNCNSFGSKSFD---CDD-SGQCRCQPGVTGKKCDHCDHGFYDFQ---EGGCTPCECPHVGNNCDADTGH 1007          

HSP 7 Score: 75.0998 bits (183), Expect = 2.939e-12
Identity = 60/197 (30.46%), Postives = 85/197 (43.15%), Query Frame = 2
Query: 2543 SYSSENYVCHKC--LHNTSGVHCDRCIEGYY----GNPKKKI-----SCKRCKCNNNQESCDPVTGECR-CSYNTMGTECQLCKHGFYG--DALTKSCKKCDCDSLGST---SENCDKLTGKCD-----CRTNFVNRQCDSCTSGLY----LKDKKCIPCNCEIQGRISSEKFCNTTSGQCFCLENVNGDRCEKCVE 3055
            + S   Y+  KC   H  SG+ C+ C  G+Y      P ++      +C  C+CN + + CDP +  C+ C +NT G  C+ C  GFYG        CK C C  L S+   S  C  L G  D     C   +  + C+ C SG      +    C  C C   G +S    C+ T+GQC C     G +C  C +
Sbjct: 1345 TISPRAYLIEKCECPHGYSGLSCEACAPGFYRVAPATPGRRTGPTLGTCVPCQCNGHSDICDPQSSVCQACKHNTAGDHCERCAPGFYGIVRGSPDDCKPCACPLLISSNNFSPTC-TLQGTNDYRCTACPLGYEGQYCERCASGYTGNPGVPGGSCQECECNPYGSLS--MICHPTTGQCTCKTGSTGLKCAGCTD 1538          

HSP 8 Score: 72.7886 bits (177), Expect = 1.387e-11
Identity = 54/160 (33.75%), Postives = 75/160 (46.88%), Query Frame = 2
Query: 4613 KKCNCNGYSKV-----CDSVTGDCQNCMGNREGNKCQLCREGFYKNDKNYDQCEPCQCPSAHYNFAQNCT-RIESSLELKCQCRIGYSGKSCENC-QQGFYGNPIKGIPCKSCDCNQQGSQSLNCNEFGICQCSPGVLGIKCDQCAPN-YVVEKKTCQSC 5068
            K C CN    +     CDS TG C  C     G  C  C EG++ +      C+ C C   H N + + +   E+    +CQCR    G+ C+ C  Q F     +G  C  C+CN  GS+S +C++ G C+C PGV G KCD C    Y  ++  C  C
Sbjct:  841 KPCKCNNNLDLSTPGCCDSQTGACLVCKPGITGQYCNKCAEGYFGDALEARGCQSCNC---HVNGSVSTSCNTETG---QCQCRNNVIGRQCDECLPQTFGLQSAQG--CVPCNCNSFGSKSFDCDDSGQCRCQPGVTGKKCDHCDHGFYDFQEGGCTPC 992          

HSP 9 Score: 63.5438 bits (153), Expect = 7.982e-9
Identity = 49/142 (34.51%), Postives = 71/142 (50.00%), Query Frame = 2
Query: 4619 CNCNG-YSKVCDSVTGDCQNCMGNREGNKCQLCREGFYKNDKNYDQCEPCQCPSAHYNFAQNCTRIESSLELKCQCRIGYSGKSCENCQQGFYGNPIKGIPCKSCDCNQQGSQSLNCN-EFGICQCSPGVLGIKCDQCAPNY 5038
            C+ NG  S  C++ TG CQ C  N  G +C  C    +   ++   C PC C S    F       + S +  C+C+ G +GK C++C  GFY     G  C  C+C   G+   NC+ + G C C P  +G +CD+CAPN+
Sbjct:  898 CHVNGSVSTSCNTETGQCQ-CRNNVIGRQCDECLPQTF-GLQSAQGCVPCNCNS----FGSKSFDCDDSGQ--CRCQPGVTGKKCDHCDHGFYDFQEGG--CTPCECPHVGN---NCDADTGHCVCPPNTIGEQCDKCAPNH 1026          

HSP 10 Score: 57.3806 bits (137), Expect = 6.141e-7
Identity = 54/185 (29.19%), Postives = 70/185 (37.84%), Query Frame = 2
Query: 3218 CVPCNC-GRGSLNPKCDMETGNCK-CAQNVARRDCSKCDVGYFGLDVTGCKKCPPCYNGQVCNNEGICVCPPNTIGNLCNKCSEDSWDFNETIGCKKCNCYINGSYSNICNKISGICACKTAFFGSKCDRCNEGYYGFP-----NCQPCSCAENGTKSNELTKCDKITGQCQCKQNVIGTKCKVC 3751
            CVPC C G   +   CD ++  C+ C  N A   C +C  G++G+       C PC             CP     N          +F+ T       C + G+    C       AC   + G  C+RC  GY G P     +CQ C C   G+ S     C   TGQC CK    G KC  C
Sbjct: 1393 CVPCQCNGHSDI---CDPQSSVCQACKHNTAGDHCERCAPGFYGIVRGSPDDCKPC------------ACPLLISSN----------NFSPT-------CTLQGTNDYRCT------ACPLGYEGQYCERCASGYTGNPGVPGGSCQECECNPYGSLS---MICHPTTGQCTCKTGSTGLKCAGC 1536          

HSP 11 Score: 56.225 bits (134), Expect = 1.531e-6
Identity = 64/227 (28.19%), Postives = 88/227 (38.77%), Query Frame = 2
Query: 4619 CNCNGY---SKVCDSVTGDCQNCMGNREGNKCQLCREGFYKNDKNYDQCEPCQCPSA----------------------------HYNF-------AQNCTRIESSLELKCQ-------CRIGYSGKSCENCQQGFYGNPIKGIPCKSCDCNQQGSQSLNCNE----------FGICQCSPGVLGIKCDQCAPN----YVVEKKTCQSCY-----SGCTK-DLLVRI 5104
            CNCN +   S  CD  +G C+ C     G KC  C  GFY  D     C PC+CP                              H+ +       A NC+    SL ++C        CR  +SG  C +C+ G+   P     C +C C   GSQ   C++           G C C   V G+ CD+C P+    +V     C SCY     + CT+ D L+R+
Sbjct:  945 CNCNSFGSKSFDCDD-SGQCR-CQPGVTGKKCDHCDHGFY--DFQEGGCTPCECPHVGNNCDADTGHCVCPPNTIGEQCDKCAPNHWGYSIITGCKACNCSN-PGSLSMQCNSDTGCCFCRPNFSGDKCSSCRLGYRKYPT----CVNCGCMLAGSQPQTCDQETEKCSCAEQTGQCNCKINVEGVLCDRCKPSTFGLHVGNPLGCSSCYCFGLATHCTEADGLIRM 1162          
BLAST of Laminin subunit alpha-2 vs. Ensembl Xenopus
Match: wdcp (WD repeat and coiled coil containing [Source:Xenbase;Acc:XB-GENE-5729803])

HSP 1 Score: 732.25 bits (1889), Expect = 0.000e+0
Identity = 456/1179 (38.68%), Postives = 622/1179 (52.76%), Query Frame = 2
Query:  188 LMENAKITSSATCGTGGPEIFCRLVDEIAIQRLINPDSHVLCDVCDNR--NETKRHPIEFAKSDDDNLWWQSPSMAQGLKYQNVNVTIDLKQVYQIVYILLKMGDSPRPGNWILERSLDGEIYMPWIFFAETPYSCYNLFQRQYPDLKLTTNAKPSSLADDEMFCTTYYSQPKSLNSGEIIISLINGRKSIMNEEYLSIKSVPQTLINFLSARYIRFRFLKHLTLAADLMTHKGYLEQSIY--------NRYYYSLRNIEIGGKCICNNHADKCDKVIENGISVAKCNCKHNTCGSNCETCCPLFNQRPWKPVAV-----CEECNCNRKSNECSYNQTVATLQLSVNKMGRMEGGGVCINCQENTEGINCEKCIKGFYRPWNVLATELYPCTPCQCHGLGTIGSCVSNGEDIGDQK--PGDCICKKGYEGVNCDLCSIGYERYPNGECLPCPCSIDGSVRTSFYRCKPPCNCKVHVNSDDLCKTCKNGYFNLDSANPEGCEPCYCFGITNQCSSLSAKNLKISDLKGWKLTTFTGEKIALPK---FTSFQYLTSENSYIDERFNN-PTVYYWTAPPPYLGNWITSYGTIFRYVVKIELQSTLKGSLIDS---PDVIIKCGDFRLFHSVSIEDRRLQRQVF------IYIKPTEWKIGKLTPDKAATKEEFISCLVKVDKLLIKAKYYSNQKSI-ELLNITLS-RGEVHLALDEMPHIEKCNCPPGFNGLSCESCESGYRRVNNVLYQGQCEACACYNHSNTCDSLNGECQNCTHNTAGAHCEDCASGYYGDAKSKNLNSCKKCPCP-RLDY-QMTELCSSYSSENYVCHKCLHNTSGVHCDRCIEGYYGNPKKK-ISCKRCKCNNNQES-----CDPVTGECR-CSYNTMGTECQLCKHGFYGDAL-TKSCKKCDCDSLGSTSENCDKLTGKCDCRTNFVNRQCDSC---TSGLYLKDKKCIPCNCEIQGRISSEKFCNTTSGQCFCLENVNGDRCEKCVEGYFNYP--NCKKCLCSPHALSADCDLNNGKCKCGSNVINRICDKCENLHY-WNNRTDCVPCNCGR-GSLNPKCDMETGNCKCAQNVARRDCSKCDVGYFGLDVTGCKKCPPCYN---------GQVCNNE----------GICVCPPNTIGNLCNKCSEDSWDFN--ETIGCKKCNCY 3514
            L  NA+IT++ATCG  G E FC+LV+ +  Q    P  +  C  CD +  N   RHPI  A  +  N WWQSPS+  G++Y  V VT+DL+QV+QI YI++K  +SPRPGNWILERSLDG  + PW ++A T   C   ++ +         A+ S   DDE+ CT++YS+   L +GEI  SLI GR S  +         P+ L+ F SARYIR R  +  TL ADLM     L QS Y         RY+YS+++I +GG CIC  HA  C          + C C+HNTCG +C+ CCP FNQ+PWK         CE CNC+ KS EC Y+Q VA  +LS++ +G   GGGVCINC  NT GINCE C+  FYRP  V  T+ YPC PC C  +G++       E    +   PG C CK G+ G  CD C++GY  YP  EC+ C CS+ GS  T+   C  PC CK +V   + C  CK GYFNL   NP+GC+ C+C G+++ C+       KI+D+ GW +T  +G     P    F     L+  N   D R    P VYYW+APP YL + +T+ G    Y +  +  +++K   +DS   P++II+    +    +S +   +Q   F      I + P  ++I     +   ++ EF+  L  V+KLLI+A Y + Q++I  L ++TL   G+   +      +E C CP GF+G SCESC  G RRVN  L+ G CE C CY H++ C  + GEC +C HNT G +C+ C  G+YG+        CK C CP  +D    +  C    +   VC  C    +G  C+RC EGYYG P +   SCK CKCNNN +      CD  TG C  C     G  C  C  G++GDAL  + C+ C+C   GS S +C+  TG+C CR N + RQCD C   T GL    + C+PCNC   G   S+ F    SGQC C   V G +C+ C  G++++    C  C C PH +  +CD + G C C  N I   CDKC   H+ ++  T C  CNC   GSL+ +C+ +TG C C  N +   CS C +GY        +K P C N          Q C+ E          G C C  N  G LC++C   ++  +    +GC  C C+
Sbjct:   19 LATNARITTNATCGEKGQETFCKLVEHVPGQ----PLRYSQCRTCDQKSSNPNLRHPISNA-INGKNSWWQSPSIQNGMQYHYVTVTLDLQQVFQIAYIIIKAANSPRPGNWILERSLDGVNFKPWQYYAITESECLTRYKVK------PQPAQASFAKDDEVICTSHYSKIHPLENGEIFTSLIIGRPSAEDPS-------PE-LLEFTSARYIRLRLQRIRTLNADLM----MLSQSTYKDIDPIVTRRYFYSIKDISVGGMCICYGHARSCP--FNLATKKSSCECEHNTCGDSCDRCCPGFNQKPWKAGTFLLKHECEPCNCHWKSEECYYDQQVADKRLSLDILGNYSGGGVCINCTSNTAGINCETCVDRFYRPKGVSPTQPYPCQPCSCDPIGSLHDICVKDEKQAPRGMLPGSCHCKSGFAGERCDKCAVGYIGYP--ECVRCNCSLIGS--TNKDPCVDPCICKDNVEGQN-CDQCKLGYFNLQKDNPQGCDQCFCSGVSSICTGSRLAYTKITDMNGWYVTDLSGYTRVAPAKDGFDGPHQLSITNR--DARAQGLPEVYYWSAPPTYLRSKVTAVGGHLSYTISYD--ASMKTDSVDSTNYPNIIIEGNGIK----ISSQQETIQLGPFEEITETIVLHPDSFRI--YGTEFQVSRREFMMVLANVNKLLIRATYSNGQEAIYRLSSVTLEVAGDPSSSGKTAFSVELCQCPSGFSGTSCESCLPGNRRVNGTLFGGSCEPCRCYGHTDRCHDVTGECLDCKHNTYGRYCDYCLPGFYGNPSEGTAEDCKPCSCPLTIDSNNFSPTCHLDKTRGLVCDSCRPGYTGQRCERCAEGYYGQPSEPGGSCKPCKCNNNLDLSTPGCCDSQTGACLVCKPGITGQYCNKCAEGYFGDALEARGCQSCNCHVNGSVSTSCNTETGQCQCRNNVIGRQCDECLPQTFGLQ-SAQGCVPCNCNSFG---SKSFDCDDSGQCRCQPGVTGKKCDHCDHGFYDFQEGGCTPCEC-PH-VGNNCDADTGHCVCPPNTIGEQCDKCAPNHWGYSIITGCKACNCSNPGSLSMQCNSDTGCCFCRPNFSGDKCSSCRLGY--------RKYPTCVNCGCMLAGSQPQTCDQETEKCSCAEQTGQCNCKINVEGVLCDRCKPSTFGLHVGNPLGCSSCYCF 1143          

HSP 2 Score: 242.276 bits (617), Expect = 7.636e-63
Identity = 163/458 (35.59%), Postives = 222/458 (48.47%), Query Frame = 2
Query: 2573 KCLHNTSGVHCDRCIEG-------YYGNPKKKISCKRCKCNNNQESCDPVTGEC-RCSYNTMGTECQLCKHGFYG---DALTKSCKKCDCDSLGSTSEN------CDKLTG-KCD-CRTNFVNRQCDSCTSGLYLKDKK----CIPCNCEIQGRISSEKFCNTTSGQCF-CLENVNGDRCEKCVEGYFN----YPNCKKCLCSPH-ALSADCDLNNGKCKCGSNVINRICDKCENLHY-WNNRTDCVPCNCGR-GSLNPKCDMETGNCKCAQNVARRDCSKCDVGYFGLDVTGCKKCPPCYNGQVCNNE-GICVCPPNTIGNLCNKCSEDSWDFNETIGCKKCNCYINGSYSNICNKISGICACKTAFFGSKCDRCNEGYYGFPNCQPCSCAENGT------KSNELTKCDKITGQCQCKQNVIGTKCKVCRKGTFPSDGTYEGGCFSCFCFGVSEKC 3832
            +C    SG  C+ C+ G        +G      SC+ C+C  + + C  VTGEC  C +NT G  C  C  GFYG   +   + CK C C  L   S N       DK  G  CD CR  +  ++C+ C  G Y +  +    C PC C     +S+   C++ +G C  C   + G  C KC EGYF        C+ C C  + ++S  C+   G+C+C +NVI R CD+C    +   +   CVPCNC   GS +  CD ++G C+C   V  + C  CD G++     GC  C   + G  C+ + G CVCPPNTIG  C+KC+ + W ++   GCK CNC   GS S  CN  +G C C+  F G KC  C  GY  +P C  C C   G+      +  E   C + TGQC CK NV G  C  C+  TF        GC SC+CFG++  C
Sbjct:  699 QCPSGFSGTSCESCLPGNRRVNGTLFGG-----SCEPCRCYGHTDRCHDVTGECLDCKHNTYGRYCDYCLPGFYGNPSEGTAEDCKPCSC-PLTIDSNNFSPTCHLDKTRGLVCDSCRPGYTGQRCERCAEGYYGQPSEPGGSCKPCKCNNNLDLSTPGCCDSQTGACLVCKPGITGQYCNKCAEGYFGDALEARGCQSCNCHVNGSVSTSCNTETGQCQCRNNVIGRQCDECLPQTFGLQSAQGCVPCNCNSFGSKSFDCD-DSGQCRCQPGVTGKKCDHCDHGFYDFQEGGCTPCECPHVGNNCDADTGHCVCPPNTIGEQCDKCAPNHWGYSIITGCKACNCSNPGSLSMQCNSDTGCCFCRPNFSGDKCSSCRLGYRKYPTCVNCGCMLAGSQPQTCDQETEKCSCAEQTGQCNCKINVEGVLCDRCKPSTFGLHVGNPLGCSSCYCFGLATHC 1149          

HSP 3 Score: 231.876 bits (590), Expect = 8.936e-60
Identity = 199/700 (28.43%), Postives = 286/700 (40.86%), Query Frame = 2
Query: 1007 VAKCNCKHNTCGSNCETCCPLFNQRPWKPVAVCEECNCNR---KSNECSYNQTVATLQLSVNKMGRMEGGGVCINCQENTEGINCEKCIKGFYRPWNVLATELYPCTPCQCHGLGT-----IGSCVSNGEDIGDQ-----------------------KPGD-----------CICKKGYEGVNCDLCSIGYERYPNGECLPCPCSIDGSV---------RTSFYRCKPPCNCKVHVNSDDLCKTCKNGYFNLDSANPEGCEPCYCFGITNQCSS--------LSAKN----LKISDLKGWKLTTFTGEKIALPKFTSFQYLTSENSYIDERFNNPTVYYWTAPPPYLGNWITSYGTIFRYVVKIELQSTLKGSLIDSPDVIIKCG---DFRLF--HSVSIEDRRLQRQVFIYIKPTEWKIGKLTPDKAATKEEFISCLVKVDKLLIKAKYYSNQKSIELLNITLSRGEVHLALDEMPH---IEKCNCPPGFNGLSCESCESGYRRVNNVL-------YQGQCEACACYNHSNTCDSLNGECQNCTHNTAGAHCEDCASGYYGDAKSKNLNSCKKCPCPRL--DYQMTELCSSYSSENYVCHKCLHNTSGVHCDRCIEGYYGNPK-KKISCKRCKCN---NNQESCDPVTGECRCSYNTMGTECQLC--KHGFYGDALTKSCKKCDCDSLGSTSENCDKL 2848
              +C C++N  G  C+ C P       +    C  CNCN    KS +C                   +  G C  CQ    G  C+ C  GFY        +   CTPC+C  +G       G CV     IG+Q                        PG            C C+  + G  C  C +GY +YP   C+ C C + GS          + S       CNCK++V    LC  CK   F L   NP GC  CYCFG+   C+         L+ K     L + DL     TT  G     P+  +      E+ + +        +YW  P  + G  +T+YG   +Y +  E +     S  + P VII+ G   + R+   +  + ++ +L R   I +   +WK       +  ++E+F+  L  +  +LIKA Y S  +   +  I+L   E   +    P    IEKC CP G++GLSCE+C  G+ RV             G C  C C  HS+ CD  +  CQ C HNTAG HCE CA G+YG  +  + + CK C CP L      +  C+   + +Y C  C     G +C+RC  GY GNP     SC+ C+CN   +    C P TG+C C   + G +C  C  +H   G      C  CD +  G   ++ ++L
Sbjct:  908 TGQCQCRNNVIGRQCDECLP--QTFGLQSAQGCVPCNCNSFGSKSFDC-------------------DDSGQC-RCQPGVTGKKCDHCDHGFYD------FQEGGCTPCECPHVGNNCDADTGHCVCPPNTIGEQCDKCAPNHWGYSIITGCKACNCSNPGSLSMQCNSDTGCCFCRPNFSGDKCSSCRLGYRKYPT--CVNCGCMLAGSQPQTCDQETEKCSCAEQTGQCNCKINVEGV-LCDRCKPSTFGLHVGNPLGCSSCYCFGLATHCTEADGLIRMWLTLKPDQTVLPLVDLTQQHRTT-KGVTYQHPEIVAMIDQVKEDLHAEP-------FYWRLPQQFEGRKLTAYGGKLKYAIYFEARDETGPSTYE-PQVIIRGGPHANHRIIVRNMAAPQNGQLTRHD-IEMTEHDWKYLGSVDGRPVSREDFMDVLYDIQYILIKAAYGSVLRQTRISEISLEVAEEGTSFTISPRAYLIEKCECPHGYSGLSCEACAPGFYRVAPATPGRRTGPTLGTCVPCQCNGHSDICDPQSSVCQACKHNTAGDHCERCAPGFYGIVRG-SPDDCKPCACPLLISSNNFSPTCTLQGTNDYRCTACPLGYEGQYCERCASGYTGNPGVPGGSCQECECNPYGSLSMICHPTTGQCTCKTGSTGLKCAGCTDRHAREGPV----CVFCDDECTGLLLDDLEQL 1561          

HSP 4 Score: 176.022 bits (445), Expect = 8.368e-43
Identity = 193/723 (26.69%), Postives = 283/723 (39.14%), Query Frame = 2
Query: 3086 CLCSPHALSADCDLNNGK--CKCGSNVINRICDKC---ENLHYWNNRT-----DCVPCNCGRGSLNPKCDMETGNCKCAQNVARRDCSKCDVGYFGLDVTGCKKCPPCYNGQVCNNEGICV-CPPNTIGNLCNKCSEDSW-----DFNETIGCKKCNCYINGSYSNICNK---------ISGICACKTAFFGSKCDRCNEGYYGFPNCQPCSCAENGTKSNELTKCDKITGQCQCKQNVIGTKCKVCRKGTFPSDGTYEGGCFSCFCFGVSEKCHAI---------LNHRIVENSIYEYHIFDEKNSLESGKDYSTIHLNA---NYPRRFGW--PLTMFRPIYVNV---MKLFNSHDLSLFYRSIFMNVSVDCLDNKCGREIPEQTEVFMESYNGLFGMRYXXXXXXXXXXXXXXDFNEHSKNGKWVISQYQNDILDKFIILEDSNVINSN---LTRDIFMMALLNVTSLKVKLYTDKVNPPLIKIKIITYKVMETTQAIGKRVTAVEKCICNALTFGNHCQNPISGYYKEYFNLPNSTKSGSMRTGNRILINLKKCNCNGYSKVCDSVTGDCQNCMGNREGNKCQLCREGFYKN--DKNYDQCEPCQCPSA--HYNFAQNCTRIESSLELKC-QCRIGYSGKSCENCQQGFYGNPIK-GIPCKSCDCNQQGSQSLNCNEFGICQ--------CSPGVLGIKCDQCAPNY---VVEKKTCQSC 5068
            C+C  HA S   +L   K  C+C  N     CD+C    N   W   T     +C PCNC           ++  C   Q VA +  S        LD+ G       Y+G      G+C+ C  NT G  C  C +  +        +   C+ C+C   GS  +IC K         + G C CK+ F G +CD+C  GY G+P C  C+C+  G+     T  D     C CK NV G  C  C+ G F        GC  CFC GVS  C            +N   V +      +   K+  +     S  + +A     P  + W  P T  R     V   +    S+D S+   S+      + +    G +I  Q E       G F                                    +I +  ++  DS  I      ++R  FMM L NV  L ++         + ++  +T +V     + GK   +VE C C +   G  C++ + G         N   +G++  G+      + C C G++  C  VTG+C +C  N  G  C  C  GFY N  +   + C+PC CP      NF+  C  ++ +  L C  CR GY+G+ CE C +G+YG P + G  CK C CN     +L+ +  G C         C PG+ G  C++CA  Y    +E + CQSC
Sbjct:  260 CICYGHARSCPFNLATKKSSCECEHNTCGDSCDRCCPGFNQKPWKAGTFLLKHECEPCNC---------HWKSEECYYDQQVADKRLS--------LDILGN------YSGG-----GVCINCTSNTAGINCETCVDRFYRPKGVSPTQPYPCQPCSCDPIGSLHDICVKDEKQAPRGMLPGSCHCKSGFAGERCDKCAVGYIGYPECVRCNCSLIGS-----TNKDPCVDPCICKDNVEGQNCDQCKLGYFNLQKDNPQGCDQCFCSGVSSICTGSRLAYTKITDMNGWYVTDLSGYTRVAPAKDGFDGPHQLSITNRDARAQGLPEVYYWSAPPTYLRSKVTAVGGHLSYTISYDASMKTDSVDSTNYPNIIIEGNGIKISSQQETIQL---GPF-----------------------------------EEITETIVLHPDSFRIYGTEFQVSRREFMMVLANVNKLLIRATYSNGQEAIYRLSSVTLEVAGDPSSSGKTAFSVELCQCPSGFSGTSCESCLPG---------NRRVNGTLFGGS-----CEPCRCYGHTDRCHDVTGECLDCKHNTYGRYCDYCLPGFYGNPSEGTAEDCKPCSCPLTIDSNNFSPTC-HLDKTRGLVCDSCRPGYTGQRCERCAEGYYGQPSEPGGSCKPCKCN----NNLDLSTPGCCDSQTGACLVCKPGITGQYCNKCAEGYFGDALEARGCQSC 892          

HSP 5 Score: 149.058 bits (375), Expect = 1.123e-34
Identity = 160/618 (25.89%), Postives = 279/618 (45.15%), Query Frame = 2
Query: 4313 LTRDIFMMALLNVTSLKVKLYTDKVNPPLIKIKIITYKVME--TTQAIGKRVTAVEKCICNALTFGNHCQNPISGYYKEYFNLPNSTKSGSMRTGNRILINLKKCNCNGYSKVCDSVTGDCQNCMGNREGNKCQLCREGFYKNDKNY-DQCEPCQCPS--AHYNFAQNCTRIESSLELKC-QCRIGYSGKSCENCQQGFYGNP-IKGIPCKSCDCNQQGSQSLNCNE-FGICQCSPGVLGIKCDQCAPNYVVEKKTCQSCYSGCTKDLLVRIDTLNETVINF--------KWKTLPSTLDLRLNKIN--ISIQMSSELLNSI--NKFYKLKNEIKNFSIQFQKMKDDAKEKYGEIEKLKTRYNKVLEDLRSTFTDINETISGHEQLGISNELIKNATAYLET-IKNIYKEMPNITL--AASVLKDVLKYVDELNQIIK--YTQSHIQSDQINNLKILKNKTIMADEINTNNKEYLNTMSTKKKEHELYIILINERMKDLQKIFRKMTKQRDNLRKKIQKLDAISKSFQDEKDLI--SINVREIEDLMKNLSS--NHLVSKSLIIPDTLKKHVEQQLNKSSNLIKK-------LTKDFNFLHNAEQAKEAYSNITRDIL 6058
            ++R+ FM  L ++  + +K     V     +I  I+ +V E  T+  I  R   +EKC C     G  C+    G+Y+     P        RTG   L     C CNG+S +CD  +  CQ C  N  G+ C+ C  GFY   +   D C+PC CP   +  NF+  CT ++ + + +C  C +GY G+ CE C  G+ GNP + G  C+ C+CN  GS S+ C+   G C C  G  G+KC  C   +  E   C  C   CT  LL  ++ LN+ V++          +KTL  T   +  ++   +S Q + E L  +  N    L  E+     +  K+  D ++   + E+   R  ++ + ++ T    ++ +  +E LGI N+ +  +   L+  I ++  E+   +L    +   D LK  + L   +K  + ++H +++ +NN   +K K  + +E   +  + L     K K  +    +  + M +L++  + + K +      +   D+I     +   +I  + NV+ +  L + L+   N+L  +  I    L + + Q  N+++ LI         L +  N   NA  A  AYSNI +D++
Sbjct: 1296 VSREDFMDVLYDIQYILIKAAYGSV-LRQTRISEISLEVAEEGTSFTISPRAYLIEKCECPHGYSGLSCEACAPGFYRVAPATPGR------RTG-PTLGTCVPCQCNGHSDICDPQSSVCQACKHNTAGDHCERCAPGFYGIVRGSPDDCKPCACPLLISSNNFSPTCT-LQGTNDYRCTACPLGYEGQYCERCASGYTGNPGVPGGSCQECECNPYGSLSMICHPTTGQCTCKTGSTGLKCAGCTDRHAREGPVCVFCDDECTGLLLDDLEQLNQMVMSVNLSGPLPPPYKTL-FTFGNQTQELKHLLSPQRAPERLLQLAQNNQDTLVIEMDELLNRAAKVTADGEQTGKDAERTNERAKQLEDFVKETLHIYDKAVKLNETLGIPNKTLDKSFQELQKDIDSMMAELRRKSLRNQKNTADDELKAAEALLNRVKKLFLEAHKKNEDLNNE--VKEKLGLFEEKLDDVWDLLREARGKIKAADDLSTVNQKNMTELERKKQGVEKGKKETESVLGDGDSIMTEVNNLAQIINEAENVK-LPPLTEQLNEKINNLTQE--IARRDLPEQILQAENQAAQLIDSSAVLDGILAEAKNLSFNATVAFNAYSNI-KDLI 1897          

HSP 6 Score: 125.561 bits (314), Expect = 1.517e-27
Identity = 107/337 (31.75%), Postives = 139/337 (41.25%), Query Frame = 2
Query: 2951 EIQGRISSEKFCNTTSGQCFCLENVNGDRCEKC------VEGYFNYPNCKKCLCSPHALSADCDLNNGKC-KCGSNVINRICDKCENLHYWN----NRTDCVPCNC----GRGSLNPKCDMETGNC----KCAQNVARRDCSKCDVGYFGLDVTGCKKCPPCYNGQVCNN-------------EGIC-VCPPNTIGNLCNKCSEDSW-DFNETIGCKKCNCYINGSYSNICNKISGICACKTAFFGSKCDRCNEGYYGFPNCQ---PCSCAENGTKSNELTKCDKITGQCQCKQNVIGTKCKVCRKGTFPSDGTYEGGCFSCFCFGVSEKCHAILNH 3850
            E+ G  SS      +   C C    +G  CE C      V G     +C+ C C  H  +  C    G+C  C  N   R CD C    Y N       DC PC+C       + +P C ++         C      + C +C  GY+G        C PC     CNN              G C VC P   G  CNKC+E  + D  E  GC+ CNC++NGS S  CN  +G C C+    G +CD C    +G  + Q   PC+C   G+KS +   CD  +GQC+C+  V G KC  C  G +      EGGC  C C  V   C A   H
Sbjct:  680 EVAGDPSSSGKTAFSVELCQCPSGFSGTSCESCLPGNRRVNGTLFGGSCEPCRCYGH--TDRCHDVTGECLDCKHNTYGRYCDYCLPGFYGNPSEGTAEDCKPCSCPLTIDSNNFSPTCHLDKTRGLVCDSCRPGYTGQRCERCAEGYYGQPSEPGGSCKPCK----CNNNLDLSTPGCCDSQTGACLVCKPGITGQYCNKCAEGYFGDALEARGCQSCNCHVNGSVSTSCNTETGQCQCRNNVIGRQCDECLPQTFGLQSAQGCVPCNCNSFGSKSFD---CDD-SGQCRCQPGVTGKKCDHCDHGFYDFQ---EGGCTPCECPHVGNNCDADTGH 1003          

HSP 7 Score: 75.0998 bits (183), Expect = 3.091e-12
Identity = 60/197 (30.46%), Postives = 85/197 (43.15%), Query Frame = 2
Query: 2543 SYSSENYVCHKC--LHNTSGVHCDRCIEGYY----GNPKKKI-----SCKRCKCNNNQESCDPVTGECR-CSYNTMGTECQLCKHGFYG--DALTKSCKKCDCDSLGST---SENCDKLTGKCD-----CRTNFVNRQCDSCTSGLY----LKDKKCIPCNCEIQGRISSEKFCNTTSGQCFCLENVNGDRCEKCVE 3055
            + S   Y+  KC   H  SG+ C+ C  G+Y      P ++      +C  C+CN + + CDP +  C+ C +NT G  C+ C  GFYG        CK C C  L S+   S  C  L G  D     C   +  + C+ C SG      +    C  C C   G +S    C+ T+GQC C     G +C  C +
Sbjct: 1341 TISPRAYLIEKCECPHGYSGLSCEACAPGFYRVAPATPGRRTGPTLGTCVPCQCNGHSDICDPQSSVCQACKHNTAGDHCERCAPGFYGIVRGSPDDCKPCACPLLISSNNFSPTC-TLQGTNDYRCTACPLGYEGQYCERCASGYTGNPGVPGGSCQECECNPYGSLS--MICHPTTGQCTCKTGSTGLKCAGCTD 1534          

HSP 8 Score: 72.7886 bits (177), Expect = 1.410e-11
Identity = 54/160 (33.75%), Postives = 75/160 (46.88%), Query Frame = 2
Query: 4613 KKCNCNGYSKV-----CDSVTGDCQNCMGNREGNKCQLCREGFYKNDKNYDQCEPCQCPSAHYNFAQNCT-RIESSLELKCQCRIGYSGKSCENC-QQGFYGNPIKGIPCKSCDCNQQGSQSLNCNEFGICQCSPGVLGIKCDQCAPN-YVVEKKTCQSC 5068
            K C CN    +     CDS TG C  C     G  C  C EG++ +      C+ C C   H N + + +   E+    +CQCR    G+ C+ C  Q F     +G  C  C+CN  GS+S +C++ G C+C PGV G KCD C    Y  ++  C  C
Sbjct:  837 KPCKCNNNLDLSTPGCCDSQTGACLVCKPGITGQYCNKCAEGYFGDALEARGCQSCNC---HVNGSVSTSCNTETG---QCQCRNNVIGRQCDECLPQTFGLQSAQG--CVPCNCNSFGSKSFDCDDSGQCRCQPGVTGKKCDHCDHGFYDFQEGGCTPC 988          

HSP 9 Score: 63.5438 bits (153), Expect = 8.253e-9
Identity = 49/142 (34.51%), Postives = 71/142 (50.00%), Query Frame = 2
Query: 4619 CNCNG-YSKVCDSVTGDCQNCMGNREGNKCQLCREGFYKNDKNYDQCEPCQCPSAHYNFAQNCTRIESSLELKCQCRIGYSGKSCENCQQGFYGNPIKGIPCKSCDCNQQGSQSLNCN-EFGICQCSPGVLGIKCDQCAPNY 5038
            C+ NG  S  C++ TG CQ C  N  G +C  C    +   ++   C PC C S    F       + S +  C+C+ G +GK C++C  GFY     G  C  C+C   G+   NC+ + G C C P  +G +CD+CAPN+
Sbjct:  894 CHVNGSVSTSCNTETGQCQ-CRNNVIGRQCDECLPQTF-GLQSAQGCVPCNCNS----FGSKSFDCDDSGQ--CRCQPGVTGKKCDHCDHGFYDFQEGG--CTPCECPHVGN---NCDADTGHCVCPPNTIGEQCDKCAPNH 1022          

HSP 10 Score: 57.3806 bits (137), Expect = 6.089e-7
Identity = 54/185 (29.19%), Postives = 70/185 (37.84%), Query Frame = 2
Query: 3218 CVPCNC-GRGSLNPKCDMETGNCK-CAQNVARRDCSKCDVGYFGLDVTGCKKCPPCYNGQVCNNEGICVCPPNTIGNLCNKCSEDSWDFNETIGCKKCNCYINGSYSNICNKISGICACKTAFFGSKCDRCNEGYYGFP-----NCQPCSCAENGTKSNELTKCDKITGQCQCKQNVIGTKCKVC 3751
            CVPC C G   +   CD ++  C+ C  N A   C +C  G++G+       C PC             CP     N          +F+ T       C + G+    C       AC   + G  C+RC  GY G P     +CQ C C   G+ S     C   TGQC CK    G KC  C
Sbjct: 1389 CVPCQCNGHSDI---CDPQSSVCQACKHNTAGDHCERCAPGFYGIVRGSPDDCKPC------------ACPLLISSN----------NFSPT-------CTLQGTNDYRCT------ACPLGYEGQYCERCASGYTGNPGVPGGSCQECECNPYGSLS---MICHPTTGQCTCKTGSTGLKCAGC 1532          

HSP 11 Score: 56.225 bits (134), Expect = 1.624e-6
Identity = 64/227 (28.19%), Postives = 88/227 (38.77%), Query Frame = 2
Query: 4619 CNCNGY---SKVCDSVTGDCQNCMGNREGNKCQLCREGFYKNDKNYDQCEPCQCPSA----------------------------HYNF-------AQNCTRIESSLELKCQ-------CRIGYSGKSCENCQQGFYGNPIKGIPCKSCDCNQQGSQSLNCNE----------FGICQCSPGVLGIKCDQCAPN----YVVEKKTCQSCY-----SGCTK-DLLVRI 5104
            CNCN +   S  CD  +G C+ C     G KC  C  GFY  D     C PC+CP                              H+ +       A NC+    SL ++C        CR  +SG  C +C+ G+   P     C +C C   GSQ   C++           G C C   V G+ CD+C P+    +V     C SCY     + CT+ D L+R+
Sbjct:  941 CNCNSFGSKSFDCDD-SGQCR-CQPGVTGKKCDHCDHGFY--DFQEGGCTPCECPHVGNNCDADTGHCVCPPNTIGEQCDKCAPNHWGYSIITGCKACNCSN-PGSLSMQCNSDTGCCFCRPNFSGDKCSSCRLGYRKYPT----CVNCGCMLAGSQPQTCDQETEKCSCAEQTGQCNCKINVEGVLCDRCKPSTFGLHVGNPLGCSSCYCFGLATHCTEADGLIRM 1158          
BLAST of Laminin subunit alpha-2 vs. Ensembl Xenopus
Match: wdcp (WD repeat and coiled coil containing [Source:Xenbase;Acc:XB-GENE-5729803])

HSP 1 Score: 724.546 bits (1869), Expect = 0.000e+0
Identity = 455/1179 (38.59%), Postives = 618/1179 (52.42%), Query Frame = 2
Query:  188 LMENAKITSSATCGTGGPEIFCRLVDEIAIQRLINPDSHVLCDVCDNR--NETKRHPIEFAKSDDDNLWWQSPSMAQGLKYQNVNVTIDLKQVYQIVYILLKMGDSPRPGNWILERSLDGEIYMPWIFFAETPYSCYNLFQRQYPDLKLTTNAKPSSLADDEMFCTTYYSQPKSLNSGEIIISLINGRKSIMNEEYLSIKSVPQTLINFLSARYIRFRFLKHLTLAADLMTHKGYLEQSIY--------NRYYYSLRNIEIGGKCICNNHADKCDKVIENGISVAKCNCKHNTCGSNCETCCPLFNQRPWKPVAV-----CEECNCNRKSNECSYNQTVATLQLSVNKMGRMEGGGVCINCQENTEGINCEKCIKGFYRPWNVLATELYPCTPCQCHGLGTIGSCVSNGEDIGDQK--PGDCICKKGYEGVNCDLCSIGYERYPNGECLPCPCSIDGSVRTSFYRCKPPCNCKVHVNSDDLCKTCKNGYFNLDSANPEGCEPCYCFGITNQCSSLSAKNLKISDLKGWKLTTFTGEKIALPK---FTSFQYLTSENSYIDERFNN-PTVYYWTAPPPYLGNWITSYGTIFRYVVKIELQSTLKGSLIDS---PDVIIKCGDFRLFHSVSIEDRRLQRQVF------IYIKPTEWKIGKLTPDKAATKEEFISCLVKVDKLLIKAKYYSNQKSI-ELLNITLS-RGEVHLALDEMPHIEKCNCPPGFNGLSCESCESGYRRVNNVLYQGQCEACACYNHSNTCDSLNGECQNCTHNTAGAHCEDCASGYYGDAKSKNLNSCKKCPCP-RLDY-QMTELCSSYSSENYVCHKCLHNTSGVHCDRCIEGYYGNPKKK-ISCKRCKCNNNQES-----CDPVTGECR-CSYNTMGTECQLCKHGFYGDAL-TKSCKKCDCDSLGSTSENCDKLTGKCDCRTNFVNRQCDSC---TSGLYLKDKKCIPCNCEIQGRISSEKFCNTTSGQCFCLENVNGDRCEKCVEGYFNYP--NCKKCLCSPHALSADCDLNNGKCKCGSNVINRICDKCENLHY-WNNRTDCVPCNCGR-GSLNPKCDMETGNCKCAQNVARRDCSKCDVGYFGLDVTGCKKCPPCYN---------GQVCNNE----------GICVCPPNTIGNLCNKCSEDSWDFN--ETIGCKKCNCY 3514
            L  NA+IT++ATCG  G E FC+LV+ +  Q    P  +  C  CD +  N   RHPI  A  +  N WWQSPS+  G++Y  V VT+DL+QV+QI YI++K  +SPRPGNWILERSLDG  + PW ++A T   C   ++ +         A+ S   DDE+ CT++YS+   L +GEI  SLI GR S  +         P+ L+ F SARYIR R  +  TL ADLM     L QS Y         RY+YS+++I +GG CIC  HA  C          + C C+HNTCG +C+ CCP FNQ+PWK         CE CNC+ KS EC Y+Q VA  +LS++ +G   GGGVCINC  NT GINCE C+  FYRP  V  T+ YPC PC C  +G++       E    +   PG C CK G+ G  CD C++GY  YP  EC+ C CS+ GS  T+   C  PC CK +V   + C  CK GYFNL   NP+GC+ C+C G+++ C+       KI+D+ GW +T  +G     P    F     L+  N   D R    P VYYW+APP YL       G    Y +  +  +++K   +DS   P++II+    +    +S +   +Q   F      I + P  ++I     +   ++ EF+  L  V+KLLI+A Y + Q++I  L ++TL   G+   +      +E C CP GF+G SCESC  G RRVN  L+ G CE C CY H++ C  + GEC +C HNT G +C+ C  G+YG+        CK C CP  +D    +  C    +   VC  C    +G  C+RC EGYYG P +   SCK CKCNNN +      CD  TG C  C     G  C  C  G++GDAL  + C+ C+C   GS S +C+  TG+C CR N + RQCD C   T GL    + C+PCNC   G   S+ F    SGQC C   V G +C+ C  G++++    C  C C PH +  +CD + G C C  N I   CDKC   H+ ++  T C  CNC   GSL+ +C+ +TG C C  N +   CS C +GY        +K P C N          Q C+ E          G C C  N  G LC++C   ++  +    +GC  C C+
Sbjct:   38 LATNARITTNATCGEKGQETFCKLVEHVPGQ----PLRYSQCRTCDQKSSNPNLRHPISNA-INGKNSWWQSPSIQNGMQYHYVTVTLDLQQVFQIAYIIIKAANSPRPGNWILERSLDGVNFKPWQYYAITESECLTRYKVK------PQPAQASFAKDDEVICTSHYSKIHPLENGEIFTSLIIGRPSAEDPS-------PE-LLEFTSARYIRLRLQRIRTLNADLM----MLSQSTYKDIDPIVTRRYFYSIKDISVGGMCICYGHARSCP--FNLATKKSSCECEHNTCGDSCDRCCPGFNQKPWKAGTFLLKHECEPCNCHWKSEECYYDQQVADKRLSLDILGNYSGGGVCINCTSNTAGINCETCVDRFYRPKGVSPTQPYPCQPCSCDPIGSLHDICVKDEKQAPRGMLPGSCHCKSGFAGERCDKCAVGYIGYP--ECVRCNCSLIGS--TNKDPCVDPCICKDNVEGQN-CDQCKLGYFNLQKDNPQGCDQCFCSGVSSICTGSRLAYTKITDMNGWYVTDLSGYTRVAPAKDGFDGPHQLSITNR--DARAQGLPEVYYWSAPPTYL-----PVGGHLSYTISYD--ASMKTDSVDSTNYPNIIIEGNGIK----ISSQQETIQLGPFEEITETIVLHPDSFRI--YGTEFQVSRREFMMVLANVNKLLIRATYSNGQEAIYRLSSVTLEVAGDPSSSGKTAFSVELCQCPSGFSGTSCESCLPGNRRVNGTLFGGSCEPCRCYGHTDRCHDVTGECLDCKHNTYGRYCDYCLPGFYGNPSEGTAEDCKPCSCPLTIDSNNFSPTCHLDKTRGLVCDSCRPGYTGQRCERCAEGYYGQPSEPGGSCKPCKCNNNLDLSTPGCCDSQTGACLVCKPGITGQYCNKCAEGYFGDALEARGCQSCNCHVNGSVSTSCNTETGQCQCRNNVIGRQCDECLPQTFGLQ-SAQGCVPCNCNSFG---SKSFDCDDSGQCRCQPGVTGKKCDHCDHGFYDFQEGGCTPCEC-PH-VGNNCDADTGHCVCPPNTIGEQCDKCAPNHWGYSIITGCKACNCSNPGSLSMQCNSDTGCCFCRPNFSGDKCSSCRLGY--------RKYPTCVNCGCMLAGSQPQTCDQETEKCSCAEQTGQCNCKINVEGVLCDRCKPSTFGLHVGNPLGCSSCYCF 1157          

HSP 2 Score: 243.047 bits (619), Expect = 4.294e-63
Identity = 165/461 (35.79%), Postives = 225/461 (48.81%), Query Frame = 2
Query: 2573 KCLHNTSGVHCDRCIEG-------YYGNPKKKISCKRCKCNNNQESCDPVTGEC-RCSYNTMGTECQLCKHGFYG---DALTKSCKKCDCDSLGSTSEN------CDKLTG-KCD-CRTNFVNRQCDSCTSGLYLKDKK----CIPCNCEIQGRISSEKFCNTTSGQCF-CLENVNGDRCEKCVEGYFN----YPNCKKCLCSPH-ALSADCDLNNGKCKCGSNVINRICDKCENLHY-WNNRTDCVPCNCGR-GSLNPKCDMETGNCKCAQNVARRDCSKCDVGYFGLDVTGCKKCPPCYNGQVCN-NEGICVCPPNTIGNLCNKCSEDSWDFNETIGCKKCNCYINGSYSNICNKISGICACKTAFFGSKCDRCNEGYYGFPNCQPCSCAENGT------KSNELTKCDKITGQCQCKQNVIGTKCKVCRKGTFPSDGTYEG---GCFSCFCFGVSEKC 3832
            +C    SG  C+ C+ G        +G      SC+ C+C  + + C  VTGEC  C +NT G  C  C  GFYG   +   + CK C C  L   S N       DK  G  CD CR  +  ++C+ C  G Y +  +    C PC C     +S+   C++ +G C  C   + G  C KC EGYF        C+ C C  + ++S  C+   G+C+C +NVI R CD+C    +   +   CVPCNC   GS +  CD ++G C+C   V  + C  CD G++     GC  C   + G  C+ + G CVCPPNTIG  C+KC+ + W ++   GCK CNC   GS S  CN  +G C C+  F G KC  C  GY  +P C  C C   G+      +  E   C + TGQC CK NV G  C  C+  TF   G + G   GC SC+CFG++  C
Sbjct:  713 QCPSGFSGTSCESCLPGNRRVNGTLFGG-----SCEPCRCYGHTDRCHDVTGECLDCKHNTYGRYCDYCLPGFYGNPSEGTAEDCKPCSC-PLTIDSNNFSPTCHLDKTRGLVCDSCRPGYTGQRCERCAEGYYGQPSEPGGSCKPCKCNNNLDLSTPGCCDSQTGACLVCKPGITGQYCNKCAEGYFGDALEARGCQSCNCHVNGSVSTSCNTETGQCQCRNNVIGRQCDECLPQTFGLQSAQGCVPCNCNSFGSKSFDCD-DSGQCRCQPGVTGKKCDHCDHGFYDFQEGGCTPCECPHVGNNCDADTGHCVCPPNTIGEQCDKCAPNHWGYSIITGCKACNCSNPGSLSMQCNSDTGCCFCRPNFSGDKCSSCRLGYRKYPTCVNCGCMLAGSQPQTCDQETEKCSCAEQTGQCNCKINVEGVLCDRCKPSTF---GLHVGNPLGCSSCYCFGLATHC 1163          

HSP 3 Score: 232.261 bits (591), Expect = 7.030e-60
Identity = 199/700 (28.43%), Postives = 286/700 (40.86%), Query Frame = 2
Query: 1007 VAKCNCKHNTCGSNCETCCPLFNQRPWKPVAVCEECNCNR---KSNECSYNQTVATLQLSVNKMGRMEGGGVCINCQENTEGINCEKCIKGFYRPWNVLATELYPCTPCQCHGLGT-----IGSCVSNGEDIGDQ-----------------------KPGD-----------CICKKGYEGVNCDLCSIGYERYPNGECLPCPCSIDGSV---------RTSFYRCKPPCNCKVHVNSDDLCKTCKNGYFNLDSANPEGCEPCYCFGITNQCSS--------LSAKN----LKISDLKGWKLTTFTGEKIALPKFTSFQYLTSENSYIDERFNNPTVYYWTAPPPYLGNWITSYGTIFRYVVKIELQSTLKGSLIDSPDVIIKCG---DFRLF--HSVSIEDRRLQRQVFIYIKPTEWKIGKLTPDKAATKEEFISCLVKVDKLLIKAKYYSNQKSIELLNITLSRGEVHLALDEMPH---IEKCNCPPGFNGLSCESCESGYRRVNNVL-------YQGQCEACACYNHSNTCDSLNGECQNCTHNTAGAHCEDCASGYYGDAKSKNLNSCKKCPCPRL--DYQMTELCSSYSSENYVCHKCLHNTSGVHCDRCIEGYYGNPK-KKISCKRCKCN---NNQESCDPVTGECRCSYNTMGTECQLC--KHGFYGDALTKSCKKCDCDSLGSTSENCDKL 2848
              +C C++N  G  C+ C P       +    C  CNCN    KS +C                   +  G C  CQ    G  C+ C  GFY        +   CTPC+C  +G       G CV     IG+Q                        PG            C C+  + G  C  C +GY +YP   C+ C C + GS          + S       CNCK++V    LC  CK   F L   NP GC  CYCFG+   C+         L+ K     L + DL     TT  G     P+  +      E+ + +        +YW  P  + G  +T+YG   +Y +  E +     S  + P VII+ G   + R+   +  + ++ +L R   I +   +WK       +  ++E+F+  L  +  +LIKA Y S  +   +  I+L   E   +    P    IEKC CP G++GLSCE+C  G+ RV             G C  C C  HS+ CD  +  CQ C HNTAG HCE CA G+YG  +  + + CK C CP L      +  C+   + +Y C  C     G +C+RC  GY GNP     SC+ C+CN   +    C P TG+C C   + G +C  C  +H   G      C  CD +  G   ++ ++L
Sbjct:  922 TGQCQCRNNVIGRQCDECLP--QTFGLQSAQGCVPCNCNSFGSKSFDC-------------------DDSGQC-RCQPGVTGKKCDHCDHGFYD------FQEGGCTPCECPHVGNNCDADTGHCVCPPNTIGEQCDKCAPNHWGYSIITGCKACNCSNPGSLSMQCNSDTGCCFCRPNFSGDKCSSCRLGYRKYPT--CVNCGCMLAGSQPQTCDQETEKCSCAEQTGQCNCKINVEGV-LCDRCKPSTFGLHVGNPLGCSSCYCFGLATHCTEADGLIRMWLTLKPDQTVLPLVDLTQQHRTT-KGVTYQHPEIVAMIDQVKEDLHAEP-------FYWRLPQQFEGRKLTAYGGKLKYAIYFEARDETGPSTYE-PQVIIRGGPHANHRIIVRNMAAPQNGQLTRHD-IEMTEHDWKYLGSVDGRPVSREDFMDVLYDIQYILIKAAYGSVLRQTRISEISLEVAEEGTSFTISPRAYLIEKCECPHGYSGLSCEACAPGFYRVAPATPGRRTGPTLGTCVPCQCNGHSDICDPQSSVCQACKHNTAGDHCERCAPGFYGIVRG-SPDDCKPCACPLLISSNNFSPTCTLQGTNDYRCTACPLGYEGQYCERCASGYTGNPGVPGGSCQECECNPYGSLSMICHPTTGQCTCKTGSTGLKCAGCTDRHAREGPV----CVFCDDECTGLLLDDLEQL 1575          

HSP 4 Score: 176.407 bits (446), Expect = 6.974e-43
Identity = 192/721 (26.63%), Postives = 283/721 (39.25%), Query Frame = 2
Query: 3086 CLCSPHALSADCDLNNGK--CKCGSNVINRICDKC---ENLHYWNNRT-----DCVPCNCGRGSLNPKCDMETGNCKCAQNVARRDCSKCDVGYFGLDVTGCKKCPPCYNGQVCNNEGICV-CPPNTIGNLCNKCSEDSW-----DFNETIGCKKCNCYINGSYSNICNK---------ISGICACKTAFFGSKCDRCNEGYYGFPNCQPCSCAENGTKSNELTKCDKITGQCQCKQNVIGTKCKVCRKGTFPSDGTYEGGCFSCFCFGVSEKCHAI---------LNHRIVENSIYEYHIFDEKNSLESGKDYSTIHLNA---NYPRRFGWPLTMFRPIYVNV---MKLFNSHDLSLFYRSIFMNVSVDCLDNKCGREIPEQTEVFMESYNGLFGMRYXXXXXXXXXXXXXXDFNEHSKNGKWVISQYQNDILDKFIILEDSNVINS---NLTRDIFMMALLNVTSLKVKLYTDKVNPPLIKIKIITYKVMETTQAIGKRVTAVEKCICNALTFGNHCQNPISGYYKEYFNLPNSTKSGSMRTGNRILINLKKCNCNGYSKVCDSVTGDCQNCMGNREGNKCQLCREGFYKN--DKNYDQCEPCQCPSA--HYNFAQNCTRIESSLELKC-QCRIGYSGKSCENCQQGFYGNPIK-GIPCKSCDCNQQGSQSLNCNEFGICQ--------CSPGVLGIKCDQCAPNY---VVEKKTCQSC 5068
            C+C  HA S   +L   K  C+C  N     CD+C    N   W   T     +C PCNC           ++  C   Q VA +  S        LD+ G       Y+G      G+C+ C  NT G  C  C +  +        +   C+ C+C   GS  +IC K         + G C CK+ F G +CD+C  GY G+P C  C+C+  G+     T  D     C CK NV G  C  C+ G F        GC  CFC GVS  C            +N   V +      +   K+  +     S  + +A     P  + W      P Y+ V   +    S+D S+   S+      + +    G +I  Q E       G F                                    +I +  ++  DS  I      ++R  FMM L NV  L ++         + ++  +T +V     + GK   +VE C C +   G  C++ + G         N   +G++  G     + + C C G++  C  VTG+C +C  N  G  C  C  GFY N  +   + C+PC CP      NF+  C  ++ +  L C  CR GY+G+ CE C +G+YG P + G  CK C CN     +L+ +  G C         C PG+ G  C++CA  Y    +E + CQSC
Sbjct:  279 CICYGHARSCPFNLATKKSSCECEHNTCGDSCDRCCPGFNQKPWKAGTFLLKHECEPCNC---------HWKSEECYYDQQVADKRLS--------LDILGN------YSGG-----GVCINCTSNTAGINCETCVDRFYRPKGVSPTQPYPCQPCSCDPIGSLHDICVKDEKQAPRGMLPGSCHCKSGFAGERCDKCAVGYIGYPECVRCNCSLIGS-----TNKDPCVDPCICKDNVEGQNCDQCKLGYFNLQKDNPQGCDQCFCSGVSSICTGSRLAYTKITDMNGWYVTDLSGYTRVAPAKDGFDGPHQLSITNRDARAQGLPEVYYWSAP---PTYLPVGGHLSYTISYDASMKTDSVDSTNYPNIIIEGNGIKISSQQETIQL---GPF-----------------------------------EEITETIVLHPDSFRIYGTEFQVSRREFMMVLANVNKLLIRATYSNGQEAIYRLSSVTLEVAGDPSSSGKTAFSVELCQCPSGFSGTSCESCLPG---------NRRVNGTLFGG-----SCEPCRCYGHTDRCHDVTGECLDCKHNTYGRYCDYCLPGFYGNPSEGTAEDCKPCSCPLTIDSNNFSPTC-HLDKTRGLVCDSCRPGYTGQRCERCAEGYYGQPSEPGGSCKPCKCN----NNLDLSTPGCCDSQTGACLVCKPGITGQYCNKCAEGYFGDALEARGCQSC 906          

HSP 5 Score: 151.369 bits (381), Expect = 2.591e-35
Identity = 182/743 (24.50%), Postives = 316/743 (42.53%), Query Frame = 2
Query: 4313 LTRDIFMMALLNVTSLKVKLYTDKVNPPLIKIKIITYKVME--TTQAIGKRVTAVEKCICNALTFGNHCQNPISGYYKEYFNLPNSTKSGSMRTGNRILINLKKCNCNGYSKVCDSVTGDCQNCMGNREGNKCQLCREGFYKNDKNY-DQCEPCQCP--SAHYNFAQNCTRIESSLELKC-QCRIGYSGKSCENCQQGFYGNP-IKGIPCKSCDCNQQGSQSLNCNE-FGICQCSPGVLGIKCDQCAPNYVVEKKTCQSCYSGCTKDLLVRIDTLNETVINF--------KWKTLPSTLDLRLNKIN--ISIQMSSELLNSI--NKFYKLKNEIKNFSIQFQKMKDDAKEKYGEIEKLKTRYNK----VLEDLRSTFTDINETISGHEQLGISNELIKNATAYLET-IKNIYKEMPNITL--AASVLKDVLKYVDELNQIIK--YTQSHIQSDQINN-------------------LKILKNKTIMADEINTNNKEYLNTMSTK-------KKEHELYI--------------ILINERMKDLQKIFRKMTKQR----DNLRKKIQKLDAISKSFQDEKDLIS-INVREIEDLM----KNLSSNHLVS-------KSLI-IPDTLKKHVEQQLNKSSNLIK------------KLTKDFNFLHNAEQAKEAYSNITRDILAVD--------------YAINQTKKELDF--NRSNMNIDSLKKLLAEFNSNKSEIVENIKNID 6199
            ++R+ FM  L ++  + +K     V     +I  I+ +V E  T+  I  R   +EKC C     G  C+    G+Y+     P        RTG   L     C CNG+S +CD  +  CQ C  N  G+ C+ C  GFY   +   D C+PC CP   +  NF+  CT ++ + + +C  C +GY G+ CE C  G+ GNP + G  C+ C+CN  GS S+ C+   G C C  G  G+KC  C   +  E   C  C   CT  LL  ++ LN+ V++          +KTL  T   +  ++   +S Q + E L  +  N    L  E+     +  K+  D ++   + E+   R  +    V E LR++    ++ +  +E LGI N+ +  +   L+  I ++  E+   +L    +   D LK  + L   +K  + ++H +++ +NN                   L+  + K   AD+++T N++ +  +  K       KKE E  +               +INE + D+ K    +T+Q     +NL ++I + D   +  Q E      I+   + D +    KNLS N  V+       K LI   +   K  + + N++ +L+              + K F  L +A++      +   D+  +                A+N T  +L    N + + I + K    + N   S+++E +K+++
Sbjct: 1310 VSREDFMDVLYDIQYILIKAAYGSV-LRQTRISEISLEVAEEGTSFTISPRAYLIEKCECPHGYSGLSCEACAPGFYRVAPATPGR------RTG-PTLGTCVPCQCNGHSDICDPQSSVCQACKHNTAGDHCERCAPGFYGIVRGSPDDCKPCACPLLISSNNFSPTCT-LQGTNDYRCTACPLGYEGQYCERCASGYTGNPGVPGGSCQECECNPYGSLSMICHPTTGQCTCKTGSTGLKCAGCTDRHAREGPVCVFCDDECTGLLLDDLEQLNQMVMSVNLSGPLPPPYKTL-FTFGNQTQELKHLLSPQRAPERLLQLAQNNQDTLVIEMDELLNRAAKVTADGEQTGKDAERTNERAKQLEDFVKETLRASKDIYDKAVKLNETLGIPNKTLDKSFQELQKDIDSMMAELRRKSLRNQKNTADDELKAAEALLNRVKKLFLEAHKKNEDLNNEVKEKLGLFEEKLDDVWDLLREARGKIKAADDLSTVNQKNMTELERKKQGVEKGKKETESVLGDGDSIMTEVNNLAQIINEDLSDMNKELPPLTEQLNEKINNLTQEIARRDLPEQILQAENQAAQLIDSSAVLDGILAEAKNLSFNATVAFNAYSNIKDLIDDAEDTAKEAKAKANEAIDLVTGPQGSLKDEAKNAIQKSFRVLSDAKRHSGDVKDNENDLAGIKNRLENADEKNQNMLQALNDTFGKLALIPNDTLVKIQTAKDKAKQANDTASDVLERLKDLN 2042          

HSP 6 Score: 125.946 bits (315), Expect = 1.191e-27
Identity = 107/337 (31.75%), Postives = 139/337 (41.25%), Query Frame = 2
Query: 2951 EIQGRISSEKFCNTTSGQCFCLENVNGDRCEKC------VEGYFNYPNCKKCLCSPHALSADCDLNNGKC-KCGSNVINRICDKCENLHYWN----NRTDCVPCNC----GRGSLNPKCDMETGNC----KCAQNVARRDCSKCDVGYFGLDVTGCKKCPPCYNGQVCNN-------------EGIC-VCPPNTIGNLCNKCSEDSW-DFNETIGCKKCNCYINGSYSNICNKISGICACKTAFFGSKCDRCNEGYYGFPNCQ---PCSCAENGTKSNELTKCDKITGQCQCKQNVIGTKCKVCRKGTFPSDGTYEGGCFSCFCFGVSEKCHAILNH 3850
            E+ G  SS      +   C C    +G  CE C      V G     +C+ C C  H  +  C    G+C  C  N   R CD C    Y N       DC PC+C       + +P C ++         C      + C +C  GY+G        C PC     CNN              G C VC P   G  CNKC+E  + D  E  GC+ CNC++NGS S  CN  +G C C+    G +CD C    +G  + Q   PC+C   G+KS +   CD  +GQC+C+  V G KC  C  G +      EGGC  C C  V   C A   H
Sbjct:  694 EVAGDPSSSGKTAFSVELCQCPSGFSGTSCESCLPGNRRVNGTLFGGSCEPCRCYGH--TDRCHDVTGECLDCKHNTYGRYCDYCLPGFYGNPSEGTAEDCKPCSCPLTIDSNNFSPTCHLDKTRGLVCDSCRPGYTGQRCERCAEGYYGQPSEPGGSCKPCK----CNNNLDLSTPGCCDSQTGACLVCKPGITGQYCNKCAEGYFGDALEARGCQSCNCHVNGSVSTSCNTETGQCQCRNNVIGRQCDECLPQTFGLQSAQGCVPCNCNSFGSKSFD---CDD-SGQCRCQPGVTGKKCDHCDHGFY---DFQEGGCTPCECPHVGNNCDADTGH 1017          

HSP 7 Score: 75.0998 bits (183), Expect = 2.750e-12
Identity = 57/185 (30.81%), Postives = 81/185 (43.78%), Query Frame = 2
Query: 2573 KCLHNTSGVHCDRCIEGYY----GNPKKKI-----SCKRCKCNNNQESCDPVTGECR-CSYNTMGTECQLCKHGFYG--DALTKSCKKCDCDSLGST---SENCDKLTGKCD-----CRTNFVNRQCDSCTSGLY----LKDKKCIPCNCEIQGRISSEKFCNTTSGQCFCLENVNGDRCEKCVE 3055
            +C H  SG+ C+ C  G+Y      P ++      +C  C+CN + + CDP +  C+ C +NT G  C+ C  GFYG        CK C C  L S+   S  C  L G  D     C   +  + C+ C SG      +    C  C C   G +S    C+ T+GQC C     G +C  C +
Sbjct: 1367 ECPHGYSGLSCEACAPGFYRVAPATPGRRTGPTLGTCVPCQCNGHSDICDPQSSVCQACKHNTAGDHCERCAPGFYGIVRGSPDDCKPCACPLLISSNNFSPTC-TLQGTNDYRCTACPLGYEGQYCERCASGYTGNPGVPGGSCQECECNPYGSLS--MICHPTTGQCTCKTGSTGLKCAGCTD 1548          

HSP 8 Score: 73.1738 bits (178), Expect = 1.144e-11
Identity = 54/160 (33.75%), Postives = 75/160 (46.88%), Query Frame = 2
Query: 4613 KKCNCNGYSKV-----CDSVTGDCQNCMGNREGNKCQLCREGFYKNDKNYDQCEPCQCPSAHYNFAQNCT-RIESSLELKCQCRIGYSGKSCENC-QQGFYGNPIKGIPCKSCDCNQQGSQSLNCNEFGICQCSPGVLGIKCDQCAPN-YVVEKKTCQSC 5068
            K C CN    +     CDS TG C  C     G  C  C EG++ +      C+ C C   H N + + +   E+    +CQCR    G+ C+ C  Q F     +G  C  C+CN  GS+S +C++ G C+C PGV G KCD C    Y  ++  C  C
Sbjct:  851 KPCKCNNNLDLSTPGCCDSQTGACLVCKPGITGQYCNKCAEGYFGDALEARGCQSCNC---HVNGSVSTSCNTETG---QCQCRNNVIGRQCDECLPQTFGLQSAQG--CVPCNCNSFGSKSFDCDDSGQCRCQPGVTGKKCDHCDHGFYDFQEGGCTPC 1002          

HSP 9 Score: 63.929 bits (154), Expect = 6.530e-9
Identity = 51/146 (34.93%), Postives = 73/146 (50.00%), Query Frame = 2
Query: 4613 KKCNC--NG-YSKVCDSVTGDCQNCMGNREGNKCQLCREGFYKNDKNYDQCEPCQCPSAHYNFAQNCTRIESSLELKCQCRIGYSGKSCENCQQGFYGNPIKGIPCKSCDCNQQGSQSLNCN-EFGICQCSPGVLGIKCDQCAPNY 5038
            + CNC  NG  S  C++ TG CQ C  N  G +C  C    +   ++   C PC C S    F       + S +  C+C+ G +GK C++C  GFY     G  C  C+C   G+   NC+ + G C C P  +G +CD+CAPN+
Sbjct:  904 QSCNCHVNGSVSTSCNTETGQCQ-CRNNVIGRQCDECLPQTF-GLQSAQGCVPCNCNS----FGSKSFDCDDSGQ--CRCQPGVTGKKCDHCDHGFYDFQEGG--CTPCECPHVGN---NCDADTGHCVCPPNTIGEQCDKCAPNH 1036          

HSP 10 Score: 57.7658 bits (138), Expect = 5.463e-7
Identity = 54/185 (29.19%), Postives = 70/185 (37.84%), Query Frame = 2
Query: 3218 CVPCNC-GRGSLNPKCDMETGNCK-CAQNVARRDCSKCDVGYFGLDVTGCKKCPPCYNGQVCNNEGICVCPPNTIGNLCNKCSEDSWDFNETIGCKKCNCYINGSYSNICNKISGICACKTAFFGSKCDRCNEGYYGFP-----NCQPCSCAENGTKSNELTKCDKITGQCQCKQNVIGTKCKVC 3751
            CVPC C G   +   CD ++  C+ C  N A   C +C  G++G+       C PC             CP     N          +F+ T       C + G+    C       AC   + G  C+RC  GY G P     +CQ C C   G+ S     C   TGQC CK    G KC  C
Sbjct: 1403 CVPCQCNGHSDI---CDPQSSVCQACKHNTAGDHCERCAPGFYGIVRGSPDDCKPC------------ACPLLISSN----------NFSPT-------CTLQGTNDYRCT------ACPLGYEGQYCERCASGYTGNPGVPGGSCQECECNPYGSLS---MICHPTTGQCTCKTGSTGLKCAGC 1546          

HSP 11 Score: 56.225 bits (134), Expect = 1.340e-6
Identity = 64/227 (28.19%), Postives = 88/227 (38.77%), Query Frame = 2
Query: 4619 CNCNGY---SKVCDSVTGDCQNCMGNREGNKCQLCREGFYKNDKNYDQCEPCQCPSA----------------------------HYNF-------AQNCTRIESSLELKCQ-------CRIGYSGKSCENCQQGFYGNPIKGIPCKSCDCNQQGSQSLNCNE----------FGICQCSPGVLGIKCDQCAPN----YVVEKKTCQSCY-----SGCTK-DLLVRI 5104
            CNCN +   S  CD  +G C+ C     G KC  C  GFY  D     C PC+CP                              H+ +       A NC+    SL ++C        CR  +SG  C +C+ G+   P     C +C C   GSQ   C++           G C C   V G+ CD+C P+    +V     C SCY     + CT+ D L+R+
Sbjct:  955 CNCNSFGSKSFDCDD-SGQCR-CQPGVTGKKCDHCDHGFY--DFQEGGCTPCECPHVGNNCDADTGHCVCPPNTIGEQCDKCAPNHWGYSIITGCKACNCSN-PGSLSMQCNSDTGCCFCRPNFSGDKCSSCRLGYRKYPT----CVNCGCMLAGSQPQTCDQETEKCSCAEQTGQCNCKINVEGVLCDRCKPSTFGLHVGNPLGCSSCYCFGLATHCTEADGLIRM 1172          
BLAST of Laminin subunit alpha-2 vs. Ensembl Xenopus
Match: wdcp (WD repeat and coiled coil containing [Source:Xenbase;Acc:XB-GENE-5729803])

HSP 1 Score: 718.383 bits (1853), Expect = 0.000e+0
Identity = 457/1180 (38.73%), Postives = 622/1180 (52.71%), Query Frame = 2
Query:  188 LMENAKITSSATCGTGGPEIFCRLVDEIAIQRLINPDSHVLCDVCDNR--NETKRHPIEFAKSDDDNLWWQSPSMAQGLKYQNVNVTIDLKQVYQIVYILLKMGDSPRPGNWILERSLDGEIYMPWIFFAETPYSCYNLFQRQYPDLKLTTNAKPSSLADDEMFCTTYYSQPKSLNSGEIIISLINGRKSIMNEEYLSIKSVPQTLINFLSARYIRFRFLKHLTLAADLMTHKGYLEQSIY--------NRYYYSLRNIEIGGKCICNNHADKCDKVIENGISVAKCNCKHNTCGSNCETCCPLFNQRPWKPVAV-----CEECNCNRKSNECSYNQTVATLQLSVNKMGRMEGGGVCINCQENTEGINCEKCIKGFYRPWNVLATELYPCTPCQCHGLGTIGS-CVSNGEDIGDQK---PGDCICKKGYEGVNCDLCSIGYERYPNGECLPCPCSIDGSVRTSFYRCKPPCNCKVHVNSDDLCKTCKNGYFNLDSANPEGCEPCYCFGITNQCSSLSAKNLKISDLKGWKLTTFTGEKIALPK---FTSFQYLTSENSYIDERFNN-PTVYYWTAPPPYLGNWITSYGTIFRYVVKIELQSTLKGSLIDS---PDVIIKCGDFRLFHSVSIEDRRLQRQVF------IYIKPTEWKIGKLTPDKAATKEEFISCLVKVDKLLIKAKYYSNQKSI-ELLNITLS-RGEVHLALDEMPHIEKCNCPPGFNGLSCESCESGYRRVNNVLYQGQCEACACYNHSNTCDSLNGECQNCTHNTAGAHCEDCASGYYGDAKSKNLNSCKKCPCPRL--DYQMTELCSSYSSENYVCHKCLHNTSGVHCDRCIEGYYGNPKKK-ISCKRCKCNNNQES-----CDPVTGECR-CSYNTMGTECQLCKHGFYGDALTKSCKKCDCDSLGSTSENCDKLTGKCDCRTNFVNRQCDSC---TSGLYLKDKKCIPCNCEIQGRISSEKFCNTTSGQCFCLENVNGDRCEKCVEGYFNYP--NCKKCLCSPHALSADCDLNNGKCKCGSNVINRICDKCENLHY-WNNRTDCVPCNCGR-GSLNPKCDMETGNCKCAQNVARRDCSKCDVGYFGLDVTGCKKCPPCYN---------GQVCNNE----------GICVCPPNTIGNLCNKCSEDSWDFN--ETIGCKKCNCY 3514
            L  NA+IT++ATCG  G E FC+LV+ +  Q    P  +  C  CD +  N   RHPI  A  +  N WWQSPS+  G++Y  V VT+DL+QV+QI YI++K  +SPRPGNWILERSLDG  + PW ++A T   C   ++ +         A+ S   DDE+ CT++YS+   L +GEI  SLI GR S  +         P+ L+ F SARYIR R  +  TL ADLM     L QS Y         RY+YS+++I +GG CIC  HA  C   +    S   C C+HNTCG +C+ CCP FNQ+PWK         CE CNC+ KS EC Y+Q VA  +LS++ +G   GGGVCINC  NT GINCE C+  FYRP  V  T+ YPC PC C  +G++   CV + +     K   PG C CK G+ G  CD C++GY  YP  EC+ C CS+ GS  T+   C  PC CK +V   + C  CK GYFNL   NP+GC+ C+C G+++ C+       KI+D+ GW +T  +G     P    F     L+  N   D R    P VYYW+APP YL + +T+ G    Y +  +  +++K   +DS   P++II+    +    +S +   +Q   F      I + P  ++I     +   ++ EF+  L  V+KLLI+A Y + Q++I  L ++TL   G+   +      +E C CP GF+G SCESC  G RRVN  L+ G CE C CY H++ C  + GEC +C HNT G +C+ C  G+YG+        CK C CP        +  C    +   VC  C    +G  C+RC EGYYG P +   SCK CKCNNN +      CD  TG C  C     G  C  C  G++GDAL    + C+C   GS S +C+  TG+C CR N + RQCD C   T GL    + C+PCNC   G   S+ F    SGQC C   V G +C+ C  G++++    C  C C PH +  +CD + G C C  N I   CDKC   H+ ++  T C  CNC   GSL+ +C+ +TG C C  N +   CS C +GY        +K P C N          Q C+ E          G C C  N  G LC++C   ++  +    +GC  C C+
Sbjct:   21 LATNARITTNATCGEKGQETFCKLVEHVPGQ----PLRYSQCRTCDQKSSNPNLRHPISNA-INGKNSWWQSPSIQNGMQYHYVTVTLDLQQVFQIAYIIIKAANSPRPGNWILERSLDGVNFKPWQYYAITESECLTRYKVK------PQPAQASFAKDDEVICTSHYSKIHPLENGEIFTSLIIGRPSAEDPS-------PE-LLEFTSARYIRLRLQRIRTLNADLMM----LSQSTYKDIDPIVTRRYFYSIKDISVGGMCICYGHARSCPFNLATKKS--SCECEHNTCGDSCDRCCPGFNQKPWKAGTFLLKHECEPCNCHWKSEECYYDQQVADKRLSLDILGNYSGGGVCINCTSNTAGINCETCVDRFYRPKGVSPTQPYPCQPCSCDPIGSLHDICVKDEKQAPRGKGMLPGSCHCKSGFAGERCDKCAVGYIGYP--ECVRCNCSLIGS--TNKDPCVDPCICKDNVEGQN-CDQCKLGYFNLQKDNPQGCDQCFCSGVSSICTGSRLAYTKITDMNGWYVTDLSGYTRVAPAKDGFDGPHQLSITNR--DARAQGLPEVYYWSAPPTYLRSKVTAVGGHLSYTISYD--ASMKTDSVDSTNYPNIIIEGNGIK----ISSQQETIQLGPFEEITETIVLHPDSFRI--YGTEFQVSRREFMMVLANVNKLLIRATYSNGQEAIYRLSSVTLEVAGDPSSSGKTAFSVELCQCPSGFSGTSCESCLPGNRRVNGTLFGGSCEPCRCYGHTDRCHDVTGECLDCKHNTYGRYCDYCLPGFYGNPSEGTAEDCKPCSCPLTIDSNNFSPTCHLDKTRGLVCDSCRPGYTGQRCERCAEGYYGQPSEPGGSCKPCKCNNNLDLSTPGCCDSQTGACLVCKPGITGQYCNKCAEGYFGDAL--EARACNCHVNGSVSTSCNTETGQCQCRNNVIGRQCDECLPQTFGLQ-SAQGCVPCNCNSFG---SKSFDCDDSGQCRCQPGVTGKKCDHCDHGFYDFQEGGCTPCEC-PH-VGNNCDADTGHCVCPPNTIGEQCDKCAPNHWGYSIITGCKACNCSNPGSLSMQCNSDTGCCFCRPNFSGDKCSSCRLGY--------RKYPTCVNCGCMLAGSQPQTCDQETEKCSCAEQTGQCNCKINVEGVLCDRCKPSTFGLHVGNPLGCSSCYCF 1144          

HSP 2 Score: 338.191 bits (866), Expect = 4.573e-92
Identity = 297/1003 (29.61%), Postives = 440/1003 (43.87%), Query Frame = 2
Query: 2573 KCLHNTSGVHCDRCIEG-------YYGNPKKKISCKRCKCNNNQESCDPVTGEC-RCSYNTMGTECQLCKHGFYG---DALTKSCKKCDCDSLGSTSEN------CDKLTG-KCD-CRTNFVNRQCDSCTSGLYLKDKK----CIPCNCEIQGRISSEKFCNTTSGQCF-CLENVNGDRCEKCVEGYF-NYPNCKKCLCSPH-ALSADCDLNNGKCKCGSNVINRICDKCENLHY-WNNRTDCVPCNCGR-GSLNPKCDMETGNCKCAQNVARRDCSKCDVGYFGLDVTGCKKCPPCYNGQVCNNE-GICVCPPNTIGNLCNKCSEDSWDFNETIGCKKCNCYINGSYSNICNKISGICACKTAFFGSKCDRCNEGYYGFPNCQPCSCAENGT------KSNELTKCDKITGQCQCKQNVIGTKCKVCRKGTFPSDGTYEGGCFSCFCFGVSEKCHAI--LNHRIVENSIYEYHIFDEKNSLESGKDYSTIHLNANYPRRFGWPLTMFRPIYVNVMKLFNSHDLSLFYRSIFMNVSVDCLDNKCGREIPEQTEVFMESY-NGLFGMRYXXXXXXXXXXXXXXDFNEHSKNGKWVISQYQNDILDKFIILEDSNVINSNLTRDIFMMALLNVTSLKVKLYTDKVNPPLIKIKIITYKVME--TTQAIGKRVTAVEKCICNALTFGNHCQNPISGYYKEYFNLPNSTKSGSMRTGNRILINLKKCNCNGYSKVCDSVTGDCQNCMGNREGNKCQLCREGFYKNDKNY-DQCEPCQCPSAHYNFAQNCTRIESSLELKC-QCRIGYSGKSCENCQQGFYGNP-IKGIPCKSCDCNQQGSQSLNCNE-FGICQCSPGVLGIKCDQCAPNYVVEKKTCQSCYSGCTKDLLVRIDTLNETVINF--------KWKTLPS----TLDLRLNKINIS-IQMSSELLNSINKFYKLKNEIKNFSI-------QFQKMKDDAKEKYGEIEKLKTRYNKVLEDLRS--TFTDIN 5383
            +C    SG  C+ C+ G        +G      SC+ C+C  + + C  VTGEC  C +NT G  C  C  GFYG   +   + CK C C  L   S N       DK  G  CD CR  +  ++C+ C  G Y +  +    C PC C     +S+   C++ +G C  C   + G  C KC EGYF +    + C C  + ++S  C+   G+C+C +NVI R CD+C    +   +   CVPCNC   GS +  CD ++G C+C   V  + C  CD G++     GC  C   + G  C+ + G CVCPPNTIG  C+KC+ + W ++   GCK CNC   GS S  CN  +G C C+  F G KC  C  GY  +P C  C C   G+      +  E   C + TGQC CK NV G  C  C+  TF        GC SC+CFG++  C     L    V      + I   K     G  Y    + A   +          P Y  + + F    L+ +   +   +  +  D         Q  +    + N    +R +            ++  EH     W           K++     +V    ++R+ FM  L ++  + +K     V     +I  I+ +V E  T+  I  R   +EKC C     G  C+    G+Y+     P        RTG   L     C CNG+S +CD  +  CQ C  N  G+ C+ C  GFY   +   D C+PC CP     F+  CT ++ + + +C  C +GY G+ CE C  G+ GNP + G  C+ C+CN  GS S+ C+   G C C  G  G+KC  C   +  E   C  C   CT  LL  ++ LN+ V++          +KTL +    T +L++N   IS +   S    SIN   ++  E KN S         +  +KD   +     ++ K + N+ ++ +R+  +FT I+
Sbjct:  703 QCPSGFSGTSCESCLPGNRRVNGTLFGG-----SCEPCRCYGHTDRCHDVTGECLDCKHNTYGRYCDYCLPGFYGNPSEGTAEDCKPCSC-PLTIDSNNFSPTCHLDKTRGLVCDSCRPGYTGQRCERCAEGYYGQPSEPGGSCKPCKCNNNLDLSTPGCCDSQTGACLVCKPGITGQYCNKCAEGYFGDALEARACNCHVNGSVSTSCNTETGQCQCRNNVIGRQCDECLPQTFGLQSAQGCVPCNCNSFGSKSFDCD-DSGQCRCQPGVTGKKCDHCDHGFYDFQEGGCTPCECPHVGNNCDADTGHCVCPPNTIGEQCDKCAPNHWGYSIITGCKACNCSNPGSLSMQCNSDTGCCFCRPNFSGDKCSSCRLGYRKYPTCVNCGCMLAGSQPQTCDQETEKCSCAEQTGQCNCKINVEGVLCDRCKPSTFGLHVGNPLGCSSCYCFGLATHCTEADGLIRMWVSRKQLSHGIL--KGGTTKGVTYQHPEIVAMIDQV--KEDLHAEPFYWRLPQQFEGRKLTAYGGKLKYAIYFEARDETGPSTYEPQVIIRGGPHANHRIIVRNMAAPQNGQLTRHDIEMTEHD----W-----------KYL----GSVDGRPVSREDFMDVLYDIQYILIKAAYGSVLRQ-TRISEISLEVAEEGTSFTISPRAYLIEKCECPHGYSGLSCEACAPGFYRVAPATPGR------RTG-PTLGTCVPCQCNGHSDICDPQSSVCQACKHNTAGDHCERCAPGFYGIVRGSPDDCKPCACPF----FSPTCT-LQGTNDYRCTACPLGYEGQYCERCASGYTGNPGVPGGSCQECECNPYGSLSMICHPTTGQCTCKTGSTGLKCAGCTDRHAREGPVCVFCDDECTGLLLDDLEQLNQMVMSVNLSGPLPPPYKTLFTFGNQTQELKVNYCFISEVTFRSNCYTSIN-LCRILAEAKNLSFNATVAFNAYSNIKDLIDDAEDTAKEAKAKANEAIDLVRTKKSFTKIH 1661          

HSP 3 Score: 230.335 bits (586), Expect = 2.318e-59
Identity = 198/694 (28.53%), Postives = 284/694 (40.92%), Query Frame = 2
Query: 1007 VAKCNCKHNTCGSNCETCCPLFNQRPWKPVAVCEECNCNR---KSNECSYNQTVATLQLSVNKMGRMEGGGVCINCQENTEGINCEKCIKGFYRPWNVLATELYPCTPCQCHGLGT-----IGSCVSNGEDIGDQ-----------------------KPGD-----------CICKKGYEGVNCDLCSIGYERYPNGECLPCPCSIDGSV---------RTSFYRCKPPCNCKVHVNSDDLCKTCKNGYFNLDSANPEGCEPCYCFGITNQCSS--------LSAKNLKISDLKGWKLTTFTGEKIALPKFTSFQYLTSENSYIDERFNNPTVYYWTAPPPYLGNWITSYGTIFRYVVKIELQSTLKGSLIDSPDVIIKCG---DFRLF--HSVSIEDRRLQRQVFIYIKPTEWKIGKLTPDKAATKEEFISCLVKVDKLLIKAKYYSNQKSIELLNITLSRGEVHLALDEMPH---IEKCNCPPGFNGLSCESCESGYRRVNNVL-------YQGQCEACACYNHSNTCDSLNGECQNCTHNTAGAHCEDCASGYYGDAKSKNLNSCKKCPCPRLDYQMTELCSSYSSENYVCHKCLHNTSGVHCDRCIEGYYGNPK-KKISCKRCKCN---NNQESCDPVTGECRCSYNTMGTECQLC--KHGFYGDALTKSCKKCDCDSLGSTSENCDKL 2848
              +C C++N  G  C+ C P       +    C  CNCN    KS +C                   +  G C  CQ    G  C+ C  GFY        +   CTPC+C  +G       G CV     IG+Q                        PG            C C+  + G  C  C +GY +YP   C+ C C + GS          + S       CNCK++V    LC  CK   F L   NP GC  CYCFG+   C+         +S K L    LKG    T  G     P+  +      E+ + +        +YW  P  + G  +T+YG   +Y +  E +     S  + P VII+ G   + R+   +  + ++ +L R   I +   +WK       +  ++E+F+  L  +  +LIKA Y S  +   +  I+L   E   +    P    IEKC CP G++GLSCE+C  G+ RV             G C  C C  HS+ CD  +  CQ C HNTAG HCE CA G+YG  +  + + CK C CP      +  C+   + +Y C  C     G +C+RC  GY GNP     SC+ C+CN   +    C P TG+C C   + G +C  C  +H   G      C  CD +  G   ++ ++L
Sbjct:  909 TGQCQCRNNVIGRQCDECLP--QTFGLQSAQGCVPCNCNSFGSKSFDC-------------------DDSGQC-RCQPGVTGKKCDHCDHGFYD------FQEGGCTPCECPHVGNNCDADTGHCVCPPNTIGEQCDKCAPNHWGYSIITGCKACNCSNPGSLSMQCNSDTGCCFCRPNFSGDKCSSCRLGYRKYPT--CVNCGCMLAGSQPQTCDQETEKCSCAEQTGQCNCKINVEGV-LCDRCKPSTFGLHVGNPLGCSSCYCFGLATHCTEADGLIRMWVSRKQLSHGILKG---GTTKGVTYQHPEIVAMIDQVKEDLHAEP-------FYWRLPQQFEGRKLTAYGGKLKYAIYFEARDETGPSTYE-PQVIIRGGPHANHRIIVRNMAAPQNGQLTRHD-IEMTEHDWKYLGSVDGRPVSREDFMDVLYDIQYILIKAAYGSVLRQTRISEISLEVAEEGTSFTISPRAYLIEKCECPHGYSGLSCEACAPGFYRVAPATPGRRTGPTLGTCVPCQCNGHSDICDPQSSVCQACKHNTAGDHCERCAPGFYGIVRG-SPDDCKPCACPFF----SPTCTLQGTNDYRCTACPLGYEGQYCERCASGYTGNPGVPGGSCQECECNPYGSLSMICHPTTGQCTCKTGSTGLKCAGCTDRHAREGPV----CVFCDDECTGLLLDDLEQL 1550          

HSP 4 Score: 167.162 bits (422), Expect = 4.093e-40
Identity = 189/722 (26.18%), Postives = 280/722 (38.78%), Query Frame = 2
Query: 3086 CLCSPHALSADCDLNNGK--CKCGSNVINRICDKC---ENLHYWNNRT-----DCVPCNCGRGSLNPKCDMETGNCKCAQNVARRDCSKCDVGYFGLDVTGCKKCPPCYNGQVCNNEGICV-CPPNTIGNLCNKCSEDSW-----DFNETIGCKKCNCYINGSYSNICNK-----------ISGICACKTAFFGSKCDRCNEGYYGFPNCQPCSCAENGTKSNELTKCDKITGQCQCKQNVIGTKCKVCRKGTFPSDGTYEGGCFSCFCFGVSEKCHAI---------LNHRIVENSIYEYHIFDEKNSLESGKDYSTIHLNA---NYPRRFGW--PLTMFRPIYVNV---MKLFNSHDLSLFYRSIFMNVSVDCLDNKCGREIPEQTEVFMESYNGLFGMRYXXXXXXXXXXXXXXDFNEHSKNGKWVISQYQNDILDKFIILEDSNVINSN---LTRDIFMMALLNVTSLKVKLYTDKVNPPLIKIKIITYKVMETTQAIGKRVTAVEKCICNALTFGNHCQNPISGYYKEYFNLPNSTKSGSMRTGNRILINLKKCNCNGYSKVCDSVTGDCQNCMGNREGNKCQLCREGFYKN--DKNYDQCEPCQCPSA--HYNFAQNCTRIESSLELKC-QCRIGYSGKSCENCQQGFYGNPIK-GIPCKSCDCNQQGSQSLNCNEFGICQ--------CSPGVLGIKCDQCAPNYVVEKKTCQSC 5068
            C+C  HA S   +L   K  C+C  N     CD+C    N   W   T     +C PCNC           ++  C   Q VA +  S        LD+ G       Y+G      G+C+ C  NT G  C  C +  +        +   C+ C+C   GS  +IC K           + G C CK+ F G +CD+C  GY G+P C  C+C+  G+     T  D     C CK NV G  C  C+ G F        GC  CFC GVS  C            +N   V +      +   K+  +     S  + +A     P  + W  P T  R     V   +    S+D S+   S+      + +    G +I  Q E       G F                                    +I +  ++  DS  I      ++R  FMM L NV  L ++         + ++  +T +V     + GK   +VE C C +   G  C++ + G         N   +G++  G+      + C C G++  C  VTG+C +C  N  G  C  C  GFY N  +   + C+PC CP      NF+  C  ++ +  L C  CR GY+G+ CE C +G+YG P + G  CK C CN     +L+ +  G C         C PG+ G  C++CA  Y  +    ++C
Sbjct:  262 CICYGHARSCPFNLATKKSSCECEHNTCGDSCDRCCPGFNQKPWKAGTFLLKHECEPCNC---------HWKSEECYYDQQVADKRLS--------LDILGN------YSGG-----GVCINCTSNTAGINCETCVDRFYRPKGVSPTQPYPCQPCSCDPIGSLHDICVKDEKQAPRGKGMLPGSCHCKSGFAGERCDKCAVGYIGYPECVRCNCSLIGS-----TNKDPCVDPCICKDNVEGQNCDQCKLGYFNLQKDNPQGCDQCFCSGVSSICTGSRLAYTKITDMNGWYVTDLSGYTRVAPAKDGFDGPHQLSITNRDARAQGLPEVYYWSAPPTYLRSKVTAVGGHLSYTISYDASMKTDSVDSTNYPNIIIEGNGIKISSQQETIQL---GPF-----------------------------------EEITETIVLHPDSFRIYGTEFQVSRREFMMVLANVNKLLIRATYSNGQEAIYRLSSVTLEVAGDPSSSGKTAFSVELCQCPSGFSGTSCESCLPG---------NRRVNGTLFGGS-----CEPCRCYGHTDRCHDVTGECLDCKHNTYGRYCDYCLPGFYGNPSEGTAEDCKPCSCPLTIDSNNFSPTC-HLDKTRGLVCDSCRPGYTGQRCERCAEGYYGQPSEPGGSCKPCKCN----NNLDLSTPGCCDSQTGACLVCKPGITGQYCNKCAEGYFGDALEARAC 893          

HSP 5 Score: 116.701 bits (291), Expect = 6.109e-25
Identity = 104/336 (30.95%), Postives = 137/336 (40.77%), Query Frame = 2
Query: 2951 EIQGRISSEKFCNTTSGQCFCLENVNGDRCEKC------VEGYFNYPNCKKCLCSPHALSADCDLNNGKC-KCGSNVINRICDKCENLHYWN----NRTDCVPCNC----GRGSLNPKCDMETGNC----KCAQNVARRDCSKCDVGYFGLDVTGCKKCPPCYNGQVCNN-------------EGIC-VCPPNTIGNLCNKCSEDSWDFNETIGCKKCNCYINGSYSNICNKISGICACKTAFFGSKCDRCNEGYYGFPN---CQPCSCAENGTKSNELTKCDKITGQCQCKQNVIGTKCKVCRKGTFPSDGTYEGGCFSCFCFGVSEKCHAILNH 3850
            E+ G  SS      +   C C    +G  CE C      V G     +C+ C C  H  +  C    G+C  C  N   R CD C    Y N       DC PC+C       + +P C ++         C      + C +C  GY+G        C PC     CNN              G C VC P   G  CNKC+E    F + +  + CNC++NGS S  CN  +G C C+    G +CD C    +G  +   C PC+C   G+KS +   CD  +GQC+C+  V G KC  C  G +      EGGC  C C  V   C A   H
Sbjct:  684 EVAGDPSSSGKTAFSVELCQCPSGFSGTSCESCLPGNRRVNGTLFGGSCEPCRCYGH--TDRCHDVTGECLDCKHNTYGRYCDYCLPGFYGNPSEGTAEDCKPCSCPLTIDSNNFSPTCHLDKTRGLVCDSCRPGYTGQRCERCAEGYYGQPSEPGGSCKPCK----CNNNLDLSTPGCCDSQTGACLVCKPGITGQYCNKCAEGY--FGDALEARACNCHVNGSVSTSCNTETGQCQCRNNVIGRQCDECLPQTFGLQSAQGCVPCNCNSFGSKSFD---CDD-SGQCRCQPGVTGKKCDHCDHGFYDFQ---EGGCTPCECPHVGNNCDADTGH 1004          
BLAST of Laminin subunit alpha-2 vs. Ensembl Mouse
Match: Lama1 (laminin, alpha 1 [Source:MGI Symbol;Acc:MGI:99892])

HSP 1 Score: 747.273 bits (1928), Expect = 0.000e+0
Identity = 441/1186 (37.18%), Postives = 640/1186 (53.96%), Query Frame = 2
Query:  188 LMENAKITSSATCGTGGPEIFCRLVDEIAIQRLINPDSHVLCDVCD--NRNETKRHPIEFAKSDDDNLWWQSPSMAQGLKYQNVNVTIDLKQVYQIVYILLKMGDSPRPGNWILERSLDGEIYMPWIFFAETPYSC---YNLFQRQYPDLKLTTNAKPSSLADDEMFCTTYYSQPKSLNSGEIIISLINGRKSIMNEEYLSIKSVPQTLINFLSARYIRFRFLKHLTLAADLMT--HKGY--LEQSIYNRYYYSLRNIEIGGKCICNNHADKCDKVIENGISVAKCNCKHNTCGSNCETCCPLFNQRPWKPVAV-----CEECNCNRKSNECSYNQTVATLQLSVNKMGRMEGGGVCINCQENTEGINCEKCIKGFYRPWNVLATELYPCTPCQCHGLGTIGS-CVSNGE--DIGDQK-PGDCICKKGYEGVNCDLCSIGYERYPNGECLPCPCSIDGSVRTSFYRCKPPCNCKVHVNSDDLCKTCKNGYFNLDSANPEGCEPCYCFGITNQCSSLSAKNLKISDLKGWKLTTF-TGEKIALPK--FTSFQYLTSENSYIDERFNNPTVYYWTAPPPYLGNWITSYGTIFRYVVKIELQ-STLKGSLIDSPDVIIKCGDFRLFHSVSIEDRRLQ--RQVFIYIKPTEWKIGKLTPDKAATKEEFISCLVKVDKLLIKAKYYSNQKSI-ELLNITL---SRGEVHLALDEMPHIEKCNCPPGFNGLSCESCESGYRRVNNVLYQGQCEACACYNHSNTCDSLNGECQNCTHNTAGAHCEDCASGYYGDAKSKNLNSCKKCPCP-RLDY-QMTELCSSYSSENYVCHKCLHNTSGVHCDRCIEGYYGNPK-KKISCKRCKCNNNQES-----CDPVTGEC-RCSYNTMGTECQLCKHGFYGDALT-KSCKKCDCDSLGSTSENCDKLTGKCDCRTNFVNRQCDSCTSGLYLKDK--KCIPCNCEIQGRISSEKFCNTTSGQCFCLENVNGDRCEKCVEGYFNYPN--CKKCLCSPHALSADCDLNNGKCKCGSNVINRICDKCENLHYW--NNRTDCVPCNCGR-GSLNPKCDMETGNCKCAQNVARRDCSKCDVGYFGLDVTGCKKCPPC---YNGQV---CNNE----------GICVCPPNTIGNLCNKCSEDSWDF--NETIGCKKCNCYINGSYSNICNKISG 3556
            L  NA I+++ATCG  GPE+FC+LV+ +  +    P  H  C VCD  + N  +RHPI  A  D  N WWQSPS+  G +Y  V VT+DL+QV+Q+ YI++K  ++PRPGNWILERS+DG  + PW ++A +   C   Y +  R+ P         P+  AD+E+ CT+YYS+   L  GEI  SLINGR S  +         PQ L+ F SARYIR R  +  TL ADLMT  H+    L+  +  RYYYS+++I +GG CIC  HA  C    +      +C C+HNTCG +C+ CCP ++Q+PW+P  +     CEECNC+ K+ +C Y+ +VA  + S+N  G+  GGGVC+NC +NT GINCE CI  +YRP  V   + +PC PC C  +G++ S C+ +    D+ + K PG C C+KGY G  CD C  GY  +PN  C+PC C   GS+      C  PC CK +V   + C  CK G++NL   NPEGC  C+CFG++  C SL+    +++++ GW +T   +  KI   +      + ++  N+ + +R    + YYW AP  YLGN +T++G   +Y V  ++   T+   L+   D+IIK     +  S   E   LQ   + F  ++            +   +++ ++ L  V  LLI+A Y S + ++  L +++L   S   + LA+     +E C CP G+ G SCE+C  GY RV+ +L+ G C+ C C+ H++ CD ++G C  CTHNT G HCE C  G+YG         C+ C CP  +D    +  C     E  VC +C    SG  C+RC +GYYGNP     +C  C C+ N +      CD VTGEC +C +NT G  C+ C  GFYGDA+T K+C+ CDC   GS S  C   TG CDC+ +   +QCD C SG Y  D    C+PCNC ++G +S    C T  GQC C   V+G +C++C  G++ + +  C  C C+      +CD  +G+C C  +     C++CE   YW  +    C  CNC   GS + +CD+ +G+C C +    + C +C +GY          C PC     G +   C+ E          G C C  N +G  C+KC   ++    +   GC  C C+     S +C+++ G
Sbjct:   36 LATNAHISANATCGEKGPEMFCKLVEHVPGR----PVRHAQCRVCDGNSTNPRERHPISHAI-DGTNNWWQSPSIQNGREYHWVTVTLDLRQVFQVAYIIIKAANAPRPGNWILERSVDGVKFKPWQYYAVSDTECLTRYKITPRRGP---------PTYRADNEVICTSYYSKLVPLEHGEIHTSLINGRPSADDPS-------PQ-LLEFTSARYIRLRLQRIRTLNADLMTLSHRDLRDLDPIVTRRYYYSIKDISVGGMCICYGHASSCP--WDEEAKQLQCQCEHNTCGESCDRCCPGYHQQPWRPGTISSGNECEECNCHNKAKDCYYDSSVAKERRSLNTAGQYSGGGVCVNCSQNTTGINCETCIDQYYRPHKVSPYDDHPCRPCNCDPVGSLSSVCIKDDRHADLANGKWPGQCPCRKGYAGDKCDRCQFGYRGFPN--CIPCDCRTVGSLNED--PCIEPCLCKKNVEGKN-CDRCKPGFYNLKERNPEGCSECFCFGVSGVCDSLTWSISQVTNMSGWLVTDLMSTNKIRSQQDVLGGHRQISINNTAVMQRLT--STYYWAAPEAYLGNKLTAFGGFLKYTVSYDIPVETVDSDLMSHADIIIKGNGLTI--STRAEGLSLQPYEEYFNVVRLVPENFRDFDTRREIDRDQLMTVLANVTHLLIRANYNSAKMALYRLDSVSLDIASPNAIDLAV--AADVEHCECPQGYTGTSCEACLPGYYRVDGILFGGICQPCECHGHASECD-IHGICSVCTHNTTGDHCEQCLPGFYGTPSRGTPGDCQPCACPLSIDSNNFSPTCHLTDGEEVVCDQCAPGYSGSWCERCADGYYGNPTVPGGTCVPCNCSGNVDPLEAGHCDSVTGECLKCLWNTDGAHCERCADGFYGDAVTAKNCRACDCHENGSLSGICHLETGLCDCKPHVTGQQCDQCLSGYYGLDTGLGCVPCNCSVEGSVSDN--C-TEEGQCHCGPGVSGKQCDRCSHGFYAFQDGGCTPCDCA--HTQNNCDPASGECLCPPHTQGLKCEECEEA-YWGLDPEQGCQACNCSAVGSTSAQCDVLSGHCPCKKGFGGQSCHQCSLGYRSF-----PDCVPCGCDLRGTLPDTCDLEQGLCSCSEDGGTCSCKENAVGPQCSKCQAGTFALRGDNPQGCSPCFCF---GLSQLCSELEG 1171          

HSP 2 Score: 406.757 bits (1044), Expect = 5.891e-113
Identity = 416/1709 (24.34%), Postives = 689/1709 (40.32%), Query Frame = 2
Query: 2573 KCLHNTSGVHCDRCIEGYYGNPKKKIS--CKRCKCNNNQESCDPVTGECR-CSYNTMGTECQLCKHGFYGD---ALTKSCKKCDCD-SLGST--SENCDKLTGK---CD-CRTNFVNRQCDSCTSGLY----LKDKKCIPCNCEIQGRISSEKFCNTTSGQCF-CLENVNGDRCEKCVEGYFN----YPNCKKCLCSPH-ALSADCDLNNGKCKCGSNVINRICDKCENLHY-WNNRTDCVPCNCG-RGSLNPKCDMETGNCKCAQNVARRDCSKCDVGYFGLDVTGCKKCPPCYNGQVCN-NEGICVCPPNTIGNLCNKCSEDSWDFNETIGCKKCNCYINGSYSNICNKISGICACKTAFFGSKCDRCNEGYYGFPNCQPCSCAENGTKSNE------LTKCDKITGQCQCKQNVIGTKCKVCRKGTFPSDGTYEGGCFSCFCFGVSEKCHAILNHRIVENSIYE----YHIFDEKN--SLESGKDYST--IHLNANYPRRFGWPLTMFRPIYVNVMKLFNSHDL-----SLFYRSIFMNVSVDCLDN-------KCGREIPEQTEVFMESYNGLFGMRYXXXXXXXXXXXXXXDFNEHSKNGKWVISQYQNDILDKFIILEDSNVINSNLTRDIFMMALLNVTSLKVKL-YTDKVNPPLIK-IKIITYKVMETTQAIGKRVTAVEKCICNALTFGNHCQNPISGYYKEYFNLPNSTKSGSMRTGNRILINLKKCNCNGYSKVCDSVTGDCQNCMGNREGNKCQLCREGFYKNDKNY-DQCEPCQCP-SAHYNFAQNCTRIESSLELKC-QCRIGYSGKSCENCQQGFYGNP-IKGIPCKSCDCNQQGSQSLNCNEF-GICQCSPGVLGIKCDQCAPNYVVEKKTCQSCYSGCTKDLLVRIDTLNETVINFKWKTL-PSTLDLRLNKINISIQMSSELLNSINKFYKLKNEIKNFSIQFQKMKDDAKEKYGEIEKLKTRYNKV----------LEDLRSTFTDINETISGHEQ---------LGISNELIKNATAYLETIK--NIYKEMPNITLAASVLKDVLKYVDELNQIIKYTQSHIQSDQINNLKILKNKTIMA---DEINTNNKEYLNTMSTKKKEHELYIILINERMKDLQKIFRKMTKQRDNLRKKIQK----LDAI---SKSFQD-------EKDLISINVREIEDLMKNLSSNHLVSKSLIIPDTLKKHVEQQLNKSSNLIKKLTKDFNFLHNAEQAKEAYSNIT-----RDILAVDYAINQTKKELD----FNRSNMNIDSLKKLLAEFNSNKSEIVENIKNIDKEHEKLLKQYKNCSYXXXXXXXXXXXXSSEIPTGFYDVEILKRNLSXXXXXXXXXXXXFILPINQTILNLGTPNVKSGLDTRNLEKLIKVVDNQYRDLVNESSFVENKIKDLRKSIKSLRERLQKARVMSE----------LIHGAAARSVEPIRHVVRCVRHYVTYYLPTSNAFSLEFYMKPQILNDQSLVLFGYDDSGSIPHAFAFTLERNNQYKFWYDSGNSVESIELTG-KFSNENYVGIMITWKLGKWHMVIRSISDGRTEQVETSSITNNILSNVRIGPQTNIFVGGF-------PSSKLLRSLKLEGRLISDLKE-NYDNYFYK-----GCLFGVKLMNTEFGL--QDIEAIEEECRNTISIDNLLLGKFNCKFNPNSSIIFLDSN 7300
            +C    +G  C+ C+ GYY          C+ C+C+ +   CD + G C  C++NT G  C+ C  GFYG         C+ C C  S+ S   S  C    G+   CD C   +    C+ C  G Y    +    C+PCNC           C++ +G+C  CL N +G  CE+C +G++       NC+ C C  + +LS  C L  G C C  +V  + CD+C + +Y  +    CVPCNC   GS++  C  E G C C   V+ + C +C  G++     GC  C   +    C+   G C+CPP+T G  C +C E  W  +   GC+ CNC   GS S  C+ +SG C CK  F G  C +C+ GY  FP+C PC C   GT  +       L  C +  G C CK+N +G +C  C+ GTF   G    GC  CFCFG+S+ C  +  +     ++       H+  + N      G  +      L+A   R+  +      P Y  + K F    L      L Y   F +       N       K GR    +  ++M++     G+R               D+    K   W   +Y N + +K +   D            FM  L N+  + +K  Y   +    I  I +   +      A G+    +E C+C   T G+ CQ+   GYY+E   LP S   G       +L     CNCN +S VCD  TG C +C  +  G+ C+LC  G+Y         C PC CP    ++F+  C  +E   + +C  C  GY G+ CE C  G++GNP   G  C++CDCN QGS   +C+   G C C PG  G+ C++C P +++ +  C SC   C   LL  +D++ + V++     + P+   +  N  N +      L+    K  + + +++  + Q + ++ +        +K+     +           +E L +   +I E ++   Q         +     + +N ++ L  IK  N  +   N TL     KD+L  +          Q   Q  Q   LK LK    +     E     +E L    +K +E  L ++L+   +K+ Q+   ++ ++++   + I K    +DA    + + QD        +D + +  R+I   + +L       ++  +    ++H  +  +++  L + L    N   NA  A   +SNI       ++LA D      K +L      +R    +    + L E  S + +       +D E + L  Q++    N  K  N +  +  E P G  +     R L+    E        +L ++  + N       +  D   +   ++  ++   +    +     K+KD+      L +RL+  + + E          L+   A + V  I+  V   R  +  Y P +++ +    +      +   +LF Y  S S     A  + R  +  F +D G+    +E      +N  +  I IT       + ++  S      V TS  +      + I   T +FVGG        P+ K+       G    + K     NY  +     GC    +  ++ F         +E+  R T++   +L       F+PN  + +L SN
Sbjct:  717 ECPQGYTGTSCEACLPGYYRVDGILFGGICQPCECHGHASECD-IHGICSVCTHNTTGDHCEQCLPGFYGTPSRGTPGDCQPCACPLSIDSNNFSPTCHLTDGEEVVCDQCAPGYSGSWCERCADGYYGNPTVPGGTCVPCNCSGNVDPLEAGHCDSVTGECLKCLWNTDGAHCERCADGFYGDAVTAKNCRACDCHENGSLSGICHLETGLCDCKPHVTGQQCDQCLSGYYGLDTGLGCVPCNCSVEGSVSDNC-TEEGQCHCGPGVSGKQCDRCSHGFYAFQDGGCTPCDCAHTQNNCDPASGECLCPPHTQGLKCEECEEAYWGLDPEQGCQACNCSAVGSTSAQCDVLSGHCPCKKGFGGQSCHQCSLGYRSFPDCVPCGCDLRGTLPDTCDLEQGLCSCSEDGGTCSCKENAVGPQCSKCQAGTFALRGDNPQGCSPCFCFGLSQLCSELEGYVRTLITLASDQPLLHVVSQSNLKGTIEGVHFQPPDTLLDAEAVRQHIYA----EPFYWRLPKQFQGDQLLAYGGKLQYSVAFYSTLGTGTSNYEPQVLIKGGRA--RKHVIYMDAPAPENGVR--------------QDYEVRMKEEFW---KYFNSVSEKHVTHSD------------FMSVLSNIDYILIKASYGQGLQQSRIANISMEVGRKAVELPAEGEAALLLELCVCPPGTAGHSCQDCAPGYYRE--KLPESGGRGP----RPLLAPCVPCNCNNHSDVCDPETGKCLSCRDHTSGDHCELCASGYYGKVTGLPGDCTPCTCPHHPPFSFSPTCV-VEGDSDFRCNACLPGYEGQYCERCSAGYHGNPRAAGGSCQTCDCNPQGSVHSDCDRASGQCVCKPGATGLHCEKCLPRHILMESDCVSCDDDCVGPLLNDLDSVGDAVLSLNLTGVSPAPYGILENLENTTKYFQRYLIKENAKKIRAEIQLEGIAEQTENLQKELTRVLARHQKVNAEMERTSNGTQALATFIEQLHANIKEITEKVATLNQTARKDFQPPVSALQSMHQNISSLLGLIKERNFTEMQQNATLELKAAKDLLSRI----------QKRFQKPQ-EKLKALKEANSLLSNHSEKLQAAEELLKEAGSKTQESNLLLLLVKANLKEFQEKKLRVQEEQNVTSELIAKGREWVDAAGTHTAAAQDTLTQLEHHRDELLLWARKIRSHVDDLVMQMSKRRARDLVHRAEQHASELQSRAGALDRDLENVRNVSLNATSAAHVHSNIQTLTEEAEMLAADAHKTANKTDLISESLASRGKAVLQRSSRFLKESVSTRRKQQGITMKLD-ELKNLTSQFQESMDNIMKQANDSLAMLRESPGGMREKGRKARELAAAANESAVKTLEDVLALSLRVFN-------TSEDLSRVNATVQETNDLLHNSTMTTLLAGRKMKDMEMQANLLLDRLKPLKTLEENLSRNLSEIKLLISRARKQVASIKVAVSADRDCIRAYQPQTSSTNYNTLILNVKTQEPDNLLF-YLGSSSSSDFLAVEMRR-GKVAFLWDLGSGSTRLEFPEVSINNNRWHSIYITRFGNMGSLSVKEASAAENPPVRTSK-SPGPSKVLDINNSTLMFVGGLGGQIKKSPAVKVTHFKGCMGEAFLNGKSIGLWNYIEREGKCNGCFGSSQNEDSSFHFDGSGYAMVEKTLRPTVTQIVILFS----TFSPNGLLFYLASN 2355          

HSP 3 Score: 235.728 bits (600), Expect = 4.381e-61
Identity = 185/670 (27.61%), Postives = 276/670 (41.19%), Query Frame = 2
Query:  950 CICNNHADKCDKVIENGISVAKCNCKHNTCGSNCETCCPLFNQRPWKPVAVCEECNCNRKSNECSYNQTVATLQLSVNKMGRMEGGGVCINCQENTEGINCEKCIKGFYRPWNVLATELYPCTPCQCHGLG-TIGSCVSNGEDIGDQKPGDCICKKGYEGVNCDLCSIGYERYPNGECLPCPCSIDGSV------RTSFYRCKP---PCNCKVHVNSDDLCKTCKNGYFNLDSANPEGCEPCYCFGITNQCSSLSAKNLKISDLKGWKLTTFTGEKIALPKFTSFQYLTSENSYIDERFNNPTVY----YWTAPPPYLGNWITSYGTIFRYVVKIELQSTL-KGSLIDSPDVIIKCGDFR---LFHSVSIEDRRLQRQVFIYIKPTEWKIGKLTPDKAATKEEFISCLVKVDKLLIKAKYYSNQKSIELLNITLSRGEVHLAL----DEMPHIEKCNCPPGFNGLSCESCESGYRRVNNVLYQGQ--------CEACACYNHSNTCDSLNGECQNCTHNTAGAHCEDCASGYYGDAKSKNLNSCKKCPCP-RLDYQMTELCSSYSSENYVCHKCLHNTSGVHCDRCIEGYYGNPKKK-ISCKRCKCNNN---QESCDPVTGECRCSYNTMGTECQLC--KHGFYGDALTKSCKKCDCDSLGSTSENCDKL 2848
            C C+      D   E G    +C+C     G  C+ C   F          C  C+C    N C                      G C+ C  +T+G+ CE+C + +   W +   +   C  C C  +G T   C        D   G C CKKG+ G +C  CS+GY  +P  +C+PC C + G++            C      C+CK +      C  C+ G F L   NP+GC PC+CFG++  CS L      +  L   +       +  L       +    ++ +D       +Y    YW  P  + G+ + +YG   +Y V     STL  G+    P V+IK G  R   ++      +  +++   + +K   WK      +K  T  +F+S L  +D +LIKA Y    +   + NI++  G   + L    +    +E C CPPG  G SC+ C  GY R       G+        C  C C NHS+ CD   G+C +C  +T+G HCE CASGYYG         C  C CP    +  +  C      ++ C+ CL    G +C+RC  GY+GNP+    SC+ C CN        CD  +G+C C     G  C+ C  +H      +   C  CD D +G    + D +
Sbjct:  958 CNCSVEGSVSDNCTEEG----QCHCGPGVSGKQCDRCSHGFYAFQ---DGGCTPCDCAHTQNNCD------------------PASGECL-CPPHTQGLKCEECEEAY---WGLDPEQ--GCQACNCSAVGSTSAQC--------DVLSGHCPCKKGFGGQSCHQCSLGYRSFP--DCVPCGCDLRGTLPDTCDLEQGLCSCSEDGGTCSCKENAVGPQ-CSKCQAGTFALRGDNPQGCSPCFCFGLSQLCSELEGYVRTLITLASDQPLLHVVSQSNLKGTIEGVHFQPPDTLLDAEAVRQHIYAEPFYWRLPKQFQGDQLLAYGGKLQYSVA--FYSTLGTGTSNYEPQVLIKGGRARKHVIYMDAPAPENGVRQDYEVRMKEEFWKYFNSVSEKHVTHSDFMSVLSNIDYILIKASYGQGLQQSRIANISMEVGRKAVELPAEGEAALLLELCVCPPGTAGHSCQDCAPGYYREKLPESGGRGPRPLLAPCVPCNCNNHSDVCDPETGKCLSCRDHTSGDHCELCASGYYGKVTGLP-GDCTPCTCPHHPPFSFSPTCVVEGDSDFRCNACLPGYEGQYCERCSAGYHGNPRAAGGSCQTCDCNPQGSVHSDCDRASGQCVCKPGATGLHCEKCLPRHIL----MESDCVSCDDDCVGPLLNDLDSV 1578          

HSP 4 Score: 152.91 bits (385), Expect = 6.806e-36
Identity = 185/749 (24.70%), Postives = 282/749 (37.65%), Query Frame = 2
Query: 3086 CLCSPHALSA--DCDLNNGKCKCGSNVINRICDKC---ENLHYWNNRT-----DCVPCNCGRGSLNPKCDMETGNCKCAQNVARRDCSKCDVGYFGLDVTGCKKCPPCYNGQVCNNEGICVCPPNTIGNLCNKCSEDSWDFNETIG-----CKKCNCYINGSYSNIC-----------NKISGICACKTAFFGSKCDRCNEGYYGFPNCQPCSCAENGTKSNELTKCDKITGQCQCKQNVIGTKCKVCRKGTFPSDGTYEGGCFSCFCFGVSEKCHAI---------LNHRIVENSIYEYHIFDEKNSLESGKDYSTIHLNANYPRRFGWPLTMFRPIYVNVMKLFNSHDLSLFYRSIFMNVSVDCLDNKCGREIPEQTEVFMESYNGLFGMRYXXXXXXXXXXXXXXDFNEHSKNGKWVISQYQNDILDKFIILEDSNVINSNLTRDIFMMALLNVTSLKVKLYTDKVNPPLIKIKIITYKVMETTQAIGKRVTA-VEKCICNALTFGNHCQNPISGYYKEYFNLPNSTKSGSMRTGNRILIN--LKKCNCNGYSKVCDSVTGDCQNCMGNREGNKCQLCREGFYKNDK--NYDQCEPCQCPSA--HYNFAQNCTRIESSLELKC-QCRIGYSGKSCENCQQGFYGNP-IKG---IPC--------------------------------------------------KSCDCNQQGSQSLNCN-EFGICQCSPGVLGIKCDQCAPNY 5038
            C+C  HA S   D +    +C+C  N     CD+C    +   W   T     +C  CNC           +  +C    +VA+   S    G +               G VC N     C  NT G  C  C +  +  ++        C+ CNC   GS S++C            K  G C C+  + G KCDRC  GY GFPNC PC C   G+ +      D     C CK+NV G  C  C+ G +        GC  CFCFGVS  C ++         ++  +V + +    I  +++ L  G    +I+  A   R       +    Y    + +  + L+ F   +   VS D        ++    ++ ++  NGL         S       +  + E+    + V   +++    + I  +    + +N+T    ++   N  S K+ LY         ++  ++  +  +  AI   V A VE C C     G  C+  + GYY+                 + IL     + C C+G++  CD + G C  C  N  G+ C+ C  GFY          C+PC CP +    NF+  C  +    E+ C QC  GYSG  CE C  G+YGNP + G   +PC                                                  ++CDC++ GS S  C+ E G+C C P V G +CDQC   Y
Sbjct:  277 CICYGHASSCPWDEEAKQLQCQCEHNTCGESCDRCCPGYHQQPWRPGTISSGNECEECNCHN---------KAKDCYYDSSVAKERRSLNTAGQYS-------------GGGVCVN-----CSQNTTGINCETCIDQYYRPHKVSPYDDHPCRPCNCDPVGSLSSVCIKDDRHADLANGKWPGQCPCRKGYAGDKCDRCQFGYRGFPNCIPCDCRTVGSLNE-----DPCIEPCLCKKNVEGKNCDRCKPGFYNLKERNPEGCSECFCFGVSGVCDSLTWSISQVTNMSGWLVTDLMSTNKIRSQQDVL-GGHRQISINNTAVMQR-------LTSTYYWAAPEAYLGNKLTAFGGFLKYTVSYDIPVETVDSDLMSHADIIIKG-NGL-------TISTRAEGLSLQPYEEYFNVVRLVPENFRDFDTRREIDRDQLMTVLANVTH---LLIRANYNSAKMALY---------RLDSVSLDIA-SPNAIDLAVAADVEHCECPQGYTGTSCEACLPGYYRV----------------DGILFGGICQPCECHGHASECD-IHGICSVCTHNTTGDHCEQCLPGFYGTPSRGTPGDCQPCACPLSIDSNNFSPTC-HLTDGEEVVCDQCAPGYSGSWCERCADGYYGNPTVPGGTCVPCNCSGNVDPLEAGHCDSVTGECLKCLWNTDGAHCERCADGFYGDAVTAKNCRACDCHENGSLSGICHLETGLCDCKPHVTGQQCDQCLSGY 946          
BLAST of Laminin subunit alpha-2 vs. Ensembl Mouse
Match: Lama2 (laminin, alpha 2 [Source:MGI Symbol;Acc:MGI:99912])

HSP 1 Score: 725.317 bits (1871), Expect = 0.000e+0
Identity = 443/1172 (37.80%), Postives = 628/1172 (53.58%), Query Frame = 2
Query:  188 LMENAKITSSATCGTGGPEIFCRLVDEIAIQRLINPDSHVLCDVCD--NRNETKRHPIEFAKSDDDNLWWQSPSMAQGLKYQNVNVTIDLKQVYQIVYILLKMGDSPRPGNWILERSLDGEIYMPWIFFAETPYSC---YNLFQRQYPDLKLTTNAKPSSLADDEMFCTTYYSQPKSLNSGEIIISLINGRKSIMNEEYLSIKSVPQTLINFLSARYIRFRFLKHLTLAADLM--THKG--YLEQSIYNRYYYSLRNIEIGGKCICNNHADKCDKVIENGISVAKCNCKHNTCGSNCETCCPLFNQRPWKPVAV-----CEECNCNRKSNECSYNQTVATLQLSVNKMGRMEGGGVCINCQENTEGINCEKCIKGFYRPWNVLATELYPCTPCQCHGLGTIGSCVSNGEDIGDQ--KPGDCICKKGYEGVNCDLCSIGYERYPNGECLPCPCSIDGSVRTSFYRCKPPCNCKVHVNSDDLCKTCKNGYFNLDSANPEGCEPCYCFGITNQCSSLSAKNLKISDLKGWKLTTFTGEKIALPKFT---SFQYLTSENSYIDERFNNPTVYYWTAPPPYLGNWITSYGTIFRYVVKIELQSTLKGSL-IDSPDVIIKCGDFRLFHSVSIEDRRLQRQVFIYIKPTEWKIGKLTPDKAA----------TKEEFISCLVKVDKLLIKAKYYSNQKSIELLNITLSRGEVHLALDE--MPHIEKCNCPPGFNGLSCESCESGYRRVNNVLYQGQCEACACYNHSNTCDSLNGECQNCTHNTAGAHCEDCASGYYGDAKSKNLNSCKKCPCPR--LDYQMTELCSSYSSENYVCHKCLHNTSGVHCDRCIEGYYGNPK-KKISCKRCKCNNNQE-----SCDPVTGECR-CSYNTMGTECQLCKHGFYGDAL-TKSCKKCDCDSLGSTSENCDKLTGKCDCRTNFVNRQCDSC---TSGLYLKDKKCIPCNCEIQGRISSEKFCNTTSGQCFCLENVNGDRCEKCVEGYFNYP--NCKKCLCSPHALSADCDLNNGKCKCGSNVINRICDKCENLHYWNNR--TDCVPCNCGR-GSLNPKCDMETGNCKCAQNVARRDCSKCDVGYFGLDV-TGCKKCPPCYNGQVCNNE----------GICVCPPNTIGNLCNKCSEDSW--DFNETIGCKKCNCY 3514
            L  NA IT++ATCG  GPE++C+LV+ +  Q + NP     C +C+  + N  +RHPI  A  D  N WWQSPS+  G++Y  V +T+DL+QV+QI Y+++K  +SPRPGNWILERSLD   Y PW + A T   C   YN++ R  P         PS   DDE+ CT++YS+   L +GEI ISLINGR S  +         P+ L+ F SARYIR RF +  TL ADLM   HK    ++  +  RYYYS+++I +GG CIC  HA  C   ++   + ++C C+HNTCG +C+ CCP F+Q+PW+         CE CNC+ K+ EC Y++TVA+  LS+N  G+  GGGVCINC  NT GINCE C+ GF+RP  V      PC PC C   G++       E    +  KPG C CK G+ GVNCD C  GY  YP  +C PC CS  GS  T+   C  PC+CK +V  +D C  CK+G+FNL   N +GCE C+C G++N+C S       I D++GW LT  +G     P+     S Q ++  NS  + R +    YYW+APPPYLGN + + G    + +  +L+     +  I    +I +  D R+  S + ++        +Y++P+E  I +++  + A          T+++F+  L  ++++L++  Y     +I  L+       V    D      +E C CPPG++G SCE+C   +RRVN  ++ G CE C C+ H+  CD + GEC NC  +T G +C +C  G+YGD    +   C+ C CP        +  C    S   +C +C    +G  C+RC EGY+G P     SC+ C+CN+N +     SCD ++G C  C   T G  C+LC  G++GDA+  K+C+ C C+  GS SE C   TG+C+CR N   R CD C   T GL L  + C+PCNC   G   S+ F    SGQC+C   V G +C++C  GYFN+    C  C CS   L  +CD   G+C C  N     C +C   + W +   T C  CNC   GSL  +C++ TG C C    +   CS+C  G++   + T C    P  +   C+ E          G C C  N  G  C++C    +  D    +GC  C C+
Sbjct:   42 LASNALITTNATCGEKGPEMYCKLVEHVPGQPVRNPQ----CRICNQNSSNPYQRHPITNA-IDGKNTWWQSPSIKNGVEYHYVTITLDLQQVFQIAYVIVKAANSPRPGNWILERSLDDVEYKPWQYHAVTDTECLTLYNIYPRTGP---------PSYAKDDEVICTSFYSKIHPLENGEIHISLINGRPSADDPS-------PE-LLEFTSARYIRLRFQRIRTLNADLMMFAHKDPREIDPIVTRRYYYSVKDISVGGMCICYGHARACP--LDPATNKSRCECEHNTCGESCDRCCPGFHQKPWRAGTFLTKSECEACNCHGKAEECYYDETVASRNLSLNIHGKYIGGGVCINCTHNTAGINCETCVDGFFRPKGVSPNYPRPCQPCHCDPTGSLSEVCVKDEKYAQRGLKPGSCHCKTGFGGVNCDRCVRGYHGYP--DCQPCNCSGLGS--TNEDPCVGPCSCKENVEGED-CSRCKSGFFNLQEDNQKGCEECFCSGVSNRCQSSYWTYGNIQDMRGWYLTDLSGRIRMAPQLDNPDSPQQISISNS--EARKSLLDGYYWSAPPPYLGNRLPAVGGQLSFTISYDLEEEEDDTEKILQLMIIFEGNDLRI--STAYKE--------VYLEPSEEHIEEVSLKEEAFTIHGTNLPVTRKDFMIVLTNLERVLMQITYNLGMDAIFRLSSVNLESAVPYPTDRRIATDVEVCQCPPGYSGSSCETCWPRHRRVNGTIFGGICEPCQCFAHAEACDDITGECLNCKDHTGGPYCNECLPGFYGDPTRGSPEDCQPCACPLNIPSNNFSPTCHLDRSLGLICDECPIGYTGPRCERCAEGYFGQPSIPGGSCQPCQCNDNLDYSIPGSCDSLSGSCLICKPGTTGRYCELCADGYFGDAVNAKNCQPCRCNINGSFSEICHTRTGQCECRPNVQGRHCDECKPETFGLQL-GRGCLPCNCNSFG---SKSFDCEASGQCWCQPGVAGKKCDRCAHGYFNFQEGGCIACDCS--HLGNNCDPKTGQCICPPNTTGEKCSECLP-NTWGHSIVTGCKVCNCSTVGSLASQCNVNTGQCSCHPKFSGMKCSECSRGHWNYPLCTLCDCFLPGTDATTCDLETRKCSCSDQTGQCSCKVNVEGVHCDRCRPGKFGLDAKNPLGCSSCYCF 1165          

HSP 2 Score: 226.098 bits (575), Expect = 4.430e-58
Identity = 156/425 (36.71%), Postives = 206/425 (48.47%), Query Frame = 2
Query: 2654 CKRCKCNNNQESCDPVTGEC-RCSYNTMGTECQLCKHGFYGDALTKS---CKKCDCDSLGSTSEN------CDKLTGK-CD-CRTNFVNRQCDSCTSGLY----LKDKKCIPCNCEIQGRISSEKFCNTTSGQCF-CLENVNGDRCEKCVEGYF----NYPNCKKCLCSPH-ALSADCDLNNGKCKCGSNVINRICDKC--ENLHYWNNRTDCVPCNCGR-GSLNPKCDMETGNCKCAQNVARRDCSKCDVGYFGLDVTGCKKCPPCYNGQVCNNE-GICVCPPNTIGNLCNKCSEDSWDFNETIGCKKCNCYINGSYSNICNKISGICACKTAFFGSKCDRCNEGYYGFPNCQPCSCAENGTKSN----ELTK--CDKITGQCQCKQNVIGTKCKVCRKGTFPSDGTYEGGCFSCFCFGVSEKC 3832
            C+ C+C  + E+CD +TGEC  C  +T G  C  C  GFYGD    S   C+ C C  L   S N       D+  G  CD C   +   +C+ C  G +    +    C PC C      S    C++ SG C  C     G  CE C +GYF    N  NC+ C C+ + + S  C    G+C+C  NV  R CD+C  E       R  C+PCNC   GS +  C+  +G C C   VA + C +C  GYF     GC  C   + G  C+ + G C+CPPNT G  C++C  ++W  +   GCK CNC   GS ++ CN  +G C+C   F G KC  C+ G++ +P C  C C   GT +     E  K  C   TGQC CK NV G  C  CR G F  D     GC SC+CFGV+ +C
Sbjct:  750 CEPCQCFAHAEACDDITGECLNCKDHTGGPYCNECLPGFYGDPTRGSPEDCQPCAC-PLNIPSNNFSPTCHLDRSLGLICDECPIGYTGPRCERCAEGYFGQPSIPGGSCQPCQCNDNLDYSIPGSCDSLSGSCLICKPGTTGRYCELCADGYFGDAVNAKNCQPCRCNINGSFSEICHTRTGQCECRPNVQGRHCDECKPETFGLQLGR-GCLPCNCNSFGSKSFDCEA-SGQCWCQPGVAGKKCDRCAHGYFNFQEGGCIACDCSHLGNNCDPKTGQCICPPNTTGEKCSECLPNTWGHSIVTGCKVCNCSTVGSLASQCNVNTGQCSCHPKFSGMKCSECSRGHWNYPLCTLCDCFLPGTDATTCDLETRKCSCSDQTGQCSCKVNVEGVHCDRCRPGKFGLDAKNPLGCSSCYCFGVTSQC 1171          

HSP 3 Score: 222.246 bits (565), Expect = 6.788e-57
Identity = 198/664 (29.82%), Postives = 280/664 (42.17%), Query Frame = 2
Query: 1007 VAKCNCKHNTCGSNCETCCP-LFNQRPWKPVAVCEECNCN---------RKSNECSYNQTVATLQLSVNKMGRM---EGG-----------------GVCINCQENTEGINCEKCIKGFYRPWNVLATELYPCTPCQCHGLGTIGS-CVSNGEDIGDQKPGDCICKKGYEGVNCDLCSIGYERYPNGECLPCPCSIDGSVRTS----FYRCK-----PPCNCKVHVNSDDLCKTCKNGYFNLDSANPEGCEPCYCFGITNQCSSLSAKNLKISDLKGWKLTTFTGEKIALPKF-TSFQYLTSENSYIDERFNNPTV---------------YYWTAPPPYLGNWITSYGTIFRYVVKIELQSTLKGSLIDSPDVIIKCG---DFRLF--HSVSIEDRRLQRQVFIYIKPTEWKIGKLTP--DKAATKEEFISCLVKVDKLLIKAKYYSNQKSIELLNITLSRGEVHLALDEMPH---IEKCNCPPGFNGLSCESCESGYRRVNNVL-------YQGQCEACACYNHSNTCDSLNGECQNCTHNTAGAHCEDCASGYYGDAKSKNLNSCKKCPCPRLDYQ--MTELCSSYSSENYVCHKCLHNTSGVHCDRCIEGYYGNPKKK-ISCKRCKCNNNQE---SCDPVTGECRCSYNTMGTECQLCKH 2761
              +C C+ N  G +C+ C P  F  +  +    C  CNCN           S +C     VA  +      G     EGG                 G CI C  NT G  C +C+   +    V       C  C C  +G++ S C  N         G C C   + G+ C  CS G+  YP   C  C C + G+  T+      +C        C+CKV+V     C  C+ G F LD+ NP GC  CYCFG+T+QCS   AK L    ++ W   T + E+  LP    + Q+ T++       F  P +               +YW  P  + G  + +YG   +Y +  E +    G     P VII+ G     R+   H  +    +L R   I +   EWK     P   +  T+E+F+  L  +  +LIKA Y +  +   +  I++   E    L   P    IE+C+CPPG++GLSCE+C  G+ R+ +           G C  C C  HS+ CD     CQNC H+TAG  CE CA GYYG  +    N C+ C CP +      +  C     E+Y C  C     G +C+RC  GY G+P     SC+ C+C+        CD VTG C C     G +C  C+H
Sbjct:  930 TGQCECRPNVQGRHCDECKPETFGLQLGR---GCLPCNCNSFGSKSFDCEASGQCWCQPGVAGKKCDRCAHGYFNFQEGGCIACDCSHLGNNCDPKTGQCI-CPPNTTGEKCSECLPNTWGHSIVTG-----CKVCNCSTVGSLASQCNVN--------TGQCSCHPKFSGMKCSECSRGHWNYP--LCTLCDCFLPGTDATTCDLETRKCSCSDQTGQCSCKVNVEGVH-CDRCRPGKFGLDAKNPLGCSSCYCFGVTSQCSE--AKGL----IRTW--VTLSDEQTILPLVDEALQHTTTKGI----AFQKPEIVAKMDEVRQELHLEPFYWKLPQQFEGKKLMAYGGKLKYAIYFEARDE-TGFATYKPQVIIRGGTPTHARIITRHMAAPLIGQLTRHE-IEMTEKEWKYYGDDPRISRTVTREDFLDILYDIHYILIKATYGNVVRQSRISEISMEVAEPGHVLAGSPPAHLIERCDCPPGYSGLSCETCAPGFYRLRSEPGGRTPGPTLGTCVPCQCNGHSSQCDPETSVCQNCQHHTAGDFCERCALGYYGIVRGLP-NDCQPCACPLISPSNNFSPSCVLEGLEDYRCTACPRGYEGQYCERCAPGYTGSPSSPGGSCQECECDPYGSLPVPCDRVTGLCTCRPGATGRKCDGCEH 1558          

HSP 4 Score: 146.362 bits (368), Expect = 5.097e-34
Identity = 163/651 (25.04%), Postives = 268/651 (41.17%), Query Frame = 2
Query: 4289 DSNVINSNLTRDIFMMALLNVTSLKVKL-YTDKVNPPLIKIKIITYKVMETTQAIGKRVTA--VEKCICNALTFGNHCQNPISGYYKEYFNLPNSTKSGSMRTGNRILINLKKCNCNGYSKVCDSVTGDCQNCMGNREGNKCQLCREGFYKNDKNY-DQCEPCQCP--SAHYNFAQNCTRIESSLELKC-QCRIGYSGKSCENCQQGFYGNPIK-GIPCKSCDCNQQGSQSLNCNEF-GICQCSPGVLGIKCDQCAPNYVVEKKTCQSCYSGCTKDLLVRIDTLNETVINFKWK-TLPSTLDLRLNKIN--------ISIQMSSELLNSINK--FYKLKNEIKNFSIQFQKMKDDAKEKYGEIEKLKTRYNKVLEDLRSTFTD----------INETISGHEQLGISN--ELIKNATAYLETIKN----IYKEMPNITLAAS--VLKDVLKYVDELNQIIKYTQSHIQS----------DQINNLKILKNKTIMADEINTNNKEYLNTMSTKKKEHELYIILINERMKDLQKIFRKMTKQRDNLRKKIQKLDAISKSFQDEKDLISINVREIEDLMKNLSSNHLVSKSLIIPDTLKKHVEQQLNKSSNLIKKLTKDFNFLHNAEQAKEAYSNITRDILAVDYAINQTKKEL 6097
            D   I+  +TR+ F+  L ++  + +K  Y + V     +I  I+ +V E    +     A  +E+C C     G  C+    G+Y+       S   G  RT    L     C CNG+S  CD  T  CQNC  +  G+ C+ C  G+Y   +   + C+PC CP  S   NF+ +C  +E   + +C  C  GY G+ CE C  G+ G+P   G  C+ C+C+  GS  + C+   G+C C PG  G KCD C   +  E   C  C   CT  LL  +  L +  +N      LP+   +     N        +S Q + E L  + +     L  E      +  K+  D ++   + E+  +R   + E ++    D          +NET+   ++    N  EL K     L+ +++      KE+    L A+  +LK V K   E     +  +  +Q           D  + L+   +KT  A+ ++  N++ +  + TKK+  E     I   +K+   I  +  +    +   I  +D I        + +S    +I+DL + +    L  K        + H  Q  + S+ L   L +  N   NA  A  AYSNI +D +     + +  KEL
Sbjct: 1312 DDPRISRTVTREDFLDILYDIHYILIKATYGNVVRQS--RISEISMEVAEPGHVLAGSPPAHLIERCDCPPGYSGLSCETCAPGFYRL-----RSEPGG--RTPGPTLGTCVPCQCNGHSSQCDPETSVCQNCQHHTAGDFCERCALGYYGIVRGLPNDCQPCACPLISPSNNFSPSCV-LEGLEDYRCTACPRGYEGQYCERCAPGYTGSPSSPGGSCQECECDPYGSLPVPCDRVTGLCTCRPGATGRKCDGCEHWHAREGAECVFCGDECTGLLLGDLARLEQMTMNINLTGPLPAPYKILYGLENTTQELKHLLSPQRAPERLIQLAEGNVNTLVMETNELLTRATKVTADGEQTGQDAERTNSRAESLEEFIKGLVQDAEAINEKAVQLNETLGNQDKTAERNLEELQKEIDRMLKELRSKDLQTQKEVAEDELVAAEGLLKRVNKLFGEPRAQNEDMEKDLQQKLAEYKNKLDDAWDLLREATDKTRDANRLSAANQKNMTILETKKEAIEGSKRQIENTLKEGNDILDEANRLLGEINSVIDYVDDIKTKLPPMSEELS---DKIDDLAQEIKDRRLAEKVF----QAESHAAQLNDSSAVLDGILDEAKNISFNATAAFRAYSNI-KDYIDEAEKVAREAKEL 1944          

HSP 5 Score: 103.605 bits (257), Expect = 4.672e-21
Identity = 88/275 (32.00%), Postives = 118/275 (42.91%), Query Frame = 2
Query: 3086 CLCSPHALSADCD--LNNGKCKCGSNVINRICDKC-ENLHY--WN-----NRTDCVPCNCGRGSLNPKCDMETGNCKCAQNVARRDCSKCDVGYFGLDVTGCKKCPPCYNGQVCNNEGICVCPPNTIGNLCNKCSEDSW-----DFNETIGCKKCNCYINGSYSNICNK---------ISGICACKTAFFGSKCDRCNEGYYGFPNCQPCSCAENGTKSNELTKCDKITGQCQCKQNVIGTKCKVCRKGTFPSDGTYEGGCFSCFCFGVSEKCHA 3838
            C+C  HA +   D   N  +C+C  N     CD+C    H   W       +++C  CNC           +   C   + VA R+ S        L++ G         G VC N     C  NT G  C  C +  +       N    C+ C+C   GS S +C K           G C CKT F G  CDRC  GY+G+P+CQPC+C+  G+ +NE    D   G C CK+NV G  C  C+ G F      + GC  CFC GVS +C +
Sbjct:  283 CICYGHARACPLDPATNKSRCECEHNTCGESCDRCCPGFHQKPWRAGTFLTKSECEACNC---------HGKAEECYYDETVASRNLS--------LNIHG-----KYIGGGVCIN-----CTHNTAGINCETCVDGFFRPKGVSPNYPRPCQPCHCDPTGSLSEVCVKDEKYAQRGLKPGSCHCKTGFGGVNCDRCVRGYHGYPDCQPCNCSGLGS-TNE----DPCVGPCSCKENVEGEDCSRCKSGFFNLQEDNQKGCEECFCSGVSNRCQS 525          

HSP 6 Score: 97.8265 bits (242), Expect = 2.706e-19
Identity = 78/268 (29.10%), Postives = 121/268 (45.15%), Query Frame = 2
Query: 4304 NSNLTRDIFMMALLNVTSLKVKLYTDKVNPPLIKIKIITYKVMETTQAIGKRVTAVEKCICNALTFGNHCQNPISGYYKEYFNLPNSTKSGSMRTGNRILINLKKCNCNGYSKVCDSVTGDCQNCMGNREGNKCQLCREGFYKNDK--NYDQCEPCQCP--SAHYNFAQNCTRIESSLELKC-QCRIGYSGKSCENCQQGFYGNP-IKGIPCKSCDCNQQGSQSL--NCNEF-GICQ-CSPGVLGIKCDQCAPNY---VVEKKTCQSC 5068
            N  +TR  FM+ L N+  + +++  +     + ++  +  +         +  T VE C C     G+ C+     + +      N T  G +          + C C  +++ CD +TG+C NC  +  G  C  C  GFY +    + + C+PC CP      NF+  C  ++ SL L C +C IGY+G  CE C +G++G P I G  C+ C CN     S+  +C+   G C  C PG  G  C+ CA  Y    V  K CQ C
Sbjct:  662 NLPVTRKDFMIVLTNLERVLMQITYNLGMDAIFRLSSVNLESAVPYPTDRRIATDVEVCQCPPGYSGSSCETCWPRHRRV-----NGTIFGGI---------CEPCQCFAHAEACDDITGECLNCKDHTGGPYCNECLPGFYGDPTRGSPEDCQPCACPLNIPSNNFSPTC-HLDRSLGLICDECPIGYTGPRCERCAEGYFGQPSIPGGSCQPCQCNDNLDYSIPGSCDSLSGSCLICKPGTTGRYCELCADGYFGDAVNAKNCQPC 914          

HSP 7 Score: 88.5817 bits (218), Expect = 1.989e-16
Identity = 49/142 (34.51%), Postives = 75/142 (52.82%), Query Frame = 2
Query: 4646 CDSVTGDCQNCMGNREGNKCQLCREGFYKNDKNYDQCEPCQCPSAHYNFAQNCTRIESSLELKCQCRIGYSGKSCENCQQGFYGNPIKGIPCKSCDCNQQGSQSLNCNEFGICQCSPGVLGIKCDQCAPNYV-VEKKTCQSC 5068
            CDS++G C  C     G  C+LC +G++ +  N   C+PC+C     N   + + I  +   +C+CR    G+ C+ C+   +G  + G  C  C+CN  GS+S +C   G C C PGV G KCD+CA  Y   ++  C +C
Sbjct:  875 CDSLSGSCLICKPGTTGRYCELCADGYFGDAVNAKNCQPCRC-----NINGSFSEICHTRTGQCECRPNVQGRHCDECKPETFGLQL-GRGCLPCNCNSFGSKSFDCEASGQCWCQPGVAGKKCDRCAHGYFNFQEGGCIAC 1010          

HSP 8 Score: 69.3218 bits (168), Expect = 1.345e-10
Identity = 64/237 (27.00%), Postives = 88/237 (37.13%), Query Frame = 2
Query: 2576 CLHNTSGVHCDRCIEGYY---GNPKKKI------SCKRCKCNNNQESCDPVTGECR-CSYNTMGTECQLCKHGFYG--DALTKSCKKCDCDSLGSTSENCDKLTGKCDCRTNFVNRQCDSCTSGLYLKDKKCIPCNCEIQGRISSEKFCNTTSGQCFCLENVNGDRCEKCVEGYFNYPN-----CKKCLCSPH-ALSADCDLNNGKCKCGSNVINRICDKCENLHYWNNRTDCVPCN 3232
            C    SG+ C+ C  G+Y     P  +       +C  C+CN +   CDP T  C+ C ++T G  C+ C  G+YG    L   C+ C C  L S S N    +  C                   L+D +C  C                            G  CE+C  GY   P+     C++C C P+ +L   CD   G C C      R CD CE+ H      +CV C 
Sbjct: 1378 CPPGYSGLSCETCAPGFYRLRSEPGGRTPGPTLGTCVPCQCNGHSSQCDPETSVCQNCQHHTAGDFCERCALGYYGIVRGLPNDCQPCAC-PLISPSNN---FSPSCVLEG---------------LEDYRCTACP-----------------------RGYEGQYCERCAPGYTGSPSSPGGSCQECECDPYGSLPVPCDRVTGLCTCRPGATGRKCDGCEHWHAREG-AECVFCG 1571          

HSP 9 Score: 61.2326 bits (147), Expect = 3.237e-8
Identity = 44/146 (30.14%), Postives = 64/146 (43.84%), Query Frame = 2
Query: 3218 CVPCNCGRGSLNPKCDMETGNCK-CAQNVARRDCSKCDVGYFGLDVTGCKKCPPCYNGQV---------CNNEGI-----CVCPPNTIGNLCNKCSEDSWDFNETIG--CKKCNCYINGSYSNICNKISGICACKTAFFGSKCDRC 3604
            CVPC C   S   +CD ET  C+ C  + A   C +C +GY+G+       C PC    +         C  EG+       CP    G  C +C+        + G  C++C C   GS    C++++G+C C+    G KCD C
Sbjct: 1413 CVPCQCNGHS--SQCDPETSVCQNCQHHTAGDFCERCALGYYGIVRGLPNDCQPCACPLISPSNNFSPSCVLEGLEDYRCTACPRGYEGQYCERCAPGYTGSPSSPGGSCQECECDPYGSLPVPCDRVTGLCTCRPGATGRKCDGC 1556          

HSP 10 Score: 59.6918 bits (143), Expect = 1.101e-7
Identity = 60/239 (25.10%), Postives = 103/239 (43.10%), Query Frame = 2
Query: 4460 VTAVEKCICNALTFGNHCQNPISGYYKEYFNLPNSTKSGSMRTGNRILINLKKCNCNGYSKVC---DSVT---------------GDCQNCMGNREGNKCQLCREGFYKN---DKNYDQ-CEPCQC-PSAHYNFAQNCTRIESSLEL-----KCQCRIGYSGKSCENCQQGFYGNPIKGIPCKSCDCNQQGSQSLNCNE---FGICQCSPGVLGIKCDQCAPNYV----VEKKTCQSCY 5071
             T   +C C   T G  C     G++++ +      ++G+  T +      + CNC+G ++ C   ++V                G C NC  N  G  C+ C +GF++      NY + C+PC C P+   + ++ C + E   +       C C+ G+ G +C+ C +G++G P     C+ C+C+  GS     NE    G C C   V G  C +C   +       +K C+ C+
Sbjct:  297 ATNKSRCECEHNTCGESCDRCCPGFHQKPW------RAGTFLTKSEC----EACNCHGKAEECYYDETVASRNLSLNIHGKYIGGGVCINCTHNTAGINCETCVDGFFRPKGVSPNYPRPCQPCHCDPTG--SLSEVCVKDEKYAQRGLKPGSCHCKTGFGGVNCDRCVRGYHGYP----DCQPCNCSGLGST----NEDPCVGPCSCKENVEGEDCSRCKSGFFNLQEDNQKGCEECF 515          
BLAST of Laminin subunit alpha-2 vs. Ensembl Mouse
Match: Lama2 (laminin, alpha 2 [Source:MGI Symbol;Acc:MGI:99912])

HSP 1 Score: 703.745 bits (1815), Expect = 0.000e+0
Identity = 442/1171 (37.75%), Postives = 625/1171 (53.37%), Query Frame = 2
Query:  188 LMENAKITSSATCGTGGPEIFCRLVDEIAIQRLINPDSHVLCDVCD--NRNETKRHPIEFAKSDDDNLWWQSPSMAQGLKYQNVNVTIDLKQVYQIVYILLKMGDSPRPGNWILERSLDGEIYMPWIFFAETPYSC---YNLFQRQYPDLKLTTNAKPSSLADDEMFCTTYYSQPKSLNSGEIIISLINGRKSIMNEEYLSIKSVPQTLINFLSARYIRFRFLKHLTLAADLM--THKG--YLEQSIYNRYYYSLRNIEIGGKCICNNHADKCDKVIENGISVAKCNCKHNTCGSNCETCCPLFNQRPWKPVAV-----CEECNCNRKSNECSYNQTVATLQLSVNKMGRMEGGGVCINCQENTEGINCEKCIKGFYRPWNVLATELYPCTPCQCHGLGTIGSCVSNGEDIGDQ--KPGDCICKKGYEGVNCDLCSIGYERYPNGECLPCPCSIDGSVRTSFYRCKPPCNCKVHVNSDDLCKTCKNGYFNLDSANPEGCEPCYCFGITNQCSSLSAKNLKISDLKGWKLTTFTGEKIALPKFT---SFQYLTSENSYIDERFNNPTVYYWTAPPPYLGNWITSYGTIFRYVVKIELQSTLKGSL-IDSPDVIIKCGDFRLFHSVSIEDRRLQRQVFIYIKPTEWKIGKLTPDKAA----------TKEEFISCLVKVDKLLIKAKYYSNQKSIELLNITLSRGEVHLALDE--MPHIEKCNCPPGFNGLSCESCESGYRRVNNVLYQGQCEACACYNHSNTCDSLNGECQNCTHNTAGAHCEDCASGYYGDAKSKNLNSCKKCPCPR--LDYQMTELCSSYSSENYVCHKCLHNTSGVHCDRCIEGYYGNPK-KKISCKRCKCNNNQE-----SCDPVTGECR-CSYNTMGTECQLCKHGFYGDAL-TKSCKKCDCDSLGSTSENCDKLTGKCDCRTNFVNRQCDSC---TSGLYLKDKKCIPCNCEIQGRISSEKFCNTTSGQCFCLENVNGDRCEKCVEGYFNYP--NCKKCLCSPHALSADCDLNNGKCKCGSNVINRICDKC-ENLHYWNNRTDCVPCNCGR-GSLNPKCDMETGNCKCAQNVARRDCSKCDVGYFGLDV-TGCKKCPPCYNGQVCNNE----------GICVCPPNTIGNLCNKCSEDSW--DFNETIGCKKCNCY 3514
            L  NA IT++ATCG  GPE++C+LV+ +  Q + NP     C +C+  + N  +RHPI  A  D  N WWQSPS+  G++Y  V +T+DL+QV+QI Y+++K  +SPRPGNWILERSLD   Y PW + A T   C   YN++ R  P         PS   DDE+ CT++YS+   L +GEI ISLINGR S  +            L+ F SARYIR RF +  TL ADLM   HK    ++  +  RYYYS+++I +GG CIC  HA  C   ++   + ++C C+HNTCG +C+ CCP F+Q+PW+         CE CNC+ K+ EC Y++TVA+  LS+N  G+  GGGVCINC  NT GINCE C+ GF+RP  V      PC PC C   G++       E    +  KPG C CK G+ GVNCD C  GY  YP  +C PC CS  GS  T+   C  PC+CK +V  +D C  CK+G+FNL   N +GCE C+C G++N+C S       I D++GW LT  +G     P+     S Q ++  NS  + R +    YYW+APPPYLGN + + G    + +  +L+     +  I    +I +  D R+  S + ++        +Y++P+E  I +++  + A          T+++F+  L  ++++L++  Y     +I  L+       V    D      +E C CPPG++G SCE+C   +RRVN  ++ G CE C C+ H+  CD + GEC NC  +T G +C +C  G+YGD    +   C+ C CP        +  C    S   +C +C    +G  C+RC EGY+G P     SC+ C+CN+N +     SCD ++G C  C   T G  C+LC  G++GDA+  K+C+ C C+  GS SE C   TG+C+CR N   R CD C   T GL L  + C+PCNC   G   S+ F    SGQC+C   V G +C++C  GYFN+    C  C CS   L  +CD   G+C C  N     C +C  N    +  T C  CNC   GSL  +C++ TG C C    +   CS+C  G++   + T C    P  +   C+ E          G C C  N  G  C++C    +  D    +GC  C C+
Sbjct:   42 LASNALITTNATCGEKGPEMYCKLVEHVPGQPVRNPQ----CRICNQNSSNPYQRHPITNA-IDGKNTWWQSPSIKNGVEYHYVTITLDLQQVFQIAYVIVKAANSPRPGNWILERSLDDVEYKPWQYHAVTDTECLTLYNIYPRTGP---------PSYAKDDEVICTSFYSKIHPLENGEIHISLINGRPSADDPS--------PELLEFTSARYIRLRFQRIRTLNADLMMFAHKDPREIDPIVTRRYYYSVKDISVGGMCICYGHARACP--LDPATNKSRCECEHNTCGESCDRCCPGFHQKPWRAGTFLTKSECEACNCHGKAEECYYDETVASRNLSLNIHGKYIGGGVCINCTHNTAGINCETCVDGFFRPKGVSPNYPRPCQPCHCDPTGSLSEVCVKDEKYAQRGLKPGSCHCKTGFGGVNCDRCVRGYHGYP--DCQPCNCSGLGS--TNEDPCVGPCSCKENVEGED-CSRCKSGFFNLQEDNQKGCEECFCSGVSNRCQSSYWTYGNIQDMRGWYLTDLSGRIRMAPQLDNPDSPQQISISNS--EARKSLLDGYYWSAPPPYLGNRLPAVGGQLSFTISYDLEEEEDDTEKILQLMIIFEGNDLRI--STAYKE--------VYLEPSEEHIEEVSLKEEAFTIHGTNLPVTRKDFMIVLTNLERVLMQITYNLGMDAIFRLSSVNLESAVPYPTDRRIATDVEVCQCPPGYSGSSCETCWPRHRRVNGTIFGGICEPCQCFAHAEACDDITGECLNCKDHTGGPYCNECLPGFYGDPTRGSPEDCQPCACPLNIPSNNFSPTCHLDRSLGLICDECPIGYTGPRCERCAEGYFGQPSIPGGSCQPCQCNDNLDYSIPGSCDSLSGSCLICKPGTTGRYCELCADGYFGDAVNAKNCQPCRCNINGSFSEICHTRTGQCECRPNVQGRHCDECKPETFGLQL-GRGCLPCNCNSFG---SKSFDCEASGQCWCQPGVAGKKCDRCAHGYFNFQEGGCIACDCS--HLGNNCDPKTGQCICPPNTTGEKCSECLPNTWGHSIVTGCKVCNCSTVGSLASQCNVNTGQCSCHPKFSGMKCSECSRGHWNYPLCTLCDCFLPGTDATTCDLETRKCSCSDQTGQCSCKVNVEGVHCDRCRPGKFGLDAKNPLGCSSCYCF 1165          

HSP 2 Score: 213.386 bits (542), Expect = 1.210e-54
Identity = 153/424 (36.08%), Postives = 204/424 (48.11%), Query Frame = 2
Query: 2654 CKRCKCNNNQESCDPVTGEC-RCSYNTMGTECQLCKHGFYGDALTKS---CKKCDC------DSLGSTSENCDKLTGKCD-CRTNFVNRQCDSCTSGLY----LKDKKCIPCNCEIQGRISSEKFCNTTSGQCF-CLENVNGDRCEKCVEGYF----NYPNCKKCLCSPH-ALSADCDLNNGKCKCGSNVINRICDKC--ENLHYWNNRTDCVPCNCGR-GSLNPKCDMETGNCKCAQNVARRDCSKCDVGYFGLDVTGCKKCPPCYNGQVCNNE-GICVCPPNTIGNLCNKCSEDSWDFNETIGCKKCNCYINGSYSNICNKISGICACKTAFFGSKCDRCNEGYYGFPNCQPCSCAENGTKSN----ELTK--CDKITGQCQCKQNVIGTKCKVCRKGTFPSDGTYEGGCFSCFCFGVSEKC 3832
            C+ C+C  + E+CD +TGEC  C  +T G  C  C  GFYGD    S   C+ C C      ++   T      L   CD C   +   +C+ C  G +    +    C PC C      S    C++ SG C  C     G  CE C +GYF    N  NC+ C C+ + + S  C    G+C+C  NV  R CD+C  E       R  C+PCNC   GS +  C+  +G C C   VA + C +C  GYF     GC  C   + G  C+ + G C+CPPNT G  C++C  ++W  +   GCK CNC   GS ++ CN  +G C+C   F G KC  C+ G++ +P C  C C   GT +     E  K  C   TGQC CK NV G  C  CR G F  D     GC SC+CFGV+ +C
Sbjct:  750 CEPCQCFAHAEACDDITGECLNCKDHTGGPYCNECLPGFYGDPTRGSPEDCQPCACPLNIPSNNFSPTCHLDRSLGLICDECPIGYTGPRCERCAEGYFGQPSIPGGSCQPCQCNDNLDYSIPGSCDSLSGSCLICKPGTTGRYCELCADGYFGDAVNAKNCQPCRCNINGSFSEICHTRTGQCECRPNVQGRHCDECKPETFGLQLGR-GCLPCNCNSFGSKSFDCEA-SGQCWCQPGVAGKKCDRCAHGYFNFQEGGCIACDCSHLGNNCDPKTGQCICPPNTTGEKCSECLPNTWGHSIVTGCKVCNCSTVGSLASQCNVNTGQCSCHPKFSGMKCSECSRGHWNYPLCTLCDCFLPGTDATTCDLETRKCSCSDQTGQCSCKVNVEGVHCDRCRPGKFGLDAKNPLGCSSCYCFGVTSQC 1171          

HSP 3 Score: 164.081 bits (414), Expect = 1.624e-39
Identity = 180/701 (25.68%), Postives = 279/701 (39.80%), Query Frame = 2
Query: 3086 CLCSPHALSADCD--LNNGKCKCGSNVINRICDKC-ENLHY--WN-----NRTDCVPCNCGRGSLNPKCDMETGNCKCAQNVARRDCSKCDVGYFGLDVTGCKKCPPCYNGQVCNNEGICV-CPPNTIGNLCNKCSEDSW-----DFNETIGCKKCNCYINGSYSNICNK---------ISGICACKTAFFGSKCDRCNEGYYGFPNCQPCSCAENGTKSNELTKCDKITGQCQCKQNVIGTKCKVCRKGTFPSDGTYEGGCFSCFCFGVSEKCHAILNHRIVENSIYEYHIFDEKNSLESGKDYSTIHLNANYPRRFGWPLTMFRPIYVNVMKLFNSHDLSLFYRSIFMNVSVDCLDNKCGREIPEQTEVFMESYNGLFGMRYXXXXXXXXXXXXXXDFNEHSKNGKWVISQYQNDILDKFIILEDSNVINSNL--TRDIFMMALLNVTSLKVKLYTDKVNPPLIKIKIITYKVMETTQAIGKRVTAVEKCICNALTFGNHCQNPISGYYKEYFNLPNSTKSGSMRTGNRILINLKKCNCNGYSKVCDSVTGDCQNCMGNREGNKCQLCREGFYKNDK--NYDQCEPCQCP--SAHYNFAQNCTRIESSLELKC-QCRIGYSGKSCENCQQGFYGNP-IKGIPCKSCDCNQQGSQSL--NCNEF-GICQ-CSPGVLGIKCDQCAPNY---VVEKKTCQSC 5068
            C+C  HA +   D   N  +C+C  N     CD+C    H   W       +++C  CNC           +   C   + VA R+ S   +   G  + G                G+C+ C  NT G  C  C +  +       N    C+ C+C   GS S +C K           G C CKT F G  CDRC  GY+G+P+CQPC+C+  G+ +NE    D   G C CK+NV G  C  C+ G F      + GC  CFC GVS +C         ++S + Y       +++  + +    L+     R      +  P     + + NS          + +     L N+      + +  F  SY+                     D    +   +  +   +  I +  +  E   +  +NL  TR  FM+ L N+  + +++  +     + ++  +  +         +  T VE C C     G+ C+     + +      N T  G +          + C C  +++ CD +TG+C NC  +  G  C  C  GFY +    + + C+PC CP      NF+  C  ++ SL L C +C IGY+G  CE C +G++G P I G  C+ C CN     S+  +C+   G C  C PG  G  C+ CA  Y    V  K CQ C
Sbjct:  283 CICYGHARACPLDPATNKSRCECEHNTCGESCDRCCPGFHQKPWRAGTFLTKSECEACNC---------HGKAEECYYDETVASRNLS---LNIHGKYIGG----------------GVCINCTHNTAGINCETCVDGFFRPKGVSPNYPRPCQPCHCDPTGSLSEVCVKDEKYAQRGLKPGSCHCKTGFGGVNCDRCVRGYHGYPDCQPCNCSGLGS-TNE----DPCVGPCSCKENVEGEDCSRCKSGFFNLQEDNQKGCEECFCSGVSNRC---------QSSYWTY------GNIQDMRGWYLTDLSG----RIRMAPQLDNPDSPQQISISNSEARKSLLDGYYWSAPPPYLGNRLPAVGGQLS--FTISYDLEEEEDDTEKILQLMIIFEGNDLRISTAYKEVYLEPSEEHIEEVSLKEEAFTIHGTNLPVTRKDFMIVLTNLERVLMQITYNLGMDAIFRLSSVNLESAVPYPTDRRIATDVEVCQCPPGYSGSSCETCWPRHRRV-----NGTIFGGI---------CEPCQCFAHAEACDDITGECLNCKDHTGGPYCNECLPGFYGDPTRGSPEDCQPCACPLNIPSNNFSPTC-HLDRSLGLICDECPIGYTGPRCERCAEGYFGQPSIPGGSCQPCQCNDNLDYSIPGSCDSLSGSCLICKPGTTGRYCELCADGYFGDAVNAKNCQPC 914          

HSP 4 Score: 98.9821 bits (245), Expect = 1.127e-19
Identity = 101/349 (28.94%), Postives = 147/349 (42.12%), Query Frame = 2
Query: 1208 GVCINCQENTEGINCEKCIKGFYRPWNVLATELYPCTPCQCHGLGTIGS-CVSNGEDIGDQKPGDCICKKGYEGVNCDLCSIGYERYPNGECLPCPCSIDGSVRTS----FYRCK-----PPCNCKVHVNSDDLCKTCKNGYFNLDSANPEGCEPCYCFGITNQCSSLSAKNLKISDLKGWKLTTFTGEKIALPKF-TSFQYLTSENSYIDERFNNPTV---------------YYWTAPPPYLGNWITSYGTIFRYVVKIELQSTLKGSLIDSPDVIIKCG---DFRLF--HSVSIEDRRLQRQVFIYIKPTEWKIGKLTP--DKAATKEEFISCLVKVDKLLIKAKY 2155
            G CI C  NT G  C +C+   +    V       C  C C  +G++ S C  N         G C C   + G+ C  CS G+  YP   C  C C + G+  T+      +C        C+CKV+V     C  C+ G F LD+ NP GC  CYCFG+T+QCS   AK L    ++ W   T + E+  LP    + Q+ T++       F  P +               +YW  P  + G  + +YG   +Y +  E +    G     P VII+ G     R+   H  +    +L R   I +   EWK     P   +  T+E+F+  L  +  +LIKA Y
Sbjct: 1024 GQCI-CPPNTTGEKCSECLPNTWGHSIVTG-----CKVCNCSTVGSLASQCNVNT--------GQCSCHPKFSGMKCSECSRGHWNYP--LCTLCDCFLPGTDATTCDLETRKCSCSDQTGQCSCKVNVEGVH-CDRCRPGKFGLDAKNPLGCSSCYCFGVTSQCSE--AKGL----IRTW--VTLSDEQTILPLVDEALQHTTTKGI----AFQKPEIVAKMDEVRQELHLEPFYWKLPQQFEGKKLMAYGGKLKYAIYFEARDE-TGFATYKPQVIIRGGTPTHARIITRHMAAPLIGQLTRHE-IEMTEKEWKYYGDDPRISRTVTREDFLDILYDIHYILIKATY 1341          

HSP 5 Score: 84.3445 bits (207), Expect = 2.822e-15
Identity = 47/131 (35.88%), Postives = 70/131 (53.44%), Query Frame = 2
Query: 4646 CDSVTGDCQNCMGNREGNKCQLCREGFYKNDKNYDQCEPCQCPSAHYNFAQNCTRIESSLELKCQCRIGYSGKSCENCQQGFYGNPIKGIPCKSCDCNQQGSQSLNCNEFGICQCSPGVLGIKCDQCAPNY 5038
            CDS++G C  C     G  C+LC +G++ +  N   C+PC+C     N   + + I  +   +C+CR    G+ C+ C+   +G  + G  C  C+CN  GS+S +C   G C C PGV G KCD+CA  Y
Sbjct:  875 CDSLSGSCLICKPGTTGRYCELCADGYFGDAVNAKNCQPCRC-----NINGSFSEICHTRTGQCECRPNVQGRHCDECKPETFGLQL-GRGCLPCNCNSFGSKSFDCEASGQCWCQPGVAGKKCDRCAHGY 999          

HSP 6 Score: 55.4546 bits (132), Expect = 1.600e-6
Identity = 60/239 (25.10%), Postives = 103/239 (43.10%), Query Frame = 2
Query: 4460 VTAVEKCICNALTFGNHCQNPISGYYKEYFNLPNSTKSGSMRTGNRILINLKKCNCNGYSKVC---DSVT---------------GDCQNCMGNREGNKCQLCREGFYKN---DKNYDQ-CEPCQC-PSAHYNFAQNCTRIESSLEL-----KCQCRIGYSGKSCENCQQGFYGNPIKGIPCKSCDCNQQGSQSLNCNE---FGICQCSPGVLGIKCDQCAPNYV----VEKKTCQSCY 5071
             T   +C C   T G  C     G++++ +      ++G+  T +      + CNC+G ++ C   ++V                G C NC  N  G  C+ C +GF++      NY + C+PC C P+   + ++ C + E   +       C C+ G+ G +C+ C +G++G P     C+ C+C+  GS     NE    G C C   V G  C +C   +       +K C+ C+
Sbjct:  297 ATNKSRCECEHNTCGESCDRCCPGFHQKPW------RAGTFLTKSEC----EACNCHGKAEECYYDETVASRNLSLNIHGKYIGGGVCINCTHNTAGINCETCVDGFFRPKGVSPNYPRPCQPCHCDPTG--SLSEVCVKDEKYAQRGLKPGSCHCKTGFGGVNCDRCVRGYHGYP----DCQPCNCSGLGST----NEDPCVGPCSCKENVEGEDCSRCKSGFFNLQEDNQKGCEECF 515          
BLAST of Laminin subunit alpha-2 vs. Ensembl Mouse
Match: Lamc1 (laminin, gamma 1 [Source:MGI Symbol;Acc:MGI:99914])

HSP 1 Score: 424.861 bits (1091), Expect = 7.958e-121
Identity = 311/1052 (29.56%), Postives = 486/1052 (46.20%), Query Frame = 2
Query:  197 NAKITSSATCGTGGPEIFCRLVDEIAIQRLINPDSHVLCDVCDNRNETKRHPIEFAK---SDDDNLWWQSPSMAQGLKYQN-VNVTIDLKQVYQIVYILLKMGDSPRPGNWILERSL--DGEIYMPWIFFAETPYSCYNLFQRQYPDLKLTTNAKPSSLADDEMFCTTYYSQPKSLNSGEIIISLINGRKSIMNEEYLSIKSVPQTLINFLSARYIRFRFLKHLTLAADLMTHKGYLEQSIYNRYYYSLRNIEIGGKCICNNHADKCDKVIENGISVAKCNCKHNTCGSNCETCCPLFNQRPWKPVAV-----CEECNCNRKSNECSYNQTVATLQLSVNKMGRMEG-GGVCINCQENTEGINCEKCIKGFYRPWNVLATELYPCTPCQCHGLGTIGS-CVSNGEDIGDQKPGDCICKKGYEGVNCDLCSIGYERYPNGECLPCPCSIDGSVRTSFYRCKPPCNCKVHVNSDDLCKTCKNGYFNLDSANPEGCEPCYCFGITNQCSSLSAKNL-KIS-----DLKGWKLTTFTGEKIALPKFTSFQYLTS-ENSYIDERFNNPTVYYWTAPPPYLGNWITSYGTIFRYVVKIELQSTLKGSLIDSPDVIIKCGDFR-----LFHSVSIEDRRLQRQVFIYIKPTE--WKIGKLTPDKAATKEEFISCLVKVDKLLIKAKYYSNQKSIELLNITLSRGEVHLALDEMPHIEKCNCPPGFNGLSCESCESGYRRVNNVLYQ-GQCEACACYNHSNTCDSLNGECQNCTHNTAGAHCEDCASGYYGDAKSKNLNSCKKCPCPRLDYQMTELCSSYSSENYVCHKCLHNTSGVHCDRCIEGYYGNPKKKIS----CKRCKCNNNQE-----SCDPVTGEC-RCSYNTMGTECQLCKHGFYGDALTKS----CKKCDCDSLGSTSE--NCDKLTGKCDCRTNFVNRQCDSCTSGLY--LKDKKCIPCNCEIQGRISSEKFCNTTSGQCFCLENVNGDRCEKCVEGYFNY--PNCKKCLCSPH-ALSADCDLNNGKCKCGSNVINRICDKCENLHYWN 3205
            N  + ++ TCGT  PE +C       + +         C +CD   +  +H   F     +  D  WWQS +M  G++Y N +N+T+ L + + I Y+ LK   S RP ++ + +    DG    PWI +     SC N + +       T   +  +L      CT  +S    L  G +  S + GR S  N +   +      L  +++A  IR    +  T   ++     + +  +   YYY++ +  +GG+C CN HA +C   ++N      CNCKHNT G +CE C P FN RPW+         C  C+CN +S EC ++           ++ R  G GG C NC++NT+G  CE+C + F+R  N  A     C+PC C  +G++ + C S G          C CK G  G  CD C  G+       C PC C   GS           C CK +V   + C+ CK G+FNL+S+NP+GC PC+CFG ++ C++    ++  IS     D  GW++    G + +L   +  Q +    +SY           Y+ AP  +LGN + SYG    +  +++ + T     + + D++++    R     +    S       + +F   + T+  W+        A +  EF   L  +  + I+   YS + +  L ++TL        +     +E C CP G+ G  CE+C  GYRR    L     C  C C  HS TCD   G C +C  NTAG HCE C+ GYYGD+     + C+ CPCP      +       ++  VC  C   T+G  C+ C +GY+G+P         C+ C+CN+N +     +C+ +TGEC +C YNT G  C  CK GF+G+ L  +    CK C C+  G+  +  +C+ +TG+C C  +   R C +C  G Y     + C  C+C   G  + +  C+  +GQC C   + G  CE+C   +F +    CK C C    +LS  C   +G+C+C    +   CD+CE  +++N
Sbjct:   58 NVTVVATNTCGTP-PEEYCVQTGVTGVTKS--------CHLCDAGQQHLQHGAAFLTDYNNQADTTWWQSQTMLAGVQYPNSINLTLHLGKAFDITYVRLKFHTS-RPESFAIYKRTREDG----PWIPYQYYSGSCENTYSKANRGFIRTGGDEQQAL------CTDEFSDISPLTGGNVAFSTLEGRPSAYNFDNSPV------LQEWVTATDIRVTLNRLNTFGDEV-----FNDPKVLKSYYYAISDFAVGGRCKCNGHASEC---VKNEFDKLMCNCKHNTYGVDCEKCLPFFNDRPWRRATAESASECLPCDCNGRSQECYFDP----------ELYRSTGHGGHCTNCRDNTDGAKCERCRENFFRLGNTEA-----CSPCHCSPVGSLSTQCDSYGR---------CSCKPGVMGDKCDRCQPGFHSLTEAGCRPCSCDPSGSTDECNVETGR-CVCKDNVEGFN-CERCKPGFFNLESSNPKGCTPCFCFGHSSVCTNAVGYSVYDISSTFQIDEDGWRVEQRDGSEASLEWSSDRQDIAVISDSYFPR--------YFIAPVKFLGNQVLSYGQNLSFSFRVDRRDT----RLSAEDLVLEGAGLRVSVPLIAQGNSYPSETTVKYIFRLHEATDYPWR-------PALSPFEFQKLLNNLTSIKIRGT-YSERSAGYLDDVTLQSARPGPGVPAT-WVESCTCPVGYGGQFCETCLPGYRRETPSLGPYSPCVLCTCNGHSETCDPETGVC-DCRDNTAGPHCEKCSDGYYGDSTLGTSSDCQPCPCP----GGSSCAIVPKTKEVVCTHCPTGTAGKRCELCDDGYFGDPLGSNGPVRLCRPCQCNDNIDPNAVGNCNRLTGECLKCIYNTAGFYCDRCKEGFFGNPLAPNPADKCKACACNPYGTVQQQSSCNPVTGQCQCLPHVSGRDCGTCDPGYYNLQSGQGCERCDCHALGSTNGQ--CDIRTGQCECQPGITGQHCERCETNHFGFGPEGCKPCDCHHEGSLSLQCK-EDGRCECREGFVGNRCDQCEENYFYN 1020          

HSP 2 Score: 155.992 bits (393), Expect = 5.605e-37
Identity = 167/627 (26.63%), Postives = 258/627 (41.15%), Query Frame = 2
Query: 3281 CKCAQNVARRDCSKC-----DVGYFGLDVTGCKKCPPCY-NG--QVC----------NNEGICV-CPPNTIGNLCNKCSEDSWDFNETIGCKKCNCYINGSYSNICNKISGICACKTAFFGSKCDRCNEGYYGF--PNCQPCSCAENGTKSNELTKCDKITGQCQCKQNVIGTKCKVCRKGTFPSDGTYEGGCFSCFCFGVSEKCHAILNHRIVENSIYEYHIFDEKNSLESGKDYSTIHLNANYPRRFGWPL--TMFRPIYVNVMKLFNSHDLSLFYRSIFMNVSVDCLDNKCGREIPEQTEVFMESYNGLFGMRYXXXXXXXXXXXXXXDFNEHSKNGKWVISQ---YQNDILDKFII-LEDSN--VINSNLTRDIFMMALLNVTSLKVK-LYTDKVNPPLIKIKIITYKVMETTQAIGKRVTAVEKCICNALTFGNHCQNPISGYYKEYFNLPNSTKSGSMRTGNRILINLKKCNCNGYSKVCDSVTGDCQNCMGNREGNKCQLCREGFYKNDK--NYDQCEPCQCPSAHYNFAQNCTRIESSLELKC-QCRIGYSGKSCENCQQGFYGNPIKGIP----CKSCDCNQQGSQSL--NCNEF-GIC-QCSPGVLGIKCDQCAPNY 5038
            C C  N    DC KC     D  +         +C PC  NG  Q C           + G C  C  NT G  C +C E+ +    T  C  C+C   GS S  C+   G C+CK    G KCDRC  G++      C+PCSC  +G+      +C+  TG+C CK NV G  C+ C+ G F  + +   GC  CFCFG S  C   + + + +  I      DE       +D S   L  +  R+    +  + F   ++  +K   +  LS + +++  +  VD  D +   E     ++ +E      G+R  V                       +I+Q   Y ++   K+I  L ++        L+   F   L N+TS+K++  Y+++    L  + + + +        G   T VE C C     G  C+  + GY +E  +L   +          +L     C CNG+S+ CD  TG C +C  N  G  C+ C +G+Y +        C+PC CP        +C  +  + E+ C  C  G +GK CE C  G++G+P+        C+ C CN     +   NCN   G C +C     G  CD+C   +
Sbjct:  303 CNCKHNTYGVDCEKCLPFFNDRPWRRATAESASECLPCDCNGRSQECYFDPELYRSTGHGGHCTNCRDNTDGAKCERCRENFFRLGNTEACSPCHCSPVGSLSTQCDSY-GRCSCKPGVMGDKCDRCQPGFHSLTEAGCRPCSCDPSGSTD----ECNVETGRCVCKDNVEGFNCERCKPGFFNLESSNPKGCTPCFCFGHSSVCTNAVGYSVYD--ISSTFQIDEDGWRVEQRDGSEASLEWSSDRQDIAVISDSYFPRYFIAPVKFLGNQVLS-YGQNLSFSFRVDRRDTRLSAE-----DLVLEGA----GLRVSVP----------------------LIAQGNSYPSETTVKYIFRLHEATDYPWRPALSPFEFQKLLNNLTSIKIRGTYSERSAGYLDDVTLQSAR-----PGPGVPATWVESCTCPVGYGGQFCETCLPGYRRETPSLGPYSPC--------VL-----CTCNGHSETCDPETGVC-DCRDNTAGPHCEKCSDGYYGDSTLGTSSDCQPCPCPG-----GSSCAIVPKTKEVVCTHCPTGTAGKRCELCDDGYFGDPLGSNGPVRLCRPCQCNDNIDPNAVGNCNRLTGECLKCIYNTAGFYCDRCKEGF 866          

HSP 3 Score: 145.591 bits (366), Expect = 7.015e-34
Identity = 104/339 (30.68%), Postives = 155/339 (45.72%), Query Frame = 2
Query: 2594 GVHCDRCIEGYYGNPKK---KISCKRCKCNNNQESCDPVTGECRCSYNTMGTECQLCKHGFYGDA---LTKSCKKCDCDSLGSTSENCDKLTGKC-DCRTNFVNRQCDSCTSGLYLKD--------KKCIPCNCEIQGRISSEKFCNTTSGQCF-CLENVNGDRCEKCVEGYFNYP-------NCKKCLCSPHAL---SADCDLNNGKCKCGSNVINRICDKCENLHY-WNNRTDCVPCNC-GRGSLNPKCDMETGNCKCAQNVARRDCSKCDVGYFGLDVTGCKKCPPCYNGQV---CNNEGICVCPPNTIGNLCNKCSEDSWDFNETIGCKKC-NCY 3514
            G  C+ C+ GY            C  C CN + E+CDP TG C C  NT G  C+ C  G+YGD+    +  C+ C C    S +         C  C T    ++C+ C  G Y  D        + C PC C      ++   CN  +G+C  C+ N  G  C++C EG+F  P        CK C C+P+      + C+   G+C+C  +V  R C  C+  +Y   +   C  C+C   GS N +CD+ TG C+C   +  + C +C+  +FG    GCK C   + G +   C  +G C C    +GN C++C E+ +      GC++C  CY
Sbjct:  696 GQFCETCLPGYRRETPSLGPYSPCVLCTCNGHSETCDPETGVCDCRDNTAGPHCEKCSDGYYGDSTLGTSSDCQPCPCPGGSSCAIVPKTKEVVCTHCPTGTAGKRCELCDDG-YFGDPLGSNGPVRLCRPCQCNDNIDPNAVGNCNRLTGECLKCIYNTAGFYCDRCKEGFFGNPLAPNPADKCKACACNPYGTVQQQSSCNPVTGQCQCLPHVSGRDCGTCDPGYYNLQSGQGCERCDCHALGSTNGQCDIRTGQCECQPGITGQHCERCETNHFGFGPEGCKPCDCHHEGSLSLQCKEDGRCECREGFVGNRCDQCEENYFYNRSWPGCQECPACY 1033          

HSP 4 Score: 136.346 bits (342), Expect = 4.935e-31
Identity = 116/351 (33.05%), Postives = 153/351 (43.59%), Query Frame = 2
Query: 2711 CRCSYNTMGTECQLCKHGFYGDALT----KSCKKCDCDSLGSTSENCDKLTGKCDCRTNFVNRQCDSCTSGLYLKD-----KKCIPCNCEIQGRISSEKFCNTTSGQC-FCLENVNGDRCEKCVEGYFNYPN--------CKKCLCS----PHALSADCDLNNGKC-KCGSNVINRICDKCENLHYWN----NRTD-CVPCNC---GRGSLNPKCDMETGNCKCAQNVARRDCSKCDVGYFGLDV-TGCKKCPPCY-----NGQVCNNEGICVCPPNTIGNLCNKCSEDSWDFNETIGCKKCNCYINGSYSNICNKISGICACKTAFFGSKCDRCNEGYY---GFPNCQPC 3643
            C C     G  C+ C  G+  +  +      C  C C+     SE CD  TG CDCR N     C+ C+ G Y          C PC C   G  S      T    C  C     G RCE C +GYF  P         C+ C C+    P+A+  +C+   G+C KC  N     CD+C+   + N    N  D C  C C   G       C+  TG C+C  +V+ RDC  CD GY+ L    GC++C  C+     NGQ     G C C P   G  C +C  + + F    GCK C+C+  GS S  C K  G C C+  F G++CD+C E Y+    +P CQ C
Sbjct:  688 CTCPVGYGGQFCETCLPGYRRETPSLGPYSPCVLCTCNG---HSETCDPETGVCDCRDNTAGPHCEKCSDGYYGDSTLGTSSDCQPCPC--PGGSSCAIVPKTKEVVCTHCPTGTAGKRCELCDDGYFGDPLGSNGPVRLCRPCQCNDNIDPNAV-GNCNRLTGECLKCIYNTAGFYCDRCKEGFFGNPLAPNPADKCKACACNPYGTVQQQSSCNPVTGQCQCLPHVSGRDCGTCDPGYYNLQSGQGCERCD-CHALGSTNGQCDIRTGQCECQPGITGQHCERCETNHFGFGPE-GCKPCDCHHEGSLSLQC-KEDGRCECREGFVGNRCDQCEENYFYNRSWPGCQEC 1029          

HSP 5 Score: 101.293 bits (251), Expect = 2.411e-20
Identity = 114/480 (23.75%), Postives = 206/480 (42.92%), Query Frame = 2
Query: 4613 KKCNCNGYSKV-----CDSVTGDCQNCMGNREGNKCQLCREGFYKNDKNYDQCEPCQCPSAHYNFAQNCTRIESSLELKCQCRIGYSGKSCENCQQGFYGNPIKGIPCKSCDCNQQGSQSLNCNEFGICQCSPGVLGIKCDQCAPNYVVEK-----KTCQSCYSGCTKDLLVRIDTLNETVINFKWKTLPSTLDLRLNKINISIQMSSELLNSINKFYKLKNEIKNFSIQFQKMKDDAKEKYGEIEKLKTRYNKVLEDLRSTFTDINET----ISGHEQLGISNELIKNATAYLETIK----NIYKEMPNIT--------LAASVLKDVLKYVDELNQIIKY--TQSHIQSDQIN-NLKILKNKTIMADEINTNNKEYLNTMSTKKKEHELYIILINERMKDLQ----KIFRKMTKQRDNLRKKIQ-KLDAISKSFQDEKDLISINVREIEDLMKNLSSNHLVSKSLIIPDTLKKHVEQQ 5950
            K C CN Y  V     C+ VTG CQ C+ +  G  C  C  G+Y N ++   CE C C +      Q   R       +C+C+ G +G+ CE C+   +G   +G  CK CDC+ +GS SL C E G C+C  G +G +CDQC  NY   +     + C +CY       LV+ D + E  +  +       L+  +  +     M ++     ++  + + E+ +   + Q++KD  +     ++++ +  +  +  L++    I ET         ++  + +LI+ A+  LE  K    N+    P  T        LA    K   ++  E + I++   T +   ++  N  L+ L  +   A EI   N++Y    +   ++ E     ++E  K       +I+  + +      + ++ + + I K   D   LI   +++ EDL +++       K+L+     K   EQQ
Sbjct:  880 KACACNPYGTVQQQSSCNPVTGQCQ-CLPHVSGRDCGTCDPGYY-NLQSGQGCERCDCHALGSTNGQCDIRTG-----QCECQPGITGQHCERCETNHFGFGPEG--CKPCDCHHEGSLSLQCKEDGRCECREGFVGNRCDQCEENYFYNRSWPGCQECPACYR------LVK-DKVAEHRVKLQ------ELESLIANLGTGDDMVTDQAFE-DRLKEAEREVTDLLREAQEVKDVDQNLMDRLQRVNSSLHSQISRLQNIRNTIEETGILAERARSRVESTEQLIEIASRELEKAKMAAANVSITQPESTGEPNNMTLLAEEARKLAERHKQEADDIVRVAKTANETSAEAYNLLLRTLAGENQTALEIEELNRKYEQAKNI-SQDLEKQAARVHEEAKRAGDKAVEIYASVAQLTPVDSEALENEANKIKKEAADLDRLIDQKLKDYEDLREDMRGKEHEVKNLL----EKGKAEQQ 1331          

HSP 6 Score: 99.7525 bits (247), Expect = 6.507e-20
Identity = 97/305 (31.80%), Postives = 127/305 (41.64%), Query Frame = 2
Query: 3005 CFCLENVNGDRCEKCVEGYFN-------YPNCKKCLCSPHALSADCDLNNGKCKCGSNVINRICDKCENLHYWNN----RTDCVPCNCGRGS---LNPKCDMETGNCKCAQNVARRDCSKCDVGYFG--LDVTG-CKKCPPCY-NGQV-------CNN-EGICV-CPPNTIGNLCNKCSE----DSWDFNETIGCKKCNCYINGSYS--NICNKISGICACKTAFFGSKCDRCNEGYYGFPN---CQPCSCAENGTKSNELTKCDKITGQCQCKQNVIGTKCKVCRKGTFPSDGTYEGGCFSCFC 3811
            C C     G  CE C+ GY         Y  C  C C+ H  S  CD   G C C  N     C+KC + +Y ++     +DC PC C  GS   + PK   E     C    A + C  CD GYFG  L   G  + C PC  N  +       CN   G C+ C  NT G  C++C E    +    N    CK C C   G+    + CN ++G C C     G  C  C+ GYY   +   C+ C C   G+ + +   CD  TGQC+C+  + G  C+ C    F   G    GC  C C
Sbjct:  688 CTCPVGYGGQFCETCLPGYRRETPSLGPYSPCVLCTCNGH--SETCDPETGVCDCRDNTAGPHCEKCSDGYYGDSTLGTSSDCQPCPCPGGSSCAIVPKT-KEVVCTHCPTGTAGKRCELCDDGYFGDPLGSNGPVRLCRPCQCNDNIDPNAVGNCNRLTGECLKCIYNTAGFYCDRCKEGFFGNPLAPNPADKCKACACNPYGTVQQQSSCNPVTGQCQCLPHVSGRDCGTCDPGYYNLQSGQGCERCDCHALGSTNGQ---CDIRTGQCECQPGITGQHCERCETNHF---GFGPEGCKPCDC 983          

HSP 7 Score: 92.0485 bits (227), Expect = 1.199e-17
Identity = 75/255 (29.41%), Postives = 116/255 (45.49%), Query Frame = 2
Query: 2726 NTMGTEC----QLCKHGFYGDALTKSCKKCDCDSLGS--TSENCDKLTGKCDCRTNFVNRQCDSCTSGLYLKDK-----------KCIPCNCEIQGR---ISSEKFCNTT-SGQCF-CLENVNGDRCEKCVEGYFNYPN---CKKCLCSP-HALSADCDLNNGKCKCGSNVINRICDKCENLHYWNNRTDCVPCNCGRGSLNPKCDMETGNCKCAQNVARRDCSKCDVGYFGLDVTGCKKCPPCY---NGQVCNN 3403
            NT G E     ++ K  +Y  +      +C C+   S       DKL   C+C+ N     C+ C    +  D+           +C+PC+C  + +      E + +T   G C  C +N +G +CE+C E +F   N   C  C CSP  +LS  CD + G+C C   V+   CD+C+   +      C PC+C       +C++ETG C C  NV   +C +C  G+F L+ +  K C PC+   +  VC N
Sbjct:  255 NTFGDEVFNDPKVLKSYYYAISDFAVGGRCKCNGHASECVKNEFDKLM--CNCKHNTYGVDCEKCLP--FFNDRPWRRATAESASECLPCDCNGRSQECYFDPELYRSTGHGGHCTNCRDNTDGAKCERCRENFFRLGNTEACSPCHCSPVGSLSTQCD-SYGRCSCKPGVMGDKCDRCQPGFHSLTEAGCRPCSCDPSGSTDECNVETGRCVCKDNVEGFNCERCKPGFFNLESSNPKGCTPCFCFGHSSVCTN 504          

HSP 8 Score: 73.559 bits (179), Expect = 5.192e-12
Identity = 54/165 (32.73%), Postives = 73/165 (44.24%), Query Frame = 2
Query: 4619 CNCNGYSKVC---------DSVTGDCQNCMGNREGNKCQLCREGFYKNDKNYDQCEPCQCPSAHYNFAQNCTRIESSLELKCQCRIGYSGKSCENCQQGFYGNPIKGIPCKSCDCNQQGSQSLNCN-EFGICQCSPGVLGIKCDQCAPNYV----VEKKTCQSCY 5071
            C+CNG S+ C             G C NC  N +G KC+ CRE F++   N + C PC C S   + +  C         +C C+ G  G  C+ CQ GF+     G  C+ C C+  GS    CN E G C C   V G  C++C P +        K C  C+
Sbjct:  340 CDCNGRSQECYFDPELYRSTGHGGHCTNCRDNTDGAKCERCRENFFRL-GNTEACSPCHC-SPVGSLSTQCDSYG-----RCSCKPGVMGDKCDRCQPGFHSLTEAG--CRPCSCDPSGSTD-ECNVETGRCVCKDNVEGFNCERCKPGFFNLESSNPKGCTPCF 494          

HSP 9 Score: 63.1586 bits (152), Expect = 8.704e-9
Identity = 60/200 (30.00%), Postives = 84/200 (42.00%), Query Frame = 2
Query: 4517 NPISGYYKEYFNLPNSTKSGSMRTGNRILINLKKCNCNGYSKVCDSVTGD---CQNCMGNREGNKCQLCREGFYKNDKNY--------DQCEPCQC--PSAHYNFAQNCTRIESSLELKCQCRIGYSGKSCENCQQGFY--GNPIKGIPCKSCDCNQQGSQSLNCNEFGICQCSPGVLGIKCDQCAPNY-VVEKKTCQSC 5068
            N ++ +  E FN P   KS      +  +    +C CNG++  C     D   C NC  N  G  C+ C   F  ND+ +         +C PC C   S    F     R          CR    G  CE C++ F+  GN      C  C C+  GS S  C+ +G C C PGV+G KCD+C P +  + +  C+ C
Sbjct:  252 NRLNTFGDEVFNDPKVLKSYYYAISDFAVGG--RCKCNGHASECVKNEFDKLMC-NCKHNTYGVDCEKCLPFF--NDRPWRRATAESASECLPCDCNGRSQECYFDPELYRSTGHGGHCTNCRDNTDGAKCERCRENFFRLGNTEA---CSPCHCSPVGSLSTQCDSYGRCSCKPGVMGDKCDRCQPGFHSLTEAGCRPC 443          
BLAST of Laminin subunit alpha-2 vs. Ensembl Mouse
Match: Lamc3 (laminin gamma 3 [Source:MGI Symbol;Acc:MGI:1344394])

HSP 1 Score: 397.897 bits (1021), Expect = 1.694e-112
Identity = 323/1066 (30.30%), Postives = 476/1066 (44.65%), Query Frame = 2
Query:  191 MENA----KITSSATCGTGGPEIFCRLVDEIAIQRLINPDSHVLCDVCDNRNETKRHPIEFA---KSDDDNLWWQSPSMAQGLKYQ-NVNVTIDLKQVYQIVYILLKMGDSPRPGNW-ILERSLDGEIYMPWIFFAETPYSCYNLFQRQYPDLKLTTNAKPSSLADDEMFCTTYYSQPKSLNSGEIIISLINGRKSIMNEEYLSIKSVPQTLINFLSARYIRFRFLKHLTLAADLMTHKGYLEQSIYNRYYYSLRNIEIGGKCICNNHADKCDKVIENGISVAKCNCKHNTCGSNCETCCPLFNQRPWKPVAV-----CEECNCNRKSNECSYNQTVATLQLSVNKMGRMEG-GGVCINCQENTEGINCEKCIKGFYRPWNVLATELYPCTPCQCHGLGTIGSCVSNGEDIGDQKPGDCICKKGYEGVNCDLCSIGYERYPNGECLPCPCSIDGSVRTSFYRCKPP---CNCKVHVNSDDLCKTCKNGYFNLDSANPEGCEPCYCFGITNQCSSLSA--KNLKISDLK----GWKLTTFTGEKIALPKFTSFQYLTSENSYIDERFNNPTVYYWTAPPPYLGNWITSYGTIFRYVVKIELQSTLKGSLIDSPDVIIKCGDFRLFHSV------SIEDRRLQRQVFIYIKPTEWKIGKLTPDKAATKEEFISCLVKVDKLLI-KAKYYSNQKSIELLNITLSRGEVHLALDEMPHIEKCNCPPGFNGLSCESCESGYRR-VNNVLYQGQCEACACYNHSNTCDSLNGECQNCTHNTAGAHCEDCASGYYGDAKSKNLNSCKKCPCPRLDYQMTELCSSYSSENYVCHKCLHNTSGVHCDRCIEGYYGNP----KKKISCKRCKCNNNQE-----SCDPVTGEC-RCSYNTMGTECQLCKHGFYGDALTK----SCKKCDCDSLGSTSE-NCDKLTGKCDCRTNFVNRQCDSCTSGLY--LKDKKCIPCNCEIQGRISSEKFCNTTSGQCFCLENVNGDRCEKCVEGYFNYP--NCKKCLCSP-HALSADCDLNNGKCKCGSNVINRICDKCE-NLHYWNNRTDCVPC 3229
             ENA    +  +S TCG   PE FC  V          P + + C  CD+ +  +RH   +     S DD+ WWQSPSMA G++Y  +VN+T+ L + Y+I Y+ LK   S RP ++ I +R+     + P+ +++    SC   + R  P+       +   +A    FCT+ +S    LN G +  S + GR S  N E   +      L  ++++  I     +  T   D+     + +  +   YYY++ +  +GG+C CN HA +C+    N      C C+HNT G +CE C P F  RPW          C  CNC+  S EC++++          ++ R  G GG C  C+++T G +CE+C K +YR W    +   PC PC CH  G++     N         G C CK    G  CD C  G+     G C PC C++ GS+ T    C P    C CK +V    LC  C+ G FNL   NP GC  C+C+G +  CS  +   ++   SD +    GW++ +    K  L      Q+  S                 +AP  +LG+   SYG      V + LQ    GS    P + ++     L  S+      S +D R  R+V +     E      +P      +  +S L  +      +   +S Q  +  + +T +  +  LA      +E C CP G+ G  CE C  GY+R + +      C  C C  H  TCD   G C  C H+T G  CE C  G+YG+A S   + C+ CPCP      +   +   S + VC  C     G  C+ C +G++G+P         C+RC+C+ N +     +CDP +G C RC YNT G  C+ C+ GFYG A+       C  C CD  GS SE  C+ +TG+C C      R C  C+ G Y     + C  C C   G +  E  C+  +GQC C   V G  C++C  G+F +    C+ C CSP  A S+ C   N  C C    +   CD+C+ N    +  T C  C
Sbjct:   48 FENAAFGRRAEASHTCGRP-PEDFCPHVGA--------PGAGLQCQRCDDADPGRRHDASYLTDFHSPDDSTWWQSPSMAFGVQYPTSVNLTLSLGKAYEITYVRLKFHTS-RPESFAIYKRTYASGPWEPYQYYSA---SCQKTYGR--PEGHYLRPGEDERVA----FCTSEFSDISPLNGGNVAFSTLEGRPSAYNFEESPV------LQEWVTSTDILISLDRLNTFGDDI-----FKDPRVLQSYYYAVSDFSVGGRCKCNGHASECEP---NAAGQLACRCQHNTTGVDCERCLPFFQDRPWARGTAEDANECLPCNCSGHSEECTFDR----------ELYRSTGHGGHCQRCRDHTTGPHCERCEKNYYR-W----SPKTPCQPCDCHPAGSLSLQCDNS--------GVCPCKPTVTGWKCDRCLPGFHSLSEGGCRPCACNVAGSLGT----CDPRSGNCPCKENVEGS-LCDRCRPGTFNLQPHNPVGCSSCFCYGHSKVCSPAAGFQEHHIRSDFRHGAGGWQIRSMGVSKRPL------QWSQSGLLLGLR-----GGEELSAPKKFLGDQRLSYGQ----PVILTLQVPPGGS---PPPIQLRLEGAGLALSLRPSSLPSPQDTRQPRRVQLQFLLQETSEEAESPLPTFHFQRLLSNLTALSIWTSGQGPGHSGQVLLCEVQLTSAWPQRELA-PPASWVETCLCPQGYTGQFCEFCALGYKREIPHGGPYANCIPCTCNQH-GTCDPNTGICL-CGHHTEGPSCERCMPGFYGNAFSGRADDCQPCPCP----GQSACATIPESGDVVCTHCPPGQRGRRCESCEDGFFGDPLGLSGAPQPCRRCQCSGNVDLNAVGNCDPHSGHCLRCLYNTTGAHCEHCREGFYGSAVATRPVDKCAPCSCDLRGSVSEKTCNPVTGQCVCLPYVSGRDCSRCSPGFYDLQSGRGCQSCKCHPLGSL--ENKCHPKTGQCPCRPGVTGQACDRCQLGFFGFSIKGCRDCRCSPLGAASSQCH-ENSTCVCRPGFVGYKCDRCQDNFFLADGDTGCQEC 1024          

HSP 2 Score: 140.584 bits (353), Expect = 2.248e-32
Identity = 166/692 (23.99%), Postives = 263/692 (38.01%), Query Frame = 2
Query: 3083 KCLCSPHALSADCDLNNG---KCKCGSNVINRICDKCENLHYWNNRT----------DCVPCNCGRGSLNPKCDMETGNCKCAQNVARRDCSKCDVGYFGLDVTGCKKCPPCYNGQVCNNEGICVCPPNTIGNLCNKCSEDSWDFNETIGCKKCNCYINGSYSNICNKISGICACKTAFFGSKCDRCNEGYYGFP--NCQPCSCAENGTKSNELTKCDKITGQCQCKQNVIGTKCKVCRKGTFPSDGTYEGGCFSCFCFGVSEKCHAILNHRIVENSIYEYHIFDEKNSLESGKDYSTIHLNANYPRRFGWPLTMFRPIYVNVM------KLFNSHDLSLFYRSIFMNVSVDCLDNKCGREIPEQTEVFMESYNGLFGMRYXXXXXXXXXXXXXXDFNEHSKNGKWVISQYQNDILDKFIILEDSNVINSNLTRDIFMMALLNVTSLKVKLYTDKVNPPLIKIKIITYKVMETT----QAIGKRVTAVEKCICNALTFGNHCQNPISGYYKEYFNLPNSTKSGSMRTGNRILINLKKCNCNGYSKVCDSVTGDCQNCMGNREGNKCQLCREGFYKN--DKNYDQCEPCQCPSAHYNFAQNCTRIESSLELKC-QCRIGYSGKSCENCQQGFYGNPI----KGIPCKSCDCNQQGSQSLNCNEFGICQCSPG--------VLGIKCDQCAPNY 5038
            +C C+ HA  ++C+ N      C+C  N     C++C  L ++ +R           +C+PCNC            +  C   + + R        G+ G     C++C                   +T G  C +C ++ + ++    C+ C+C+  GS S  C+  SG+C CK    G KCDRC  G++      C+PC+C   G+    L  CD  +G C CK+NV G+ C  CR GTF        GC SCFC+G S+ C              E+HI   ++    G     I       R   W  +                K      LS + + + + + V    +      P   ++ +E       +R     S  +                   ++    +  +F++ E S    S L    F   L N+T+L +  +T    P     +++  +V  T+    + +    + VE C+C     G  C+    GY +E   +P+               N   C CN +   CD  TG C  C  + EG  C+ C  GFY N      D C+PC CP         C  I  S ++ C  C  G  G+ CE+C+ GF+G+P+       PC+ C C    S +++ N  G C    G          G  C+ C   +
Sbjct:  279 RCKCNGHA--SECEPNAAGQLACRCQHNTTGVDCERC--LPFFQDRPWARGTAEDANECLPCNC---------SGHSEECTFDRELYR------STGHGG----HCQRCRD-----------------HTTGPHCERCEKNYYRWSPKTPCQPCDCHPAGSLSLQCDN-SGVCPCKPTVTGWKCDRCLPGFHSLSEGGCRPCACNVAGS----LGTCDPRSGNCPCKENVEGSLCDRCRPGTFNLQPHNPVGCSSCFCYGHSKVCSPAAG-------FQEHHI---RSDFRHGAGGWQIRSMGVSKRPLQWSQSGLLLGLRGGEELSAPKKFLGDQRLS-YGQPVILTLQVPPGGS------PPPIQLRLEGAGLALSLRPSSLPSPQD-------------------TRQPRRVQLQFLLQETSEEAESPLPTFHFQRLLSNLTALSI--WTSGQGPGHSG-QVLLCEVQLTSAWPQRELAPPASWVETCLCPQGYTGQFCEFCALGYKRE---IPHGGP----------YANCIPCTCNQHG-TCDPNTGICL-CGHHTEGPSCERCMPGFYGNAFSGRADDCQPCPCPG-----QSACATIPESGDVVCTHCPPGQRGRRCESCEDGFFGDPLGLSGAPQPCRRCQC----SGNVDLNAVGNCDPHSGHCLRCLYNTTGAHCEHCREGF 862          

HSP 3 Score: 120.553 bits (301), Expect = 3.360e-26
Identity = 104/372 (27.96%), Postives = 155/372 (41.67%), Query Frame = 2
Query: 2858 CDCRTNFVNRQCDSCTSGLYLKD-------KKCIPCNCEIQGRISSEKFCNTTSGQCFCLENVNGDRCEKCVEGYFN------YPNCKKCLCSPHALSADCDLNNGKC--KCGSNVINRICDKCEN------LHYWNNRTDCVPCNC-GRGSLNP--KCDMETGNC-KCAQNVARRDCSKCDVGYFGLDVT--GCKKCPPC-------YNGQVCNN-EGICVCPPNTIGNLCNKCSEDSWDFNETIGCKKCNCYINGSYSNICNKISGICACKTAFFGSKCDRCNEGYYGFP--NCQPCSCAENGTKSNELTKCDKITGQCQCKQNVIGTKCKVCRKGTFPSDGTYEGGCFSC-FCFGVSEKCHAILNHRIV 3859
            C C   +  + C+ C  G Y ++         CIPC C   G       C+  +G C C  +  G  CE+C+ G++         +C+ C C   +  A    +       C      R C+ CE+      L        C  C C G   LN    CD  +G+C +C  N     C  C  G++G  V      KC PC        + + CN   G CVC P   G  C++CS   +D     GC+ C C+  GS  N C+  +G C C+    G  CDRC  G++GF    C+ C C+  G  S++  +       C C+   +G KC  C+   F +DG  + GC  C  C+ + ++  A L  R++
Sbjct:  685 CLCPQGYTGQFCEFCALG-YKREIPHGGPYANCIPCTCNQHGT------CDPNTGICLCGHHTEGPSCERCMPGFYGNAFSGRADDCQPCPCPGQSACATIPESGDVVCTHCPPGQRGRRCESCEDGFFGDPLGLSGAPQPCRRCQCSGNVDLNAVGNCDPHSGHCLRCLYNTTGAHCEHCREGFYGSAVATRPVDKCAPCSCDLRGSVSEKTCNPVTGQCVCLPYVSGRDCSRCSPGFYDLQSGRGCQSCKCHPLGSLENKCHPKTGQCPCRPGVTGQACDRCQLGFFGFSIKGCRDCRCSPLGAASSQCHE----NSTCVCRPGFVGYKCDRCQDNFFLADG--DTGCQECPTCYALVKEEAAKLKARLM 1043          

HSP 4 Score: 112.464 bits (280), Expect = 8.225e-24
Identity = 99/347 (28.53%), Postives = 140/347 (40.35%), Query Frame = 2
Query: 2576 CLHNTSGVHCDRCIEGY-----YGNPKKKISCKRCKCNNNQESCDPVTGECRCSYNTMGTECQLCKHGFYGDALT---KSCKKCDC--------------------------------------DSLGST-----------SENCD-KLTGKCD--------CRTNFVNRQCDSCTSGLYLKD------KKCIPCNCEIQGRISSEKFCNTTSGQCFCLENVNGDRCEKCVEGYFNYPN---CKKCLCSP-HALSADCDLNNGKCKCGSNVINRICDKCENLHYWNNRTDCVPCNCGR-GSLNPKCDMETGNCKCAQNVARRDCSKCDVGYFGLDV-TGCKKCPPCY 3382
            C    +G  C+ C  GY     +G P    +C  C CN +  +CDP TG C C ++T G  C+ C  GFYG+A +     C+ C C                                      D LG +           S N D    G CD        C  N     C+ C  G Y          KC PC+C+++G + SEK CN  +GQC CL  V+G  C +C  G+++  +   C+ C C P  +L   C    G+C C   V  + CD+C+   +  +   C  C C   G+ + +C  E   C C        C +C   +F  D  TGC++CP CY
Sbjct:  687 CPQGYTGQFCEFCALGYKREIPHGGPY--ANCIPCTCNQHG-TCDPNTGICLCGHHTEGPSCERCMPGFYGNAFSGRADDCQPCPCPGQSACATIPESGDVVCTHCPPGQRGRRCESCEDGFFGDPLGLSGAPQPCRRCQCSGNVDLNAVGNCDPHSGHCLRCLYNTTGAHCEHCREGFYGSAVATRPVDKCAPCSCDLRGSV-SEKTCNPVTGQCVCLPYVSGRDCSRCSPGFYDLQSGRGCQSCKCHPLGSLENKCHPKTGQCPCRPGVTGQACDRCQLGFFGFSIKGCRDCRCSPLGAASSQCH-ENSTCVCRPGFVGYKCDRCQDNFFLADGDTGCQECPTCY 1028          

HSP 5 Score: 93.9745 bits (232), Expect = 3.666e-18
Identity = 84/346 (24.28%), Postives = 141/346 (40.75%), Query Frame = 2
Query: 4613 KKCNCNGYSKV-----CDSVTGDCQNCMGNREGNKCQLCREGFYKN---DKNYDQCEPC------------------QCPSAHYNFAQNCTRIE--------------------SSLELKCQ-------CRIGYSGKSCENCQQGFYGNPIKGIPCKSCDCNQQGSQSLNCNEFGICQCSPGVLGIKCDQCAPNYVVEK-----KTCQSCYSGCTKD-------LLVRIDTLNETVINFKWKTLPSTLDLRLNKINISIQMSSELLNSINKFYKLKNEIKNFSIQFQKMKDDAKEKYGEIEKLKTRYNKVLEDLRST---FTDINETISGHEQLGISNELIKNATA 5446
            ++C C+G   +     CD  +G C  C+ N  G  C+ CREGFY +    +  D+C PC                  QC    Y   ++C+R                       SLE KC        CR G +G++C+ CQ GF+G  IKG  C+ C C+  G+ S  C+E   C C PG +G KCD+C  N+ +       + C +CY+   ++       L++    L  +     W      LD+        +Q  + L +     + L+     F  Q   ++D  K  + +++ L+   +      + T     ++ ET+   E+     E+++ A+A
Sbjct:  820 RRCQCSGNVDLNAVGNCDPHSGHCLRCLYNTTGAHCEHCREGFYGSAVATRPVDKCAPCSCDLRGSVSEKTCNPVTGQCVCLPYVSGRDCSRCSPGFYDLQSGRGCQSCKCHPLGSLENKCHPKTGQCPCRPGVTGQACDRCQLGFFGFSIKG--CRDCRCSPLGAASSQCHENSTCVCRPGFVGYKCDRCQDNFFLADGDTGCQECPTCYALVKEEAAKLKARLMLMEGWLQRSDCGSPW----GPLDI--------LQGEAPLGDVYQGHHLLQETRGTFLQQMVGLEDSVKATWEQLQVLRGHVHCAQAGAQKTCIQLAELEETLQSSEE-----EVLRAASA 1146          

HSP 6 Score: 79.7221 bits (195), Expect = 6.803e-14
Identity = 73/269 (27.14%), Postives = 105/269 (39.03%), Query Frame = 2
Query: 2609 RCIEGYYGNPKKKISCKRCKCNNNQESCDP-VTGE--CRCSYNTMGTECQLCKHGFYGDALTKSCKKCDCDSLGSTSENCDKLTGKCDCRTNFVNRQCDSCTSGLYLKDKKCIPCNCEIQGR---ISSEKFCNTT-SGQC-FCLENVNGDRCEKCVEGYFNYPN---CKKCLCSPH-ALSADCDLNNGKCKCGSNVINRICDKCENLHYWNNRTDCVPCNCGRGSLNPKCDMETGNCKCAQNVARRDCSKCDVGYFGL---DVTGCKKC 3370
            R ++ YY          RCKCN +   C+P   G+  CRC +NT G +C+ C   F      +            T+E+ ++                             C+PCNC           E + +T   G C  C ++  G  CE+C + Y+ +     C+ C C P  +LS  CD N+G C C   V    CD+C    +  +   C PC C        CD  +GNC C +NV    C +C  G F L   +  GC  C
Sbjct:  262 RVLQSYYYAVSDFSVGGRCKCNGHASECEPNAAGQLACRCQHNTTGVDCERCLPFFQDRPWARG-----------TAEDANE-----------------------------CLPCNCSGHSEECTFDRELYRSTGHGGHCQRCRDHTTGPHCERCEKNYYRWSPKTPCQPCDCHPAGSLSLQCD-NSGVCPCKPTVTGWKCDRCLPGFHSLSEGGCRPCACNVAGSLGTCDPRSGNCPCKENVEGSLCDRCRPGTFNLQPHNPVGCSSC 489          

HSP 7 Score: 53.9138 bits (128), Expect = 5.594e-6
Identity = 64/267 (23.97%), Postives = 108/267 (40.45%), Query Frame = 2
Query:  929 NIEIGGKCICNNHADKCDKVIENGISVAKCNCKHNTCGSNCETCCPLF--NQRPWKPVAVCEECNCNRKSNECSYNQTVATLQLSVNKMGRMEGGGVCINCQENTEGINCEKCIKGFYRPWNVLATELYPCTPCQCHGLGTIGSCVSNGEDIGDQKPGDCICKKGYEGVNCDLCSIGYERYPNGECLPCPCSIDGSVRTSFYRCKPPCNCKVHVNSDDLCKTCKNGYFNLDSANPEGCEPC-YCFGITNQCSSLSAKNLKISDLKGW 1720
            N+++     C+ H+  C +            C +NT G++CE C   F  +    +PV  C  C+C+              L+ SV++       G C+ C     G +C +C  GFY   +        C  C+CH LG++       E+    K G C C+ G  G  CD C +G+  +    C  C CS  G+  +  +     C C+        C  C++ +F  D     GC+ C  C+ +  + ++     L +  ++GW
Sbjct:  827 NVDLNAVGNCDPHSGHCLR------------CLYNTTGAHCEHCREGFYGSAVATRPVDKCAPCSCD--------------LRGSVSEKTCNPVTGQCV-CLPYVSGRDCSRCSPGFYDLQSGRG-----CQSCKCHPLGSL-------ENKCHPKTGQCPCRPGVTGQACDRCQLGFFGFSIKGCRDCRCSPLGAASSQCHE-NSTCVCRPGFVGYK-CDRCQDNFFLADGDT--GCQECPTCYALVKEEAAKLKARLML--MEGW 1048          
BLAST of Laminin subunit alpha-2 vs. UniProt/SwissProt
Match: sp|P25391|LAMA1_HUMAN (Laminin subunit alpha-1 OS=Homo sapiens OX=9606 GN=LAMA1 PE=1 SV=2)

HSP 1 Score: 754.592 bits (1947), Expect = 0.000e+0
Identity = 448/1182 (37.90%), Postives = 632/1182 (53.47%), Query Frame = 2
Query:  188 LMENAKITSSATCGTGGPEIFCRLVDEIAIQRLINPDSHVLCDVCD--NRNETKRHPIEFAKSDDDNLWWQSPSMAQGLKYQNVNVTIDLKQVYQIVYILLKMGDSPRPGNWILERSLDGEIYMPWIFFAETPYSC---YNLFQRQYPDLKLTTNAKPSSLADDEMFCTTYYSQPKSLNSGEIIISLINGRKSIMNEEYLSIKSVPQTLINFLSARYIRFRFLKHLTLAADLMT--HK--GYLEQSIYNRYYYSLRNIEIGGKCICNNHADKCDKVIENGISVAKCNCKHNTCGSNCETCCPLFNQRPWKPVAV-----CEECNCNRKSNECSYNQTVATLQLSVNKMGRMEGGGVCINCQENTEGINCEKCIKGFYRPWNVLATELYPCTPCQCHGLGTIGS-CVSNG--EDIGDQK-PGDCICKKGYEGVNCDLCSIGYERYPNGECLPCPCSIDGSVRTSFYRCKPPCNCKVHVNSDDLCKTCKNGYFNLDSANPEGCEPCYCFGITNQCSSLSAKNLKISDLKGWKLTTFTGEKIALP----KFTSFQYLTSENSYIDERFNNPTVYYWTAPPPYLGNWITSYGTIFRYVVKIELQ-STLKGSLIDSPDVIIKCGDFRLFHSVSIEDRRLQ--RQVFIYIKPTEWKIGKLTPDKAATKEEFISCLVKVDKLLIKAKYYSNQKSI-ELLNITLSRGEVH-LALDEMPHIEKCNCPPGFNGLSCESCESGYRRVNNVLYQGQCEACACYNHSNTCDSLNGECQNCTHNTAGAHCEDCASGYYGDAKSKNLNSCKKCPCPR--LDYQMTELCSSYSSENYVCHKCLHNTSGVHCDRCIEGYYGNPK-KKISCKRCKCNNNQES-----CDPVTGEC-RCSYNTMGTECQLCKHGFYGDALT-KSCKKCDCDSLGSTSENCDKLTGKCDCRTNFVNRQCDSCTSGLYLKDK--KCIPCNCEIQGRISSEKFCNTTSGQCFCLENVNGDRCEKCVEGYFNYPN--CKKCLCSPHALSADCDLNNGKCKCGSNVINRICDKCENLHY-WNNRTDCVPCNCGR-GSLNPKCDMETGNCKCAQNVARRDCSKCDVGYFGLDVTGCKKCPPC------YNGQVCNNE----------GICVCPPNTIGNLCNKCSEDSWDF--NETIGCKKCNCYINGSYSNICNKI 3550
            L  NA I+++ATCG  GPE+FC+LV+ +  + + NP     C +CD  + N  +RHPI  A  D  N WWQSPS+  G +Y  V +T+DL+QV+Q+ Y+++K  ++PRPGNWILERSLDG  + PW ++A +   C   YN+  R+ P         P+  ADDE+ CT+YYS+   L  GEI  SLINGR S    + LS K     L+ F SARYIR R  +  TL ADLMT  H+    L+  +  RYYYS+++I +GG CIC  HA  C    +      +C C+HNTCG +C  CCP ++Q+PW+P  V     CE CNC+ K+ +C Y+++VA  + S+N  G+  GGGVCINC +NT GINCE CI G+YRP  V   E  PC PC C  +G++ S C+ +    D+ + K PG C CK+GY G  CD C +GY+ YP   C+ C C+  GS   S   C  PC CK +V     C  CK G++NL   NP GC  C+CFG+++ CSSLS    +++ + GW +T     +  +P           ++  N+ + +R      YYW AP  YLGN +T++G   +Y V  ++   T+  +L+   DVIIK     L  S   E   LQ   +    ++            +   +++ ++ L  V  LLI+A Y S + ++  L +++L     + + L     +E C CP G+ G SCESC SGY RV+ +L+ G C+ C C+ H+  C+ ++G C  C HNT G HCE C  G+YG+        C+ C CP        +  C     +  VC  C    SG  C+RC +GYYGNP     SC  C C+ N +      CD VTGEC +C  NT G  C+ C  GFYGDA+T K+C+ C+C   GS S  C   TG CDC+ N   +QCD C  G Y  D    C PCNC + G +S    C T  GQC C+  V G RC++C  G++ Y +  C  C C PH  +  CD   G+C C  +     C++CE+ H+ ++    C  CNC   GS + +CD+ TG+C+C      R C +C +GY          C PC       +G  CN E          G C C  N  G  CN+C E ++    +  +GC  C C      S++C+++
Sbjct:   29 LASNAHISTNATCGEKGPEMFCKLVEHVPGRPVRNPQ----CRICDGNSANPRERHPISHAI-DGTNNWWQSPSIQNGREYHWVTITLDLRQVFQVAYVIIKAANAPRPGNWILERSLDGTTFSPWQYYAVSDSECLSRYNITPRRGP---------PTYRADDEVICTSYYSRLVPLEHGEIHTSLINGRPSA---DDLSPK-----LLEFTSARYIRLRLQRIRTLNADLMTLSHREPKELDPIVTRRYYYSIKDISVGGMCICYGHASSCP--WDETTKKLQCQCEHNTCGESCNRCCPGYHQQPWRPGTVSSGNTCEACNCHNKAKDCYYDESVAKQKKSLNTAGQFRGGGVCINCLQNTMGINCETCIDGYYRPHKVSPYEDEPCRPCNCDPVGSLSSVCIKDDLHSDLHNGKQPGQCPCKEGYTGEKCDRCQLGYKDYPT--CVSCGCNPVGSA--SDEPCTGPCVCKENVEG-KACDRCKPGFYNLKEKNPRGCSECFCFGVSDVCSSLSWPVGQVNSMSGWLVTDLISPR-KIPSQQDALGGRHQVSINNTAVMQRL--APKYYWAAPEAYLGNKLTAFGGFLKYTVSYDIPVETVDSNLMSHADVIIKGNGLTL--STQAEGLSLQPYEEYLNVVRLVPENFQDFHSKRQIDRDQLMTVLANVTHLLIRANYNSAKMALYRLESVSLDIASSNAIDLVVAADVEHCECPQGYTGTSCESCLSGYYRVDGILFGGICQPCECHGHAAECN-VHGVCIACAHNTTGVHCEQCLPGFYGEPSRGTPGDCQPCACPLTIASNNFSPTCHLNDGDEVVCDWCAPGYSGAWCERCADGYYGNPTVPGESCVPCDCSGNVDPSEAGHCDSVTGECLKCLGNTDGAHCERCADGFYGDAVTAKNCRACECHVKGSHSAVCHLETGLCDCKPNVTGQQCDQCLHGYYGLDSGHGCRPCNCSVAGSVSDG--C-TDEGQCHCVPGVAGKRCDRCAHGFYAYQDGSCTPCDC-PHTQNT-CDPETGECVCPPHTQGVKCEECEDGHWGYDAEVGCQACNCSLVGSTHHRCDVVTGHCQCKSKFGGRACDQCSLGYRDF-----PDCVPCDCDLRGTSGDACNLEQGLCGCVEETGACPCKENVFGPQCNECREGTFALRADNPLGCSPCFC---SGLSHLCSEL 1162          

HSP 2 Score: 397.512 bits (1020), Expect = 2.907e-109
Identity = 410/1680 (24.40%), Postives = 683/1680 (40.65%), Query Frame = 2
Query: 2573 KCLHNTSGVHCDRCIEGYYGNPKKKIS--CKRCKCNNNQESCDPVTGEC-RCSYNTMGTECQLCKHGFYGD---ALTKSCKKCDCD-SLGST--SENCDKLTGK---CD-CRTNFVNRQCDSCTSGLY----LKDKKCIPCNCEIQGRISSEKFCNTTSGQCF-CLENVNGDRCEKCVEGYFN----YPNCKKCLCS-PHALSADCDLNNGKCKCGSNVINRICDKCENLHY-WNNRTDCVPCNCG-RGSLNPKCDMETGNCKCAQNVARRDCSKCDVGYFGLDVTGCKKCPPCYNGQVCNNE-GICVCPPNTIGNLCNKCSEDSWDFNETIGCKKCNCYINGSYSNICNKISGICACKTAFFGSKCDRCNEGYYGFPNCQPCSCAENGTKSNE------LTKCDKITGQCQCKQNVIGTKCKVCRKGTFPSDGTYEGGCFSCFCFGVSEKCHAILNHRIVENSIYE----YHIFDEKN--SLESGKDYST--IHLNANYPRRFGWPLTMFRPIYVNVMKLFNSHDLSLFYRSIFMNVSVDCLDN------------KCGREIPEQTEVFMESYNGLFGMRYXXXXXXXXXXXXXXDFNEHSKNGKWVISQYQNDILDKFIILEDSNVINSNLTRDIFMMALLNVTSLKVKL-YTDKVNPPLIK-IKIITYKVMETTQAIGKRVTAVEKCICNALTFGNHCQNPISGYYKEYFNLPNSTKSGSMRTGNRILINLKKCNCNGYSKVCDSVTGDCQNCMGNREGNKCQLCREGFY-KNDKNYDQCEPCQCP-SAHYNFAQNCTRIESSLELKCQ-CRIGYSGKSCENCQQGFYGNP-IKGIPCKSCDCNQQGSQSLNCNEF-GICQCSPGVLGIKCDQCAPNYVVEKKTCQSCYSGCTKDLLVRIDTLNETVINFKWK-TLPSTLDLRLNKINISIQMSSELL--NSINKFYKLK-----NEIKNFSIQFQKMKDDAKEKYGEIEKLKTRYNKV---LEDLRSTFTDINETISGHEQL--------GISNELIKNATAYLET--IKNIYKEMPNITLAASVLKDVLKYVDELNQ-------IIKYTQSHIQSDQINNLKILKNKTIMADE-----------INTNNKEYLNTMSTKKKEHELYIILINERMKDLQKIFRKMTKQRDNLRKKIQKLDAISKSFQDEKDLISINVR-EIEDLMKNLSSNHLV----------SKSLIIPDTLKKHVEQQLNKSSNLIKKLTKDFNFL----HNAEQAKEAYSNITRDILAVDYAINQTKKEL--------DFNRSNMNIDSLKKLLAEFNSNKSEIVENIKNIDKEHEKLLKQYKNCSYXXXXXXXXXXXXSSEIPTGFYDVEILKRNLSXXXXXXXXXXXXFILPINQTILNLGTPNVKSGLDTRNLEKLIKVVDNQYRDL-----VNESSFVENKIKDLRKSIKSLRERLQKARVMSELIHGAAARSVEPIRHVVRCVRHYVTYYLP---TSNAFSLEFYMKPQILNDQSLVLFGYDDSGSIPHAFAFTLERNNQYKFWYDSGNSVESIELTGKFSNENYVGIMITWKLGK-WHMVIRSISDGRTEQVETSSI--TNNILSNVRIGPQTNIFVGGFPSSKLLRSLKLEGRLISDLKENYDNYFYKGCLFGVKLMNTEFGLQDIEAIEEECRN 7216
            +C    +G  C+ C+ GYY          C+ C+C+ +   C+ V G C  C++NT G  C+ C  GFYG+        C+ C C  ++ S   S  C    G    CD C   +    C+ C  G Y    +  + C+PC+C      S    C++ +G+C  CL N +G  CE+C +G++       NC+ C C    + SA C L  G C C  NV  + CD+C + +Y  ++   C PCNC   GS++  C  E G C C   VA + C +C  G++      C  C   +    C+ E G CVCPP+T G  C +C +  W ++  +GC+ CNC + GS  + C+ ++G C CK+ F G  CD+C+ GY  FP+C PC C   GT  +       L  C + TG C CK+NV G +C  CR+GTF        GC  CFC G+S  C  + ++     ++        +  + N      G  Y      L+A   R+         P Y  + + F    L  +   +  +V+   LD             K GR I +Q  ++M++     G+R                  E     +    +Y N + +K +  ED            FM  L ++  + +K  Y   +    I  I +   +  E      +  + +E C+C   T G  CQ+   GY++    LP    +GS R    ++     C+CN +S  CD  TG C NC  N  G+ C +C  G+Y K   +   C  C CP S   +F+  C  +E   + +C  C +GY GK CE C   +YGNP   G  C+ CDCN  GS   +C+   G C C  G  G++CD+C P +++ +  C SC   C   LL  +D + + V++      +P    +  N  N +  +   LL  N      K+K      E  N   +  +M    ++     E++      +   +E L+ + T+I E  + ++ L             + +N T+ LE   I++  +   N TL     +D+L  + E  Q       ++K   SH+ S   N LK  +     A+            +N N +E+ +     ++E  L   LI +     + +      Q D ++  ++ L+      QD+  L S  +R  I+DL+ ++S  + V          ++   + D L   +E   N S N        +N       + E A++A+  +T   L  +  ++  K  +        + N  +  +  +   L+E  +  +   EN   I ++  + L   +                   IP G  D     + L+    +        +  ++Q +LN      +     R   +L++  D+    L     V +     N + D  K +K L E L +     +L+   A +    I+  V   R  +  Y P   ++N  +L   +K Q  ++    L  Y  S +     A  + R  +  F +D G+    +E      ++N    +   + G    + ++ +S  +    +TS    T N+L    +   T +FVGG    ++ +S  ++               +KGCL    L     GL +    E +CR 
Sbjct:  710 ECPQGYTGTSCESCLSGYYRVDGILFGGICQPCECHGHAAECN-VHGVCIACAHNTTGVHCEQCLPGFYGEPSRGTPGDCQPCACPLTIASNNFSPTCHLNDGDEVVCDWCAPGYSGAWCERCADGYYGNPTVPGESCVPCDCSGNVDPSEAGHCDSVTGECLKCLGNTDGAHCERCADGFYGDAVTAKNCRACECHVKGSHSAVCHLETGLCDCKPNVTGQQCDQCLHGYYGLDSGHGCRPCNCSVAGSVSDGCTDE-GQCHCVPGVAGKRCDRCAHGFYAYQDGSCTPCDCPHTQNTCDPETGECVCPPHTQGVKCEECEDGHWGYDAEVGCQACNCSLVGSTHHRCDVVTGHCQCKSKFGGRACDQCSLGYRDFPDCVPCDCDLRGTSGDACNLEQGLCGCVEETGACPCKENVFGPQCNECREGTFALRADNPLGCSPCFCSGLSHLCSELEDYVRTPVTLGSDQPLLRVVSQSNLRGTTEGVYYQAPDFLLDAATVRQH----IRAEPFYWRLPQQFQGDQLMAYGGKLKYSVAFYSLDGVGTSNFEPQVLIKGGR-IRKQV-IYMDAPAPENGVR-----------------QEQEVAMRENFWKYFNSVSEKPVTRED------------FMSVLSDIEYILIKASYGQGLQQSRISDISMEVGRKAEKLHPEEEVASLLENCVCPPGTVGFSCQDCAPGYHRG--KLP----AGSDRGPRPLVAPCVPCSCNNHSDTCDPNTGKCLNCGDNTAGDHCDVCTSGYYGKVTGSASDCALCACPHSPPASFSPTCV-LEGDHDFRCDACLLGYEGKHCERCSSSYYGNPQTPGGSCQKCDCNPHGSVHGDCDRTSGQCVCRLGASGLRCDECEPRHILMETDCVSCDDECVGVLLNDLDEIGDAVLSLNLTGIIPVPYGILSNLENTTKYLQESLLKENMQKDLGKIKLEGVAEETDNLQKKLTRMLASTQKVNRATERIFKESQDLAIAIERLQMSITEIMEKTTLNQTLDEDFLLPNSTLQNMQQNGTSLLEIMQIRDFTQLHQNATLELKAAEDLLSQIQENYQKPLEELEVLKEAASHVLSKHNNELKAAEALVREAEAKMQESNHLLLMVNANLREFSDKKLHVQEEQNLTSELIVQG----RGLIDAAAAQTDAVQDALEHLE----DHQDKLLLWSAKIRHHIDDLVMHMSQRNAVDLVYRAEDHAAEFQRLADVLYSGLENIRNVSLNATSAAYVHYNIQSLIEESEELARDAHRTVTETSLLSESLVSNGKAAVQRSSRFLKEGNNLSRKLPGIALELSELRNKTNRFQENAVEITRQTNESLLILR------------------AIPKGIRDKGAKTKELATSASQSAVSTLRDVAGLSQELLNTSASLSRVNTTLRETHQLLQ--DSTMATLLAGRKVKDVEIQANLLFDRLKPLKMLEENLSRNLSEIKLLISQARKQAASIKVAVSADRDCIRAYQPQISSTNYNTLTLNVKTQEPDN----LLFYLGSSTASDFLAVEMRR-GRVAFLWDLGSGSTRLEFPDFPIDDNRWHSIHVARFGNIGSLSVKEMSSNQKSPTKTSKSPGTANVLD---VNNSTLMFVGGL-GGQIKKSPAVK------------VTHFKGCLGEAFLNGKSIGLWNYIEREGKCRG 2296          

HSP 3 Score: 229.565 bits (584), Expect = 2.257e-58
Identity = 192/690 (27.83%), Postives = 286/690 (41.45%), Query Frame = 2
Query:  914 YYSLRNIEIGGKCICNNHADKCDKVIENGISVAKCNCKHNTCGSNCETCCPLFNQRPWKPVAVCEECNCNRKSNECSYNQTVATLQLSVNKMGRMEGGGVCINCQENTEGINCEKCIKGFYRPWNVLATELYPCTPCQCHGLGTIGSCVSNGEDIGDQKPGDCICKKGYEGVNCDLCSIGYERYPNGECLPCPCSIDGS------VRTSFYRC---KPPCNCKVHVNSDDLCKTCKNGYFNLDSANPEGCEPCYCFGITNQCSSLSAKNLKISDLKGWKLTTFT-GEKIALPKFTSFQYL--TSENSYI---DERFNNPTV--------YYWTAPPPYLGNWITSYGTIFRYVVKIELQSTLKGSLIDSPDVIIKCGDFR---LFHSVSIEDRRLQRQVFIYIKPTEWKIGKLTPDKAATKEEFISCLVKVDKLLIKAKYYSNQKSIELLNITLSRG----EVHLALDEMPHIEKCNCPPGFNGLSCESCESGYRRVNNVLYQGQ----------CEACACYNHSNTCDSLNGECQNCTHNTAGAHCEDCASGYYGDAKSKNLNSCKKCPCPR-LDYQMTELCSSYSSENYVCHKCLHNTSGVHCDRCIEGYYGNPKKK-ISCKRCKCNNN---QESCDPVTGECRCSYNTMGTECQLCKHGFYGDALTKSCKKCDCDSLGSTSENCDKL 2848
            YY L +      C C+      D   + G    +C+C     G  C+ C   F          C  C+C    N C                      G C+ C  +T+G+ CE+C  G    W   A     C  C C       S V +     D   G C CK  + G  CD CS+GY  +P  +C+PC C + G+      +      C      C CK +V     C  C+ G F L + NP GC PC+C G+++ CS          +L+ +  T  T G    L +  S   L  T+E  Y    D   +  TV        +YW  P  + G+ + +YG   +Y V       +  S  + P V+IK G  R   ++      +  ++++  + ++   WK      +K  T+E+F+S L  ++ +LIKA Y    +   + +I++  G    ++H   +    +E C CPPG  G SC+ C  GY R    L  G           C  C+C NHS+TCD   G+C NC  NTAG HC+ C SGYYG   + + + C  C CP       +  C      ++ C  CL    G HC+RC   YYGNP+    SC++C CN +      CD  +G+C C     G  C  C+       +   C  CD + +G    + D++
Sbjct:  939 YYGLDSGHGCRPCNCSVAGSVSDGCTDEG----QCHCVPGVAGKRCDRCAHGFYAYQ---DGSCTPCDCPHTQNTCDPET------------------GECV-CPPHTQGVKCEECEDGH---WGYDAE--VGCQACNC-------SLVGSTHHRCDVVTGHCQCKSKFGGRACDQCSLGYRDFP--DCVPCDCDLRGTSGDACNLEQGLCGCVEETGACPCKENVFGPQ-CNECREGTFALRADNPLGCSPCFCSGLSHLCS----------ELEDYVRTPVTLGSDQPLLRVVSQSNLRGTTEGVYYQAPDFLLDAATVRQHIRAEPFYWRLPQQFQGDQLMAYGGKLKYSVAFYSLDGVGTSNFE-PQVLIKGGRIRKQVIYMDAPAPENGVRQEQEVAMRENFWKYFNSVSEKPVTREDFMSVLSDIEYILIKASYGQGLQQSRISDISMEVGRKAEKLHPEEEVASLLENCVCPPGTVGFSCQDCAPGYHR--GKLPAGSDRGPRPLVAPCVPCSCNNHSDTCDPNTGKCLNCGDNTAGDHCDVCTSGYYGKV-TGSASDCALCACPHSPPASFSPTCVLEGDHDFRCDACLLGYEGKHCERCSSSYYGNPQTPGGSCQKCDCNPHGSVHGDCDRTSGQCVCRLGASGLRCDECEPRHI--LMETDCVSCDDECVGVLLNDLDEI 1571          

HSP 4 Score: 168.318 bits (425), Expect = 8.769e-40
Identity = 191/712 (26.83%), Postives = 285/712 (40.03%), Query Frame = 2
Query: 3086 CLCSPHALSADCDLNNGK--CKCGSNVINRICDKC---ENLHYWNNRT-----DCVPCNCGRGSLNPKCDMETGNCKCAQNVARRDCSKCDVGYFGLDVTGCKKCPPCYNGQVCNNEGICVCPPNTIGNLCNKCSEDSWDFN-----ETIGCKKCNCYINGSYSNIC-----------NKISGICACKTAFFGSKCDRCNEGYYGFPNCQPCSCAENGTKSNELTKCDKITGQCQCKQNVIGTKCKVCRKGTFPSDGTYEGGCFSCFCFGVSEKCHAI---------LNHRIVENSIYEYHIFDEKNSLESGKDYSTIHLNANYPRRFGWPLTMFRPIYVNVMKLFNSHDLSLFYRSIFMNVSVDCLDNKCGREIPEQTEVFMESYNGLFGMRYXXXXXXXXXXXXXXDFNEHSKNGKWVISQYQNDILDKFIILEDSNVINSNLTRDIFMMALLNVTSLKVKLYTDKVNPPLIKIKIITYKVMETTQAIGKRVTA-VEKCICNALTFGNHCQNPISGYYKEYFNLPNSTKSGSMRTGNRILIN--LKKCNCNGYSKVCDSVTGDCQNCMGNREGNKCQLCREGFY--KNDKNYDQCEPCQCPS--AHYNFAQNCTRIESSLELKCQ-CRIGYSGKSCENCQQGFYGNP-IKGIPCKSCDC--NQQGSQSLNCNEF-GIC-QCSPGVLGIKCDQCAPNY---VVEKKTCQSC 5068
            C+C  HA S   D    K  C+C  N     C++C    +   W   T      C  CNC           +  +C   ++VA++  S    G F               G VC N     C  NT+G  C  C +  +  +     E   C+ CNC   GS S++C            K  G C CK  + G KCDRC  GY  +P C  C C   G+ S+E       TG C CK+NV G  C  C+ G +        GC  CFCFGVS+ C ++         ++  +V + I    I  ++++L  G+   +I+  A   R       +    Y    + +  + L+ F   +   VS D         +    +V ++  NGL         S       +  + E+    + V   +Q D   K             + RD  M  L NVT L ++   +     L +++ ++  +  ++ AI   V A VE C C     G  C++ +SGYY+                 + IL     + C C+G++  C+ V G C  C  N  G  C+ C  GFY   +      C+PC CP   A  NF+  C  +    E+ C  C  GYSG  CE C  G+YGNP + G  C  CDC  N   S++ +C+   G C +C     G  C++CA  +    V  K C++C
Sbjct:  270 CICYGHASSCPWDETTKKLQCQCEHNTCGESCNRCCPGYHQQPWRPGTVSSGNTCEACNCHN---------KAKDCYYDESVAKQKKSLNTAGQF-------------RGGGVCIN-----CLQNTMGINCETCIDGYYRPHKVSPYEDEPCRPCNCDPVGSLSSVCIKDDLHSDLHNGKQPGQCPCKEGYTGEKCDRCQLGYKDYPTCVSCGCNPVGSASDE-----PCTGPCVCKENVEGKACDRCKPGFYNLKEKNPRGCSECFCFGVSDVCSSLSWPVGQVNSMSGWLVTDLISPRKIPSQQDAL-GGRHQVSINNTAVMQR-------LAPKYYWAAPEAYLGNKLTAFGGFLKYTVSYDIPVETVDSNLMSHADVIIKG-NGL-------TLSTQAEGLSLQPYEEYLNVVRLVPENFQ-DFHSK-----------RQIDRDQLMTVLANVTHLLIRANYNSAKMALYRLESVSLDIA-SSNAIDLVVAADVEHCECPQGYTGTSCESCLSGYYRV----------------DGILFGGICQPCECHGHAAECN-VHGVCIACAHNTTGVHCEQCLPGFYGEPSRGTPGDCQPCACPLTIASNNFSPTC-HLNDGDEVVCDWCAPGYSGAWCERCADGYYGNPTVPGESCVPCDCSGNVDPSEAGHCDSVTGECLKCLGNTDGAHCERCADGFYGDAVTAKNCRAC 902          
BLAST of Laminin subunit alpha-2 vs. UniProt/SwissProt
Match: sp|P19137|LAMA1_MOUSE (Laminin subunit alpha-1 OS=Mus musculus OX=10090 GN=Lama1 PE=1 SV=2)

HSP 1 Score: 747.273 bits (1928), Expect = 0.000e+0
Identity = 441/1186 (37.18%), Postives = 640/1186 (53.96%), Query Frame = 2
Query:  188 LMENAKITSSATCGTGGPEIFCRLVDEIAIQRLINPDSHVLCDVCD--NRNETKRHPIEFAKSDDDNLWWQSPSMAQGLKYQNVNVTIDLKQVYQIVYILLKMGDSPRPGNWILERSLDGEIYMPWIFFAETPYSC---YNLFQRQYPDLKLTTNAKPSSLADDEMFCTTYYSQPKSLNSGEIIISLINGRKSIMNEEYLSIKSVPQTLINFLSARYIRFRFLKHLTLAADLMT--HKGY--LEQSIYNRYYYSLRNIEIGGKCICNNHADKCDKVIENGISVAKCNCKHNTCGSNCETCCPLFNQRPWKPVAV-----CEECNCNRKSNECSYNQTVATLQLSVNKMGRMEGGGVCINCQENTEGINCEKCIKGFYRPWNVLATELYPCTPCQCHGLGTIGS-CVSNGE--DIGDQK-PGDCICKKGYEGVNCDLCSIGYERYPNGECLPCPCSIDGSVRTSFYRCKPPCNCKVHVNSDDLCKTCKNGYFNLDSANPEGCEPCYCFGITNQCSSLSAKNLKISDLKGWKLTTF-TGEKIALPK--FTSFQYLTSENSYIDERFNNPTVYYWTAPPPYLGNWITSYGTIFRYVVKIELQ-STLKGSLIDSPDVIIKCGDFRLFHSVSIEDRRLQ--RQVFIYIKPTEWKIGKLTPDKAATKEEFISCLVKVDKLLIKAKYYSNQKSI-ELLNITL---SRGEVHLALDEMPHIEKCNCPPGFNGLSCESCESGYRRVNNVLYQGQCEACACYNHSNTCDSLNGECQNCTHNTAGAHCEDCASGYYGDAKSKNLNSCKKCPCP-RLDY-QMTELCSSYSSENYVCHKCLHNTSGVHCDRCIEGYYGNPK-KKISCKRCKCNNNQES-----CDPVTGEC-RCSYNTMGTECQLCKHGFYGDALT-KSCKKCDCDSLGSTSENCDKLTGKCDCRTNFVNRQCDSCTSGLYLKDK--KCIPCNCEIQGRISSEKFCNTTSGQCFCLENVNGDRCEKCVEGYFNYPN--CKKCLCSPHALSADCDLNNGKCKCGSNVINRICDKCENLHYW--NNRTDCVPCNCGR-GSLNPKCDMETGNCKCAQNVARRDCSKCDVGYFGLDVTGCKKCPPC---YNGQV---CNNE----------GICVCPPNTIGNLCNKCSEDSWDF--NETIGCKKCNCYINGSYSNICNKISG 3556
            L  NA I+++ATCG  GPE+FC+LV+ +  +    P  H  C VCD  + N  +RHPI  A  D  N WWQSPS+  G +Y  V VT+DL+QV+Q+ YI++K  ++PRPGNWILERS+DG  + PW ++A +   C   Y +  R+ P         P+  AD+E+ CT+YYS+   L  GEI  SLINGR S  +         PQ L+ F SARYIR R  +  TL ADLMT  H+    L+  +  RYYYS+++I +GG CIC  HA  C    +      +C C+HNTCG +C+ CCP ++Q+PW+P  +     CEECNC+ K+ +C Y+ +VA  + S+N  G+  GGGVC+NC +NT GINCE CI  +YRP  V   + +PC PC C  +G++ S C+ +    D+ + K PG C C+KGY G  CD C  GY  +PN  C+PC C   GS+      C  PC CK +V   + C  CK G++NL   NPEGC  C+CFG++  C SL+    +++++ GW +T   +  KI   +      + ++  N+ + +R    + YYW AP  YLGN +T++G   +Y V  ++   T+   L+   D+IIK     +  S   E   LQ   + F  ++            +   +++ ++ L  V  LLI+A Y S + ++  L +++L   S   + LA+     +E C CP G+ G SCE+C  GY RV+ +L+ G C+ C C+ H++ CD ++G C  CTHNT G HCE C  G+YG         C+ C CP  +D    +  C     E  VC +C    SG  C+RC +GYYGNP     +C  C C+ N +      CD VTGEC +C +NT G  C+ C  GFYGDA+T K+C+ CDC   GS S  C   TG CDC+ +   +QCD C SG Y  D    C+PCNC ++G +S    C T  GQC C   V+G +C++C  G++ + +  C  C C+      +CD  +G+C C  +     C++CE   YW  +    C  CNC   GS + +CD+ +G+C C +    + C +C +GY          C PC     G +   C+ E          G C C  N +G  C+KC   ++    +   GC  C C+     S +C+++ G
Sbjct:   36 LATNAHISANATCGEKGPEMFCKLVEHVPGR----PVRHAQCRVCDGNSTNPRERHPISHAI-DGTNNWWQSPSIQNGREYHWVTVTLDLRQVFQVAYIIIKAANAPRPGNWILERSVDGVKFKPWQYYAVSDTECLTRYKITPRRGP---------PTYRADNEVICTSYYSKLVPLEHGEIHTSLINGRPSADDPS-------PQ-LLEFTSARYIRLRLQRIRTLNADLMTLSHRDLRDLDPIVTRRYYYSIKDISVGGMCICYGHASSCP--WDEEAKQLQCQCEHNTCGESCDRCCPGYHQQPWRPGTISSGNECEECNCHNKAKDCYYDSSVAKERRSLNTAGQYSGGGVCVNCSQNTTGINCETCIDQYYRPHKVSPYDDHPCRPCNCDPVGSLSSVCIKDDRHADLANGKWPGQCPCRKGYAGDKCDRCQFGYRGFPN--CIPCDCRTVGSLNED--PCIEPCLCKKNVEGKN-CDRCKPGFYNLKERNPEGCSECFCFGVSGVCDSLTWSISQVTNMSGWLVTDLMSTNKIRSQQDVLGGHRQISINNTAVMQRLT--STYYWAAPEAYLGNKLTAFGGFLKYTVSYDIPVETVDSDLMSHADIIIKGNGLTI--STRAEGLSLQPYEEYFNVVRLVPENFRDFDTRREIDRDQLMTVLANVTHLLIRANYNSAKMALYRLDSVSLDIASPNAIDLAV--AADVEHCECPQGYTGTSCEACLPGYYRVDGILFGGICQPCECHGHASECD-IHGICSVCTHNTTGDHCEQCLPGFYGTPSRGTPGDCQPCACPLSIDSNNFSPTCHLTDGEEVVCDQCAPGYSGSWCERCADGYYGNPTVPGGTCVPCNCSGNVDPLEAGHCDSVTGECLKCLWNTDGAHCERCADGFYGDAVTAKNCRACDCHENGSLSGICHLETGLCDCKPHVTGQQCDQCLSGYYGLDTGLGCVPCNCSVEGSVSDN--C-TEEGQCHCGPGVSGKQCDRCSHGFYAFQDGGCTPCDCA--HTQNNCDPASGECLCPPHTQGLKCEECEEA-YWGLDPEQGCQACNCSAVGSTSAQCDVLSGHCPCKKGFGGQSCHQCSLGYRSF-----PDCVPCGCDLRGTLPDTCDLEQGLCSCSEDGGTCSCKENAVGPQCSKCQAGTFALRGDNPQGCSPCFCF---GLSQLCSELEG 1171          

HSP 2 Score: 406.757 bits (1044), Expect = 4.121e-112
Identity = 416/1709 (24.34%), Postives = 689/1709 (40.32%), Query Frame = 2
Query: 2573 KCLHNTSGVHCDRCIEGYYGNPKKKIS--CKRCKCNNNQESCDPVTGECR-CSYNTMGTECQLCKHGFYGD---ALTKSCKKCDCD-SLGST--SENCDKLTGK---CD-CRTNFVNRQCDSCTSGLY----LKDKKCIPCNCEIQGRISSEKFCNTTSGQCF-CLENVNGDRCEKCVEGYFN----YPNCKKCLCSPH-ALSADCDLNNGKCKCGSNVINRICDKCENLHY-WNNRTDCVPCNCG-RGSLNPKCDMETGNCKCAQNVARRDCSKCDVGYFGLDVTGCKKCPPCYNGQVCN-NEGICVCPPNTIGNLCNKCSEDSWDFNETIGCKKCNCYINGSYSNICNKISGICACKTAFFGSKCDRCNEGYYGFPNCQPCSCAENGTKSNE------LTKCDKITGQCQCKQNVIGTKCKVCRKGTFPSDGTYEGGCFSCFCFGVSEKCHAILNHRIVENSIYE----YHIFDEKN--SLESGKDYST--IHLNANYPRRFGWPLTMFRPIYVNVMKLFNSHDL-----SLFYRSIFMNVSVDCLDN-------KCGREIPEQTEVFMESYNGLFGMRYXXXXXXXXXXXXXXDFNEHSKNGKWVISQYQNDILDKFIILEDSNVINSNLTRDIFMMALLNVTSLKVKL-YTDKVNPPLIK-IKIITYKVMETTQAIGKRVTAVEKCICNALTFGNHCQNPISGYYKEYFNLPNSTKSGSMRTGNRILINLKKCNCNGYSKVCDSVTGDCQNCMGNREGNKCQLCREGFYKNDKNY-DQCEPCQCP-SAHYNFAQNCTRIESSLELKC-QCRIGYSGKSCENCQQGFYGNP-IKGIPCKSCDCNQQGSQSLNCNEF-GICQCSPGVLGIKCDQCAPNYVVEKKTCQSCYSGCTKDLLVRIDTLNETVINFKWKTL-PSTLDLRLNKINISIQMSSELLNSINKFYKLKNEIKNFSIQFQKMKDDAKEKYGEIEKLKTRYNKV----------LEDLRSTFTDINETISGHEQ---------LGISNELIKNATAYLETIK--NIYKEMPNITLAASVLKDVLKYVDELNQIIKYTQSHIQSDQINNLKILKNKTIMA---DEINTNNKEYLNTMSTKKKEHELYIILINERMKDLQKIFRKMTKQRDNLRKKIQK----LDAI---SKSFQD-------EKDLISINVREIEDLMKNLSSNHLVSKSLIIPDTLKKHVEQQLNKSSNLIKKLTKDFNFLHNAEQAKEAYSNIT-----RDILAVDYAINQTKKELD----FNRSNMNIDSLKKLLAEFNSNKSEIVENIKNIDKEHEKLLKQYKNCSYXXXXXXXXXXXXSSEIPTGFYDVEILKRNLSXXXXXXXXXXXXFILPINQTILNLGTPNVKSGLDTRNLEKLIKVVDNQYRDLVNESSFVENKIKDLRKSIKSLRERLQKARVMSE----------LIHGAAARSVEPIRHVVRCVRHYVTYYLPTSNAFSLEFYMKPQILNDQSLVLFGYDDSGSIPHAFAFTLERNNQYKFWYDSGNSVESIELTG-KFSNENYVGIMITWKLGKWHMVIRSISDGRTEQVETSSITNNILSNVRIGPQTNIFVGGF-------PSSKLLRSLKLEGRLISDLKE-NYDNYFYK-----GCLFGVKLMNTEFGL--QDIEAIEEECRNTISIDNLLLGKFNCKFNPNSSIIFLDSN 7300
            +C    +G  C+ C+ GYY          C+ C+C+ +   CD + G C  C++NT G  C+ C  GFYG         C+ C C  S+ S   S  C    G+   CD C   +    C+ C  G Y    +    C+PCNC           C++ +G+C  CL N +G  CE+C +G++       NC+ C C  + +LS  C L  G C C  +V  + CD+C + +Y  +    CVPCNC   GS++  C  E G C C   V+ + C +C  G++     GC  C   +    C+   G C+CPP+T G  C +C E  W  +   GC+ CNC   GS S  C+ +SG C CK  F G  C +C+ GY  FP+C PC C   GT  +       L  C +  G C CK+N +G +C  C+ GTF   G    GC  CFCFG+S+ C  +  +     ++       H+  + N      G  +      L+A   R+  +      P Y  + K F    L      L Y   F +       N       K GR    +  ++M++     G+R               D+    K   W   +Y N + +K +   D            FM  L N+  + +K  Y   +    I  I +   +      A G+    +E C+C   T G+ CQ+   GYY+E   LP S   G       +L     CNCN +S VCD  TG C +C  +  G+ C+LC  G+Y         C PC CP    ++F+  C  +E   + +C  C  GY G+ CE C  G++GNP   G  C++CDCN QGS   +C+   G C C PG  G+ C++C P +++ +  C SC   C   LL  +D++ + V++     + P+   +  N  N +      L+    K  + + +++  + Q + ++ +        +K+     +           +E L +   +I E ++   Q         +     + +N ++ L  IK  N  +   N TL     KD+L  +          Q   Q  Q   LK LK    +     E     +E L    +K +E  L ++L+   +K+ Q+   ++ ++++   + I K    +DA    + + QD        +D + +  R+I   + +L       ++  +    ++H  +  +++  L + L    N   NA  A   +SNI       ++LA D      K +L      +R    +    + L E  S + +       +D E + L  Q++    N  K  N +  +  E P G  +     R L+    E        +L ++  + N       +  D   +   ++  ++   +    +     K+KD+      L +RL+  + + E          L+   A + V  I+  V   R  +  Y P +++ +    +      +   +LF Y  S S     A  + R  +  F +D G+    +E      +N  +  I IT       + ++  S      V TS  +      + I   T +FVGG        P+ K+       G    + K     NY  +     GC    +  ++ F         +E+  R T++   +L       F+PN  + +L SN
Sbjct:  717 ECPQGYTGTSCEACLPGYYRVDGILFGGICQPCECHGHASECD-IHGICSVCTHNTTGDHCEQCLPGFYGTPSRGTPGDCQPCACPLSIDSNNFSPTCHLTDGEEVVCDQCAPGYSGSWCERCADGYYGNPTVPGGTCVPCNCSGNVDPLEAGHCDSVTGECLKCLWNTDGAHCERCADGFYGDAVTAKNCRACDCHENGSLSGICHLETGLCDCKPHVTGQQCDQCLSGYYGLDTGLGCVPCNCSVEGSVSDNC-TEEGQCHCGPGVSGKQCDRCSHGFYAFQDGGCTPCDCAHTQNNCDPASGECLCPPHTQGLKCEECEEAYWGLDPEQGCQACNCSAVGSTSAQCDVLSGHCPCKKGFGGQSCHQCSLGYRSFPDCVPCGCDLRGTLPDTCDLEQGLCSCSEDGGTCSCKENAVGPQCSKCQAGTFALRGDNPQGCSPCFCFGLSQLCSELEGYVRTLITLASDQPLLHVVSQSNLKGTIEGVHFQPPDTLLDAEAVRQHIYA----EPFYWRLPKQFQGDQLLAYGGKLQYSVAFYSTLGTGTSNYEPQVLIKGGRA--RKHVIYMDAPAPENGVR--------------QDYEVRMKEEFW---KYFNSVSEKHVTHSD------------FMSVLSNIDYILIKASYGQGLQQSRIANISMEVGRKAVELPAEGEAALLLELCVCPPGTAGHSCQDCAPGYYRE--KLPESGGRGP----RPLLAPCVPCNCNNHSDVCDPETGKCLSCRDHTSGDHCELCASGYYGKVTGLPGDCTPCTCPHHPPFSFSPTCV-VEGDSDFRCNACLPGYEGQYCERCSAGYHGNPRAAGGSCQTCDCNPQGSVHSDCDRASGQCVCKPGATGLHCEKCLPRHILMESDCVSCDDDCVGPLLNDLDSVGDAVLSLNLTGVSPAPYGILENLENTTKYFQRYLIKENAKKIRAEIQLEGIAEQTENLQKELTRVLARHQKVNAEMERTSNGTQALATFIEQLHANIKEITEKVATLNQTARKDFQPPVSALQSMHQNISSLLGLIKERNFTEMQQNATLELKAAKDLLSRI----------QKRFQKPQ-EKLKALKEANSLLSNHSEKLQAAEELLKEAGSKTQESNLLLLLVKANLKEFQEKKLRVQEEQNVTSELIAKGREWVDAAGTHTAAAQDTLTQLEHHRDELLLWARKIRSHVDDLVMQMSKRRARDLVHRAEQHASELQSRAGALDRDLENVRNVSLNATSAAHVHSNIQTLTEEAEMLAADAHKTANKTDLISESLASRGKAVLQRSSRFLKESVSTRRKQQGITMKLD-ELKNLTSQFQESMDNIMKQANDSLAMLRESPGGMREKGRKARELAAAANESAVKTLEDVLALSLRVFN-------TSEDLSRVNATVQETNDLLHNSTMTTLLAGRKMKDMEMQANLLLDRLKPLKTLEENLSRNLSEIKLLISRARKQVASIKVAVSADRDCIRAYQPQTSSTNYNTLILNVKTQEPDNLLF-YLGSSSSSDFLAVEMRR-GKVAFLWDLGSGSTRLEFPEVSINNNRWHSIYITRFGNMGSLSVKEASAAENPPVRTSK-SPGPSKVLDINNSTLMFVGGLGGQIKKSPAVKVTHFKGCMGEAFLNGKSIGLWNYIEREGKCNGCFGSSQNEDSSFHFDGSGYAMVEKTLRPTVTQIVILFS----TFSPNGLLFYLASN 2355          

HSP 3 Score: 235.728 bits (600), Expect = 3.064e-60
Identity = 185/670 (27.61%), Postives = 276/670 (41.19%), Query Frame = 2
Query:  950 CICNNHADKCDKVIENGISVAKCNCKHNTCGSNCETCCPLFNQRPWKPVAVCEECNCNRKSNECSYNQTVATLQLSVNKMGRMEGGGVCINCQENTEGINCEKCIKGFYRPWNVLATELYPCTPCQCHGLG-TIGSCVSNGEDIGDQKPGDCICKKGYEGVNCDLCSIGYERYPNGECLPCPCSIDGSV------RTSFYRCKP---PCNCKVHVNSDDLCKTCKNGYFNLDSANPEGCEPCYCFGITNQCSSLSAKNLKISDLKGWKLTTFTGEKIALPKFTSFQYLTSENSYIDERFNNPTVY----YWTAPPPYLGNWITSYGTIFRYVVKIELQSTL-KGSLIDSPDVIIKCGDFR---LFHSVSIEDRRLQRQVFIYIKPTEWKIGKLTPDKAATKEEFISCLVKVDKLLIKAKYYSNQKSIELLNITLSRGEVHLAL----DEMPHIEKCNCPPGFNGLSCESCESGYRRVNNVLYQGQ--------CEACACYNHSNTCDSLNGECQNCTHNTAGAHCEDCASGYYGDAKSKNLNSCKKCPCP-RLDYQMTELCSSYSSENYVCHKCLHNTSGVHCDRCIEGYYGNPKKK-ISCKRCKCNNN---QESCDPVTGECRCSYNTMGTECQLC--KHGFYGDALTKSCKKCDCDSLGSTSENCDKL 2848
            C C+      D   E G    +C+C     G  C+ C   F          C  C+C    N C                      G C+ C  +T+G+ CE+C + +   W +   +   C  C C  +G T   C        D   G C CKKG+ G +C  CS+GY  +P  +C+PC C + G++            C      C+CK +      C  C+ G F L   NP+GC PC+CFG++  CS L      +  L   +       +  L       +    ++ +D       +Y    YW  P  + G+ + +YG   +Y V     STL  G+    P V+IK G  R   ++      +  +++   + +K   WK      +K  T  +F+S L  +D +LIKA Y    +   + NI++  G   + L    +    +E C CPPG  G SC+ C  GY R       G+        C  C C NHS+ CD   G+C +C  +T+G HCE CASGYYG         C  C CP    +  +  C      ++ C+ CL    G +C+RC  GY+GNP+    SC+ C CN        CD  +G+C C     G  C+ C  +H      +   C  CD D +G    + D +
Sbjct:  958 CNCSVEGSVSDNCTEEG----QCHCGPGVSGKQCDRCSHGFYAFQ---DGGCTPCDCAHTQNNCD------------------PASGECL-CPPHTQGLKCEECEEAY---WGLDPEQ--GCQACNCSAVGSTSAQC--------DVLSGHCPCKKGFGGQSCHQCSLGYRSFP--DCVPCGCDLRGTLPDTCDLEQGLCSCSEDGGTCSCKENAVGPQ-CSKCQAGTFALRGDNPQGCSPCFCFGLSQLCSELEGYVRTLITLASDQPLLHVVSQSNLKGTIEGVHFQPPDTLLDAEAVRQHIYAEPFYWRLPKQFQGDQLLAYGGKLQYSVA--FYSTLGTGTSNYEPQVLIKGGRARKHVIYMDAPAPENGVRQDYEVRMKEEFWKYFNSVSEKHVTHSDFMSVLSNIDYILIKASYGQGLQQSRIANISMEVGRKAVELPAEGEAALLLELCVCPPGTAGHSCQDCAPGYYREKLPESGGRGPRPLLAPCVPCNCNNHSDVCDPETGKCLSCRDHTSGDHCELCASGYYGKVTGLP-GDCTPCTCPHHPPFSFSPTCVVEGDSDFRCNACLPGYEGQYCERCSAGYHGNPRAAGGSCQTCDCNPQGSVHSDCDRASGQCVCKPGATGLHCEKCLPRHIL----MESDCVSCDDDCVGPLLNDLDSV 1578          

HSP 4 Score: 152.91 bits (385), Expect = 4.761e-35
Identity = 185/749 (24.70%), Postives = 282/749 (37.65%), Query Frame = 2
Query: 3086 CLCSPHALSA--DCDLNNGKCKCGSNVINRICDKC---ENLHYWNNRT-----DCVPCNCGRGSLNPKCDMETGNCKCAQNVARRDCSKCDVGYFGLDVTGCKKCPPCYNGQVCNNEGICVCPPNTIGNLCNKCSEDSWDFNETIG-----CKKCNCYINGSYSNIC-----------NKISGICACKTAFFGSKCDRCNEGYYGFPNCQPCSCAENGTKSNELTKCDKITGQCQCKQNVIGTKCKVCRKGTFPSDGTYEGGCFSCFCFGVSEKCHAI---------LNHRIVENSIYEYHIFDEKNSLESGKDYSTIHLNANYPRRFGWPLTMFRPIYVNVMKLFNSHDLSLFYRSIFMNVSVDCLDNKCGREIPEQTEVFMESYNGLFGMRYXXXXXXXXXXXXXXDFNEHSKNGKWVISQYQNDILDKFIILEDSNVINSNLTRDIFMMALLNVTSLKVKLYTDKVNPPLIKIKIITYKVMETTQAIGKRVTA-VEKCICNALTFGNHCQNPISGYYKEYFNLPNSTKSGSMRTGNRILIN--LKKCNCNGYSKVCDSVTGDCQNCMGNREGNKCQLCREGFYKNDK--NYDQCEPCQCPSA--HYNFAQNCTRIESSLELKC-QCRIGYSGKSCENCQQGFYGNP-IKG---IPC--------------------------------------------------KSCDCNQQGSQSLNCN-EFGICQCSPGVLGIKCDQCAPNY 5038
            C+C  HA S   D +    +C+C  N     CD+C    +   W   T     +C  CNC           +  +C    +VA+   S    G +               G VC N     C  NT G  C  C +  +  ++        C+ CNC   GS S++C            K  G C C+  + G KCDRC  GY GFPNC PC C   G+ +      D     C CK+NV G  C  C+ G +        GC  CFCFGVS  C ++         ++  +V + +    I  +++ L  G    +I+  A   R       +    Y    + +  + L+ F   +   VS D        ++    ++ ++  NGL         S       +  + E+    + V   +++    + I  +    + +N+T    ++   N  S K+ LY         ++  ++  +  +  AI   V A VE C C     G  C+  + GYY+                 + IL     + C C+G++  CD + G C  C  N  G+ C+ C  GFY          C+PC CP +    NF+  C  +    E+ C QC  GYSG  CE C  G+YGNP + G   +PC                                                  ++CDC++ GS S  C+ E G+C C P V G +CDQC   Y
Sbjct:  277 CICYGHASSCPWDEEAKQLQCQCEHNTCGESCDRCCPGYHQQPWRPGTISSGNECEECNCHN---------KAKDCYYDSSVAKERRSLNTAGQYS-------------GGGVCVN-----CSQNTTGINCETCIDQYYRPHKVSPYDDHPCRPCNCDPVGSLSSVCIKDDRHADLANGKWPGQCPCRKGYAGDKCDRCQFGYRGFPNCIPCDCRTVGSLNE-----DPCIEPCLCKKNVEGKNCDRCKPGFYNLKERNPEGCSECFCFGVSGVCDSLTWSISQVTNMSGWLVTDLMSTNKIRSQQDVL-GGHRQISINNTAVMQR-------LTSTYYWAAPEAYLGNKLTAFGGFLKYTVSYDIPVETVDSDLMSHADIIIKG-NGL-------TISTRAEGLSLQPYEEYFNVVRLVPENFRDFDTRREIDRDQLMTVLANVTH---LLIRANYNSAKMALY---------RLDSVSLDIA-SPNAIDLAVAADVEHCECPQGYTGTSCEACLPGYYRV----------------DGILFGGICQPCECHGHASECD-IHGICSVCTHNTTGDHCEQCLPGFYGTPSRGTPGDCQPCACPLSIDSNNFSPTC-HLTDGEEVVCDQCAPGYSGSWCERCADGYYGNPTVPGGTCVPCNCSGNVDPLEAGHCDSVTGECLKCLWNTDGAHCERCADGFYGDAVTAKNCRACDCHENGSLSGICHLETGLCDCKPHVTGQQCDQCLSGY 946          
BLAST of Laminin subunit alpha-2 vs. UniProt/SwissProt
Match: sp|Q60675|LAMA2_MOUSE (Laminin subunit alpha-2 OS=Mus musculus OX=10090 GN=Lama2 PE=1 SV=2)

HSP 1 Score: 725.317 bits (1871), Expect = 0.000e+0
Identity = 443/1172 (37.80%), Postives = 628/1172 (53.58%), Query Frame = 2
Query:  188 LMENAKITSSATCGTGGPEIFCRLVDEIAIQRLINPDSHVLCDVCD--NRNETKRHPIEFAKSDDDNLWWQSPSMAQGLKYQNVNVTIDLKQVYQIVYILLKMGDSPRPGNWILERSLDGEIYMPWIFFAETPYSC---YNLFQRQYPDLKLTTNAKPSSLADDEMFCTTYYSQPKSLNSGEIIISLINGRKSIMNEEYLSIKSVPQTLINFLSARYIRFRFLKHLTLAADLM--THKG--YLEQSIYNRYYYSLRNIEIGGKCICNNHADKCDKVIENGISVAKCNCKHNTCGSNCETCCPLFNQRPWKPVAV-----CEECNCNRKSNECSYNQTVATLQLSVNKMGRMEGGGVCINCQENTEGINCEKCIKGFYRPWNVLATELYPCTPCQCHGLGTIGSCVSNGEDIGDQ--KPGDCICKKGYEGVNCDLCSIGYERYPNGECLPCPCSIDGSVRTSFYRCKPPCNCKVHVNSDDLCKTCKNGYFNLDSANPEGCEPCYCFGITNQCSSLSAKNLKISDLKGWKLTTFTGEKIALPKFT---SFQYLTSENSYIDERFNNPTVYYWTAPPPYLGNWITSYGTIFRYVVKIELQSTLKGSL-IDSPDVIIKCGDFRLFHSVSIEDRRLQRQVFIYIKPTEWKIGKLTPDKAA----------TKEEFISCLVKVDKLLIKAKYYSNQKSIELLNITLSRGEVHLALDE--MPHIEKCNCPPGFNGLSCESCESGYRRVNNVLYQGQCEACACYNHSNTCDSLNGECQNCTHNTAGAHCEDCASGYYGDAKSKNLNSCKKCPCPR--LDYQMTELCSSYSSENYVCHKCLHNTSGVHCDRCIEGYYGNPK-KKISCKRCKCNNNQE-----SCDPVTGECR-CSYNTMGTECQLCKHGFYGDAL-TKSCKKCDCDSLGSTSENCDKLTGKCDCRTNFVNRQCDSC---TSGLYLKDKKCIPCNCEIQGRISSEKFCNTTSGQCFCLENVNGDRCEKCVEGYFNYP--NCKKCLCSPHALSADCDLNNGKCKCGSNVINRICDKCENLHYWNNR--TDCVPCNCGR-GSLNPKCDMETGNCKCAQNVARRDCSKCDVGYFGLDV-TGCKKCPPCYNGQVCNNE----------GICVCPPNTIGNLCNKCSEDSW--DFNETIGCKKCNCY 3514
            L  NA IT++ATCG  GPE++C+LV+ +  Q + NP     C +C+  + N  +RHPI  A  D  N WWQSPS+  G++Y  V +T+DL+QV+QI Y+++K  +SPRPGNWILERSLD   Y PW + A T   C   YN++ R  P         PS   DDE+ CT++YS+   L +GEI ISLINGR S  +         P+ L+ F SARYIR RF +  TL ADLM   HK    ++  +  RYYYS+++I +GG CIC  HA  C   ++   + ++C C+HNTCG +C+ CCP F+Q+PW+         CE CNC+ K+ EC Y++TVA+  LS+N  G+  GGGVCINC  NT GINCE C+ GF+RP  V      PC PC C   G++       E    +  KPG C CK G+ GVNCD C  GY  YP  +C PC CS  GS  T+   C  PC+CK +V  +D C  CK+G+FNL   N +GCE C+C G++N+C S       I D++GW LT  +G     P+     S Q ++  NS  + R +    YYW+APPPYLGN + + G    + +  +L+     +  I    +I +  D R+  S + ++        +Y++P+E  I +++  + A          T+++F+  L  ++++L++  Y     +I  L+       V    D      +E C CPPG++G SCE+C   +RRVN  ++ G CE C C+ H+  CD + GEC NC  +T G +C +C  G+YGD    +   C+ C CP        +  C    S   +C +C    +G  C+RC EGY+G P     SC+ C+CN+N +     SCD ++G C  C   T G  C+LC  G++GDA+  K+C+ C C+  GS SE C   TG+C+CR N   R CD C   T GL L  + C+PCNC   G   S+ F    SGQC+C   V G +C++C  GYFN+    C  C CS   L  +CD   G+C C  N     C +C   + W +   T C  CNC   GSL  +C++ TG C C    +   CS+C  G++   + T C    P  +   C+ E          G C C  N  G  C++C    +  D    +GC  C C+
Sbjct:   42 LASNALITTNATCGEKGPEMYCKLVEHVPGQPVRNPQ----CRICNQNSSNPYQRHPITNA-IDGKNTWWQSPSIKNGVEYHYVTITLDLQQVFQIAYVIVKAANSPRPGNWILERSLDDVEYKPWQYHAVTDTECLTLYNIYPRTGP---------PSYAKDDEVICTSFYSKIHPLENGEIHISLINGRPSADDPS-------PE-LLEFTSARYIRLRFQRIRTLNADLMMFAHKDPREIDPIVTRRYYYSVKDISVGGMCICYGHARACP--LDPATNKSRCECEHNTCGESCDRCCPGFHQKPWRAGTFLTKSECEACNCHGKAEECYYDETVASRNLSLNIHGKYIGGGVCINCTHNTAGINCETCVDGFFRPKGVSPNYPRPCQPCHCDPTGSLSEVCVKDEKYAQRGLKPGSCHCKTGFGGVNCDRCVRGYHGYP--DCQPCNCSGLGS--TNEDPCVGPCSCKENVEGED-CSRCKSGFFNLQEDNQKGCEECFCSGVSNRCQSSYWTYGNIQDMRGWYLTDLSGRIRMAPQLDNPDSPQQISISNS--EARKSLLDGYYWSAPPPYLGNRLPAVGGQLSFTISYDLEEEEDDTEKILQLMIIFEGNDLRI--STAYKE--------VYLEPSEEHIEEVSLKEEAFTIHGTNLPVTRKDFMIVLTNLERVLMQITYNLGMDAIFRLSSVNLESAVPYPTDRRIATDVEVCQCPPGYSGSSCETCWPRHRRVNGTIFGGICEPCQCFAHAEACDDITGECLNCKDHTGGPYCNECLPGFYGDPTRGSPEDCQPCACPLNIPSNNFSPTCHLDRSLGLICDECPIGYTGPRCERCAEGYFGQPSIPGGSCQPCQCNDNLDYSIPGSCDSLSGSCLICKPGTTGRYCELCADGYFGDAVNAKNCQPCRCNINGSFSEICHTRTGQCECRPNVQGRHCDECKPETFGLQL-GRGCLPCNCNSFG---SKSFDCEASGQCWCQPGVAGKKCDRCAHGYFNFQEGGCIACDCS--HLGNNCDPKTGQCICPPNTTGEKCSECLP-NTWGHSIVTGCKVCNCSTVGSLASQCNVNTGQCSCHPKFSGMKCSECSRGHWNYPLCTLCDCFLPGTDATTCDLETRKCSCSDQTGQCSCKVNVEGVHCDRCRPGKFGLDAKNPLGCSSCYCF 1165          

HSP 2 Score: 226.098 bits (575), Expect = 3.098e-57
Identity = 156/425 (36.71%), Postives = 206/425 (48.47%), Query Frame = 2
Query: 2654 CKRCKCNNNQESCDPVTGEC-RCSYNTMGTECQLCKHGFYGDALTKS---CKKCDCDSLGSTSEN------CDKLTGK-CD-CRTNFVNRQCDSCTSGLY----LKDKKCIPCNCEIQGRISSEKFCNTTSGQCF-CLENVNGDRCEKCVEGYF----NYPNCKKCLCSPH-ALSADCDLNNGKCKCGSNVINRICDKC--ENLHYWNNRTDCVPCNCGR-GSLNPKCDMETGNCKCAQNVARRDCSKCDVGYFGLDVTGCKKCPPCYNGQVCNNE-GICVCPPNTIGNLCNKCSEDSWDFNETIGCKKCNCYINGSYSNICNKISGICACKTAFFGSKCDRCNEGYYGFPNCQPCSCAENGTKSN----ELTK--CDKITGQCQCKQNVIGTKCKVCRKGTFPSDGTYEGGCFSCFCFGVSEKC 3832
            C+ C+C  + E+CD +TGEC  C  +T G  C  C  GFYGD    S   C+ C C  L   S N       D+  G  CD C   +   +C+ C  G +    +    C PC C      S    C++ SG C  C     G  CE C +GYF    N  NC+ C C+ + + S  C    G+C+C  NV  R CD+C  E       R  C+PCNC   GS +  C+  +G C C   VA + C +C  GYF     GC  C   + G  C+ + G C+CPPNT G  C++C  ++W  +   GCK CNC   GS ++ CN  +G C+C   F G KC  C+ G++ +P C  C C   GT +     E  K  C   TGQC CK NV G  C  CR G F  D     GC SC+CFGV+ +C
Sbjct:  750 CEPCQCFAHAEACDDITGECLNCKDHTGGPYCNECLPGFYGDPTRGSPEDCQPCAC-PLNIPSNNFSPTCHLDRSLGLICDECPIGYTGPRCERCAEGYFGQPSIPGGSCQPCQCNDNLDYSIPGSCDSLSGSCLICKPGTTGRYCELCADGYFGDAVNAKNCQPCRCNINGSFSEICHTRTGQCECRPNVQGRHCDECKPETFGLQLGR-GCLPCNCNSFGSKSFDCEA-SGQCWCQPGVAGKKCDRCAHGYFNFQEGGCIACDCSHLGNNCDPKTGQCICPPNTTGEKCSECLPNTWGHSIVTGCKVCNCSTVGSLASQCNVNTGQCSCHPKFSGMKCSECSRGHWNYPLCTLCDCFLPGTDATTCDLETRKCSCSDQTGQCSCKVNVEGVHCDRCRPGKFGLDAKNPLGCSSCYCFGVTSQC 1171          

HSP 3 Score: 222.246 bits (565), Expect = 4.749e-56
Identity = 198/664 (29.82%), Postives = 280/664 (42.17%), Query Frame = 2
Query: 1007 VAKCNCKHNTCGSNCETCCP-LFNQRPWKPVAVCEECNCN---------RKSNECSYNQTVATLQLSVNKMGRM---EGG-----------------GVCINCQENTEGINCEKCIKGFYRPWNVLATELYPCTPCQCHGLGTIGS-CVSNGEDIGDQKPGDCICKKGYEGVNCDLCSIGYERYPNGECLPCPCSIDGSVRTS----FYRCK-----PPCNCKVHVNSDDLCKTCKNGYFNLDSANPEGCEPCYCFGITNQCSSLSAKNLKISDLKGWKLTTFTGEKIALPKF-TSFQYLTSENSYIDERFNNPTV---------------YYWTAPPPYLGNWITSYGTIFRYVVKIELQSTLKGSLIDSPDVIIKCG---DFRLF--HSVSIEDRRLQRQVFIYIKPTEWKIGKLTP--DKAATKEEFISCLVKVDKLLIKAKYYSNQKSIELLNITLSRGEVHLALDEMPH---IEKCNCPPGFNGLSCESCESGYRRVNNVL-------YQGQCEACACYNHSNTCDSLNGECQNCTHNTAGAHCEDCASGYYGDAKSKNLNSCKKCPCPRLDYQ--MTELCSSYSSENYVCHKCLHNTSGVHCDRCIEGYYGNPKKK-ISCKRCKCNNNQE---SCDPVTGECRCSYNTMGTECQLCKH 2761
              +C C+ N  G +C+ C P  F  +  +    C  CNCN           S +C     VA  +      G     EGG                 G CI C  NT G  C +C+   +    V       C  C C  +G++ S C  N         G C C   + G+ C  CS G+  YP   C  C C + G+  T+      +C        C+CKV+V     C  C+ G F LD+ NP GC  CYCFG+T+QCS   AK L    ++ W   T + E+  LP    + Q+ T++       F  P +               +YW  P  + G  + +YG   +Y +  E +    G     P VII+ G     R+   H  +    +L R   I +   EWK     P   +  T+E+F+  L  +  +LIKA Y +  +   +  I++   E    L   P    IE+C+CPPG++GLSCE+C  G+ R+ +           G C  C C  HS+ CD     CQNC H+TAG  CE CA GYYG  +    N C+ C CP +      +  C     E+Y C  C     G +C+RC  GY G+P     SC+ C+C+        CD VTG C C     G +C  C+H
Sbjct:  930 TGQCECRPNVQGRHCDECKPETFGLQLGR---GCLPCNCNSFGSKSFDCEASGQCWCQPGVAGKKCDRCAHGYFNFQEGGCIACDCSHLGNNCDPKTGQCI-CPPNTTGEKCSECLPNTWGHSIVTG-----CKVCNCSTVGSLASQCNVN--------TGQCSCHPKFSGMKCSECSRGHWNYP--LCTLCDCFLPGTDATTCDLETRKCSCSDQTGQCSCKVNVEGVH-CDRCRPGKFGLDAKNPLGCSSCYCFGVTSQCSE--AKGL----IRTW--VTLSDEQTILPLVDEALQHTTTKGI----AFQKPEIVAKMDEVRQELHLEPFYWKLPQQFEGKKLMAYGGKLKYAIYFEARDE-TGFATYKPQVIIRGGTPTHARIITRHMAAPLIGQLTRHE-IEMTEKEWKYYGDDPRISRTVTREDFLDILYDIHYILIKATYGNVVRQSRISEISMEVAEPGHVLAGSPPAHLIERCDCPPGYSGLSCETCAPGFYRLRSEPGGRTPGPTLGTCVPCQCNGHSSQCDPETSVCQNCQHHTAGDFCERCALGYYGIVRGLP-NDCQPCACPLISPSNNFSPSCVLEGLEDYRCTACPRGYEGQYCERCAPGYTGSPSSPGGSCQECECDPYGSLPVPCDRVTGLCTCRPGATGRKCDGCEH 1558          

HSP 4 Score: 146.362 bits (368), Expect = 3.566e-33
Identity = 163/651 (25.04%), Postives = 268/651 (41.17%), Query Frame = 2
Query: 4289 DSNVINSNLTRDIFMMALLNVTSLKVKL-YTDKVNPPLIKIKIITYKVMETTQAIGKRVTA--VEKCICNALTFGNHCQNPISGYYKEYFNLPNSTKSGSMRTGNRILINLKKCNCNGYSKVCDSVTGDCQNCMGNREGNKCQLCREGFYKNDKNY-DQCEPCQCP--SAHYNFAQNCTRIESSLELKC-QCRIGYSGKSCENCQQGFYGNPIK-GIPCKSCDCNQQGSQSLNCNEF-GICQCSPGVLGIKCDQCAPNYVVEKKTCQSCYSGCTKDLLVRIDTLNETVINFKWK-TLPSTLDLRLNKIN--------ISIQMSSELLNSINK--FYKLKNEIKNFSIQFQKMKDDAKEKYGEIEKLKTRYNKVLEDLRSTFTD----------INETISGHEQLGISN--ELIKNATAYLETIKN----IYKEMPNITLAAS--VLKDVLKYVDELNQIIKYTQSHIQS----------DQINNLKILKNKTIMADEINTNNKEYLNTMSTKKKEHELYIILINERMKDLQKIFRKMTKQRDNLRKKIQKLDAISKSFQDEKDLISINVREIEDLMKNLSSNHLVSKSLIIPDTLKKHVEQQLNKSSNLIKKLTKDFNFLHNAEQAKEAYSNITRDILAVDYAINQTKKEL 6097
            D   I+  +TR+ F+  L ++  + +K  Y + V     +I  I+ +V E    +     A  +E+C C     G  C+    G+Y+       S   G  RT    L     C CNG+S  CD  T  CQNC  +  G+ C+ C  G+Y   +   + C+PC CP  S   NF+ +C  +E   + +C  C  GY G+ CE C  G+ G+P   G  C+ C+C+  GS  + C+   G+C C PG  G KCD C   +  E   C  C   CT  LL  +  L +  +N      LP+   +     N        +S Q + E L  + +     L  E      +  K+  D ++   + E+  +R   + E ++    D          +NET+   ++    N  EL K     L+ +++      KE+    L A+  +LK V K   E     +  +  +Q           D  + L+   +KT  A+ ++  N++ +  + TKK+  E     I   +K+   I  +  +    +   I  +D I        + +S    +I+DL + +    L  K        + H  Q  + S+ L   L +  N   NA  A  AYSNI +D +     + +  KEL
Sbjct: 1312 DDPRISRTVTREDFLDILYDIHYILIKATYGNVVRQS--RISEISMEVAEPGHVLAGSPPAHLIERCDCPPGYSGLSCETCAPGFYRL-----RSEPGG--RTPGPTLGTCVPCQCNGHSSQCDPETSVCQNCQHHTAGDFCERCALGYYGIVRGLPNDCQPCACPLISPSNNFSPSCV-LEGLEDYRCTACPRGYEGQYCERCAPGYTGSPSSPGGSCQECECDPYGSLPVPCDRVTGLCTCRPGATGRKCDGCEHWHAREGAECVFCGDECTGLLLGDLARLEQMTMNINLTGPLPAPYKILYGLENTTQELKHLLSPQRAPERLIQLAEGNVNTLVMETNELLTRATKVTADGEQTGQDAERTNSRAESLEEFIKGLVQDAEAINEKAVQLNETLGNQDKTAERNLEELQKEIDRMLKELRSKDLQTQKEVAEDELVAAEGLLKRVNKLFGEPRAQNEDMEKDLQQKLAEYKNKLDDAWDLLREATDKTRDANRLSAANQKNMTILETKKEAIEGSKRQIENTLKEGNDILDEANRLLGEINSVIDYVDDIKTKLPPMSEELS---DKIDDLAQEIKDRRLAEKVF----QAESHAAQLNDSSAVLDGILDEAKNISFNATAAFRAYSNI-KDYIDEAEKVAREAKEL 1944          

HSP 5 Score: 103.605 bits (257), Expect = 3.268e-20
Identity = 88/275 (32.00%), Postives = 118/275 (42.91%), Query Frame = 2
Query: 3086 CLCSPHALSADCD--LNNGKCKCGSNVINRICDKC-ENLHY--WN-----NRTDCVPCNCGRGSLNPKCDMETGNCKCAQNVARRDCSKCDVGYFGLDVTGCKKCPPCYNGQVCNNEGICVCPPNTIGNLCNKCSEDSW-----DFNETIGCKKCNCYINGSYSNICNK---------ISGICACKTAFFGSKCDRCNEGYYGFPNCQPCSCAENGTKSNELTKCDKITGQCQCKQNVIGTKCKVCRKGTFPSDGTYEGGCFSCFCFGVSEKCHA 3838
            C+C  HA +   D   N  +C+C  N     CD+C    H   W       +++C  CNC           +   C   + VA R+ S        L++ G         G VC N     C  NT G  C  C +  +       N    C+ C+C   GS S +C K           G C CKT F G  CDRC  GY+G+P+CQPC+C+  G+ +NE    D   G C CK+NV G  C  C+ G F      + GC  CFC GVS +C +
Sbjct:  283 CICYGHARACPLDPATNKSRCECEHNTCGESCDRCCPGFHQKPWRAGTFLTKSECEACNC---------HGKAEECYYDETVASRNLS--------LNIHG-----KYIGGGVCIN-----CTHNTAGINCETCVDGFFRPKGVSPNYPRPCQPCHCDPTGSLSEVCVKDEKYAQRGLKPGSCHCKTGFGGVNCDRCVRGYHGYPDCQPCNCSGLGS-TNE----DPCVGPCSCKENVEGEDCSRCKSGFFNLQEDNQKGCEECFCSGVSNRCQS 525          

HSP 6 Score: 97.8265 bits (242), Expect = 1.893e-18
Identity = 78/268 (29.10%), Postives = 121/268 (45.15%), Query Frame = 2
Query: 4304 NSNLTRDIFMMALLNVTSLKVKLYTDKVNPPLIKIKIITYKVMETTQAIGKRVTAVEKCICNALTFGNHCQNPISGYYKEYFNLPNSTKSGSMRTGNRILINLKKCNCNGYSKVCDSVTGDCQNCMGNREGNKCQLCREGFYKNDK--NYDQCEPCQCP--SAHYNFAQNCTRIESSLELKC-QCRIGYSGKSCENCQQGFYGNP-IKGIPCKSCDCNQQGSQSL--NCNEF-GICQ-CSPGVLGIKCDQCAPNY---VVEKKTCQSC 5068
            N  +TR  FM+ L N+  + +++  +     + ++  +  +         +  T VE C C     G+ C+     + +      N T  G +          + C C  +++ CD +TG+C NC  +  G  C  C  GFY +    + + C+PC CP      NF+  C  ++ SL L C +C IGY+G  CE C +G++G P I G  C+ C CN     S+  +C+   G C  C PG  G  C+ CA  Y    V  K CQ C
Sbjct:  662 NLPVTRKDFMIVLTNLERVLMQITYNLGMDAIFRLSSVNLESAVPYPTDRRIATDVEVCQCPPGYSGSSCETCWPRHRRV-----NGTIFGGI---------CEPCQCFAHAEACDDITGECLNCKDHTGGPYCNECLPGFYGDPTRGSPEDCQPCACPLNIPSNNFSPTC-HLDRSLGLICDECPIGYTGPRCERCAEGYFGQPSIPGGSCQPCQCNDNLDYSIPGSCDSLSGSCLICKPGTTGRYCELCADGYFGDAVNAKNCQPC 914          

HSP 7 Score: 88.5817 bits (218), Expect = 1.391e-15
Identity = 49/142 (34.51%), Postives = 75/142 (52.82%), Query Frame = 2
Query: 4646 CDSVTGDCQNCMGNREGNKCQLCREGFYKNDKNYDQCEPCQCPSAHYNFAQNCTRIESSLELKCQCRIGYSGKSCENCQQGFYGNPIKGIPCKSCDCNQQGSQSLNCNEFGICQCSPGVLGIKCDQCAPNYV-VEKKTCQSC 5068
            CDS++G C  C     G  C+LC +G++ +  N   C+PC+C     N   + + I  +   +C+CR    G+ C+ C+   +G  + G  C  C+CN  GS+S +C   G C C PGV G KCD+CA  Y   ++  C +C
Sbjct:  875 CDSLSGSCLICKPGTTGRYCELCADGYFGDAVNAKNCQPCRC-----NINGSFSEICHTRTGQCECRPNVQGRHCDECKPETFGLQL-GRGCLPCNCNSFGSKSFDCEASGQCWCQPGVAGKKCDRCAHGYFNFQEGGCIAC 1010          

HSP 8 Score: 69.3218 bits (168), Expect = 9.409e-10
Identity = 64/237 (27.00%), Postives = 88/237 (37.13%), Query Frame = 2
Query: 2576 CLHNTSGVHCDRCIEGYY---GNPKKKI------SCKRCKCNNNQESCDPVTGECR-CSYNTMGTECQLCKHGFYG--DALTKSCKKCDCDSLGSTSENCDKLTGKCDCRTNFVNRQCDSCTSGLYLKDKKCIPCNCEIQGRISSEKFCNTTSGQCFCLENVNGDRCEKCVEGYFNYPN-----CKKCLCSPH-ALSADCDLNNGKCKCGSNVINRICDKCENLHYWNNRTDCVPCN 3232
            C    SG+ C+ C  G+Y     P  +       +C  C+CN +   CDP T  C+ C ++T G  C+ C  G+YG    L   C+ C C  L S S N    +  C                   L+D +C  C                            G  CE+C  GY   P+     C++C C P+ +L   CD   G C C      R CD CE+ H      +CV C 
Sbjct: 1378 CPPGYSGLSCETCAPGFYRLRSEPGGRTPGPTLGTCVPCQCNGHSSQCDPETSVCQNCQHHTAGDFCERCALGYYGIVRGLPNDCQPCAC-PLISPSNN---FSPSCVLEG---------------LEDYRCTACP-----------------------RGYEGQYCERCAPGYTGSPSSPGGSCQECECDPYGSLPVPCDRVTGLCTCRPGATGRKCDGCEHWHAREG-AECVFCG 1571          

HSP 9 Score: 61.2326 bits (147), Expect = 2.264e-7
Identity = 44/146 (30.14%), Postives = 64/146 (43.84%), Query Frame = 2
Query: 3218 CVPCNCGRGSLNPKCDMETGNCK-CAQNVARRDCSKCDVGYFGLDVTGCKKCPPCYNGQV---------CNNEGI-----CVCPPNTIGNLCNKCSEDSWDFNETIG--CKKCNCYINGSYSNICNKISGICACKTAFFGSKCDRC 3604
            CVPC C   S   +CD ET  C+ C  + A   C +C +GY+G+       C PC    +         C  EG+       CP    G  C +C+        + G  C++C C   GS    C++++G+C C+    G KCD C
Sbjct: 1413 CVPCQCNGHS--SQCDPETSVCQNCQHHTAGDFCERCALGYYGIVRGLPNDCQPCACPLISPSNNFSPSCVLEGLEDYRCTACPRGYEGQYCERCAPGYTGSPSSPGGSCQECECDPYGSLPVPCDRVTGLCTCRPGATGRKCDGC 1556          

HSP 10 Score: 59.6918 bits (143), Expect = 7.699e-7
Identity = 60/239 (25.10%), Postives = 103/239 (43.10%), Query Frame = 2
Query: 4460 VTAVEKCICNALTFGNHCQNPISGYYKEYFNLPNSTKSGSMRTGNRILINLKKCNCNGYSKVC---DSVT---------------GDCQNCMGNREGNKCQLCREGFYKN---DKNYDQ-CEPCQC-PSAHYNFAQNCTRIESSLEL-----KCQCRIGYSGKSCENCQQGFYGNPIKGIPCKSCDCNQQGSQSLNCNE---FGICQCSPGVLGIKCDQCAPNYV----VEKKTCQSCY 5071
             T   +C C   T G  C     G++++ +      ++G+  T +      + CNC+G ++ C   ++V                G C NC  N  G  C+ C +GF++      NY + C+PC C P+   + ++ C + E   +       C C+ G+ G +C+ C +G++G P     C+ C+C+  GS     NE    G C C   V G  C +C   +       +K C+ C+
Sbjct:  297 ATNKSRCECEHNTCGESCDRCCPGFHQKPW------RAGTFLTKSEC----EACNCHGKAEECYYDETVASRNLSLNIHGKYIGGGVCINCTHNTAGINCETCVDGFFRPKGVSPNYPRPCQPCHCDPTG--SLSEVCVKDEKYAQRGLKPGSCHCKTGFGGVNCDRCVRGYHGYP----DCQPCNCSGLGST----NEDPCVGPCSCKENVEGEDCSRCKSGFFNLQEDNQKGCEECF 515          
BLAST of Laminin subunit alpha-2 vs. UniProt/SwissProt
Match: sp|P24043|LAMA2_HUMAN (Laminin subunit alpha-2 OS=Homo sapiens OX=9606 GN=LAMA2 PE=1 SV=4)

HSP 1 Score: 715.687 bits (1846), Expect = 0.000e+0
Identity = 433/1176 (36.82%), Postives = 614/1176 (52.21%), Query Frame = 2
Query:  188 LMENAKITSSATCGTGGPEIFCRLVDEIAIQRLINPDSHVLCDVCD--NRNETKRHPIEFAKSDDDNLWWQSPSMAQGLKYQNVNVTIDLKQVYQIVYILLKMGDSPRPGNWILERSLDGEIYMPWIFFAETPYSC---YNLFQRQYPDLKLTTNAKPSSLADDEMFCTTYYSQPKSLNSGEIIISLINGRKSIMNEEYLSIKSVPQTLINFLSARYIRFRFLKHLTLAADLM--THKG--YLEQSIYNRYYYSLRNIEIGGKCICNNHADKCDKVIENGISVAKCNCKHNTCGSNCETCCPLFNQRPWKPVAV-----CEECNCNRKSNECSYNQTVATLQLSVNKMGRMEGGGVCINCQENTEGINCEKCIKGFYRPWNVLATELYPCTPCQCHGLGTIGSCVSNGEDIGDQ--KPGDCICKKGYEGVNCDLCSIGYERYPNGECLPCPCSIDGSVRTSFYRCKPPCNCKVHVNSDDLCKTCKNGYFNLDSANPEGCEPCYCFGITNQCSSLSAKNLKISDLKGWKLTTFTGEKIALPK---FTSFQYLTSENSYIDERFNNPTVYYWTAPPPYLGNWITSYGTIFRYVVKIELQSTLKGS--------LIDSPDVIIKCGDFRLFHSVSIEDRR--LQRQVFIYIKPTEWKIGKLTPDKAATKEEFISCLVKVDKLLIKAKYYSNQKSIELLNITLSRGEVHLALDE--MPHIEKCNCPPGFNGLSCESCESGYRRVNNVLYQGQCEACACYNHSNTCDSLNGECQNCTHNTAGAHCEDCASGYYGDAKSKNLNSCKKCPCPR--LDYQMTELCSSYSSENYVCHKCLHNTSGVHCDRCIEGYYGNPK-KKISCKRCKCNNNQE-----SCDPVTGECR-CSYNTMGTECQLCKHGFYGDAL-TKSCKKCDCDSLGSTSENCDKLTGKCDCRTNFVNRQCDSCTSGLY--LKDKKCIPCNCEIQGRISSEKFCNTTSGQCFCLENVNGDRCEKCVEGYFNYP--NCKKCLCSPHALSADCDLNNGKCKCGSNVINRICDKCENLHYWNNR--TDCVPCNCGR-GSLNPKCDMETGNCKCAQNVARRDCSKCDVGYF-------------GLDVTGC----KKCPPCYNGQVCNNEGICVCPPNTIGNLCNKCSEDSW--DFNETIGCKKCNCY 3514
            L  NA IT++ATCG  GPE++C+LV+ +  Q + NP     C +C+  + N  +RHPI  A  D  N WWQSPS+  G++Y  V +T+DL+QV+QI Y+++K  +SPRPGNWILERSLD   Y PW + A T   C   YN++ R  P         PS   DDE+ CT++YS+   L +GEI ISLINGR S  +         P+ L+ F SARYIR RF +  TL ADLM   HK    ++  +  RYYYS+++I +GG CIC  HA  C   ++   + ++C C+HNTCG +C+ CCP F+Q+PW+         CE CNC+ K+ EC Y++ VA   LS+N  G+  GGGVCINC +NT GINCE C  GF+RP  V      PC PC C  +G++       E    +   PG C CK G+ GV+CD C+ GY  YP  +C  C CS  GS       C  PC CK +V   D C  CK+G+FNL   N +GC+ C+C G++N+C S      KI D+ GW LT   G     P+     S Q ++  N+  + R   P  YYW+AP PYLGN + + G    + +  +L+   + +        +++  D+ I      ++   S E     L ++    I  T + +          ++EF++ L  + ++L++  Y     +I  L+       V    D      +E C CPPG+ G SCESC   +RRVN  ++ G CE C C+ H+ +CD + GEC NC  +T G +C+ C  G+YG+        C+ C CP        +  C    S   +C  C    +G  C+RC EGY+G P     SC+ C+CN+N +     SCD ++G C  C   T G  C+LC  G++GDA+  K+C+ C C++ GS SE C   TG+C+CR N   ++CD C +G +     + C+PCNC   G   S+ F    SGQC+C   V G +C++C  GYFN+    C  C CS   L  +CD   G+C C  N I   C KC   + W +   T C  CNC   GSL+ +C++ TG C C    +   C++C  G++             G D T C    KKC         +  G C C  N  G  C++C    +  D    +GC  C C+
Sbjct:   46 LASNALITTNATCGEKGPEMYCKLVEHVPGQPVRNPQ----CRICNQNSSNPNQRHPITNA-IDGKNTWWQSPSIKNGIEYHYVTITLDLQQVFQIAYVIVKAANSPRPGNWILERSLDDVEYKPWQYHAVTDTECLTLYNIYPRTGP---------PSYAKDDEVICTSFYSKIHPLENGEIHISLINGRPSADDPS-------PE-LLEFTSARYIRLRFQRIRTLNADLMMFAHKDPREIDPIVTRRYYYSVKDISVGGMCICYGHARACP--LDPATNKSRCECEHNTCGDSCDQCCPGFHQKPWRAGTFLTKTECEACNCHGKAEECYYDENVARRNLSLNIRGKYIGGGVCINCTQNTAGINCETCTDGFFRPKGVSPNYPRPCQPCHCDPIGSLNEVCVKDEKHARRGLAPGSCHCKTGFGGVSCDRCARGYTGYP--DCKACNCSGLGSKNED--PCFGPCICKENVEGGD-CSRCKSGFFNLQEDNWKGCDECFCSGVSNRCQSSYWTYGKIQDMSGWYLTDLPGRIRVAPQQDDLDSPQQISISNA--EARQALPHSYYWSAPAPYLGNKLPAVGGQLTFTISYDLEEEEEDTERVLQLMIILEGNDLSISTAQDEVYLHPSEEHTNVLLLKEESFTIHGTHFPV---------RRKEFMTVLANLKRVLLQITYSFGMDAIFRLSSVNLESAVSYPTDGSIAAAVEVCQCPPGYTGSSCESCWPRHRRVNGTIFGGICEPCQCFGHAESCDDVTGECLNCKDHTGGPYCDKCLPGFYGEPTKGTSEDCQPCACPLNIPSNNFSPTCHLDRSLGLICDGCPVGYTGPRCERCAEGYFGQPSVPGGSCQPCQCNDNLDFSIPGSCDSLSGSCLICKPGTTGRYCELCADGYFGDAVDAKNCQPCRCNAGGSFSEVCHSQTGQCECRANVQGQRCDKCKAGTFGLQSARGCVPCNCNSFG---SKSFDCEESGQCWCQPGVTGKKCDRCAHGYFNFQEGGCTACECS--HLGNNCDPKTGRCICPPNTIGEKCSKCAP-NTWGHSITTGCKACNCSTVGSLDFQCNVNTGQCNCHPKFSGAKCTECSRGHWNYPRCNLCDCFLPGTDATTCDSETKKC------SCSDQTGQCTCKVNVEGIHCDRCRPGKFGLDAKNPLGCSSCYCF 1169          

HSP 2 Score: 234.187 bits (596), Expect = 1.017e-59
Identity = 156/424 (36.79%), Postives = 209/424 (49.29%), Query Frame = 2
Query: 2654 CKRCKCNNNQESCDPVTGEC-RCSYNTMGTECQLCKHGFYGD---ALTKSCKKCDCDSLGSTSEN------CDKLTGK-CD-CRTNFVNRQCDSCTSGLY----LKDKKCIPCNCEIQGRISSEKFCNTTSGQCF-CLENVNGDRCEKCVEGYF----NYPNCKKCLC-SPHALSADCDLNNGKCKCGSNVINRICDKCENLHY-WNNRTDCVPCNCGR-GSLNPKCDMETGNCKCAQNVARRDCSKCDVGYFGLDVTGCKKCPPCYNGQVCNNE-GICVCPPNTIGNLCNKCSEDSWDFNETIGCKKCNCYINGSYSNICNKISGICACKTAFFGSKCDRCNEGYYGFPNCQPCSCAENGTKS----NELTK--CDKITGQCQCKQNVIGTKCKVCRKGTFPSDGTYEGGCFSCFCFGVSEKC 3832
            C+ C+C  + ESCD VTGEC  C  +T G  C  C  GFYG+     ++ C+ C C  L   S N       D+  G  CD C   +   +C+ C  G +    +    C PC C      S    C++ SG C  C     G  CE C +GYF    +  NC+ C C +  + S  C    G+C+C +NV  + CDKC+   +   +   CVPCNC   GS +  C+ E+G C C   V  + C +C  GYF     GC  C   + G  C+ + G C+CPPNTIG  C+KC+ ++W  + T GCK CNC   GS    CN  +G C C   F G+KC  C+ G++ +P C  C C   GT +    +E  K  C   TGQC CK NV G  C  CR G F  D     GC SC+CFG + +C
Sbjct:  754 CEPCQCFGHAESCDDVTGECLNCKDHTGGPYCDKCLPGFYGEPTKGTSEDCQPCAC-PLNIPSNNFSPTCHLDRSLGLICDGCPVGYTGPRCERCAEGYFGQPSVPGGSCQPCQCNDNLDFSIPGSCDSLSGSCLICKPGTTGRYCELCADGYFGDAVDAKNCQPCRCNAGGSFSEVCHSQTGQCECRANVQGQRCDKCKAGTFGLQSARGCVPCNCNSFGSKSFDCE-ESGQCWCQPGVTGKKCDRCAHGYFNFQEGGCTACECSHLGNNCDPKTGRCICPPNTIGEKCSKCAPNTWGHSITTGCKACNCSTVGSLDFQCNVNTGQCNCHPKFSGAKCTECSRGHWNYPRCNLCDCFLPGTDATTCDSETKKCSCSDQTGQCTCKVNVEGIHCDRCRPGKFGLDAKNPLGCSSCYCFGTTTQC 1175          

HSP 3 Score: 221.09 bits (562), Expect = 1.020e-55
Identity = 198/654 (30.28%), Postives = 273/654 (41.74%), Query Frame = 2
Query:  950 CICNNHADKCDKVIENGISVAKCNCKHNTCGSNCETCC-PLFNQRPWKPVAVCEECNCNRKSNECSYNQTVATLQLSVNKMGRMEGGGVCINCQENTEGINCEKCIKGFYRPWNVLATELYPCTPCQCHGLGTIG-SCVSNGEDIGDQKPGDCICKKGYEGVNCDLCSIGYERYPNGECLPCPCSIDGSVRTS----FYRCK-----PPCNCKVHVNSDDLCKTCKNGYFNLDSANPEGCEPCYCFGITNQCSSLSAKNLKISDLKGWKLTTFTGEKIALPKF-TSFQYLTSENSYIDERFNNPTV---------------YYWTAPPPYLGNWITSYGTIFRYVVKIELQSTLKGSLIDSPDVIIKCGD-----FRLFHSVSIEDRRLQRQVFIYIKPTEWKIGKLTP--DKAATKEEFISCLVKVDKLLIKAKYYSNQKSIELLNITLSRGEVHLALDEMPH---IEKCNCPPGFNGLSCESCESGYRRVNNVL-------YQGQCEACACYNHSNTCDSLNGECQNCTHNTAGAHCEDCASGYYGDAKSKNLNSCKKCPCPRLDYQ--MTELCSSYSSENYVCHKCLHNTSGVHCDRCIEGYYGNP-KKKISCKRCKCNNNQE---SCDPVTGECRCSYNTMGTECQLCKH 2761
            C CN+   K     E+G    +C C+    G  C+ C    FN +       C  C C+   N C              K GR      CI C  NT G  C KC       W    T    C  C C  +G++   C  N         G C C   + G  C  CS G+  YP   C  C C + G+  T+      +C        C CKV+V     C  C+ G F LD+ NP GC  CYCFG T QCS   AK L    ++ W   T   E+  LP    + Q+ T++       F +P +               +YW  P  + G  + +YG   +Y +  E +     S  + P VII+ G        + H  +    +L R   I +   EWK     P   +  T+E+F+  L  +  +LIKA Y +  +   +  I++   E        P    IEKC+CP G++GLSCE+C  G+ R+ +           G C  C C  HS+ CD     CQNC H+TAG  CE CA GYYG  K    N C++C CP +      +  C +   ++Y C  C     G +C+RC  GY G+P     SC+ C+C+        CDPVTG C C     G +C  CKH
Sbjct:  967 CNCNSFGSKSFDCEESG----QCWCQPGVTGKKCDRCAHGYFNFQE----GGCTACECSHLGNNCD------------PKTGR------CI-CPPNTIGEKCSKCAP---NTWGHSITT--GCKACNCSTVGSLDFQCNVN--------TGQCNCHPKFSGAKCTECSRGHWNYP--RCNLCDCFLPGTDATTCDSETKKCSCSDQTGQCTCKVNVEGIH-CDRCRPGKFGLDAKNPLGCSSCYCFGTTTQCSE--AKGL----IRTW--VTLKAEQTILPLVDEALQHTTTKGIV----FQHPEIVAHMDLMREDLHLEPFYWKLPEQFEGKKLMAYGGKLKYAIYFEAREETGFSTYN-PQVIIRGGTPTHARIIVRHMAAPLIGQLTRHE-IEMTEKEWKYYGDDPRVHRTVTREDFLDILYDIHYILIKATYGNFMRQSRISEISMEVAEQGRGTTMTPPADLIEKCDCPLGYSGLSCEACLPGFYRLRSQPGGRTPGPTLGTCVPCQCNGHSSLCDPETSICQNCQHHTAGDFCERCALGYYGIVKGLP-NDCQQCACPLISSSNNFSPSCVAEGLDDYRCTACPRGYEGQYCERCAPGYTGSPGNPGGSCQECECDPYGSLPVPCDPVTGFCTCRPGATGRKCDGCKH 1562          

HSP 4 Score: 137.117 bits (344), Expect = 2.719e-30
Identity = 167/688 (24.27%), Postives = 291/688 (42.30%), Query Frame = 2
Query: 4289 DSNVINSNLTRDIFMMALLNVTSLKVKL-YTDKVNPPLIKIKIITYKVMETTQAIGKRVTA----VEKCICNALTFGNHCQNPISGYYKEYFNLPNSTKSGSMRTGNRILINLKKCNCNGYSKVCDSVTGDCQNCMGNREGNKCQLCREGFYKNDKNY-DQCEPCQCP--SAHYNFAQNCTRIESSLELKC-QCRIGYSGKSCENCQQGFYGNPI-KGIPCKSCDCNQQGSQSLNCNEF-GICQCSPGVLGIKCDQCAPNYVVEKKTCQSCYSGCTKDLLVRIDTLNETVINFKWK-TLPSTLDLRLNKINISIQMSSELLNSINKFYKLKNEIKNFSIQFQKMKDDAKEKYGEIEKLKTRYNKVLEDLRSTFTDINETISGHEQLG-ISNELIKNATAYLETIKNIYKEMPNITLA-----ASVLKDVLKYVDELNQIIKYTQSHIQSDQINNLK-ILKNKTIMADEINTNNKEYLNTMSTKKKEHELYIILINERMKDLQKIFRKMTKQRDNLRKKIQKLDAISK----SFQDEKDLISINVREIEDLMKNLSSNHLVSKSLIIPDTLKKHVE-------------QQLNKSSNLIKKLTKDFNFLHNAEQAKEAYSNITRDILAVDYAINQTKKELDFNRSNMNIDSLKKLLAEFNSNKSEIVENIKNIDKEHEKLLKQYKNCSY 6244
            D   ++  +TR+ F+  L ++  + +K  Y + +     +I  I+ +V E  Q  G  +T     +EKC C     G  C+  + G+Y+       S   G  RT    L     C CNG+S +CD  T  CQNC  +  G+ C+ C  G+Y   K   + C+ C CP  S+  NF+ +C   E   + +C  C  GY G+ CE C  G+ G+P   G  C+ C+C+  GS  + C+   G C C PG  G KCD C   +  E   C  C   CT  LL  +  L + V++      LP+   +     N++ ++   LL+      +L           Q  + +      E+ +L TR  KV  D   T  D   T +  + LG    EL ++A A  E    + + +     A       + K++ + + EL +    TQ  I  D++   + +LK    +  E    N+E    +  K  +++        ++ D   + R+ T   D +R+   +L A+++    + + +K+ +    R+IE+ +K    N ++ ++  + D +   ++             ++LN   + + +  KD        QA E+++    D  AV   I    K + FN +           A F +       NIK+   E EK+ K+ K+ ++
Sbjct: 1316 DDPRVHRTVTREDFLDILYDIHYILIKATYGNFMRQS--RISEISMEVAE--QGRGTTMTPPADLIEKCDCPLGYSGLSCEACLPGFYRL-----RSQPGG--RTPGPTLGTCVPCQCNGHSSLCDPETSICQNCQHHTAGDFCERCALGYYGIVKGLPNDCQQCACPLISSSNNFSPSCV-AEGLDDYRCTACPRGYEGQYCERCAPGYTGSPGNPGGSCQECECDPYGSLPVPCDPVTGFCTCRPGATGRKCDGCKHWHAREGWECVFCGDECTGLLLGDLARLEQMVMSINLTGPLPAPYKMLYGLENMTQEL-KHLLSPQRAPERL----------IQLAEGNLNTLVTEMNELLTRATKVTADGEQTGQDAERTNTRAKSLGEFIKELARDAEAVNEKAIKLNETLGTRDEAFERNLEGLQKEIDQMIKELRRKNLETQKEIAEDELVAAEALLKKVKKLFGESRGENEEMEKDLREKLADYK-------NKVDDAWDLLREAT---DKIREA-NRLFAVNQKNMTALEKKKEAVESGKRQIENTLK--EGNDILDEANRLADEINSIIDYVEDIQTKLPPMSEELNDKIDDLSQEIKDRKLAEKVSQA-ESHAAQLNDSSAVLDGILDEAKNISFNAT-----------AAFKA-----YSNIKDYIDEAEKVAKEAKDLAH 1950          

HSP 5 Score: 100.908 bits (250), Expect = 2.551e-19
Identity = 87/275 (31.64%), Postives = 117/275 (42.55%), Query Frame = 2
Query: 3086 CLCSPHALSADCD--LNNGKCKCGSNVINRICDKC-ENLHY--WN-----NRTDCVPCNCGRGSLNPKCDMETGNCKCAQNVARRDCSKCDVGYFGLDVTGCKKCPPCYNGQVCNNEGICVCPPNTIGNLCNKCSEDSW-----DFNETIGCKKCNCYINGSYSNICNK---------ISGICACKTAFFGSKCDRCNEGYYGFPNCQPCSCAENGTKSNELTKCDKITGQCQCKQNVIGTKCKVCRKGTFPSDGTYEGGCFSCFCFGVSEKCHA 3838
            C+C  HA +   D   N  +C+C  N     CD+C    H   W       +T+C  CNC           +   C   +NVARR+ S        L++ G         G VC N     C  NT G  C  C++  +       N    C+ C+C   GS + +C K           G C CKT F G  CDRC  GY G+P+C+ C+C+  G+K+      D   G C CK+NV G  C  C+ G F        GC  CFC GVS +C +
Sbjct:  287 CICYGHARACPLDPATNKSRCECEHNTCGDSCDQCCPGFHQKPWRAGTFLTKTECEACNC---------HGKAEECYYDENVARRNLS--------LNIRG-----KYIGGGVCIN-----CTQNTAGINCETCTDGFFRPKGVSPNYPRPCQPCHCDPIGSLNEVCVKDEKHARRGLAPGSCHCKTGFGGVSCDRCARGYTGYPDCKACNCSGLGSKNE-----DPCFGPCICKENVEGGDCSRCKSGFFNLQEDNWKGCDECFCSGVSNRCQS 529          

HSP 6 Score: 99.3673 bits (246), Expect = 6.364e-19
Identity = 80/281 (28.47%), Postives = 125/281 (44.48%), Query Frame = 2
Query: 4274 FIILEDSNVINSN---LTRDIFMMALLNVTSLKVKLYTDKVNPPLIKIKIITYKVMETTQAIGKRVTAVEKCICNALTFGNHCQNPISGYYKEYFNLPNSTKSGSMRTGNRILINLKKCNCNGYSKVCDSVTGDCQNCMGNREGNKCQLCREGFY--KNDKNYDQCEPCQCP--SAHYNFAQNCTRIESSLELKCQ-CRIGYSGKSCENCQQGFYGNP-IKGIPCKSCDCNQQGSQSL--NCNEF-GICQ-CSPGVLGIKCDQCAPNY---VVEKKTCQSC 5068
             ++ E+S  I+     + R  FM  L N+  + +++        + ++  +  +   +    G    AVE C C     G+ C++    + +      N T  G +          + C C G+++ CD VTG+C NC  +  G  C  C  GFY        + C+PC CP      NF+  C  ++ SL L C  C +GY+G  CE C +G++G P + G  C+ C CN     S+  +C+   G C  C PG  G  C+ CA  Y    V+ K CQ C
Sbjct:  653 LLLKEESFTIHGTHFPVRRKEFMTVLANLKRVLLQITYSFGMDAIFRLSSVNLESAVSYPTDGSIAAAVEVCQCPPGYTGSSCESCWPRHRRV-----NGTIFGGI---------CEPCQCFGHAESCDDVTGECLNCKDHTGGPYCDKCLPGFYGEPTKGTSEDCQPCACPLNIPSNNFSPTC-HLDRSLGLICDGCPVGYTGPRCERCAEGYFGQPSVPGGSCQPCQCNDNLDFSIPGSCDSLSGSCLICKPGTTGRYCELCADGYFGDAVDAKNCQPC 918          

HSP 7 Score: 94.3597 bits (233), Expect = 2.173e-17
Identity = 52/143 (36.36%), Postives = 80/143 (55.94%), Query Frame = 2
Query: 4646 CDSVTGDCQNCMGNREGNKCQLCREGFYKNDKNYDQCEPCQCPSAHYNFAQNCTRIESSLELKCQCRIGYSGKSCENCQQGFYG-NPIKGIPCKSCDCNQQGSQSLNCNEFGICQCSPGVLGIKCDQCAPNYV-VEKKTCQSC 5068
            CDS++G C  C     G  C+LC +G++ +  +   C+PC+C +A  +F++ C     S   +C+CR    G+ C+ C+ G +G    +G  C  C+CN  GS+S +C E G C C PGV G KCD+CA  Y   ++  C +C
Sbjct:  879 CDSLSGSCLICKPGTTGRYCELCADGYFGDAVDAKNCQPCRC-NAGGSFSEVC----HSQTGQCECRANVQGQRCDKCKAGTFGLQSARG--CVPCNCNSFGSKSFDCEESGQCWCQPGVTGKKCDRCAHGYFNFQEGGCTAC 1014          

HSP 8 Score: 69.707 bits (169), Expect = 6.959e-10
Identity = 60/225 (26.67%), Postives = 88/225 (39.11%), Query Frame = 2
Query: 2576 CLHNTSGVHCDRCIEGYY---GNPKKKI------SCKRCKCNNNQESCDPVTGECR-CSYNTMGTECQLCKHGFYG--DALTKSCKKCDCDSLGSTSENCDKLTGKCDCRTNFVNRQCDSCTSGLYLKDKKCIPCNCEIQGRISSEKFCNTTSGQCFCLENVNGDRCEKCVEGYFNYP-----NCKKCLCSPH-ALSADCDLNNGKCKCGSNVINRICDKCENLH 3196
            C    SG+ C+ C+ G+Y     P  +       +C  C+CN +   CDP T  C+ C ++T G  C+ C  G+YG    L   C++C C  + S++              NF      SC +   L D +C  C                            G  CE+C  GY   P     +C++C C P+ +L   CD   G C C      R CD C++ H
Sbjct: 1382 CPLGYSGLSCEACLPGFYRLRSQPGGRTPGPTLGTCVPCQCNGHSSLCDPETSICQNCQHHTAGDFCERCALGYYGIVKGLPNDCQQCACPLISSSN--------------NF----SPSCVAE-GLDDYRCTACP-----------------------RGYEGQYCERCAPGYTGSPGNPGGSCQECECDPYGSLPVPCDPVTGFCTCRPGATGRKCDGCKHWH 1564          

HSP 9 Score: 63.1586 bits (152), Expect = 6.770e-8
Identity = 61/224 (27.23%), Postives = 96/224 (42.86%), Query Frame = 2
Query: 4460 VTAVEKCICNALTFGNHCQNPISGYYKEYFNLPNSTKSGSMRTGNRILINLKKCNCNGYSKVC---DSVT---------------GDCQNCMGNREGNKCQLCREGFYKN---DKNYDQ-CEPCQC-PSAHYNFAQNCTRIESSLEL-----KCQCRIGYSGKSCENCQQGFYGNPIKGIPCKSCDCNQQGSQSLNCNE---FGICQCSPGVLGIKCDQCAPNY 5038
             T   +C C   T G+ C     G++++ +      ++G+  T        + CNC+G ++ C   ++V                G C NC  N  G  C+ C +GF++      NY + C+PC C P    N  + C + E           C C+ G+ G SC+ C +G+ G P     CK+C+C+  GS+    NE   FG C C   V G  C +C   +
Sbjct:  301 ATNKSRCECEHNTCGDSCDQCCPGFHQKPW------RAGTFLTKTEC----EACNCHGKAEECYYDENVARRNLSLNIRGKYIGGGVCINCTQNTAGINCETCTDGFFRPKGVSPNYPRPCQPCHCDPIGSLN--EVCVKDEKHARRGLAPGSCHCKTGFGGVSCDRCARGYTGYP----DCKACNCSGLGSK----NEDPCFGPCICKENVEGGDCSRCKSGF 504          

HSP 10 Score: 58.5362 bits (140), Expect = 1.468e-6
Identity = 56/201 (27.86%), Postives = 84/201 (41.79%), Query Frame = 2
Query: 3236 GRGS-LNPKCDMETGNCKCAQNVARRDCSKCDVGYFGLDVTGCKKCP--------PCY-NGQ--VCNNE-GICV-CPPNTIGNLCNKCSEDSWDFNETI--GCKKCNCYINGSYSNICNK--ISGI-----CACKTAFFGSKCDRCNEGYYGFP-----NCQPCSCAENGTKSNELTKCDKITGQCQCKQNVIGTKCKVCR 3754
            GRG+ + P  D+    C C    +   C  C  G++ L      + P        PC  NG   +C+ E  IC  C  +T G+ C +C+   +   + +   C++C C +  S +N        G+      AC   + G  C+RC  GY G P     +CQ C C   G+       CD +TG C C+    G KC  C+
Sbjct: 1365 GRGTTMTPPADL-IEKCDCPLGYSGLSCEACLPGFYRLRSQPGGRTPGPTLGTCVPCQCNGHSSLCDPETSICQNCQHHTAGDFCERCALGYYGIVKGLPNDCQQCACPLISSSNNFSPSCVAEGLDDYRCTACPRGYEGQYCERCAPGYTGSPGNPGGSCQECECDPYGSLP---VPCDPVTGFCTCRPGATGRKCDGCK 1561          

HSP 11 Score: 58.151 bits (139), Expect = 2.019e-6
Identity = 48/148 (32.43%), Postives = 66/148 (44.59%), Query Frame = 2
Query: 3218 CVPCNC-GRGSLNPKCDMETGNCK-CAQNVARRDCSKCDVGYFGLDVTG----CKKCP-PCYNGQ-----VCNNEGI-----CVCPPNTIGNLCNKCSED--SWDFNETIGCKKCNCYINGSYSNICNKISGICACKTAFFGSKCDRC 3604
            CVPC C G  SL   CD ET  C+ C  + A   C +C +GY+G+ V G    C++C  P  +        C  EG+       CP    G  C +C+        N    C++C C   GS    C+ ++G C C+    G KCD C
Sbjct: 1417 CVPCQCNGHSSL---CDPETSICQNCQHHTAGDFCERCALGYYGI-VKGLPNDCQQCACPLISSSNNFSPSCVAEGLDDYRCTACPRGYEGQYCERCAPGYTGSPGNPGGSCQECECDPYGSLPVPCDPVTGFCTCRPGATGRKCDGC 1560          
BLAST of Laminin subunit alpha-2 vs. UniProt/SwissProt
Match: sp|A0JP86|LAMC1_XENTR (Laminin subunit gamma-1 OS=Xenopus tropicalis OX=8364 GN=lamc1 PE=2 SV=1)

HSP 1 Score: 451.44 bits (1160), Expect = 7.733e-129
Identity = 314/1050 (29.90%), Postives = 497/1050 (47.33%), Query Frame = 2
Query:  197 NAKITSSATCGTGGPEIFCRLVDEIAIQRLINPDSHVLCDVCDNRNETKRHPIEFAKSDDDNL---WWQSPSMAQGLKY-QNVNVTIDLKQVYQIVYILLKMGDSPRPGNWIL-ERSLDGEIYMPWIFFAETPYSCYNLFQRQYPDLKLTTNAKPSSLADDEMFCTTYYSQPKSLNSGEIIISLINGRKSIMNEEYLSIKSVPQTLINFLSARYIRFRFLKHLTLAADLMTHKGYLEQSIYNRYYYSLRNIEIGGKCICNNHADKCDKVIENGISVAKCNCKHNTCGSNCETCCPLFNQRPWKPVAV-----CEECNCNRKSNECSYNQTVATLQLSVNKMGRMEG-GGVCINCQENTEGINCEKCIKGFYRPWNVLATELYPCTPCQCHGLGTIGSCVSNGEDIGDQKPGDCICKKGYEGVNCDLCSIGYERYPNGECLPCPCSIDGSVRTSFYRCKPPCNCKVHVNSDDLCKTCKNGYFNLDSANPEGCEPCYCFGITNQCSSLSAKNLKI------SDLKGWKLTTFTGEKIALPKFTSFQYLTSENSYIDERFNNPTVYYWTAPPPYLGNWITSYGTIFRYVVKIELQSTLKGSLIDSPDVIIKCGDFR-----LFHSVSIEDRRLQRQVFIYIKPTE--WKIGKLTPDKAATKEEFISCLVKVDKLLIKAKYYSNQKSIELLNITLSRGEVHLALDEMPHIEKCNCPPGFNGLSCESCESGYRRVNNVLYQG---QCEACACYNHSNTCDSLNGECQNCTHNTAGAHCEDCASGYYGDAKSKNLNSCKKCPCPRLDYQMTELCSSYSSENYVCHKCLHNTSGVHCDRCIEGYYGNP----KKKISCKRCKCNNNQE-----SCDPVTGEC-RCSYNTMGTECQLCKHGFYGDALTKS----CKKCDCDSLGST--SENCDKLTGKCDCRTNFVNRQCDSCTSGLY--LKDKKCIPCNCEIQGRISSEKFCNTTSGQCFCLENVNGDRCEKCVEGYFNY--PNCKKCLCSPHALSADCDLNNGKCKCGSNVINRICDKCENLHYWN 3205
            NA + ++ TCGT  PE +C       + +         C +CD+     +H  E+    ++     WWQS +M  G++Y   +N+T+ L + + I Y+ LK   S RP ++ L +R+ +   ++P+ +++ +    Y  F R +    + T        + +  CT  +S    L  G +  S + GR S  N +   +      L  +++A  IR    +  T   ++ +     +  +   YYY++ +  +GG+C CN HA +C   + N      CNCKHNT GS+CE C P +N RPW+         C  CNCN +S EC ++           ++ R  G GG C  C +NT+G NCE+C + +YR  N       PC  CQC+ +G++ +   N         G C CK G  G  CD C  G+       C PC C+  GS           C+CK +V   + C+ CK G+F+LD ANP GC PC+C+G ++ CSS     +        S ++GW      G + +L    S+   +S  S I E +      Y+ AP  +LGN   SYG    +  ++E + T     + + D++++    R     +    S      QR +F   + T+  W+        + +  EF   L  +  + I+  Y  +++S   L        V  A    P +E C+CP G+ G  CE C  GYRR N    QG    C  C C  HS+TCD  +G C +C HNTAG HCE C+ GYYGD+ + + + C+ CPCP      +       ++  VC  C   T+G  C+ C +GY+G+P         C+ C+C+NN +     +CD +TGEC +C YNT G  C  C+ GFYG+ L ++    C+ C C+  G+      C+++TG+C+C  +   R C +C  G Y  L  + C  C+C   G  S +  C+  +GQC C   ++G +C++C   +F +    CK C C P    +     +G+C+C S  +   CD+CE  +++N
Sbjct:   43 NATVVATNTCGTP-PEEYCVQTGVTGVTKS--------CHICDSGQFHLQHGAEYLTDYNNQAEITWWQSQTMLAGIQYPSTINLTLHLGKAFDITYVRLKFHTS-RPESFALYKRTHEDGPWIPYQYYSGSCEKTYQKFNRGF----IRTGED-----EQQALCTDEFSDISPLTGGNVAFSTLEGRPSAYNFDNSPV------LQEWVTATDIRVTLNRLNTFGDEVFS-----DPKVLKSYYYAISDFAVGGRCKCNGHASEC---VRNEFEKIVCNCKHNTFGSDCEKCLPFYNDRPWRRSTADSPNECLPCNCNGRSQECYFDP----------ELYRSTGHGGHCTGCADNTDGPNCERCRENYYRQDNN-----EPCHACQCNPVGSLSTQCDNY--------GRCSCKPGVMGEKCDRCQPGFHSLTEAGCRPCACNPAGSTDECNVETGR-CSCKDNVEGFN-CERCKPGFFHLDEANPRGCTPCFCYGHSSVCSSAEGYRVSSIVSTFESGVEGWTAQQRDGSEYSL----SWVSDSSAVSVISESY---FPIYFIAPAKFLGNQGASYGQNLTFSFRVERRDT----RLSAEDLVLEGAGLRVSVPLIAQGNSYPSETTQRYIFRMHEATDYPWR-------PSVSPFEFQKMLQNLTAIKIRGSY--SERSAGFLEEVSLVTAVAGAGPSAPWVEICSCPTGYIGQFCERCAPGYRRENPS--QGPYSPCVLCTCNGHSDTCDPESGVC-DCQHNTAGPHCERCSEGYYGDSTTGSASDCQPCPCP----GGSSCAVVPRTKEVVCTNCPLGTTGKRCELCDDGYFGDPLGENGAPRPCRICECSNNIDPNAVGNCDRLTGECLKCIYNTGGFYCDRCRDGFYGNPLAQNPDLKCRACSCNPYGTVKGQSGCNQVTGQCECLPHVTERDCSACEPGFYNLLSGRGCERCDCHSLGSTSGQ--CDVRTGQCECHPGISGQQCQQCEPNHFGFGPEGCKPCDCDPEGSGSLQCKEDGRCECKSGFVGTRCDQCEENYFYN 1005          

HSP 2 Score: 152.91 bits (385), Expect = 3.071e-35
Identity = 169/694 (24.35%), Postives = 273/694 (39.34%), Query Frame = 2
Query: 3083 KCLCSPHALSADCDLNNGK---CKCGSNVINRICDKCENLHYWNNR----------TDCVPCNC-GRGS---LNPKCDMETGNCKCAQNVARRDCSKCDVGYFGLDVTGCKKCPPCYNGQVCNNEGICVCPPNTIGNLCNKCSEDSWDFNETIGCKKCNCYINGSYSNICNKISGICACKTAFFGSKCDRCNEGYYGF--PNCQPCSCAENGTKSNELTKCDKITGQCQCKQNVIGTKCKVCRKGTFPSDGTYEGGCFSCFCFGVSEKCHAILNHRIVE-NSIYEYHIFDEKNSLESGKDYSTIHLNANYPRRFGWPLTMFRPIYVNVMKLFNSHDLSLFYRSIFMNVSVDCLDNKCGREIPEQTEVFMESYNGLFGMRYXXXXXXXXXXXXXXDFNEHSKNGKWVISQ---YQNDILDKFIILEDSNV---INSNLTRDIFMMALLNVTSLKVK-LYTDKVNPPLIKIKIITYKVMETTQAIGKRVTAVEKCICNALTFGNHCQNPISGYYKEYFNLPNSTKSGSMRTGNRILINLKKCNCNGYSKVCDSVTGDCQNCMGNREGNKCQLCREGFYKNDK--NYDQCEPCQCPSAHYNFAQNCTRIESSLELKC-QCRIGYSGKSCENCQQGFYGNPI----KGIPCKSCDCNQQGSQSLNCNEFGIC--------QCSPGVLGIKCDQCAPNY 5038
            +C C+ HA  ++C  N  +   C C  N     C+KC  L ++N+R           +C+PCNC GR      +P+    TG+                    G   TGC                      NT G  C +C E+ +  +    C  C C   GS S  C+   G C+CK    G KCDRC  G++      C+PC+C   G+      +C+  TG+C CK NV G  C+ C+ G F  D     GC  CFC+G S  C +   +R+    S +E  +         G +YS   ++ +           + PIY      F  +  + + +++  +  V+  D +   E     ++ +E      G+R  V                       +I+Q   Y ++   ++I             +++   F   L N+T++K++  Y+++    L ++ ++T          G     VE C C     G  C+    GY +E  N      S  +            C CNG+S  CD  +G C +C  N  G  C+ C EG+Y +    +   C+PC CP        +C  +  + E+ C  C +G +GK CE C  G++G+P+       PC+ C+C    S +++ N  G C        +C     G  CD+C   +
Sbjct:  268 RCKCNGHA--SECVRNEFEKIVCNCKHNTFGSDCEKC--LPFYNDRPWRRSTADSPNECLPCNCNGRSQECYFDPELYRSTGH--------------------GGHCTGCAD--------------------NTDGPNCERCRENYYRQDNNEPCHACQCNPVGSLSTQCDNY-GRCSCKPGVMGEKCDRCQPGFHSLTEAGCRPCACNPAGSTD----ECNVETGRCSCKDNVEGFNCERCKPGFFHLDEANPRGCTPCFCYGHSSVCSSAEGYRVSSIVSTFESGVEGWTAQQRDGSEYSLSWVSDSSA--VSVISESYFPIYFIAPAKFLGNQGASYGQNLTFSFRVERRDTRLSAE-----DLVLEGA----GLRVSVP----------------------LIAQGNSYPSETTQRYIFRMHEATDYPWRPSVSPFEFQKMLQNLTAIKIRGSYSERSAGFLEEVSLVT-----AVAGAGPSAPWVEICSCPTGYIGQFCERCAPGYRRE--NPSQGPYSPCVL-----------CTCNGHSDTCDPESGVC-DCQHNTAGPHCERCSEGYYGDSTTGSASDCQPCPCPG-----GSSCAVVPRTKEVVCTNCPLGTTGKRCELCDDGYFGDPLGENGAPRPCRICEC----SNNIDPNAVGNCDRLTGECLKCIYNTGGFYCDRCRDGF 851          

HSP 3 Score: 138.272 bits (347), Expect = 9.141e-31
Identity = 104/341 (30.50%), Postives = 142/341 (41.64%), Query Frame = 2
Query: 2594 GVHCDRCIEGYY-GNPKKKI--SCKRCKCNNNQESCDPVTGECRCSYNTMGTECQLCKHGFYGDALTKS---CKKCDCDS-------------------LGSTSE--------------------------------------NCDKLTGKC-DCRTNFVNRQCDSCTSGLYL------KDKKCIPCNCEIQGRISSEKFCNTTSGQCFCLENVNGDRCEKCVEGYFNY---PNCKKCLC-SPHALSADCDLNNGKCKCGSNVINRICDKCENLHYWNNRTDCVPCNC---GRGSLNPKCDMETGNCKCAQNVARRDCSKCDVGYF-GLDVTGCKKCPPCY 3382
            G  C+RC  GY   NP +     C  C CN + ++CDP +G C C +NT G  C+ C  G+YGD+ T S   C+ C C                     LG+T +                                      NCD+LTG+C  C  N     CD C  G Y        D KC  C+C   G +  +  CN  +GQC CL +V    C  C  G++N      C++C C S  + S  CD+  G+C+C   +  + C +CE  H+      C PC+C   G GSL  K   E G C+C        C +C+  YF      GC++CP CY
Sbjct:  681 GQFCERCAPGYRRENPSQGPYSPCVLCTCNGHSDTCDPESGVCDCQHNTAGPHCERCSEGYYGDSTTGSASDCQPCPCPGGSSCAVVPRTKEVVCTNCPLGTTGKRCELCDDGYFGDPLGENGAPRPCRICECSNNIDPNAVGNCDRLTGECLKCIYNTGGFYCDRCRDGFYGNPLAQNPDLKCRACSCNPYGTVKGQSGCNQVTGQCECLPHVTERDCSACEPGFYNLLSGRGCERCDCHSLGSTSGQCDVRTGQCECHPGISGQQCQQCEPNHFGFGPEGCKPCDCDPEGSGSLQCK---EDGRCECKSGFVGTRCDQCEENYFYNRSGPGCQECPACY 1018          

HSP 4 Score: 111.694 bits (278), Expect = 1.100e-22
Identity = 113/485 (23.30%), Postives = 200/485 (41.24%), Query Frame = 2
Query: 4613 KKCNCNGYSKV-----CDSVTGDCQNCMGNREGNKCQLCREGFYKNDKNYDQCEPCQCPSAHYNFAQNCTRIESSLELKCQCRIGYSGKSCENCQQGFYGNPIKGIPCKSCDCNQQGSQSLNCNEFGICQCSPGVLGIKCDQCAPNYVVEK-----KTCQSCYSGCT-------------KDLLVRIDTLNETVINFKWKTLPSTLDLRLNKINISIQMSSEL-------LNSIN-----KFYKLKNEIKNFSIQFQKMKDDAKEKYGEIEKLKTRYNKVLEDLRSTFTDINETISGHEQLGISNELIKNATAYLETIKNIYKEMPNITLAASVLKDVLKYVDELNQIIKYTQSHIQSDQINNLKI--LKNKTIMADEINTNNKEYLNTMSTKKKEHELYIILINERMKDLQKI-FRKMTKQRDNLRKKIQKLDAISKSFQDEKDLISINVREIEDLMKNLSSNHLVSKSLIIPDTLKKHVEQQL 5953
            + C+CN Y  V     C+ VTG C+ C+ +     C  C  GFY N  +   CE C C S      Q   R       +C+C  G SG+ C+ C+   +G   +G  CK CDC+ +GS SL C E G C+C  G +G +CDQC  NY   +     + C +CY                 +DLL  + T  E + +  ++      +  +N + +  Q S ++       L  IN     +  +L+N I++      K   +A+++    E +       LE  +    ++  +I+  E  G  N +   A    +  +   +E  +I  AA    D        N+ ++  Q  + S+    L I  L  K   A +I    ++  + +  + +E     + I   +  +  I    +  + D ++K+ ++LD+          LI   +R+ EDL +++    +  K+L+     ++    QL
Sbjct:  865 RACSCNPYGTVKGQSGCNQVTGQCE-CLPHVTERDCSACEPGFY-NLLSGRGCERCDCHSLGSTSGQCDVRTG-----QCECHPGISGQQCQQCEPNHFGFGPEG--CKPCDCDPEGSGSLQCKEDGRCECKSGFVGTRCDQCEENYFYNRSGPGCQECPACYRLVKDKVNEQRGKLQELEDLLKNLSTGEENITDQAFEERLREAEKAVNDLLLDAQSSKDVDQGMLDRLAEINTTLSFQLERLQN-IRDMIRDTDKQAQEARDRVENTEFIIDSARVQLEKAKMAIANV--SITPPESTGDPNNMTLLAEEARKLAERHMQEARDIEKAAKEANDT------ANEALRLLQKTLASENQTALDIEELNRKYAQAKDIARELEKQASKVHAEAEEAGNRALQIYANLTSVPSIDTTALQNEADKIQKEAEELDS----------LIDRKLRDYEDLREDMRGREMEVKNLLDKGKTEQQTADQL 1321          

HSP 5 Score: 106.301 bits (264), Expect = 4.355e-21
Identity = 106/376 (28.19%), Postives = 147/376 (39.10%), Query Frame = 2
Query: 2711 CRCSYNTMGTECQLCKHGFYGDALTKS----CKKCDCDSLGSTSENCDKLTGKCDCRTNFVNRQCDSCTSGLYLKD-----KKCIPCNCEIQGRISSEKFCNTTSGQCF-CLENVNGDRCEKCVEGYFNYPNCKKCLCSPHALSADCDLNNGKCKCGSNVINRICDKCENLHYWNNRTDCVPCNCGRGSLNPKCDMETGNC-KCAQNVARRDCSKCDVGYFGLDVT-----GCKKCPPCYNGQV-----CNN-EGICVCPPNTIGNLCNKCSEDSWDFNETIGCKKCNCYINGSYSNICNKISGICACKTAFFGSKCDRCNEGYYGF--PNCQPCSCAENGTKSNELTKCDKITGQCQCKQNVIGTKCKVCRKGTF 3766
            C C    +G  C+ C  G+  +  ++     C  C C+     S+ CD  +G CDC+ N     C+ C+ G Y          C PC C   G  S      T    C  C     G RCE C +GYF  P                         G N   R C  CE     +N  D  P   G       CD  TG C KC  N     C +C  G++G  +       C+ C     G V     CN   G C C P+     C+ C    ++     GC++C+C+  GS S  C+  +G C C     G +C +C   ++GF    C+PC C   G+ S    +C K  G+C+CK   +GT+C  C +  F
Sbjct:  673 CSCPTGYIGQFCERCAPGYRRENPSQGPYSPCVLCTCNG---HSDTCDPESGVCDCQHNTAGPHCERCSEGYYGDSTTGSASDCQPCPCP--GGSSCAVVPRTKEVVCTNCPLGTTGKRCELCDDGYFGDP------------------------LGENGAPRPCRICE----CSNNID--PNAVG------NCDRLTGECLKCIYNTGGFYCDRCRDGFYGNPLAQNPDLKCRACSCNPYGTVKGQSGCNQVTGQCECLPHVTERDCSACEPGFYNLLSGRGCERCDCHSLGSTSGQCDVRTGQCECHPGISGQQCQQCEPNHFGFGPEGCKPCDCDPEGSGS---LQC-KEDGRCECKSGFVGTRCDQCEENYF 1003          

HSP 6 Score: 95.5153 bits (236), Expect = 7.862e-18
Identity = 75/255 (29.41%), Postives = 108/255 (42.35%), Query Frame = 2
Query: 2660 RCKCNNNQESCDPVTGE-----CRCSYNTMGTECQLCKHGFYGDALTKSCKKCDCDSLGSTSENCDKLTGKCDCRTNFVNRQCDSCTSGLYLKDKKCIPCNCEIQGR---ISSEKFCNTT-SGQCF-CLENVNGDRCEKCVEGYFNYPN---CKKCLCSP-HALSADCDLNNGKCKCGSNVINRICDKCENLHYWNNRTDCVPCNCGRGSLNPKCDMETGNCKCAQNVARRDCSKCDVGYFGLDVTGCKKCPPCY 3382
            RCKCN +   C  V  E     C C +NT G++C+ C   FY D   +  ++   DS                                      +C+PCNC  + +      E + +T   G C  C +N +G  CE+C E Y+   N   C  C C+P  +LS  CD N G+C C   V+   CD+C+   +      C PC C       +C++ETG C C  NV   +C +C  G+F LD    + C PC+
Sbjct:  268 RCKCNGHASEC--VRNEFEKIVCNCKHNTFGSDCEKCLP-FYND---RPWRRSTADS------------------------------------PNECLPCNCNGRSQECYFDPELYRSTGHGGHCTGCADNTDGPNCERCRENYYRQDNNEPCHACQCNPVGSLSTQCD-NYGRCSCKPGVMGEKCDRCQPGFHSLTEAGCRPCACNPAGSTDECNVETGRCSCKDNVEGFNCERCKPGFFHLDEANPRGCTPCF 479          

HSP 7 Score: 78.1814 bits (191), Expect = 1.726e-12
Identity = 77/288 (26.74%), Postives = 118/288 (40.97%), Query Frame = 2
Query: 4295 NVINSNLTRDIFMMALLNVTSLKVKLYTDKV--NPPLIKIKIITYKVMETTQAIGKRV-----------TAVEKCICNAL--TFGNHCQNPISGYYKEYFNLPNSTKSGSMRTGNRILINLKKCNCNGYSKVC---------DSVTGDCQNCMGNREGNKCQLCREGFYKNDKNYDQCEPCQCPSAHYNFAQNCTRIESSLELKCQCRIGYSGKSCENCQQGFYGNPIKGIPCKSCDCNQQGSQSLNCN-EFGICQCSPGVLGIKCDQCAPNYV----VEKKTCQSCY 5071
            N  NS + ++      + VT  ++  + D+V  +P ++K    +Y    +  A+G R               EK +CN    TFG+ C+  +  Y    +      +  +  + N  L     CNCNG S+ C             G C  C  N +G  C+ CRE +Y+ D N + C  CQC     + +  C         +C C+ G  G+ C+ CQ GF+     G  C+ C CN  GS    CN E G C C   V G  C++C P +        + C  C+
Sbjct:  216 NFDNSPVLQEWVTATDIRVTLNRLNTFGDEVFSDPKVLK----SYYYAISDFAVGGRCKCNGHASECVRNEFEKIVCNCKHNTFGSDCEKCLPFYNDRPW------RRSTADSPNECL----PCNCNGRSQECYFDPELYRSTGHGGHCTGCADNTDGPNCERCRENYYRQDNN-EPCHACQCNPVG-SLSTQCDNYG-----RCSCKPGVMGEKCDRCQPGFHSLTEAG--CRPCACNPAGSTD-ECNVETGRCSCKDNVEGFNCERCKPGFFHLDEANPRGCTPCF 479          
BLAST of Laminin subunit alpha-2 vs. TrEMBL
Match: G7YIN3 (Laminin alpha 1/2 (Fragment) OS=Clonorchis sinensis OX=79923 GN=CLF_108864 PE=4 SV=1)

HSP 1 Score: 1343.56 bits (3476), Expect = 0.000e+0
Identity = 857/2689 (31.87%), Postives = 1321/2689 (49.13%), Query Frame = 2
Query:  158 EILSVNVDGLLMENAKITSSATCGTGGPEIFCRLVDE----IAIQRL------------INPDSH-------VLCDVCDNRNETKRHPIEFAKSDDDNLWWQSPSMAQGLKYQNVNVTIDLKQVYQIVYILLKMGDSPRPGNWILERSLDGEIYMPWIFFAETPYSCYNLFQRQYP-DLKLTTNAKPSSLADDEMFCTTYYSQPKSLNSGEIIISLINGRKSIMNEEYLSIKSVPQTLINFLSARYIRFRFLKHLTLAADLMTHKGYLEQSIYNRYYYSLRNIEIGGKCICNNHADKCDKVIENGISVAKCNCKHNTCGSNCETCCPLFNQRPWKPVAVCEECNCNRKSNECSYNQTVATLQLSVNKMGRMEGGGVCINCQENTEGINCEKCIKGFYRPWNVLATELYPCTPCQCHGLGTIGSCVSNGEDIGDQKPGDCICKKGYEGVNCDLCSIGYERYPN--GECLPCPCSIDGSVRTSFYRCKPPCNCKVHVNSDDLCKTCKNGYFNLDSANPEGCEPCYCFGITNQCSSLSAKNLKISDLKGWKLTTFTGEKIALPKFTSFQ----------YLTSENSYIDERFNNPTV------YYWTAPPPYLGNWITSYGTIFRYVVK-------------------------IELQSTLKGSLIDSPDVIIKCGDFRLFHSVS---------IEDRRLQRQVFIYIKPT----------EWKIGKLT---------------PDKAATKEEFISCLVKVDKLLIKAKYYSNQKSIELLNITLSRGEVHLALDEMPHIEKCNCPPGFNGLSCESCESGYRRVNNV-----------LYQGQCEACA---CYNHSNTCDSLNGECQNCTHNTAGAHCEDCASGYYGDAKSKNLNSCKKCPCPRLDYQMTELCSSYSS------ENYVCHKCLHNTSGVHCDRCIEGYYGNPKKKISCKRCKCNNNQESCDPVTGECRCSYNTMGTECQLCKHGFYGDALT-KSCKKCDCDSLGSTSENCDKLTGKCDCRTNFVNRQCDSCTSGLYLKDKKCIPCNCEIQG-RISSEKFCNTTSGQCFCLENVNGD-RCEKCVEGYFNY-PN-CKKCLCSPHALSADCDLNNGKCKCGSNVINRICDKCENLHYWN-NRTDCVPCNCGRGSL-------NPKCDMETGNCKCAQNVARRDCSKCDVGYFGLDVTGCKKCPPCYNGQVCNN-EGICVCPPNTIGNLCNKCSEDSWDFNETIGCKKCNCYINGSYSN---ICNKISGICACKTAFFGSKCDRCNEGYYGFPNCQPCSC------AENGTKSNELTKCDKITGQCQCKQNVIGTKCKVCRKGTFPSDGTYEGGCFSCFCFGVSE--KCHAILNHRIVENSIYEYHIFDEKNSLESGKDYSTIHLNANYPRR-----------FGWPLTMFRPIYVNVMKLFNSHDLSLFYRSIFMNVSVDCLD-NKCGREIPEQTEVFMESYNGLFGMRYXXXXXXXXXXXXXXDFNEHSKNGKWVISQYQ------NDILDKF--IILEDSNVINSNL---------TRDIFMMALLNVTSLKVKLYTDKVNPPLIKIKIITYKVM-ETTQAIGKRVTAVEKCICNALTFGNHCQNPISGYYKEYFN-------LPNSTKSGSMRTGNRILI--NLKKCNCNGYSKVCDSVTGDCQNCMGNREGNKCQLCREGFYKNDKNYDQCEPCQCPSAHYNFAQNCTRIESS--LELKCQCRIGYSGKSCENCQQGFYGNPIKGIPCKSCDCNQQGSQSLNCNE-FGICQCSPGVLGIKCDQCAPNYVVEKKTCQSCYSGCTKDLLVRIDTLNETVINFKWKTLPSTLDLRLNKINISIQMSSELLNSINKFYKLKNEIKNFSIQ-FQKMKDDAKEKYGEIEKLKTRYNKVLEDLRSTFTDINETISGHEQLGISNELIKNATAYLETIKNIYKEMPNITLAASVLKDVLKYVDELNQI-IKYTQSHIQS--DQINNLKILKNKTIMADEINTNNKEYLNTMSTKKKEHELYIILINERMKDLQKIFRKMTKQRDNLRKKIQKLDAISKSFQDEKDLISIN--------VREIEDLMKNLSSNHLVSK--------------------SLIIPDTLKKHVEQQLNKSSNLIKKLTKDFNFLHNAEQAKEAYSNITRDI-------LAVDYAINQTKKELDFNRSNMNIDSLKKLLAEFNSNKSEIVENIKNIDKEHEKLLKQYKNCSYXXXXXXXXXXXXSSEIPTGFYDVEILKRNLSXXXXXXXXXXXXFILPINQTILNLGTPNVKSGLDTRNLEKLIKVVDNQYR------------------DLVNESSFVENKIKDLRKSIKSLRERLQKARVMSELIHGAAARSVEPIRHVVRCVRHYVTYYLPTSNAFSLEFYMKPQILNDQSLVLFGYDDSGSIPHA--FAFTLERNNQ-YKFWYDSGNSVESIELTGKFSNENYVGIMITWKLGKWHMVIRSISDGRTEQVETSSITNNILSN-----VRIGPQTNIFVGGF-PSSKLLRSLKLEG---------RLISDLKENYDNYFYKGCLFGVKLMNTEFGLQDIEAIEEECRNTISIDNLLLGKFNCKFNPNSSIIFLDSNI-------ESVNTFKRSVRRQKRD--VQTNFDLHFTG-NGFAMIN 7405
            + L ++ D +L ENA+IT++ATCG    E +CRLV+     +  +RL              P S+       V C  CD RNE+ RHPIEF +S + +LWWQSPS+A+GLKY  V +T+D KQVYQIVY+LL+MGDSPRP NWILERSLDG+ Y PW+FFAE+ Y C  L++      L +T+  +P  L DDE++CTTYYSQP++L SGEII++L   R S ++      ++V   LI+FLSARY+R RF K  TL+ D M     L+ S+YNRYYYS+R I++GGKCICN+HA++C++ + +G+  A C C+HNTCG+NCETCCP+FNQ+PW+P  VCEECNC+ K++ C +NQTVA L+LS  K G  EGGGVC++C+E+T GINCE C  G+YRP +V      PC  C+C   G+ G CVSN  +I ++ PGDCICK+G+ G  CD C+ GY R      +C+ C C + GS R   YRC+PPCNCKV+VN D  C+ C+ GYFNLD+ NPEGC+PCYC G+T++C  +S     +S L GW +  F G         S++          +L ++   ++   +  ++      YYW+AP  YLG  +T+Y +    +++                         + ++  L    +  PD++++   +RL + +          IE   ++    + ++P           +   G LT               P + AT  + ++ L K+D+ LIK KY S+Q +IEL  + L R E       +P +E+C CP G  G SCESC  GY R  +V           +++G+ E C    C+ HS  CD   G+C +C HNTAG  CE CA G+YGD KS + ++C+ C CP L  + T  C +           Y+C  C   T G +C+ CIEGYYG P+K I C++C C      C+  TG C C +NT G  C  C  G +GD L  ++C+ C+C  +GS S  C    G+C CR  +   +CD C +G    D  C PC C   G + +    C+  +GQC C     G   C KC  GY++  P+ C +C+CS  A+   CD  +G+CKCG NV+   CDKC+  ++WN    +C+ C+CG G++          CDM+TG C+CA +V  R C++C+ GYFG+   GC+ CP C NGQ+C+   G C+CPPNT G+ C +C++ SWD+N   GCK CNC   GS S     C+ +SG C+CK  + G  CD+C+ GYYG+PNC+PC C        NGT+S  +T C+   G C CK NV G +C  C+ GTF  +  Y  GC++CFCF  ++  KC  +   R          I    +S   G   + I L+     R           F W  +  RP ++ + +L     L+  Y S+ + +  +CL    C    P+Q    + +     G    V  S+       VD    +  G+ V  +YQ      + I D +  I L +S+ + + +         +R+  M+AL+NVTS  V+L+  +  P L+ +K   Y+ M E   ++G  + ++EKC C + + G+HC+   SG+Y            LP    + ++R    I     ++KC C+G S  CD VTG CQ C GN  G  C  C EG++ + K    C  CQCP+   ++A  CT  +    +  +C C+ GY+G  CE C  G++G+P+  I C+ C+C+  GS+S NC++  G C C PG+ G +CDQC P++VV+   C+ C   CT +LL++ D +   + N             LN  +++ Q  + L   +    K  N+ +    Q   K      ++ GEI  L  R       +        E ++  ++   +  L +    +++ I+ +  EMP+  +    L+   K   +L++I +  TQ  +    D+IN L     +    D+ +    +     + + ++  L+    + ++K + +I     +    L+   +K DA+ K+  +  +L  I         +R+  D +  LS   L S+                     + +P  L   V + L + S  I    +    ++    A EAY +I  +I       +  + A+ ++     +      I  + K LAE +    E   N +N  +  ++++KQ  +      +++   +K  S+  +   +V+ +K+ L+               P+ + I  L     + G     L+  +K  +N+Y                    LV   +  E  IK L   +  LR    +AR M ++ +GA A+   PI     CV   V Y L  S  F +EF+ +    + ++  +        I H   FAFTLE   +  +F ++  N    +EL      E +  + +T   G+  M++    D  +++ +   +  N  +N     + +  Q  I +GG  PS   L + +  G         RL+S     +       C+F ++L  T  GL D+ A    C+           +  C+ + N   I  D +I       + V T  RS R+   +  +Q  F   F G  G+A I 
Sbjct:    6 DFLDMDPDSILEENAEITANATCGEHRREYYCRLVEHADGALIYKRLERERRQVMTYFQQQPRSYRDPSGQWVQCSFCDARNESLRHPIEFVRSGEPHLWWQSPSLAEGLKYHAVTITMDFKQVYQIVYVLLRMGDSPRPANWILERSLDGQNYKPWVFFAESEYDCKRLYEPLLEGPLTVTSGPRPWKLEDDEVYCTTYYSQPQALQSGEIIVTLSLDRASTISTTLGLERAVSPKLIDFLSARYVRLRFQKLQTLSGDWMAMPNQLDSSVYNRYYYSIRTIKVGGKCICNSHANRCEQRVVDGVPRAVCVCQHNTCGTNCETCCPMFNQQPWRPGRVCEECNCHGKADSCVFNQTVANLRLSQRKDGVFEGGGVCVDCREDTTGINCESCKPGYYRPVHVRPDSPNPCVRCECDTAGSTGVCVSNEREIPNRYPGDCICKEGFAGKRCDQCAEGYRRSDTDPSKCVACTCDVRGSSRGGSYRCEPPCNCKVNVNPDSYCRECQPGYFNLDAENPEGCQPCYCSGLTDKCDGISPITALVSTLNGWSI-LFPGTATDSGYLVSYRDDNVGEGESSFLLADIRVVESWLSAASLRPIDRGYYWSAPTDYLGKQLTAYRSQLTVILRFNSPTMQAFGVSYSPDTSRRISTSSLAIRDQLDAMWLSEPDIVLEGNGYRLAYILPPDYRANHLIIEIPLIESSFRVLVEPPSSVPLDRIPIDLSQGSLTSSRIAPYGGSNGMQLPGRPATIADMVAVLSKLDRFLIKVKYISDQATIELRQVKLERAERD-PDGRIPSLEECICPAGHTGTSCESCAFGYWRSQDVNVTTEPPRMLGMWRGRVEVCVPCECHGHSAHCDERTGKCTDCQHNTAGDKCELCAPGFYGDPKSGSPSACQPCECPNLANKKTGSCVANEQAPPTDLRPYLCLDCEDYTRGRYCELCIEGYYGQPEKGIPCQKCDCGRGAIGCNGTTGLCICGFNTAGPRCDACAEGTHGDPLLGQACRPCNCHEMGSVSPTCRLGDGQCTCRPGYEGVRCDRCVAGRGNVDAGCPPCQCSPLGTQQNVRPPCDQVTGQCVCKHGFGGTLDCSKCAPGYYSLGPDTCTECMCSSRAIDRVCDPEDGRCKCGENVVGNTCDKCKTGYFWNVTGPNCLACDCGIGTIIDGTVGGAVGCDMQTGQCRCAPHVTGRQCTECEPGYFGVSAKGCQPCPSCPNGQLCDQITGKCICPPNTQGDRCEECTKGSWDYNPVAGCKDCNCSEVGSVSGADTTCDLVSGKCSCKRGYTGRACDQCDAGYYGYPNCRPCECDPAGSLRPNGTEST-ITLCNPADGSCFCKANVQGERCDECKPGTFGLNIDYPLGCYTCFCFPSNQKPKCSLLTGFRSSRGREKGVEIIASDHSSTPGG--ALIQLDIGLKDRGNNDLTVGVSQFNWRFSDHRPTFLEIPEL--KGPLTRNYGSVVIELLTECLPMGDCHLNPPDQPSGLVVNGGAGVGPNTDVAGSLIVRRPYRVDAKMVAFGGR-VQLEYQPSDDAPSAIQDGYRQIWLRESDWVLTRVVDVDTRVRPSRNELMLALMNVTSFSVRLFMPEAKPKLVTVKYRIYQAMSEMKTSVGTPIRSIEKCECPSTSSGDHCEIASSGFYFPPLIPKPGTSLLPPDPSAPAIRDPQNIQWTGGVEKCRCHGMSSHCDPVTGVCQACTGNTVGPDCGQCAEGYFGDPKKGQTCVKCQCPTEQTDYAITCTPFQDRPYVAHQCVCKPGYTGPRCERCAPGYFGDPLSMIACQPCECDVSGSKSANCDQRTGACDCWPGIQGRRCDQCEPDHVVDAGRCRDCRGPCTGELLIKADEVKSQIDN-------------LNMTSLAYQGLARLGQQVEGARKRFNKERATKEQELVKHAHSVAKQTGEIRALADRVMATRNAIEVARCSSTENVTQLQK--TAQRLEQRVREWIQRIEELSVEMPDERVLQRWLEQARKVNTDLSKINLDSTQEWLDKLMDEINELISSAEQLSKLDKYSKTTADLERLTAYQSQQINLH----DAQIKLMYEISNSTARGNVRLKDAQEKSDALKKAATEAAELNVIQAFQESLEKLRKQIDQIATLSPEELQSRLDEAKAALKYITGIDLADLDGIYVPPNLLSGVVEPLERESERILSTLRYSTKINQTIVALEAYESIVNNIKKAEEATIKAEEALQESTGPESWQERREKIQLIGKKLAE-DVEAQEATVNSRN--ETLKEVIKQVDSSKMELDEVQKTADKTLSDAKSAIKNVQSVKQLLASTD------------PLTRNISALVE---QQGSLMSRLQNRLKSAENRYAKLQGTAQSAVDQANGTQTSLVKAITEAEESIKQLDSKLTHLRRLADEARSMLDVNYGALAQDPVPISLDRECVYSLVPYSLTKSRIFDIEFWFRLHASSSETDGVMMVGRRAFIGHTQMFAFTLESAGKTLRFSWNIPNG--KLELD-SIKEETWYQVRVTSMWGETKMMLLERPDEGSQKPQYREVATNASANYPESALMLDRQMEIRIGGANPSQSRLLNPEAWGDNGAEVFWTRLLSLDSTQF-------CIFNLRLGATAIGLVDLAAASSGCQQP--------SRMVCQIS-NYRPIVRDGHIWRTQGKMDDVTTTPRSPRKSPPNFVLQRMFFYDFAGAGGYARIQ 2630          
BLAST of Laminin subunit alpha-2 vs. TrEMBL
Match: A0A074ZCC3 (Uncharacterized protein OS=Opisthorchis viverrini OX=6198 GN=T265_10681 PE=4 SV=1)

HSP 1 Score: 1323.53 bits (3424), Expect = 0.000e+0
Identity = 851/2705 (31.46%), Postives = 1325/2705 (48.98%), Query Frame = 2
Query:  110 FILLIVHKAHSQDDEP-----EILSVNVDGLLMENAKITSSATCGTGGPEIFCRLVDE----IAIQRL------------INPDSH-------VLCDVCDNRNETKRHPIEFAKSDDDNLWWQSPSMAQGLKYQNVNVTIDLKQVYQIVYILLKMGDSPRPGNWILERSLDGEIYMPWIFFAETPYSCYNLFQRQYPD-LKLTTNAKPSSLADDEMFCTTYYSQPKSLNSGEIIISLINGRKSIMNEEYLSIKSVPQTLINFLSARYIRFRFLKHLTLAADLMTHKGYLEQSIYNRYYYSLRNIEIGGKCICNNHADKCDKVIENGISVAKCNCKHNTCGSNCETCCPLFNQRPWKPVAVCEECNCNRKSNECSYNQTVATLQLSVNKMGRMEGGGVCINCQENTEGINCEKCIKGFYRPWNVLATELYPCTPCQCHGLGTIGSCVSNGEDIGDQKPGDCICKKGYEGVNCDLCSIGYER--YPNGECLPCPCSIDGSVRTSFYRCKPPCNCKVHVNSDDLCKTCKNGYFNLDSANPEGCEPCYCFGITNQC---SSLSAKNLK-------ISDLKGWKLTTFTGEKIALPKFTSFQ----------YLTSENSYIDERFNNPTV------YYWTAPPPYLGNWITSYGTIFRYVVK-------------------------IELQSTLKGSLIDSPDVIIKCGDFRLFHSVSIEDRRLQRQVFIYIKPTEWKI----------------------------------GKLTPDKAATKEEFISCLVKVDKLLIKAKYYSNQKSIELLNITLSRGEVHLALDEMPHIEKCNCPPGFNGLSCESCESGYRRVNNV-----------LYQGQ---CEACACYNHSNTCDSLNGECQNCTHNTAGAHCEDCASGYYGDAKSKNLNSCKKCPCPRLDYQMTELCSSYSS------ENYVCHKCLHNTSGVHCDRCIEGYYGNPKKKISCKRCKCNNNQESCDPVTGECRCSYNTMGTECQLCKHGFYGDALT-KSCKKCDCDSLGSTSENCDKLTGKCDCRTNFVNRQCDSCTSGLYLKDKKCIPCNCEIQG-RISSEKFCNTTSGQCFCLENVNGD-RCEKCVEGYFNY-PN-CKKCLCSPHALSADCDLNNGKCKCGSNVINRICDKCENLHYWN-NRTDCVPCNCGRGSL-------NPKCDMETGNCKCAQNVARRDCSKCDVGYFGLDVTGCKKCPPCYNGQVCNN-EGICVCPPNTIGNLCNKCSEDSWDFNETIGCKKCNCYINGSYSN---ICNKISGICACKTAFFGSKCDRCNEGYYGFPNCQPCSC------AENGTKSNELTKCDKITGQCQCKQNVIGTKCKVCRKGTFPSDGTYEGGCFSCFCFGVSE--KCHAILNHRIVENSIYEYHIFDEKNSLESGKDYSTIHLNANYPRR-----------FGWPLTMFRPIYVNVMKLFNSHDLSLFYRSIFMNVSVDCLD-NKCGREIPEQTEVFMESYNGLFGMRYXXXXXXXXXXXXXXDFNEHSKNGKWVISQYQ------NDILDKF--IILEDSNVINSNL---------TRDIFMMALLNVTSLKVKLYTDKVNPPLIKIKIITYKVM-ETTQAIGKRVTAVEKCICNALTFGNHCQNPISGYYKEYFN-------LPNSTKSGSMRTGNRILI--NLKKCNCNGYSKVCDSVTGDCQNCMGNREGNKCQLCREGFYKNDKNYDQCEPCQCPSAHYNFAQNCTRIESS--LELKCQCRIGYSGKSCENCQQGFYGNPIKGIPCKSCDCNQQGSQSLNCNE-FGICQCSPGVLGIKCDQCAPNYVVEKKTCQSCYSGCTKDLLVRIDTLNETVINFKWKTLP--STLDLRLNKINISIQMSSELLNSINKFYKLKNEIKNFSIQFQKMKDDAKEKYGEIEKLKTRYNKVLEDLRSTFT----DINETISGHEQLGISNELIKNATAYLETIKNIYKEMPNITLAASVLKDVLKYVDELNQIIKYTQSHIQSDQIN----NLKILKNKTIMADEINTNNKEYLNTMSTKKKEHELYIILINERMKDLQKIFRKMTKQ------RDNLRKKIQKLDAISKSFQDEKDLISINVREIEDLMKNLSSNHLVS-KSLIIPDTLKKHVEQQLNKSSNLIKKLTKDFNFLHNAEQAKEAYSNITRDI-------LAVDYAINQTKKELDFNRSNMNIDSLKKLLAEFNSNKSEIVENIKNIDKEHEKLLKQYKNCSYXXXXXXXXXXXXSSEIPTGFYDVEILKRNLSXXXXXXXXXXXXFILPINQTILNLGTPNVKSGLDTRNLEKLIKVVDNQYR------------------DLVNESSFVENKIKDLRKSIKSLRERLQKARVMSELIHGAAARSVEPIRHVVRCVRHYVTYYLPTSNAFSLEFYMKPQILNDQSLVLFGYDDSGSIPHA--FAFTLERNNQ-YKFWYDSGNSVESIELTGKFSNENYVGIMITWKLGKWHMVIRSISDGRTEQVETSSITNNILSN-----VRIGPQTNIFVGGF-PSSKLLRSLKLEG---------RLISDLKENYDNYFYKGCLFGVKLMNTEFGLQDIEAIEEECRNTISIDNLLLGKFNCKFNPNSSIIFLDSNI-------ESVNTFKRSVRRQKRD--VQTNFDLHFTG-NGFAMIN 7405
             + LI+  A+ Q   P     + L ++ D +L ENA+IT++ATCG    E +CRLV+     +  +RL              P S+       V C  CD RNE+ RHPIEF +S + +LWWQSPS+A+GLKY           VYQIVY+LL+MGDSPRP NWILERSLDG+ Y PW+FFAE+ Y C  L++      L +T+  +P  L DDE++CTTYYSQP++L SGEII++L   R S ++      ++V   LI+FLSARY+R RF K  TL+ D M     L+ S+YNRYYYS+R I++GGKCICN+HA++C++ + +G+  A C C+HNTCG+NCETCCP+FNQ+PW+P  VCEECNC+ K++ C +NQTVA L+LS  K G  EGGGVC++C+E+T GINCE C  G+YRP +V     +PC  C+C   G+ G CVSN  +I ++ PGDCICK+G+ G  CD C+ GY R      +C+PC C + GS R   YRC+PPCNCKV+VN D  C+ C+ GYFNLD+ NPEGC+PCYC G+T++C   S ++A  L+       +S L GW +  F G         S++          +L ++   ++   +  ++      YYW+AP  YLG  +T+Y +    +++                         + ++  L    +  PD++++   +RL + +  + R     + I +  + +++                                  G   P + AT  + ++ L K+D+ LIK KY S+Q +IEL  + L R E       +P +E+C CP G  G SCESC  GY R  +V           +++GQ   C  C C+ HS  CD   G+C +C HNTAG  CE CA G+YGD KS +  +C+ C CP L  + T+ C +           Y+C  C   T G +C+ CIEGYYG P+K I C++C C      C+  TG C C +NT G  C  C  G +GD L  ++C+ C+C  +GS S  C    G+C CR  +   +CD C +G    D  C PC C   G + +    C+  +GQC C     G   C KC  GY++  P+ C +C+CS  A+   CD  +G+CKCG NV+   CDKC+  ++WN    +C+ C+CG G++          CDM+TG C+CA +V  R C++C+ GYFG+   GC+ CP C NGQ+C+   G C+CPPNT G+ C +C++ SWD+N   GCK CNC   GS S     C+ +SG C+CK  + G  CD+C+ GYYG+PNC+PC C        NGT+S  +T C+   G C CK NV G +C  C+ GTF  +  Y  GC++CFCF  ++  KC  +   R          I    +S   G   + I L+     R           F W  +  RP ++ + +L     L+  Y S+ + +  +CL    C    P++   F+ +     G    V  S+   +   VD    +  G+ V  +YQ      + I D +  I L +S+ + + +         +R+  M+AL+NVTS  V+L+  +  P L+ +K   Y+ M E   ++G  + ++EKC C + + G+HC+   SG+Y            LP    + ++R    I     ++KC C+G S  CD VTG CQ C GN  G  C  C EG++ + K    C  CQCP+   ++A  CT  +    +  +C C+ GY+G  CE C  G++G+P+  I C+ C+C+  GS+S NC++  G C C PG+ G +CDQC P++VV+   C+ C   CT +LL++ D +   + N    +L       LR        + S E      +  K  + +   + + + + D        IE  +    + +  L+ T       + E I   E+L +     +    +LE  + +  ++ NI L  S  + + K +DE+N++I   +   + D+ +    +L+ L        +++    + +  +S       + +    E+   L+K   +  +       +++L K  +++D I+    +E   +   + E +  +K ++   L     + +P  L   V + L + S  I    +    ++    A EAY +I  ++       +  + A+ ++     +      I  + K LAE    +   V +     KE   ++KQ  +      +++   +K  S+  +   +V+ +K+ L+               P+ + I  L     + G     L+  +K  +N+Y                    LV   +  E  IK L   +  LR    +AR M ++ +GA A+   PI     CV   V Y L  S  F +EF+ +    + ++  +        I H   FAFTLE   +  +F ++  N    +EL      E +  + +T   G+  M++    D  +++ +   +  N  +N     + +  Q  I +GG  PS   L + +  G         RL+S     +       C+F +++  T  GL D+ A    C+           +  C+ + N   I  D +I       ++V    RS RR   +  +Q  F   F G  G+A I 
Sbjct:   10 LLSLILFTAYGQGYLPYTYDSDFLDMDPDSILEENAEITANATCGEHRREYYCRLVEHADGALIYKRLERDRRQVMTYFQQQPRSYRDPSGQWVQCSFCDARNESLRHPIEFVRSGEPHLWWQSPSLAEGLKYH---------AVYQIVYVLLRMGDSPRPANWILERSLDGQNYKPWVFFAESEYDCKRLYEPLLEGALTVTSGPRPWKLEDDEVYCTTYYSQPQALQSGEIIVTLSLDRASTISTTLGLERAVSPKLIDFLSARYVRLRFQKLQTLSGDWMAMPNQLDSSVYNRYYYSIRTIKVGGKCICNSHANRCEQRVVDGVPRAVCVCQHNTCGTNCETCCPMFNQQPWRPGRVCEECNCHGKADSCVFNQTVANLRLSQRKDGVFEGGGVCVDCREDTTGINCESCKPGYYRPLHVRPDSPHPCVKCECDTAGSTGVCVSNEREIPNRYPGDCICKEGFAGKRCDQCAEGYRRSDMDPSKCVPCTCDVRGSSRGGSYRCEPPCNCKVNVNPDSYCRECQPGYFNLDAENPEGCQPCYCSGLTDKCDGISPITALTLEQNGLLGAVSTLNGWSI-LFPGTSTDSGYLVSYRDDNGGEGESSFLLADVRIVESWLSAASLRPIDRGYYWSAPTDYLGKQLTAYRSQLTVILRFNSPTMQAFGVSYSSDTSRRISTSSLAIRDQLDAMWLSEPDIVLEGNGYRLAYMLPPDYRANHLIIEIPLSESSFRVLVEPPSSVPLDRIPIDLSQGSLASSRIAPYGGSNGIQLPGRPATIADMVAVLSKLDRFLIKVKYISDQATIELRQVKLERAERD-PDGRIPSLEECICPVGHTGTSCESCAFGYWRSQDVNVTTEQPTILGMWRGQVEKCVPCECHGHSAHCDERTGKCTDCQHNTAGDKCELCAPGFYGDPKSGSPTACQPCECPNLANKKTDSCVANEQSPPTDLRPYLCLDCEDFTRGRYCELCIEGYYGQPEKGIPCRKCDCGRGAVGCNGTTGLCICGFNTAGPRCDACAEGTHGDPLLGQACRPCNCHEMGSVSPTCRLGDGQCTCRPGYEGVRCDRCVAGRGNVDAGCPPCQCSPLGTQQNVRPPCDQVTGQCVCKHGFGGTLDCSKCAPGYYSLGPDTCTECMCSSRAIDRVCDPEDGRCKCGENVVGITCDKCKAGYFWNVTGPNCLACDCGIGTIVDGTVGGAVGCDMQTGQCRCAPHVTGRQCTECEPGYFGVSAKGCQPCPSCPNGQLCDQITGKCICPPNTQGDRCEECTKGSWDYNPVTGCKDCNCSEVGSVSGADTTCDLVSGKCSCKRGYTGRACDQCDAGYYGYPNCRPCECDPAGSLRPNGTEST-ITLCNPTDGSCFCKANVQGDRCDECKPGTFGLNIDYPLGCYTCFCFPSNQKPKCSLLTGFRSSRGREKGVEIIASDHSSTPGG--ALIQLDIGLKDRGHNDLTVGVSQFNWRFSDHRPTFLEIPEL--KGPLTRNYGSVVIELLTECLPMGDCHLNPPDEPSGFVVNGGAGVGPNTDVAGSLIVRHPYRVDAKMVAFGGR-VQLEYQPSDDAPSAIQDGYRQIWLRESDWVLTRVVDVDTRVRPSRNELMLALMNVTSFSVRLFMPEARPKLVTVKYRIYQAMSEMKTSVGTPIRSIEKCECPSTSSGDHCEIASSGFYFPPLIPKPGTSLLPPDPSAPAIRDSQNIQWTGGVEKCRCHGMSSHCDPVTGVCQACTGNTVGPDCGQCAEGYFGDPKKGQTCVKCQCPTEQTDYAITCTPFQDRPYVAHQCVCKPGYTGPRCERCAPGYFGDPLSMIACQPCECDLSGSKSANCDQRTGACDCWPGIQGRRCDQCEPDHVVDAGRCRDCRGPCTGELLIKADEVKAQIDNLNMTSLAYQGLARLRQQAEGARKRFSKERATKEQELVKHAHSVAKQTGEIRALADRVMATRNAIEVARCSSTENVTQLQKTAQRFEHRVREWIQRIEELSVEMPDERVLQRWLEQARKVNTDLSNINL-DSTQEWLDKLMDEINEVISSAEQLSKLDKYSKTTADLERLTAYQSQQVKLHDAQIKLMYEISNSTARGNVRLNAAQEKSDALKKAATEAAELNVIQAFQESLEKLQEQIDQIATIPPEE---LQSRLDEAKAALKYITGIDLADLDGIYVPSNLLSGVVEPLERESERILSTLRYSTKINQTIVALEAYESIANNMKKAEEATIKAEEALQESTGPESWQERREKIQLIGKKLAEAMEAQEATVNSRNETLKE---VMKQVDSSKMELDEVQKTADKTLSDAKSAIKNVQSVKQLLASTD------------PLTKNISALVE---QQGSLMNRLQSRLKSAENRYAKLQGTAQSAVDQANGTQTSLVKAITEAEESIKQLDSKLTHLRRLADEARSMLDVNYGALAQDPVPISLDRDCVYSLVPYSLTKSRIFDIEFWFRLHGSSSETDGVMMVGRRAFIGHTQMFAFTLESAGKTLRFSWNIPNG--KLELD-SIREEIWYQVRVTSMWGETKMMLLERPDEGSQKPQYREVATNASANYPESALMLDRQMEIRIGGANPSQSRLLNPEAWGDNGAEVFWTRLLSLDSTQF-------CIFNLRIGATAVGLVDLAAASSGCQQP--------SRMVCQIS-NYRPIVRDGHIWRTQGKMDNVTATPRSPRRSPPNFVLQRMFFYDFAGAGGYARIQ 2656          
BLAST of Laminin subunit alpha-2 vs. TrEMBL
Match: A0A4S2LAR7 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_008536 PE=4 SV=1)

HSP 1 Score: 1307.74 bits (3383), Expect = 0.000e+0
Identity = 805/2454 (32.80%), Postives = 1237/2454 (50.41%), Query Frame = 2
Query:  158 EILSVNVDGLLMENAKITSSATCGTGGPEIFCRLV---DEIAIQRLIN---------------PDSH-------VLCDVCDNRNETKRHPIEFAKSDDDNLWWQSPSMAQGLKYQNVNVTIDLKQVYQIVYILLKMGDSPRPGNWILERSLDGEIYMPWIFFAETPYSCYNLFQRQYPD-LKLTTNAKPSSLADDEMFCTTYYSQPKSLNSGEIIISLINGRKSIMNEEYLSIKSVPQTLINFLSARYIRFRFLKHLTLAADLMTHKGYLEQSIYNRYYYSLRNIEIGGKCICNNHADKCDKVIENGISVAKCNCKHNTCGSNCETCCPLFNQRPWKPVAVCEECNCNRKSNECSYNQTVATLQLSVNKMGRMEGGGVCINCQENTEGINCEKCIKGFYRPWNVLATELYPCTPCQCHGLGTIGSCVSNGEDIGDQKPGDCICKKGYEGVNCDLCSIGYER--YPNGECLPCPCSIDGSVRTSFYRCKPPCNCKVHVNSDDLCKTCKNGYFNLDSANPEGCEPCYCFGITNQC---SSLSAKNLK-------ISDLKGWKLTTFTGEKIALPKFTSFQ----------YLTSENSYIDERFNNPTV------YYWTAPPPYLGNWITSYGTIFRYVVK-------------------------IELQSTLKGSLIDSPDVIIKCGDFRLFHSVSIEDRRLQRQVFIYIKPTEWKI-------------------GKLT---------------PDKAATKEEFISCLVKVDKLLIKAKYYSNQKSIELLNITLSRGEVHLALDEMPHIEKCNCPPGFNGLSCESCESGYRRVNNV-----------LYQGQCEACA---CYNHSNTCDSLNGECQNCTHNTAGAHCEDCASGYYGDAKSKNLNSCKKCPCPRLDYQMTELC------SSYSSENYVCHKCLHNTSGVHCDRCIEGYYGNPKKKISCKRCKCNNNQESCDPVTGECRCSYNTMGTECQLCKHGFYGDALT-KSCKKCDCDSLGSTSENCDKLTGKCDCRTNFVNRQCDSCTSGLYLKDKKCIPCNCEIQG-RISSEKFCNTTSGQCFCLENVNGD-RCEKCVEGYFNY-PN-CKKCLCSPHALSADCDLNNGKCKCGSNVINRICDKCENLHYWN-NRTDCVPCNCGRGSL-------NPKCDMETGNCKCAQNVARRDCSKCDVGYFGLDVTGCKKCPPCYNGQVCNN-EGICVCPPNTIGNLCNKCSEDSWDFNETIGCKKCNCYINGSYSN---ICNKISGICACKTAFFGSKCDRCNEGYYGFPNCQPCSC------AENGTKSNELTKCDKITGQCQCKQNVIGTKCKVCRKGTFPSDGTYEGGCFSCFCFGVSE--KCHAILNHRIVENSIYEYHIFDEKNSLESGKDYSTIHLNANYPRR-----------FGWPLTMFRPIYVNVMKLFNSHDLSLFYRSIFMNVSVDCLD-NKCGREIPEQTEVFMESYNGLFGMRYXXXXXXXXXXXXXXDFNEHSKNGKWVISQYQ------NDILDKF--IILEDSNVINSNL---------TRDIFMMALLNVTSLKVKLYTDKVNPPLIKIKIITYKVM-ETTQAIGKRVTAVEKCICNALTFGNHCQNPISGYYKEYFN-------LPNSTKSGSMRTGNRILI--NLKKCNCNGYSKVCDSVTGDCQNCMGNREGNKCQLCREGFYKNDKNYDQCEPCQCPSAHYNFAQNCTRIESS--LELKCQCRIGYSGKSCENCQQGFYGNPIKGIPCKSCDCNQQGSQSLNCNE-FGICQCSPGVLGIKCDQCAPNYVVEKKTCQSCYSGCTKDLLVRIDTLNETVINFKWKTLPSTLDLRLNKI--NISIQMSSELLNSINKFYKLKNEIKNFSIQFQKMKDDAKEKYGEIEKLKTRYNKVLEDLRSTFT----DINETISGHEQLGISNELIKNATAYLETIKNIYKEMPNITLAASV---------LKDVLKYVDELNQIIKYTQS-----HIQSDQINNLKILKNKTIMADEI-NTNNKEYLNTMSTKKKEHELYIILINERMKDLQKIFRKMTKQRDNLRKKIQKLDAISKSFQDEKDLISINVREIEDLMKNLSSNHLVS-KSLIIPDTLKKHVEQQLNKSSNLIKKLTKDFNFLHNAEQAKEAYSNITRDI-------LAVDYAINQTKKELDFNRSNMNIDSLKKLLAE--------FNSNKSEIVENIKNIDKEHEKLLKQYKNCSYXXXXXXXXXXXXSSEIPTGFYDVEILKRNLSXXXXXXXXXXXXFILPINQTILNLGTPNVKSGLDTRNLEKLIKVVDNQYRDLVNESSFVENKIKDLRKSIKSLRERLQKARVMSELIHGAAARSVEPIRHVVRCVRHYVTYYLPTSNAFSLEFYMKPQILNDQSLVLFGYDDSGSIPHA--FAFTLE 6802
            + L ++ D +L ENA+IT++ATCG    E +CRLV   DE  I + I+               P S+       V C  CD RNE+ RHPIEF +S + +LWWQSPS+A+GLKY  V +T+D KQVYQIVY+LL+MGDSPRP NWILERSLDG+ Y PW+FFAE+ Y C  L++      L +T+  +P  L DDE++CTTYYSQP++L SGEII++L   R S ++      ++V   LI+FLSARY+R RF K  TL+ D M     L+ S+YNRYYYS+R I++GGKCICN+HA++C++ +  G+  A C C+HNTCG+NCETCCP+FNQ+PW+P  VCEECNC+ K++ C +NQTVA L+LS  K G  EGGGVC++C+E+T GINCE C  G+YRP +V      PC  C+C   G+ G CVSN  +I ++ PGDCICK+G+ G  CD C+ GY R      +C+ C C + GS R   YRC+PPCNCKV+VN D  C+ C+ GYFNLD+ NPEGC+PCYC G+T++C   S ++A  L+       +S L GW +  F G         S++          +L ++   ++   +  ++      YYW+AP  YLG  +T+Y +    +++                         + ++  L    +  PD++++   +RL + +  + R     + I +  + +++                   G LT               P + AT  + ++ L K+D+ LIK KY S+Q +IEL  + L R E       +P +E+C CP G  G SCESC  GY R  +V           +++G+ E C    C+ HS  CD   G+C +C HNTAG  CE CA G+YGD KS + ++C+ C CP L  + T+ C      S      Y+C  C   T G +C+ CIEGYYG P K I C++C C      C+  TG C C +NT G  C  C  G +GD L  ++C+ C+C  +GS S  C    G+C CR  +   +CD C +G    D  C PC C   G + +    C+  +GQC C     G   C KC  GY++  P+ C +C+CS  A+   CD  +G+CKCG NV+   CDKC+  ++WN    +C+ C+CG G++          CDM+TG C+CA +VA R C++C+ GYFG+   GC+ CP C NGQ+C+   G C+CPPNT G+ C +C++ SWD+N   GCK CNC   GS S     C+  SG C+CK  + G  CD+C+ GYYG+PNC+PC C        NGT+S  +T C+   G C CK NV G +C  C+ GTF  +  Y  GC++CFCF  S+  KC  +   R          I    +S   G   + I L+     R           F W  +  RP ++ + +L     L+  Y S+ + +  +CL    C    P+Q   F+ +     G    V  S+       VD    +  G+ V  +YQ      + I D +  I L +S+ + + +         +R+  M+AL+NVTS  V+L+  +  P L+ +K   Y+ M E   ++G  + ++EKC C + + G+HC+   SG+Y            LP    + ++R    I     ++KC C+G S  CD VTG CQ C GN  G  C  C EG++ + K    C  CQCP+   ++A  CT  +    +  +C C+ GY+G  CE C  G++G+P+  I C+ C+C+  GS+S NC++  G C C PG+ G +CDQC P++VV+   C+ C   CT +LL++ D +   + N    +L      RL +       + + E      +  K  + +   + + + + D        IE  +    + +  L+ T       + E I   E+L +     +    +LE  + +  ++  I L ++          +++V+   ++L+++ KY+++      + + Q   +K+   +  +  EI N+  +  +   + ++K   L          ++ + F      +++L K  +++D I+    +E   +   + E +D +K ++   L     + +P  L   V + L + S  +         ++    A EAY +I  ++       +  + A+ ++     +      I  + K LAE         NS    + E +K +D    +L +  K         K+  + + S +       + L RN+S +  +Q ++       +N+    L +   +        +  +   +     LV      E  IK L   +  LR    +AR M ++ +GA A+   PI     CV   V Y L  S  F +EF+ +    + ++  +        I H   FAFTLE
Sbjct:   31 DFLDMDPDSILEENAEITANATCGEQRREYYCRLVEHADEALIYKRISLEREKRQVMTYFQQQPRSYRDPSGQWVQCSFCDARNESLRHPIEFVRSGEPHLWWQSPSLAEGLKYHAVTITMDFKQVYQIVYVLLRMGDSPRPANWILERSLDGQNYKPWVFFAESEYDCKRLYEPLLEGPLTITSGPRPWKLEDDEVYCTTYYSQPQALQSGEIIVTLSLDRASTISTTLGLERAVSPKLIDFLSARYVRLRFQKLQTLSGDWMAMPNQLDSSVYNRYYYSIRTIKVGGKCICNSHANRCEQRVVEGVPRAVCVCQHNTCGTNCETCCPMFNQQPWRPGRVCEECNCHGKADSCVFNQTVANLRLSQRKDGVFEGGGVCVDCREDTTGINCESCKPGYYRPVHVRPDSPNPCVRCECDTAGSTGVCVSNEREIPNRYPGDCICKEGFAGKRCDQCAEGYRRSDMDPSKCVACTCDVRGSSRGGSYRCEPPCNCKVNVNPDSYCRECQPGYFNLDAENPEGCQPCYCSGLTDKCDGISPITALTLEQNGLLGAVSTLNGWSIL-FPGTATDSGYLVSYRDDNVGEGESTFLLADVRVVESWLSAASLRPIDRGYYWSAPTDYLGKQLTAYRSQLTVILRFNSPTMQAFGVSYSSDTSRRISTSSLAIRDQLDAMWLSEPDIVLEGNGYRLAYMLPPDYRASHLIIEIPLTESSFRVLVEPPSSVPLDRIPIDLSQGSLTSSRIAPYGGSNGMQLPGRPATIADMVAVLSKLDRFLIKVKYISDQATIELRQVKLERAERD-PDGRIPSLEECICPVGHTGTSCESCAFGYWRSQDVNVTTEQPTMLGMWRGRVEVCVPCECHGHSAHCDERTGKCTDCQHNTAGDKCELCAPGFYGDPKSGSPSACQPCECPNLANKKTDSCVANEQASPADLRPYLCLDCEDYTRGRYCELCIEGYYGQPDKGIPCRKCDCGRGAIGCNGTTGLCICGFNTAGPRCDACAEGTHGDPLLGQACRPCNCHEMGSVSPTCRLGDGQCTCRPGYEGVRCDRCVAGRGNVDAGCPPCQCSPLGTQQNIRPPCDQVTGQCVCKHGFGGTLDCSKCGPGYYSLGPDRCTECMCSSRAIDRVCDPEDGRCKCGENVVGITCDKCKAGYFWNVTGPNCLACDCGIGTIIDGTVGGAVGCDMQTGQCRCAPHVAGRQCTECEPGYFGVSAKGCQPCPSCPNGQLCDQITGKCICPPNTQGDRCEECTKGSWDYNPVTGCKDCNCSEVGSVSGADTTCDLGSGKCSCKRGYTGRACDQCDAGYYGYPNCRPCECDPAGSLRPNGTEST-ITLCNPTDGSCFCKTNVQGDRCDECKPGTFGLNIDYPLGCYTCFCFPSSQKPKCSLLTGFRSSRGREKSVEIIASDHSSTPGG--ALIQLDIGLKDRGNNDLTVGVSQFNWRFSDHRPTFLEIPEL--KGPLTRNYGSVVIELLTECLPMGDCHLNPPDQPSGFVVNGGAGVGPNTDVAGSLIVRRPYRVDAKMVAFGGR-VQLEYQPSDDAPSAIQDGYRQIWLRESDWVLTRVVDVDTRVRPSRNELMLALMNVTSFSVRLFMPEARPKLVTVKYRIYQAMSEMKTSVGTPIRSIEKCECPSTSSGDHCEIASSGFYFPPLIPKPGTSLLPPDPSAPAIRDPQNIQWAGGVEKCRCHGMSSHCDPVTGVCQACTGNTVGPDCGQCAEGYFGDPKKGQTCVKCQCPTEQTDYAITCTPFQDRPYVAHQCVCKPGYTGPRCERCAPGYFGDPLSMIACQPCECDISGSKSANCDQRTGACDCWPGIQGRRCDQCEPDHVVDAGRCRDCRGPCTGELLIKADEVKTQIDNLNMTSLAYQGLARLGQQAEGARKRFNKERATKEQELVKHTHSVAKQTGEIRALADRVMATRNAIELARCSSTENVTQLQKTAQRFEHRVREWIQRIEELSVEMPDERVLQRWLEQARKVNTDLSKINLDSTQEWLGKLMDEIEEVISSAEQLSKLDKYSKTTADLERLTAYQSQQVKLHDAQIKLMYEISNSTARGNVRLKAAQEKSDALKKAATEAAELNVIQAF------QESLEKLQKQIDQIATIPPEE---LQSRLDEAKDSLKYITGIDLADLDGIYVPPNLISGVVEPLERESERVLSTLLYSTKINQTIVALEAYESIVNNMKKAEEATIKAEEALQESTGPESWQERREKIQLVGKKLAEDVEAQEATVNSRNETLKEAMKQVDSSKMELDEVQKTADKTLSDAKSAIKNVQS-VNQLLSSTDPLTRNISALVEQQGSL-------MNRLQNRLKSAENRYAKLQGTAQSAVDQANGTQTSLVKAIIEAEESIKQLDSKLTHLRRLADEARSMLDVNYGALAQDPVPISLDRECVYSLVPYSLTKSRIFDMEFWFRLHASSSETDGVMMVGRRAFIGHTQMFAFTLE 2459          
BLAST of Laminin subunit alpha-2 vs. TrEMBL
Match: A0A564ZBU7 (Uncharacterized protein OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS14019 PE=4 SV=1)

HSP 1 Score: 1292.72 bits (3344), Expect = 0.000e+0
Identity = 820/2650 (30.94%), Postives = 1278/2650 (48.23%), Query Frame = 2
Query:  158 EILSVNVDGLLMENAKITSSATCGTGGPEIFCRLVDEI-----AIQRLI--------------NPDSHVL-CDVCDNRNETKRHPIEFAKSDDDNLWWQSPSMAQGLKYQNVNVTIDLKQVYQIVYILLKMGDSPRPGNWILERSLDGEIYMPWIFFAETPYSCYNLFQRQY-PDLKLTTNAKPSSLADDEMFCTTYYSQPKSLNSGEIIISLINGRKSIMNEEYLSIKSVPQTLINFLSARYIRFRFLKHLTLAADLMTHKGYLEQSIYNRYYYSLRNIEIGGKCICNNHADKCDKVIENGISVAKCNCKHNTCGSNCETCCPLFNQRPWKPVAVCEECNCNRKSNECSYNQTVATLQLSVNKMGRMEGGGVCINCQENTEGINCEKCIKGFYRPWNVLATELYPCTPCQCHGLGTIGSCVSNGEDIGDQKPGDCICKKGYEGVNCDLCSIGYERYPNGE--CLPCPCSIDGSVRTSFYRCKPPCNCKVHVNSDDLCKTCKNGYFNLDSANPEGCEPCYCFGITNQCSSLSAKNLK----------ISDLKGWKLTTFTGEK-IALP-----------KFTSFQYLTSENSYIDERFNNPTV-----YYWTAPPPYLGNWITSYGTIFRYVVKIELQSTLKGSLIDS----------PDVIIKCGDFRLFHSVSIEDRRLQRQVFIYIKPTEWKI------------------------GKLTPD-----------------KAATKEEFISCLVKVDKLLIKAKYYSNQKSIELLNITLSRGEV-HLALDEMPH----IEKCNCPPGFNGLSCESCESGYRR--------------------VNNVLYQGQCEACACYNHSNTCDSLNGECQNCTHNTAGAHCEDCASGYYGDAKSKNLNSCKKCPCPRLDYQMTELCSSYSSEN-----------YVCHKCLHNTSGVHCDRCIEGYYGNPKKKISCKRCKCNNNQESCDPVTGECRCSYNTMGTECQLCKHGFYGD-ALTKSCKKCDCDSLGSTSENCDKLTGKCDCRTNFVNRQCDSCTSGLYLKDKKCIPCNCEIQGRI-SSEKFCNTTSGQCFCLENVNGD-RCEKCVEGYFNYPN--CKKCLCSPHALSADCDLNNGKCKCGSNVINRICDKCENLHYWN-NRTDCVPCNCGRGSL-NPKCDMETGNCKCAQNVARRDCSKCDVGYFGLDVTGCKKCPPCYNGQVCNN-EGICVCPPNTIGNLCNKCSEDSWDFNETIGCKKCNCYINGSY--SNICNKISGICACKTAFFGSKCDRCNEGYYGFPNCQPCSCAENGTKSN----ELTKCDKITGQCQCKQNVIGTKCKVCRKGTFPSDGTYEGGCFSCFCFGVSE--KCHAILNHRIVENSIYEYHIFDEKNSLESGKDYSTIHLNANYP-------------RRFGWPLTMFRPIYVNVMKLFNSHDLSLFYRSIFMNVSVDCLD-NKCGREIP------------------EQTEVF--MESYNGLFGMRYXXXXXXXXXXXXXXDFNEH-----SKNGKWVISQYQNDILDKFIILEDSNVINSNLTRDIFMMALLNVTSLKVKLYTDKVNPPLIKI--KIITYKVMETTQAIGKRVTAVEKCICN-ALTFGNHCQ---------------NPISGYYKEYFNLPNSTKSGSMRTGNRILINLK-----KCNCNGYSKVCDSVTGDCQNCMGNREGNKCQLCREGFYKNDKNYDQCEPCQCPSAHYNFAQNCTRIESSLELKCQCRIGYSGKSCENCQQGFYGNPIKGIPCKSCDCNQQGSQSLNCN-EFGICQCSPGVLGIKCDQCAPNYVVEKKTCQSCYSGCTKDLLVRIDTLNETVINFKWKTLP----STLDLRLNKINISIQMSSELLNS----INKFYKLKNEIKNFSIQFQKMKDDAKEKYGEIEKLKTRY-NKVLEDLRSTFTDINETISGHEQL--GISNELIKNATAYLETIKNIYKEMPNITL------AASVLKDVLKYVDELNQIIKYTQSHIQSDQINNLKILKNKTIMADEINTNNKEYLNTMSTKKKEHELYIILINERMKDLQKIFRKMTKQRDNLRKKIQKLDAISKSFQDEKDLISINVREIEDLMKNLSSNHLVSKSLIIPDTLKKHVEQQLNKSSNLIKKLTKDFNFLHNAEQAKEAYSNITRDILAVDYAINQTKKELDFNRS-NMNIDSLKKLLAEFNSNKSEIVENIKNI-DKEHEKLLKQYKNCSYXXXXXXXXXXXXSSEIPTGFYDV-EILKRNLSXXXXXXXXXXXXFILPINQT-----ILNLGTPNVKSGLDTRNLEKLIKVVDNQYRDLVNESSFVENKI----KDLRKSIKSLRERLQ--------------KARVMSELIHGAAARSVEPIR--HVVRCVRHYVTYYLPTSNAFSLEFYMKPQI------------LNDQSLVLFGYDDSGSIPHAFAFTLERNNQYKFWYDSGNSVE---SIELTGKFSNENYVGIMITWKLGKWHMVIRSISDGR-------------TEQVETSSITNNILSN----VRIGPQTNIFVGGFPSSKLLRSLKLEG------RLISDLKENYDNYFYKGCLFGVKLMNTEFGLQDIEAIEEEC 7210
            + L ++ D LL E+A IT++ATCG    E FCRLV+       A+ R+               + D  V+ C+ CD R+ T RHPIE+A S D+NLWWQSPS+A+GL+Y  V + +DLKQVYQIV++LL+MGDSPRP NWILE+S+DG+ + PW+FFAE    C +++Q      L++T++++P  L + E++CTTY+SQP++L +GEIII L   R+      + + K +   LI FLSAR++R RF K  TL+ D MT +  L+ ++YNRYYYS+RNI+IGGKCICN+HA+ C + I +G+  A C+C+HNTCG  CE CCPLFNQ+PW+P  +CEECNC+ K++ C YNQTVA L LS+N+    EGGGVC+ C+E T GINCE CI G+YRP NV      PC PCQC+  G+ G C+SN   + +++PGDC+C++G+ G  CD C+ GY + P     CL CPC + GS R   YRC+PPCNCK +V+ D LCK C   +FNLD  +PEGC+ C+C G+T  C S+S    +          +  L+ W L   +  + +++P           + T    L++E++        P        YW+AP  YLG  +T Y      + +    +    +  D+          PDV+I+    RL +S   E R+  R   I +  + +++                         ++ PD                 + AT  + ++ L  V KL +KAKY  +Q   EL  + + R E  +  L  +P     IE+C CPPG  G+SCE CE GY R                    + N +++  C  C C   ++TCD  NG C NC +NT G  CE CA G++ D      + C+ C CP +  Q T  C + S  +           Y C  C  NT G  C+ CIE +YGNP     C+ C C     +CD +TGEC+C + T G  C  C  G +GD +  + C  C C  +GS S  CDK TG C CR  +  R CD C +G    +  C  CNC+  G +  +   C+  +GQC+C   V G   C++C +GY+N  +  C+ C CS  ALS  C    G+C+CG+NVI + CD+C   HYWN +  +C+PC CG G+L N +CD+ TG C+CA  V  R C +C  G++G    GC++CP C NG+VC+   G C+CPPNTIG+ C  CS +S+D+N  +GCK CNC   GS   +  C+ ++G CACK+ F G  CD C  GYYG+PNC+PC C+  GT  N    +   CD ITG C CK NV G KC  C  G+F     Y  GC++CFCF  S+  +C  +   R V  +     +    N    G     +HL +                 +F W  +   P Y+ +  +   H  S  Y SIF+ +  DCL    CG+E P                  +  ++F  M + NG     Y   +  + +     D          +   WV+++ +            S  +    +R   ++ L N+T+  V+L T  +    I +  +I T K    TQ +G  +T +E CICN   T G+HC+                P   Y+ + F++   +++G++  G +    ++     +C CNG +  CDS TG C NC GN  G  C++C EG+  +      CE C+CPS + NFA+ C  I  +    C+C  GY+G+ C+ C  G+YG+P+  IPCK C+CN  GSQ  NCN + G C C PGV G +CD+C P +VV+   C  C   CT +LL R   ++E +       L       L  R +K+    + + ++LN+    I +  K+ +E+   S+        + +   E   L     N+   D+ S     NE I     L  G  +E++     + +T + I +E+  + L      A  +L+D  +  ++L  IIK T +     +I+ LK  +    + D   T   E L  M  + +     I+ I++ +         +     N  +  ++L+ +  +  D ++     +  + D+++N  +   +  + + PD + K    ++ K   L      D   +    + +EAY  I   I       +++ + ++ +    ++  S++  LA+      +  E ++ + D+ +++ L    N                + +   F D+  +L+R L   ++  + +    +  +  T      L + T N +   D   ++K +K ++ Q+ ++   ++   N+     K L  +I +  ER++               AR + +LI+G+  +   P+R      CV   + Y+   S  F LEF+  P +            +   S++L G     +    FA T+E N   +F +     +     +E+ G  +  N   + +T   G+  + ++ I   R             T++ ++ S+T  +L +    +R+G   +       ++  + +   +G      RLI            KGCL+ +K+     G  D    +  C
Sbjct:   31 DYLDMDPDSLLAEHAVITANATCGERKREYFCRLVEHAGYNFAALLRMKRQAFSYPQDARTFKDVDGTVIECNYCDARDPTLRHPIEYAVSGDNNLWWQSPSLAEGLQYHAVTIDVDLKQVYQIVFVLLRMGDSPRPANWILEKSIDGKDFQPWVFFAENAQQCISMYQPTVNKTLRITSDSRPHKLGNAEVYCTTYFSQPQNLQAGEIIIPLTVDREGASASYFEASKPIDPELIEFLSARFVRLRFQKLQTLSGDWMTLRDQLDPTVYNRYYYSIRNIKIGGKCICNSHANTCGRQIIDGVPRAVCDCQHNTCGYTCEKCCPLFNQQPWRPGGMCEECNCHGKADSCVYNQTVANLLLSLNRYNVREGGGVCVGCREQTTGINCEDCIPGYYRPLNVGPDAKNPCVPCQCNIYGSTGVCISNDALMPEKQPGDCVCREGFAGRLCDRCAEGYYQSPIDPRGCLKCPCDVAGSHRGQGYRCQPPCNCKANVDPDSLCKACLPKHFNLDDEDPEGCQECFCMGLTKDCQSVSVATARRLEQEGKLGLVDTLEEWSLVVPSSPRSLSVPPTSAGASADEIETTRMLRLSAEDAEF--ALGPPAAAPGRSIYWSAPAKYLGKQLTGYRGYLEVITRFTSPAIRTATAYDNYTASRVWITEPDVVIEGHGIRLGYSPYPETRQTHRVQRIRLHESNFRVLVEAGNGSLDRIPIHQTQATGNGRQQMYPDPTYGQDGSYRLDYTRVGRPATIVDIMTVLSNVTKLYVKAKYTDDQTFTELRRVAMERAERKNTTLGGLPEGVRGIEECRCPPGHRGISCEECEPGYWRDPSIAPAGDGQSGEIAAFLGLVNPIFRRACVPCDCNGRADTCDPNNGHCLNCKYNTFGPKCEQCAPGFHIDPSKFGSDICQPCECPSVLNQKTNSCVALSPGDLRTFGISAEKPYACLDCEDNTRGQFCESCIEMFYGNPLLGQPCRHCDCGPMAINCDSITGECQCGHYTTGPRCTECAPGSHGDPSRGEPCTPCGCHPVGSQSIECDKDTGLCLCRLFYEGRHCDRCVAGRGNVEAGCPTCNCDPLGSVPQANASCDPVTGQCYCKPGVGGTLECDRCADGYYNLGSNGCQLCECSNRALSTACHPTTGQCECGNNVIGQKCDRCLRGHYWNGSEPNCLPCECGPGALVNNECDLYTGQCRCALYVTGRRCDQCQTGFWGPSPRGCQRCPQCPNGRVCDQLTGKCICPPNTIGDQCETCSPNSYDYNPALGCKDCNCSSIGSVDPTGDCDLLTGQCACKSGFAGRACDECAPGYYGYPNCKPCMCSLEGTLRNFSNGDQITCDPITGACLCKPNVEGEKCDKCIPGSFGLSADYPLGCYACFCFPTSQPAQCEQLKGFRSVPEAQRRLQLVGTDNQYMPGGPIVDLHLTSEVSTGSSELPDLTVGQNQFKWRFSKSMPTYLILPDVKGPHTRS--YGSIFVEIHADCLPTGNCGQEYPSTALQTRGRPSADRTVLEDPQKIFARMTALNGQLEFEYQPENLPTQTAIPGGDLAAQYNTIWMREADWVLTRIR------------SQHLRVRPSRAALVLGLTNITTFSVRLATPGIPLKAISVNYRIRTAKSEALTQ-LGTPITTIETCICNDTSTKGDHCELADELNYFPPITIKPGPDGTYFDDLFDITKPSENGTIPAGGKPSFEIEGGSVLRCECNGMASECDSETGFCMNCEGNTAGAHCEVCAEGYMGDPTQGIPCERCRCPSENANFARTCHTIGQTGSYICECLPGYAGQLCDRCDTGYYGDPVNMIPCKKCECNPAGSQHQNCNMKTGQCVCLPGVTGQQCDECPPGHVVDGGRCIDCRGECTGELLERAAEVSEKIDRIDLTELAHQGLGDLQNRTDKLLDRYESAGKILNTERDLIERASKITSELTRISLNMMTSLPSSVKAIDEASCLAANATNQFSRDIVSLERKFNEWIQSMRNLRPGQVDEIL--IQHWHQTARLIRQEIARLDLGLTSEWANKMLEDSRRLEEQLASIIKRTSTADYGSKIDRLKYYQK---LQDSHLTTQLEQLYLMGNQTQRGLDEIVSIHDMIDTTSG--GALDTLWVNQSRFEEELNVLKSNASDYQEPTMTEISRLSDILENTQTFSEIPDT-VPPDVISKAHSLEMAKDRILA---ALDRPGVDQTLEVREAYKKIADTIWEARNITDESMEAIEASGGEGVSASSIEASLADIMKRHDQATERVQRLSDRLNDEQLIIAANADRI------------TALKKSFVDINAVLQRTLEASKLTADRVNKQLLPLVTLTRPQLDALAIETANARKRFDA--IDKEVKAIEKQFNEMEGTANMAVNQANSTQKSLLDAILATEERVETVDRKMADARRLASTARSLLDLIYGSLGKDPIPLRLNGGGDCVYTLIPYHATKSRVFDLEFWFAPALQRISGTTGSATGIRTNSVLLVGRRAFPARTSIFAVTVEPNGNLRFAWSQPEVIGGELGVEI-GPLNGSNTNRVRVTAIPGRVDLYLQEIPKDRDNLEGLPIHQATYTDETDSESLTTGLLLDNQLELRVGGAFHSVSAAGSNAPPMETWGDDGAEEIWNRLIK-------MEHAKGCLYELKISGHRLGFPDFAKADPAC 2630          
BLAST of Laminin subunit alpha-2 vs. TrEMBL
Match: A0A5K4FDV5 (Uncharacterized protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 1285.01 bits (3324), Expect = 0.000e+0
Identity = 832/2483 (33.51%), Postives = 1252/2483 (50.42%), Query Frame = 2
Query:   86 LKMRIFIIF--ILLIVHKAHSQDDEPEILSVNVDGLLMENAKITSSATCGTGGPEIFCRLVDE-----IAIQRLINPDSHVL------------------CDVCDNRNETKRHPIEFAKSDDDNLWWQSPSMAQGLKYQNVNVTIDLKQVYQIVYILLKMGDSPRPGNWILERSLDGEIYMPWIFFAETPYSCYNLFQRQYP-DLKLTTNAKPSSLADDEMFCTTYYSQPKSLNSGEIIISLINGRKSIMNEEYLSIKSVPQTLINFLSARYIRFRFLKHLTLAADLMTHKGYLEQSIYNRYYYSLRNIEIGGKCICNNHADKCDKVIENGISVAKCNCKHNTCGSNCETCCPLFNQRPWKPVAVCEECNCNRKSNECSYNQTVATLQLSVNKMGRMEGGGVCINCQENTEGINCEKCIKGFYRPWNVLATELYPCTPCQCHGLGTIGSCVSNGEDIGDQKPGDCICKKGYEGVNCDLCSIGYER--YPNGECLPCPCSIDGSVRTSFYRCKPPCNCKVHVNSDDLCKTCKNGYFNLDSANPEGCEPCYCFGITNQCSSLSAKNLKISDLKG----------WKL------TTFTGEKIALPKFTSFQY---LTSENSYIDERFNNPTV------YYWTAPPPYLGNWITSYGTIFRYVVKI-----------ELQSTLKGS----------------LIDSPDVIIKCGDFRLFHSVSIEDRR--------LQRQVFIYIK-----------PTEWKIG-KLTPD--------KAATKEEFISCLVKVDKLLIKAKYYSNQKSIELLNITLSRGEVHLALDEMPHIEKCNCPPGFNGLSCESCESGYRR---------VNNVLYQGQ----------------CEACACYNHSNTCDSLNGECQNCTHNTAGAHCEDCASGYYGDAKSKNLNSCKKCPCPRLDYQMTELCSSYSSE------NYVCHKCLHNTSGVHCDRCIEGYYGNPKKKISCKRCKCNNNQESCDPVTGECRCSYNTMGTECQLCKHGFYGDALT-KSCKKCDCDSLGSTSENCDKLTGKCDCRTNFVNRQCDSCTSGLYLKDKKCIPCNCE-IQGRISSEKFCNTTSGQCFCLENVNGD-RCEKCVEGYFNY-PN-CKKCLCSPHALSADCDLNNGKCKCGSNVINRICDKCENLHYWNNR-TDCVPCNCGRGSLNPK-------CDMETGNCKCAQNVARRDCSKCDVGYFGLDVTGCKKCPPCYNGQVCNN-EGICVCPPNTIGNLCNKCSEDSWDFNETIGCKKCNCYINGSYSNI---CNKISGICACKTAFFGSKCDRCNEGYYGFPNCQPCSCAENGTK------SNELTKCDKITGQCQCKQNVIGTKCKVCRKGTFPSDGTYEGGCFSCFCF--GVSEKCHAILNHRIVENSIYEYHIFDEKNSLESG----------KDYSTIHLNANYPRRFGWPLTMFRPIYVNVMKLFNSHDLSLFYRSIFMNVSVDCL---DNKCGREIPEQTEVFMESY-----NGLFGMRYXXXXXXXXXXXXXXDFN-EHSKNGKWVISQYQNDIL--DKFIILEDSNVINSNL--TRDIFMMALLNVTSLKVKLYTDKVNPPLIKIKIITYKV-METTQAIGKRVTAVEKCICNALTFGNHCQNPISGYY---------KEYFNLPNSTKSGSMRTGNRILI-NLKKCNCNGYSKVCDSVTGDCQNCMGNREGNKCQLCREGFYKNDKNYDQCEPCQCPSAHYNFAQNCTRI--ESSLELKCQCRIGYSGKSCENCQQGFYGNPIKGIPCKSCDCNQQGSQSLNCNE-FGICQCSPGVLGIKCDQCAPNYVVEKKTCQSCYSGCTKDLLVRIDTLNETVINFKWKTLPSTLDLRLNKINISIQMSSELLNSINKFYKLKNEIKNFSIQFQKMKDDAKEKYGEIEKLKTRYNKVLEDLRSTFTDINETISG--HEQLGISNELIKNATAYLETIKNIYKEMPNITLAASVLKDVLKYVDELNQIIKYTQSHIQSDQINNLKI-LKNKTIMADEINTNNKEYLNTMSTKK-----------KEHELYIILINERMKDLQKI--FRKM--------TKQRDNLRKKIQKLDAIS--KSFQDEKDLISINVREIEDLMKNLSSNHLV-----------------SKSLIIPDTLKKHVEQQLNKSSNLIKKLTKDFNFLHNAEQAKEAYSNITRDILAVDYAINQTKKELDFNRSNMNIDSLKKLLAEFNSNKSEIVENIKNIDKEHEKLLKQYKNCSYXXXXXXXXXXXXSSEIPTGFYDV----EILKRNLSXXXXXXXXXXXXFILPINQTILNLGTPNVKSGLD---------------TRNLEKLIKVVDNQYRDLVNESSFVENKI-----------KDLRKSIKSLRERLQKARVMSELIHGAAARSVEPIRHVVRCVRHYVTYYLPTSNAFSLEFYM 6712
            L + +FIIF   + I+ +      E + L ++ D +L ENA IT++ATCG G  E FCRLV+          RL      VL                  C  CD+R+   RHPIE+  S + NLWWQSPS+AQGL+Y  V +T+D +QVYQIVY+LL+MGDSPRP NWILERS+DGE+Y PW+FFA+T Y C  L++      L +T+  +P  L DDE++CTT+YSQP++L SGEII++L   R+S ++ E      +   LI+FLSAR++R RF +  TL+ D M     L+ S+YNRYYYS+R I++GGKC+CN+HA +C++ + +G+  A C+C+HNTCG+NCE CCPLFNQ+PW+P  +CEECNCN+K++EC YNQTVA L+LS+ K G +EGGGVC+NC+E+T G+NCEKC +G+YRP NV     YPC PC+C   G+ G C SN  +I ++ PGDCICK+GY G  CD C+ GY+R       C+PC C I GS R   Y+C+PPCNCK++V+ D  C TC+ G+FNLD  NPEGC+ CYC G+T++C+ ++     I + KG          WK+      T  TG  I + + TS QY   L ++   ++   ++ T       YYW+AP  YLGN IT+Y      +++             + + + GS                 +  PD++I+   +RL H +S   R         L    F  I            P  W  G +L  D        + AT  + ++ L  +D+L+IKAKY ++Q + EL+++TL R  +   +  +P+IE+C CP G++G SCESC  GY R          N   +                   C  C C+ HS+ CD   G C +C HNTAG  C+ CA G+YGD ++ +  +CK C CP LDYQMT +C ++  E       YVC  C  NT G +C+ C E YYG+P   + C+ C C      C+   G C C +NT G +C  C  G +GD    + C+ C+C   GS S +C    G+C+C + +   +CD C  G    +  C PC C+ I  R      C+  SGQC C   V G   C  C  GY+N  PN C +C C+  A+   C+   G+CKCG NVI   CDKC   +YWNN  ++C+PC+CG G+   +       CDM TG CKCA +V  RDC++C++GYFG+  +GCK C PC NGQVC+   G C+CPPNT G+ C+KC   SWD+N  IGCK CNC I+GS   +   C+ I+G C CK  F G  C+ C++GYYG+P+C+ C+C   GT       S+ +  C+   GQC CK+NV G +C  C+ GTF  +  Y  GC+SCFCF  G   +C  +  +R V   +    I    +    G          +D     L      +F W  ++ RP ++ + +L  S  L+  Y S+ + V  +CL   D K G E  + T   + S       GL   R  +  +   + N  ++   + S+N    I+     I   ++  +L   + I++ +  TR+  M+ALLNVTS  V+L+  +  P L+ +K   Y+   E T   G  +  +EKC C     G+HC+   SG+Y         +E    P S    ++ TG+ I     +KC C+G S  CD +TG C +C GN EG  C  C  G+  + K    C  CQCP+   ++A  CT     S L  KC C++GY+G  CE C  G+YG+P     C++CDC+  GS+S  CN+  G C C PG+ G +CDQC  ++VV+  TC+ C   CT +LL++ D +   +      TL       L+K+   I+ +       N+  +L+NEI   + Q  +  ++  + Y  +  +K       E L  +  ++ + I+   +E   I N+L          + N+ K+  N  +     +++ ++ DE  QI    ++++ + Q+N+  + L N  +  ++IN    E++  +  +            +  EL   L+N  M  L +I  + K+         K+ D L   ++   ++S  +SF  E   +   + ++E L  N    + +                 S+ + IP  L  H  + + + S  I       + L+    A  AY  I  +I   + A N+ +    F  S   ID  K++  +         + +  I  + +++     N S            L  E+ T   D+    +I K NL   +   N +++       Q  L    P V++  D                + +E     +    + LV+ ++  ++ +           + L   + +LR    +AR M ++ +G+ +    P++    CV   V Y L  S  F +EF+ 
Sbjct:    5 LSVLLFIIFNVKVAILQRYDGYPYEADFLDMDPDSILEENAIITANATCGIGRKEYFCRLVEHADGFITYDGRLHRTPREVLTYSQEAKSYRDPSGQWVQCGYCDDRDPNLRHPIEYVLSGEANLWWQSPSLAQGLQYHAVTITMDFRQVYQIVYVLLRMGDSPRPANWILERSVDGEVYHPWVFFAKTEYDCKKLYEPLIDRPLTITSGPRPWHLGDDEVYCTTFYSQPQALQSGEIIVTLTLDRESTISTESGLESPISSKLIDFLSARFVRLRFQQLQTLSGDWMAMPNQLDSSVYNRYYYSIRTIKVGGKCVCNSHASRCEQKVIDGVPRAVCDCQHNTCGNNCEKCCPLFNQQPWRPGRICEECNCNQKADECIYNQTVANLRLSMRKDGVLEGGGVCLNCREDTTGVNCEKCKQGYYRPLNVRPDSQYPCRPCECSTFGSTGDCTSNDAEIPERYPGDCICKEGYAGRRCDECAEGYQRSNIDPQLCIPCTCDIRGSHRGPGYQCEPPCNCKINVDPDSYCNTCQKGFFNLDVNNPEGCQSCYCSGLTDRCTGVTPSTAMILEKKGLLGPVNTLANWKIIVPSLSTPDTGYTIPMTE-TSVQYDKVLFAQTRTVEAWLSSVTSTPVTRGYYWSAPEAYLGNQITAYRDTLNIILRFNSPTMLTYRQPTIPTDISGSRQFSMSMAMTDHLNYMWLHEPDIVIEGNGYRLVHMLSPSYRESHMILNIPLSESSFRVIVEPPTSIPLDRFPISWLQGDQLRFDESTLERVGRPATIADIMTVLSSIDRLMIKAKYITDQTTTELMSVTLGRA-IRDEIGGIPNIEECICPNGYSGSSCESCAIGYYRDYQKQSMIQTNQTSFTSSTALSLWRSTMMTQLPVCVLCECHGHSDICDEKTGVCIDCAHNTAGDKCDICAPGFYGDPRTGDPKACKSCECPHLDYQMTTVCLAHEEELFKEEKPYVCLDCTENTRGRYCEVCAEMYYGDPLNGVPCRPCNCGPAAIGCNATNGACICGFNTAGPQCDACAEGTHGDPTRGQPCRPCNCHPKGSISPSCRLEDGQCNCLSTYEGVRCDRCIPGRGNTEAGCPPCQCDPIGTRPEYLTMCDPVSGQCSCKPGVGGTLDCSTCQIGYYNLGPNGCTECKCTSRAIDRTCNPITGQCKCGENVIGDTCDKCLPGYYWNNTGSNCLPCSCGIGTELTRTLTQLTECDMNTGQCKCAPHVVGRDCTECELGYFGVSESGCKPCLPCPNGQVCDQITGKCICPPNTEGDRCDKCIAGSWDYNPVIGCKNCNCSIDGSVIGLEDQCDLITGQCTCKPEFSGRACNECSKGYYGYPDCRKCNCDMRGTAWGNLSISDTVVPCNPKDGQCNCKENVEGDQCDQCKPGTFGLNIDYPLGCYSCFCFPTGTPSRCSLLTGYRSVPGKVKGVEIISTDDPRYPGGPLIDLKLGLRDIDVNELTIGL-SQFSWRFSVHRPTHLEIPELKGS--LTRNYGSVIIGVLTECLPTGDCKLGIEDAQTTTTTILSTRDDLPGGLIIRRNDIVDARMTALNGYIEMEYQPSENSPTSIADGYRQIWLREQDWVLTRVSGIDTRVRPTRNELMLALLNVTSFSVRLFMPEARPKLVSVKYKIYQPRTEITTLSGIEIKTIEKCECPPTASGDHCEIASSGFYFPPIKPKPGREILP-PTSIIDPTLPTGHIIWEGGAQKCRCHGMSSNCDPITGICLDCTGNTEGPNCGNCATGYMGDPKIGQPCVKCQCPTEQTDYAITCTPSTDPSFLPHKCICKVGYAGLRCEQCAPGYYGDPTSMTACQACDCDIGGSRSETCNQDTGQCDCWPGIKGRRCDQCEEDHVVDHGTCRDCRGPCTGELLIKSDYIKLQINELNITTLAYQ---GLSKLKQQIEFNKARFIESNQ--QLENEIILRTKQLTRQFNEINQSYISVILIKQ------ETLNQSNCNLIKQINQLYNESQSIENQLYN-------WMNNLLKQEFNQPIINEE-EELKRWYDEAQQI----KNNLINIQLNHTDLWLINIELQFNKINKEINEFIQIIKQQSNKINNYLIKFNRYQELQQFLMNYEMNQLYRISNYTKLLMNELDMGIKKADTLVDTVKTTTSLSTLQSFDKESKNLDQELLKLEQLHTNQEQINRIEQLKQLIQQLSQIQLPDSRQIYIPPELITHTIEPIEQESKRIIDSLIPSDQLNRTYLAYNAYQFIIDNINLAENATNEAENA--FFNSTTTIDG-KQITWQ---------QRLNTIINKRDQITDILNNYSIIYNSHNETLNILDKELQTTENDLSTLNQIAKNNLKLTKDITNKVDSI------QQFLKDTKPLVQNASDKLQVQLGRYNELHDRLQGMENRFSQIQGTAKTLVDRANITQSYLIKSIDEAETVARQLDSKLLNLRRLADEARSMLDVNYGSLSHDPVPLQLGQDCVYTLVPYSLTKSRVFDIEFWF 2440          
BLAST of Laminin subunit alpha-2 vs. Ensembl Cavefish
Match: lama1 (laminin, alpha 1 [Source:ZFIN;Acc:ZDB-GENE-060118-1])

HSP 1 Score: 651.744 bits (1680), Expect = 0.000e+0
Identity = 407/1188 (34.26%), Postives = 600/1188 (50.51%), Query Frame = 2
Query:  188 LMENAKITSSATCGTGGPEIFCRLVDEIAIQRLINPDSHVLCDVCD--NRNETKRHPIEFAKSDDDNLWWQSPSMAQGLKYQNVNVTIDLKQVYQIVYILLKMGDSPRPGNWILERSLDGEIYMPWIFFAETPYSC---YNLFQRQYPDLKLTTNAKPSSLADDEMFCTTYYSQPKSLNSGEIIISLINGRKSIMNEEYLSIKSVPQTLINFLSARYIRFRFLKHLTLAADLMT----HKGYLEQSIYNRYYYSLRNIEIGGKCICNNHADKC--DKVIENGISVAKCNCKHNTCGSNCETCCPLFNQRPWKPVAV-----CEECNCNRKSNECSYNQTVATLQLSVNKMGRMEGGGVCINCQENTEGINCEKCIKGFYRPWNVLATELYPCTPCQCHGLGTIGS-CVSNGEDIGDQK---PGDCICKKGYEGVNCDLCSIGYERYPNGECLPCPCSIDGSVRTSFYRCKPPCNCKVHVNSDDLCKTCKNGYFNLDSANPEGCEPCYCFGITNQCSSLSAKNLKISDLKGWKLTTFTGEKIALPKFTSFQYLTSENSYIDERFNNPTVYYWTAPPPYLGNWITSYGTIFRYVVKIE--LQSTLKGSLIDSPDVIIKCGDFRLFHSVSIEDRRLQ-RQVFIYIKPTEWKIGKLTP--------DKAATKEEFISCLVKVDKLLIKAKYYSNQKSI-ELLNITLSRGE-VHLALDEMPHIEKCNCPPGFNGLSCESCESGYRRVNNVLYQGQCEACACYNHSNTCDSLNGECQNCTHNTAGAHCEDCASGYYGDAKSKNLNSCKKCPCP--RLDYQMTELCSSYSSENYVCHKCLHNTSGVHCDRCIEGYYGNPK-KKISCKRCKCNNNQES-----CDPVTGEC-RCSYNTMGTECQLCKHGFYGDALT-KSCKKCDCDSLGSTSENCDKLTGKCDCRTNFVNRQCDSCTSGLYL--KDKKCIPCNCEIQGRISSEKFCNTTSGQCFCLENVNGDRCEKCVEGYFNYPN--CKKCLCSPHALSADCDLNNGKCKCGSNVINRICDKCENLHYWNNR-TDCVPCNCG-RGSLNPKCDMETGNCKCAQNVARRDCSKCDVGYFGLDVTGCKKCPPCYNGQV------------CNNEGICVCPPNTIGNLCNKCSEDS---WDFNETIGCKKCNCYINGSYSNICNKISGI 3559
            L  NA+I+++ATCG   PE++C+LV+ +  +R+ NP     C  CD  + N  +RHPI  A  D  N WWQSPS+  G ++  V VT+DL+Q++Q+ Y+++K  +SPRPGNWILERSLDG  Y PW ++A +   C   YN+  R  P         P+   D+E+ CT+YYS+   L  GEI  SLINGR             +   L+ F SAR+IR R  +  TL ADLMT        ++  +  RYYYS+++I +GG CIC  HA  C  D V +      +C C+HNTCG +C  CCP ++Q  W+P  +     CE+CNC+ K+ +C YNQTVA L++S+N  G+  GGGVCINC +NT G+NCE C  G+YRP  +      PC  C C   G++   C+ + +     K   PG C+CK+G+ G  CD C+ GY  +P   C  C CS+ GS      R    C CKV+V   + C  CK G++NL ++NPEGC  C+CFG+++ C   +           W  +  T                                              +YG+   Y V  +  + + +  +L    DV+I+ G+ R         R+LQ R+VF+     +  + +  P        ++   ++E +S L  V  L I+A   ++   +  L +++L+  + +  +    P +E+C CP G++G SCE C SG+ RV  +L+ G C  C C +H+  CD +NG C  C+HNT G HC+ C  GYYGD        C++C CP        +  CS       +C +C    +G  C+RC  GYYGNP      C  C+CN N +      CD VTGEC +C  +T G  C+ C+ G++GDA+T K C+ C C + GS S  C+ +TG+CDCR N V  +CD C  G +       C  C C   G +S  + C    GQC C+  V+G +C++C +G++N+ +  C  C C+      +C+   G+C C  +     C+ CE  H+ ++  T C PC C   GS + +CD+  G C C  + A + C +C +GY       C  C    NG              C + G CVC  N  G  C++C   +   W  N + GC  C C+     S +C ++ G+
Sbjct:   24 LASNAEISTNATCGEPLPEMYCKLVEHVPGRRIRNPQ----CRTCDANSANLKERHPITNAI-DGTNQWWQSPSIKNGRQFHWVTVTLDLRQIFQVAYVIIKAANSPRPGNWILERSLDGINYQPWQYYAISDTECLTRYNITPRLGP---------PTYKRDEEVICTSYYSRLVPLEHGEIHTSLINGRPGA--------DDLTPELLEFTSARFIRLRLQRIRTLNADLMTLSYRDPKDVDPIVTRRYYYSIKDISVGGMCICYGHAQSCPWDPVTKK----LQCVCEHNTCGESCNECCPGYHQELWQPGTISDGNTCEKCNCHNKAEDCYYNQTVADLKMSLNTHGQFVGGGVCINCTQNTAGVNCETCADGYYRPHKMSPYATEPCLECNCDMRGSVSHVCLKDDKHANPGKGLLPGQCVCKEGFAGEKCDRCAFGYRDFP--LCTRCECSLKGSHNIDPCR---ECICKVNVMGAN-CDLCKQGFYNLQASNPEGCTECFCFGVSDVCEGST-----------WNTSLLT----------------------------------------------AYGSFLNYSVAYDASVDNNVDKTLPSHFDVVIQ-GNGRSL-------RQLQSRRVFLNPHMEQHVVLEFLPHFFVDMHMERRVQRDELMSVLADVASLRIRAHLNTSVDGVLRLSSVSLAVADPISRSAAPAPDVEQCECPWGYSGTSCEYCISGFYRVGGILFGGNCLQCECNDHATECD-INGVCLGCSHNTTGPHCDQCLPGYYGDPTEGTAEDCQRCACPLTLASNNFSPTCSLQGPGEIMCDQCEQGYTGTKCERCANGYYGNPTVAGQKCSVCECNGNVDPSEPGHCDAVTGECLKCVGHTSGRHCERCEDGYFGDAVTAKDCQACGCHANGSVSSVCNIITGQCDCRANVVGDKCDRCQVGFHGINSGDGCRQCECSQSGSVS--EACE-EDGQCQCIVGVSGAKCDRCQQGFYNFTDGGCTPCDCA--HTHGNCNAETGECICPPHTRGEKCEVCEEDHWGHDAVTGCKPCECSVDGSNSSQCDLLNGQCACRPHFASQKCDRCALGY--RKFPECTACNCNTNGTREDFCDDELEVCGCEDHGQCVCKDNVGGGGCDECKTGTFGLWGQNPS-GCSPCFCF---GVSTVCEELGGL 1102          

HSP 2 Score: 378.637 bits (971), Expect = 1.624e-104
Identity = 344/1271 (27.07%), Postives = 558/1271 (43.90%), Query Frame = 2
Query: 2573 KCLHNTSGVHCDRCIEGYY--GNPKKKISCKRCKCNNNQESCDPVTGEC-RCSYNTMGTECQLCKHGFYGD---ALTKSCKKCDCD-SLGST--SENCDKLTGK----CD-CRTNFVNRQCDSCTSGLY----LKDKKCIPCNCEIQGRISSEKFCNTTSGQCF-CLENVNGDRCEKCVEGYFN----YPNCKKCLCSPH-ALSADCDLNNGKCKCGSNVINRICDKCE-NLHYWNNRTDCVPCNCGR-GSLNPKCDMETGNCKCAQNVARRDCSKCDVGYFGLDVTGCKKCPPCYNGQVCNNE-GICVCPPNTIGNLCNKCSEDSWDFNETIGCKKCNCYINGSYSNICNKISGICACKTAFFGSKCDRCNEGYYGFPNCQPCSCAENGTKS----NELTKCD-KITGQCQCKQNVIGTKCKVCRKGTFPSDGTYEGGCFSCFCFGVSEKCHAILNHRIVENSIYEYHIF---DEKNSLESGKDYSTIHLNANYPRRFGWPLTMFRPIYVNVMKLFNSHDLSLFYRSIFMNVSVDCLDNKCGREIPEQTEVFMESYNGLFGMRYXXXXXXXXXXXXXXDFNEHSKNGKWVISQYQNDILDKFIILEDSNVINSNLTRDIFMMALLNVTSLKVKLYTDKVNPPLIKIKIITYKVMETTQAIGKRVTAVEKCICNALTFGNHCQNPISGYYKEYFNLPNSTKSGSMRTGNRILINL-KKCNCNGYSKVCDSVTGDCQNCMGNREGNKCQLCREGFYKNDK-NYDQCEPCQCPSAHYNFAQNCTRIESSLELKC-QCRIGYSGKSCENCQQGFYGNPIK-GIPCKSCDCNQQGSQSLNCN-EFGICQCSPGVLGIKCDQCAPNYVVEKKTCQSCYSGCTKDLLVRIDTLNETV--INFKWKTL-PSTLDLRLNKINISIQMSSELLNSINKF-YKLKNEIKNF-SIQFQKMKDDAKEKYGEIEKLKTRYNKVLEDLRSTFT-------DINETISGHEQL--GISNELIKNATAYLETIKNIYKEMPNITLAASVLKDVLKYVDELNQIIKYTQSHIQSDQINNLKILKNKTIMADEINTNNKEYLNTMSTKKKEHELYIILINERMKDLQKIFRKMTKQRDNLRKKIQKLDAISKSFQDEKDLISINVREIEDLMKNLSSNHLVSKSLIIPDTLKKHVEQQLNKSSNLIKKLTKDFNFLHNAEQAKEAYSNITRDILAVDYAINQTKKELDFNRSNMNIDSLKKLLAEFNSNKSEIVENIKNIDKEHEKLLK 6223
            +C    SG  C+ CI G+Y  G      +C +C+CN++   CD + G C  CS+NT G  C  C  G+YGD      + C++C C  +L S   S  C  L G     CD C   +   +C+ C +G Y    +  +KC  C C      S    C+  +G+C  C+ + +G  CE+C +GYF       +C+ C C  + ++S+ C++  G+C C +NV+   CD+C+   H  N+   C  C C + GS++  C+ E G C+C   V+   C +C  G++     GC  C   +    CN E G C+CPP+T G  C  C ED W  +   GCK C C ++GS S+ C+ ++G CAC+  F   KCDRC  GY  FP C  C+C  NGT+     +EL  C  +  GQC CK NV G  C  C+ GTF   G    GC  CFCFGVS  C  +     V  S    H+    D K +LE    Y T         +     ++  P Y  + + F    L  +   +  +V+   LD         Q  +       L     +     S      V   EH    KW   +Y N + +K +   D   I SNL  +I ++    + +  + LY    N     I + T    +           VE C C     G  CQ    GYY+++ +  N      M+   R ++     C CN +S  CD  TG C  C  N  G  C +C  G+Y   K +   C  C CP    +F+  C  +E   + +C  C+ GY G+ CE C  G+YGNP + G  C+ C C + GS    C+ + G C+C  GV G  CDQC   +V+    C SC  GCT  LL  +D +  ++  +N     L P +L + L      +Q+ + L  ++      L  E++   S    +      EK   I+ L +R     ++LR+          D+ E  +  + L   IS  L ++    +E    +     +      +LK++   ++E    +++  S +    + NL+  ++  ++ D  +     +  TM  ++++ EL       R K +  +  ++TK RD L + + + +  +++   E   +   +  + +   N++S   V+ +  I D + +   Q L+ +      L+   + +H      +   ++ +++  V+  +N  +  +D N + +  DSL  L    N  +  +VE  + ++K +  L K
Sbjct:  648 ECPWGYSGTSCEYCISGFYRVGGILFGGNCLQCECNDHATECD-INGVCLGCSHNTTGPHCDQCLPGYYGDPTEGTAEDCQRCACPLTLASNNFSPTC-SLQGPGEIMCDQCEQGYTGTKCERCANGYYGNPTVAGQKCSVCECNGNVDPSEPGHCDAVTGECLKCVGHTSGRHCERCEDGYFGDAVTAKDCQACGCHANGSVSSVCNIITGQCDCRANVVGDKCDRCQVGFHGINSGDGCRQCECSQSGSVSEACE-EDGQCQCIVGVSGAKCDRCQQGFYNFTDGGCTPCDCAHTHGNCNAETGECICPPHTRGEKCEVCEEDHWGHDAVTGCKPCECSVDGSNSSQCDLLNGQCACRPHFASQKCDRCALGYRKFPECTACNCNTNGTREDFCDDELEVCGCEDHGQCVCKDNVGGGGCDECKTGTFGLWGQNPSGCSPCFCFGVSTVCEELGGLVRVPVSAERLHVVSQSDLKGTLEG--VYHTEGEMLLDVTQLQSASSLTGPYYWRLPQRFQGSKLLSYGGDLSYSVAFAALDGSGLSNHEPQVLIRGGHLKKLVIYMDMPAPENSIRTTQRVPLTEH----KW---KYFNAVSEKAVSHADFMSILSNLHINILVL----MANYLLFLYMLISN-----ISMDTAVEADEAPEGTPEARLVEACECPPGYAGLSCQECAPGYYRQHVSELN------MKGMKRPMMQPCVPCQCNNHSLACDLDTGKCLGCQHNTTGENCNVCAPGYYGQVKGSISDCSLCACPLHSNSFSPTCV-LEGVGDFRCDACKPGYEGRYCERCSLGYYGNPSEPGGKCEVCQCTESGSLHPVCDSQTGKCECKAGVRGHLCDQCEDRHVLSNDQCLSCDDGCTGLLLDDVDAVEASIQSLNLSGVILAPYSLLISLENQTQELQVGAFLEENVGNLNMTLTEEVEEVNSTTLMEQMMALIEKMKTID-LSSRNTTADDELRAAVAVLESIQKDVVEPSNRTQTLKEKISTALARHDQQLMEAQDLLNAAQSHNNHTEHLLKNIHTNIEEFTS-LRHNVSSLNQTTVTNLEDAQD--LLTDAFSIAGDLHNLTMKAEEEKDELVEWSPTLR-KHVDTLVMELTK-RDAL-QLVYRAEDHAQALSKEAQAVYNTLTGVREASTNITSASQVNSN--ISDNIHQAENQALSANQTASSALSLVSHTVH-----IQTLDDLAQNVSDVNGRLNLVRARVD-NFTQLLPDSLTALRNLSNGGRELVVEVKQQVEKANASLQK 1875          

HSP 3 Score: 211.846 bits (538), Expect = 7.268e-54
Identity = 168/564 (29.79%), Postives = 246/564 (43.62%), Query Frame = 2
Query: 1208 GVCINCQENTEGINCEKCIKGFYRPWNVLATELYPCTPCQCHGLGTIGSCVSNGEDIGDQKPGDCICKKGYEGVNCDLCSIGYERYPNGECLPCPCSIDGSVRTSFYRCKPPCNCKVH---VNSDDL----CKTCKNGYFNLDSANPEGCEPCYCFGITNQCSSL--------SAKNLKI---SDLKGWKLTTFTGEKIALPKFTSFQYLTSENSYIDERFNNPTVYYWTAPPPYLGNWITSYGTIFRYVVKIELQSTLKGSLIDS--PDVIIKCGDFR---LFHSVSIEDRRLQRQVFIYIKPTEWKIGKLTPDKAATKEEFISCL--VKVDKLLIKAKYYSNQKSIELLNITLSRGEVHLAL--DEMPH-------IEKCNCPPGFNGLSCESCESGYRR--VNNVLYQGQ-------CEACACYNHSNTCDSLNGECQNCTHNTAGAHCEDCASGYYGDAKSKNLNSCKKCPCPRLDYQMTELCSSYSSENYVCHKCLHNTSGVHCDRCIEGYYGNPKKKIS-CKRCKCNNN---QESCDPVTGECRCSYNTMGTECQLCK 2758
            G CI C  +T G  CE C +  +    V       C PC+C   G+  S         D   G C C+  +    CD C++GY ++P  EC  C C+ +G+           C C+ H   V  D++    C  CK G F L   NP GC PC+CFG++  C  L        SA+ L +   SDLKG     +  E   L   T  Q  +S           P  YYW  P  + G+ + SYG    Y V     + L GS + +  P V+I+ G  +   ++  +   +  ++    + +   +WK      +KA +  +F+S L  + ++ L++ A Y      +  L + +S   +  A+  DE P        +E C CPPG+ GLSC+ C  GY R  V+ +  +G        C  C C NHS  CD   G+C  C HNT G +C  CA GYYG  K  +++ C  C CP      +  C      ++ C  C     G +C+RC  GYYGNP +    C+ C+C  +      CD  TG+C C     G  C  C+
Sbjct:  950 GECI-CPPHTRGEKCEVCEEDHWGHDAVTG-----CKPCECSVDGSNSSQC-------DLLNGQCACRPHFASQKCDRCALGYRKFP--ECTACNCNTNGTREDFCDDELEVCGCEDHGQCVCKDNVGGGGCDECKTGTFGLWGQNPSGCSPCFCFGVSTVCEELGGLVRVPVSAERLHVVSQSDLKGTLEGVYHTEGEMLLDVTQLQSASS--------LTGP--YYWRLPQRFQGSKLLSYGGDLSYSVAF---AALDGSGLSNHEPQVLIRGGHLKKLVIYMDMPAPENSIRTTQRVPLTEHKWKYFNAVSEKAVSHADFMSILSNLHINILVLMANY------LLFLYMLISNISMDTAVEADEAPEGTPEARLVEACECPPGYAGLSCQECAPGYYRQHVSELNMKGMKRPMMQPCVPCQCNNHSLACDLDTGKCLGCQHNTTGENCNVCAPGYYGQVKG-SISDCSLCACPLHSNSFSPTCVLEGVGDFRCDACKPGYEGRYCERCSLGYYGNPSEPGGKCEVCQCTESGSLHPVCDSQTGKCECKAGVRGHLCDQCE 1478          

HSP 4 Score: 100.138 bits (248), Expect = 4.847e-20
Identity = 77/265 (29.06%), Postives = 121/265 (45.66%), Query Frame = 2
Query: 4313 LTRDIFMMALLNVTSLKVKLYTDKVNPPLIKIKIITYKVMETTQAIGKRVTAVEKCICNALTFGNHCQNPISGYYKEYFNLPNSTKSGSMRTGNRILINLKKCNCNGYSKVCDSVTGDCQNCMGNREGNKCQLCREGFYKN--DKNYDQCEPCQCPS--AHYNFAQNCTRIESSLELKC-QCRIGYSGKSCENCQQGFYGNP-IKGIPCKSCDCNQ--QGSQSLNCNEF-GIC-QCSPGVLGIKCDQCAPNY---VVEKKTCQSC 5068
            + RD  M  L +V SL+++ + +     ++++  ++  V +           VE+C C     G  C+  ISG+Y+           G +  G   L    +C CN ++  CD + G C  C  N  G  C  C  G+Y +  +   + C+ C CP   A  NF+  C+ ++   E+ C QC  GY+G  CE C  G+YGNP + G  C  C+CN     S+  +C+   G C +C     G  C++C   Y    V  K CQ+C
Sbjct:  592 VQRDELMSVLADVASLRIRAHLNTSVDGVLRLSSVSLAVADPISRSAAPAPDVEQCECPWGYSGTSCEYCISGFYR----------VGGILFGGNCL----QCECNDHATECD-INGVCLGCSHNTTGPHCDQCLPGYYGDPTEGTAEDCQRCACPLTLASNNFSPTCS-LQGPGEIMCDQCEQGYTGTKCERCANGYYGNPTVAGQKCSVCECNGNVDPSEPGHCDAVTGECLKCVGHTSGRHCERCEDGYFGDAVTAKDCQAC 840          

HSP 5 Score: 93.9745 bits (232), Expect = 3.379e-18
Identity = 58/161 (36.02%), Postives = 81/161 (50.31%), Query Frame = 2
Query: 3407 GICV-CPPNTIGNLCNKCSEDSWDFNE-----TIGCKKCNCYINGSYSNICNK-----------ISGICACKTAFFGSKCDRCNEGYYGFPNCQPCSCAENGTKSNELTKCDKITGQCQCKQNVIGTKCKVCRKGTFPSDGTYEGGCFSCFCFGVSEKCHA 3838
            G+C+ C  NT G  C  C++  +  ++     T  C +CNC + GS S++C K           + G C CK  F G KCDRC  GY  FP C  C C+  G  S+ +  C     +C CK NV+G  C +C++G +    +   GC  CFCFGVS+ C  
Sbjct:  354 GVCINCTQNTAGVNCETCADGYYRPHKMSPYATEPCLECNCDMRGSVSHVCLKDDKHANPGKGLLPGQCVCKEGFAGEKCDRCAFGYRDFPLCTRCECSLKG--SHNIDPCR----ECICKVNVMGANCDLCKQGFYNLQASNPEGCTECFCFGVSDVCEG 508          

HSP 6 Score: 61.2326 bits (147), Expect = 2.614e-8
Identity = 57/185 (30.81%), Postives = 79/185 (42.70%), Query Frame = 2
Query:  950 CICNNHADKCDKVIENGISVAKC-NCKHNTCGSNCETCCPLFNQRPWKPVAVCEECNCNRKSNECSYNQTVATLQLSVNKMGRMEGGG--VCINCQENTEGINCEKCIKGFYRPWNVLATELYPCTPCQCHGLGTIGSCVSNGEDIGDQKPGDCICKKGYEGVNCDLCSIGYERY--PNGECLPC 1489
            C CNNH+  CD      +   KC  C+HNT G NC  C P +  +    ++ C  C C   SN  S++ T             +EG G   C  C+   EG  CE+C  G+Y   +    +   C  CQC   G++         + D + G C CK G  G  CD C    +R+   N +CL C
Sbjct: 1339 CQCNNHSLACD------LDTGKCLGCQHNTTGENCNVCAPGYYGQVKGSISDCSLCACPLHSN--SFSPTCV-----------LEGVGDFRCDACKPGYEGRYCERCSLGYYGNPSEPGGK---CEVCQCTESGSL-------HPVCDSQTGKCECKAGVRGHLCDQCE---DRHVLSNDQCLSC 1491          

HSP 7 Score: 59.3066 bits (142), Expect = 9.999e-8
Identity = 57/223 (25.56%), Postives = 95/223 (42.60%), Query Frame = 2
Query: 4460 VTAVEKCICNALTFGNHCQNPISGYYKEYFNLPNSTKSGSMRTGNRILINLKKCNCNGYSKVC---DSVT---------------GDCQNCMGNREGNKCQLCREGFYKNDK----NYDQCEPCQCPSAHYNFAQNCTRIESS-------LELKCQCRIGYSGKSCENCQQGFYGNPIKGIPCKSCDCNQQGSQSLN-CNEFGICQCSPGVLGIKCDQCAPNY 5038
            VT   +C+C   T G  C     GY++E +      + G++  GN      +KCNC+  ++ C    +V                G C NC  N  G  C+ C +G+Y+  K      + C  C C     + +  C + +         L  +C C+ G++G+ C+ C  G+   P+    C  C+C+ +GS +++ C E   C C   V+G  CD C   +
Sbjct:  279 VTKKLQCVCEHNTCGESCNECCPGYHQELW------QPGTISDGN----TCEKCNCHNKAEDCYYNQTVADLKMSLNTHGQFVGGGVCINCTQNTAGVNCETCADGYYRPHKMSPYATEPCLECNC-DMRGSVSHVCLKDDKHANPGKGLLPGQCVCKEGFAGEKCDRCAFGYRDFPL----CTRCECSLKGSHNIDPCRE---CICKVNVMGANCDLCKQGF 483          
BLAST of Laminin subunit alpha-2 vs. Ensembl Cavefish
Match: ENSAMXT00000010400.2 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02001664.1:1364:148130:-1 gene:ENSAMXG00000009442.2 transcript:ENSAMXT00000010400.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 554.673 bits (1428), Expect = 6.960e-169
Identity = 389/1117 (34.83%), Postives = 541/1117 (48.43%), Query Frame = 2
Query:  200 AKITSSATCGTGGPEIFCRLVDEIAIQRLINPDSHVLCDVCDNRNET--KRHPIEFAKSDDDNLWWQSPSMAQGLKYQNVNVTIDLKQVYQIVYILLKMGDSPRPGNWILERSLDGEIYMPWIFFAETPYSC---YNLFQRQYPDLKLTTNAKPSSLADDEMFCTTYYSQPKSLNSGEIIISLINGRKSIMNEEYLSIKSVPQTLINFLSARYIRFRFLKHLTLAADLMT----HKGYLEQSIYNRYYYSLRNIEIGGKCICNNHADKCD-KVIENGISVAKCNCKHNTCGSNCETCCPLFNQRPWKPVA-----VCEECNCNRKSNECSYNQTVATLQLSVNKMGRMEGGGVCINCQENTEGINCEKCIKGFYRPWNVLATELYPCTPCQCHGLGTIGS-CVSN-GEDIGDQKPGDCICKKGYEGVNCDLCSIGYERYPNGECLPCPCSIDGSVRTSFYRCKPPCNCKVHVNSDDLCKTCKNGYFNLDSANPEGCEPCYCFGITNQCSSLSAKNLKISDLKGWKLTTFTGEKIALPKFTSFQYLTSENSYIDERFNNPTV---YYWTAPPPYLGNWITSYGTIFRYVVKIELQSTLKGSLIDSPDVIIKCGDFRLFHSVSIEDRRLQRQVFIYIKPTEWKIGKLTPDKAATKEEFISCLVKVDKLLIKAKYYSNQKSIELLNITLSRGEVHLALDEMPHIEKCNCPPGF--------NGLSCESCESGYRRVNNVLYQGQCEACACY------NHSNTCDSLNGE---CQNCTHNTAGAHCEDCASGYYGDAKSKNLNSCKKCPC-PRLDYQMTELCSSYSSENYVCHKCLHNTSGVHCDRCIEGYYGNPKKKISCKRCKCNNN---QESCDPVTGECRCSYNTMGTECQLCKHGFYGDALTKSCKKCDCDSLGSTSENCDKLTGKCDCRTNFVNRQCDSCTSGLY-LKDKKCIPCNCEIQGRISSEKFCNTTSGQCFCLENVNGDRCEKCVEGYFNY---PNCKKCLCSP-HALSADCDLNNGKCKCGSNVINRICDKCENLHYWNNRTDCVPCNCG-RGSLNPKCDME---------TGNCKCAQNVARRDCSKCDVGYFGLDVTGCKKCPPCY 3382
            AKIT++ATCG   PE+FC+LV+ +  Q + NP     C +C+ ++E   +RHPIE+A  D  N WWQSPS+  G++Y  V +T+DL+QV+QI Y +LK  +SPRPGNWILERSLDGE + PW ++A T   C   +N+  R  P         P    DDE+ CT++YS+   L +GEI  SLINGR S  +           TL+NF +ARYIR +FL+  TL A+LMT        ++  +  RYYYS+++I +GG CIC  HA  C   +I   +S   C C+HNTCG +C+ CCP +NQ+PW         VCE+CNC+ KS EC YNQTVA  +LS+N  G  EGGGVC  C ENT G+NC+ C  G+YRP  V   + YPC PC C   G+I S C+ +  +  G    G C CK+GY G  CD C+ GY  +P  EC  C CS+ GS+      C+ PC CK +V   + C  CK G++NL      GCE CYC G+ + C  L  K   ++D+ GW LT   GE +           T    Y+  R   P +   ++W+APP YLGN +++      ++  + +   L  S             F  F             V + +          + D  A+  E  +C         +    S  +    +N T  +G   L      H   C+   G+         G  C+ C  GY           C+ CAC       N S TC         C  C     G  C+ C +GY+G   S    SC+ C C   LD      C   + E   C +C     G  CD C +GYYG+      C+ C+CN N    E C+   G+C C  N +G +C  C        L   C  C+C+S GS S +C +  G+C C+     ++CD C  G +  ++  C PC C   G       C++T+GQC C  N  G+RC++C   ++ Y     CK C C+   ++S  C++N G C C    +   C +C+    + +   C+ C+C   GS    CD +         TG C C  NV    CS C  G FGL V+    C  CY
Sbjct:    2 AKITANATCGERKPEMFCKLVEHVPGQPVRNPQ----CRMCNLKSERPYERHPIEYAI-DGTNKWWQSPSIKNGMEYHYVTITLDLQQVFQIAYFILKAANSPRPGNWILERSLDGENFTPWQYYAITDTECITRFNISPRTGP---------PGYRRDDEVICTSFYSKIHPLENGEIHTSLINGRPSADDPS--------PTLLNFTTARYIRLKFLRIRTLNAELMTLALNDPLDIDPIVTRRYYYSIKDISVGGMCICYGHAKACPLNLITKKLS---CECEHNTCGESCDRCCPGYNQKPWMAGTFLTRHVCEKCNCHGKSEECYYNQTVADGKLSLNVNGEYEGGGVCRGCSENTAGVNCQSCTDGYYRPRGVNPEDPYPCRPCSCDPEGSISSACIPDETQASGGLSEGWCRCKQGYTGEKCDRCAFGYTGFP--ECQRCNCSVFGSINQD--PCQLPCVCKDNVEGVN-CDRCKMGFYNLHGDGFHGCEKCYCSGVASNCEDLLWKRSNLTDMSGWFLTGAEGEGLVWANRN-----TPLQVYVSHRDAQPHLEAPFFWSAPPSYLGNKVST-----NHLDHLSINIYLNVSPF-----------FLYFCLCVCVCVCRLGSVSVEVASE-----GSSSDVQASAVEVCTCPFGYSGTSCE----SCAEGYRRINGTTYQGVCELCQCHG-HAAHCDEVTGYCLGCEDHTTGPHCDKCAPGYYGDATKGTASDCQPCACPLNAPSNNFSPTCHQDARSQMICDRCQPGYTGPRCDRCDNGYFG-RPSVLGGSCRPCECNDNLDLSTDRSCDPVTGE---CLRCREGYGGPVCDTCADGYYGDAIFAKDCQPCRCNINGSVSEVCNKQNGQCECRQNAIGRQCDEC---MVTHMLPGGCVPCNCNSFGSKSFDCGE-NGQCRCQPGVTGQKCDRCAPGHFNFQEGGCTPCQCAHVG-----NNCDSTTGQCICPPNTIGERCDRCAPNHWGYDITTGCKPCGCNVLGSVSQQCNVNTGCCTCQERFVGEKCTECK--LGFRDFPQCMSCDCTLAGSTADTCDSDSGLCACADRTGQCSCKANVEGVRCSSCKAGTFGLSVSNPLGCSHCY 1042          

HSP 2 Score: 279.256 bits (713), Expect = 3.516e-76
Identity = 187/564 (33.16%), Postives = 262/564 (46.45%), Query Frame = 2
Query: 2240 IEKCNCPPGFNGLSCESCESGYRRVNNVLYQGQCEACACYNHSNTCDSLNGECQNCTHNTAGAHCEDCASGYYGDAKSKNLNSCKKCPCP--RLDYQMTELCSSYSSENYVCHKCLHNTSGVHCDRCIEGYYGNPKK-KISCKRCKCNNN-----QESCDPVTGEC-RCSYNTMGTECQLCKHGFYGDAL-TKSCKKCDCDSLGSTSENCDKLTGKCDCRTNFVNRQCDSCTSGLYLKDKKCIPCNCEIQGRISSEKFCNTTSGQCFCLENVNGDRCEKCVEGYFNYP--NCKKCLCSPHALSADCDLNNGKCKCGSNVINRICDKCENLHY-WNNRTDCVPCNCG-RGSLNPKCDMETGNCKCAQNVARRDCSKCDVGYFGLDVTGCKKCPPCYNGQVCNNEGICVCPPNTIGNLCNKCSEDSWDFNETIGCKKCNCYINGSYSNICNKISGICACKTAFFGSKCDRCNEGYYGFPNCQPCSCAENGTKSNELTKCDKITGQCQCKQNVIGTKCKVCRKGTFPSDGTYEGGCFSCFCFGVSEKC---HAILNHRIVENSIYEY 3880
            +E C CP G++G SCESC  GYRR+N   YQG CE C C+ H+  CD + G C  C  +T G HC+ CA GYYGDA     + C+ C CP        +  C   +    +C +C    +G  CDRC  GY+G P     SC+ C+CN+N       SCDPVTGEC RC     G  C  C  G+YGDA+  K C+ C C+  GS SE C+K  G+C+CR N + RQCD C    ++    C+PCNC   G   S+ F    +GQC C   V G +C++C  G+FN+    C  C C+   +  +CD   G+C C  N I   CD+C   H+ ++  T C PC C   GS++ +C++ TG C C +      C++C +G+                                             DF +   C  C+C + GS ++ C+  SG+CAC         DR  +          CSC                      K NV G +C  C+ GTF    +   GC  C+CFG+S+ C     ++  R+ +   + Y
Sbjct:  599 VEVCTCPFGYSGTSCESCAEGYRRINGTTYQGVCELCQCHGHAAHCDEVTGYCLGCEDHTTGPHCDKCAPGYYGDATKGTASDCQPCACPLNAPSNNFSPTCHQDARSQMICDRCQPGYTGPRCDRCDNGYFGRPSVLGGSCRPCECNDNLDLSTDRSCDPVTGECLRCREGYGGPVCDTCADGYYGDAIFAKDCQPCRCNINGSVSEVCNKQNGQCECRQNAIGRQCDECMV-THMLPGGCVPCNCNSFG---SKSFDCGENGQCRCQPGVTGQKCDRCAPGHFNFQEGGCTPCQCA--HVGNNCDSTTGQCICPPNTIGERCDRCAPNHWGYDITTGCKPCGCNVLGSVSQQCNVNTGCCTCQERFVGEKCTECKLGFR--------------------------------------------DFPQ---CMSCDCTLAGSTADTCDSDSGLCACA--------DRTGQ----------CSC----------------------KANVEGVRCSSCKAGTFGLSVSNPLGCSHCYCFGMSQSCTEAQGLIRMRVSKTHTHTY 1069          

HSP 3 Score: 82.8037 bits (203), Expect = 5.908e-15
Identity = 72/271 (26.57%), Postives = 119/271 (43.91%), Query Frame = 2
Query: 4292 SNVINSNLTRDIFMMALLNVTSLKVKLYTDKVNPPLIKIKIITYKVMETTQAIGKRVTAVEKCICNALTFGNHCQNPISGYYKEYFNLPNSTKSGSMRTGNRILINLKKCNCNGYSKVCDSVTGDCQNCMGNREGNKCQLCREGFYKN--DKNYDQCEPCQCP--SAHYNFAQNCTRIESSLELKCQCRIGYSGKSCENCQQGFYGNP-IKGIPCKSCDCNQ--QGSQSLNCNEF-GIC-QCSPGVLGIKCDQCAPNY---VVEKKTCQSC 5068
             N +++N    + +   LNV+   +  +   V   + ++  ++ +V     +   + +AVE C C     G  C++   GY +    +  +T  G            + C C+G++  CD VTG C  C  +  G  C  C  G+Y +        C+PC CP  +   NF+  C +   S  +  +C+ GY+G  C+ C  G++G P + G  C+ C+CN     S   +C+   G C +C  G  G  CD CA  Y    +  K CQ C
Sbjct:  541 GNKVSTNHLDHLSINIYLNVSPFFL-YFCLCVCVCVCRLGSVSVEVASEGSSSDVQASAVEVCTCPFGYSGTSCESCAEGYRR----INGTTYQGV----------CELCQCHGHAAHCDEVTGYCLGCEDHTTGPHCDKCAPGYYGDATKGTASDCQPCACPLNAPSNNFSPTCHQDARSQMICDRCQPGYTGPRCDRCDNGYFGRPSVLGGSCRPCECNDNLDLSTDRSCDPVTGECLRCREGYGGPVCDTCADGYYGDAIFAKDCQPC 796          

HSP 4 Score: 77.411 bits (189), Expect = 2.800e-13
Identity = 49/147 (33.33%), Postives = 73/147 (49.66%), Query Frame = 2
Query: 4613 KKCNCN-----GYSKVCDSVTGDCQNCMGNREGNKCQLCREGFYKNDKNYDQCEPCQCPSAHYNFAQNCTRIESSLELKCQCRIGYSGKSCENCQQGFYGNPIKGIPCKSCDCNQQGSQSLNCNEFGICQCSPGVLGIKCDQCAPNY 5038
            + C CN        + CD VTG+C  C     G  C  C +G+Y +      C+PC+C     N   + + + +    +C+CR    G+ C+ C      + + G  C  C+CN  GS+S +C E G C+C PGV G KCD+CAP +
Sbjct:  741 RPCECNDNLDLSTDRSCDPVTGECLRCREGYGGPVCDTCADGYYGDAIFAKDCQPCRC-----NINGSVSEVCNKQNGQCECRQNAIGRQCDEC---MVTHMLPG-GCVPCNCNSFGSKSFDCGENGQCRCQPGVTGQKCDRCAPGH 878          

HSP 5 Score: 75.485 bits (184), Expect = 1.071e-12
Identity = 83/280 (29.64%), Postives = 110/280 (39.29%), Query Frame = 2
Query: 3086 CLCSPHALSADCDLNNGK--CKCGSNVINRICDKC---ENLHYWN-----NRTDCVPCNCGRGSLNPKCDMETGNCKCAQNVARRDCSKCDVGYFGLDVTGCKKCPPCYNGQVCNNEGICVCPPNTIGNLCNKCSEDSW-----DFNETIGCKKCNCYINGSYSNIC---------NKISGICACKTAFFGSKCDRCNEGYYGFPNCQPCSCAENGTKSNELTKCDKITGQCQCKQNVIGTKCKVCRKGTFPSDGTYEGGCFSCFCFGVSEKCHAILNHR 3853
            C+C  HA +   +L   K  C+C  N     CD+C    N   W       R  C  CNC           ++  C   Q VA         G   L+V G  +      G VC       C  NT G  C  C++  +     +  +   C+ C+C   GS S+ C             G C CK  + G KCDRC  GY GFP CQ C+C+  G+ +      D     C CK NV G  C  C+ G +   G    GC  C+C GV+  C  +L  R
Sbjct:  239 CICYGHAKACPLNLITKKLSCECEHNTCGESCDRCCPGYNQKPWMAGTFLTRHVCEKCNC---------HGKSEECYYNQTVAD--------GKLSLNVNGEYE-----GGGVCRG-----CSENTAGVNCQSCTDGYYRPRGVNPEDPYPCRPCSCDPEGSISSACIPDETQASGGLSEGWCRCKQGYTGEKCDRCAFGYTGFPECQRCNCSVFGSINQ-----DPCQLPCVCKDNVEGVNCDRCKMGFYNLHGDGFHGCEKCYCSGVASNCEDLLWKR 486          

HSP 6 Score: 67.3958 bits (163), Expect = 2.857e-10
Identity = 73/253 (28.85%), Postives = 101/253 (39.92%), Query Frame = 2
Query:  950 CICNNHADKCDKVIENGISVAKCNCKHNTCGSNCETCCP-LFNQRPWKPVAVCEECNCNRKSNECSYNQTVATLQLSVNKMGRMEGGGVCINCQENTEGINCEKCIKGFYRPWNVLATELYPCTPCQCHGLGTIGS-CVSNGEDIGDQKPGDCICKKGYEGVNCDLCSIGYERYPNGECLPCPCSIDGSVR------TSFYRCKP---PCNCKVHVNSDDLCKTCKNGYFNLDSANPEGCEPCYCFGITNQCS 1675
            C CN+   K     ENG    +C C+    G  C+ C P  FN +       C  C C    N C                      G CI C  NT G  C++C       W    T    C PC C+ LG++   C  N         G C C++ + G  C  C +G+  +P  +C+ C C++ GS        +    C      C+CK +V     C +CK G F L  +NP GC  CYCFG++  C+
Sbjct:  842 CNCNSFGSKSFDCGENG----QCRCQPGVTGQKCDRCAPGHFNFQE----GGCTPCQCAHVGNNCDSTT------------------GQCI-CPPNTIGERCDRCAPNH---WGYDITT--GCKPCGCNVLGSVSQQCNVN--------TGCCTCQERFVGEKCTECKLGFRDFP--QCMSCDCTLAGSTADTCDSDSGLCACADRTGQCSCKANVEGV-RCSSCKAGTFGLSVSNPLGCSHCYCFGMSQSCT 1051          

HSP 7 Score: 59.3066 bits (142), Expect = 8.064e-8
Identity = 86/374 (22.99%), Postives = 142/374 (37.97%), Query Frame = 2
Query: 4316 TRDIFMMALLNVTSLKVKLYTDKVNPPLIKIKIITYKVMETTQAIG----------------KRVTAVEKCICNALTFGNHCQNPISGYYKEYFNLPNSTKSGSMRTGNRILINLKKCNCNGYSKVC---DSVT---------------GDCQNCMGNREGNKCQLCREGFYK----NDKNYDQCEPCQC-PSAHYNFAQNCTRIESSLELK---CQCRIGYSGKSCENCQQGFYGNPIKGIPCKSCDCNQQGSQSLNCNEFGICQCSPGVLGIKCDQCAPNYV---------VEKKTCQSCYSGCTKDLLVRIDTLNETVINF---------KWKTLPSTLDLRLNKINISIQMSSELLNSINKFYKLKNEIK 5257
            T     +  L + +L  +L T  +N PL    I+T +   + + I                   +T    C C   T G  C     GY ++ +       +G+  T +      +KCNC+G S+ C    +V                G C+ C  N  G  CQ C +G+Y+    N ++   C PC C P    + A      ++S  L    C+C+ GY+G+ C+ C  G+ G P     C+ C+C+  GS + +  +   C C   V G+ CD+C   +           EK  C    S C +DLL +   L +    F          W    + L + ++  +    + +    S    Y L N++ 
Sbjct:  189 TARYIRLKFLRIRTLNAELMTLALNDPLDIDPIVTRRYYYSIKDISVGGMCICYGHAKACPLNLITKKLSCECEHNTCGESCDRCCPGYNQKPW------MAGTFLTRHVC----EKCNCHGKSEECYYNQTVADGKLSLNVNGEYEGGGVCRGCSENTAGVNCQSCTDGYYRPRGVNPEDPYPCRPCSCDPEGSISSACIPDETQASGGLSEGWCRCKQGYTGEKCDRCAFGYTGFP----ECQRCNCSVFGSINQDPCQL-PCVCKDNVEGVNCDRCKMGFYNLHGDGFHGCEKCYCSGVASNC-EDLLWKRSNLTDMSGWFLTGAEGEGLVWANRNTPLQVYVSHRDAQPHLEAPFFWSAPPSY-LGNKVS 545          
BLAST of Laminin subunit alpha-2 vs. Ensembl Cavefish
Match: lamc1 (laminin subunit gamma 1 [Source:NCBI gene;Acc:103023755])

HSP 1 Score: 442.965 bits (1138), Expect = 6.685e-127
Identity = 317/1049 (30.22%), Postives = 483/1049 (46.04%), Query Frame = 2
Query:  197 NAKITSSATCGTGGPEIFCRLVDEIAIQRLINPDSHVLCDVCDNRNETKRHPIEFAK---SDDDNLWWQSPSMAQGLKYQN-VNVTIDLKQVYQIVYILLKMGDSPRPGNWILERSLDGEIYMPWIFFAETPYSCYNLFQRQYPDLKLTTNAKPSSLADDEMFCTTYYSQPKSLNSGEIIISLINGRKSIMNEEYLSIKSVPQTLINFLSARYIRFRFLKHLTLAADLMTHKGYLEQSIYNRYYYSLRNIEIGGKCICNNHADKCDKVIENGISVAKCNCKHNTCGSNCETCCPLFNQRPWKPVAV-----CEECNCNRKSNECSYNQTVATLQLSVNKMGRMEG-GGVCINCQENTEGINCEKCIKGFYRPWNVLATELYPCTPCQCHGLGTIGSCVSNGEDIGDQKPGDCICKKGYEGVNCDLCSIGYERYPNGECLPCPCSIDGSVRTSFYRCKPPCNCKVHVNSDDLCKTCKNGYFNLDSANPEGCEPCYCFGITNQCSSLSAKNLKI------SDLKGWKLTTFTGEKIALPKFTSFQYLTSENSYIDERFNNPTVYYWTAPPPYLGNWITSYGTIFRYVVKIELQSTLKGSLIDSPDVIIKCGDFR-----LFHSVSIEDRRLQRQVFIYIKPTEWKIGKLTPDKAATKEEFISCLVKVDKLLIKAKYYSNQKSIELLNITLSRGEVHLALDEMPHIEKCNCPPGFNGLSCESCESGYRRVNNVL-YQGQCEACACYNHSNTCDSLNGECQNCTHNTAGAHCEDCASGYYGDAKSKNLNSCKKCPCPRLDYQMTELCSSY-SSENYVCHKCLHNTSGVHCDRCIEGYYGNPKKKI----SCKRCKCNNNQE-----SCDPVTGEC-RCSYNTMGTECQLCKHGFYGDALTKS----CKKCDCDSLGSTSEN--CDKLTGKCDCRTNFVNRQCDSCTSGLY--LKDKKCIPCNCEIQGRISSEKFCNTTSGQCFCLENVNGDRCEKCVEGYFNY--PNCKKCLCSPHALSADCDLNNGKCKCGSNVINRICDKCENLHYWNNRT 3214
            N  + ++ TCG+  PE +C       + +         C +CD R+  + H   +     +  D  WWQS +M  G++Y N +N+T+ L + + I Y+ LK   S      I +R+ +G  + P+ +++ +    Y+   R +    + T        + +  CT  +S    L  G +  S + GR S  N +   +      L ++++A  IR    +  T   ++     + +  +   YYY++ +  +GG+C CN HA +C   +++  S   CNCKHNT G +C  C P +N RPW+         C  CNCN KS EC ++          +++ R  G GG C NC +NT+G NCE+C+  +YR  +        C PC C+ +G++    S   DI     G C CK G  G  CD C  GY       C PC C+  GS +         C CK +V+  + C  CK GYFNLD  NP+GC PC+CF  +  C S    ++         D +GWK     G  + +     +   + E S I + +      Y+ AP  +LGN + SYG       ++E     + + + + DV+++    +     +    S    ++Q  VF   + T++    +      T  +F   L  +  + I+   YS + +  L N++L   +          +EKC CPPG+ G  C  C  GYRR    L     CE C C  HS TCD   G C NC  NTAG  CE C  G+YGDA   + + CK CPCP         C+    ++  VC  C   T+G  C+ C +G++G+P  K     +C+ CKC++N +     +CD  TGEC +C YNT G  C  CK GFYG+AL  +    CK C C   G+  +   C ++TG+C C  +  NR C +C  G Y     K C  CNC   G  S+   C+  SGQC C   V G +CE+C   +F +    CK C C P          +G+C+C    +   CD CE  +++N  T
Sbjct:   47 NVTVVATNTCGSP-PEEYCVQTGVTGVTKS--------CHICDARDPRQHHSAVYLTDYNNQADTTWWQSQTMLAGIQYPNSINLTLHLGKAFDITYVRLKFHTSRPESFAIYKRTREGGPWTPYQYYSGSCEKTYSKLNRGF----IRTGED-----EQQALCTDEFSDISPLTGGNVAFSTLEGRPSAYNFDNSPV------LQDWVTATDIRVTLNRLNTFGDEV-----FNDPKVLKSYYYAISDFAVGGRCKCNGHASEC---VKDEYSKLVCNCKHNTEGDDCGVCKPFYNDRPWRRATADNPNECLPCNCNGKSGECYFD----------SELYRATGHGGHCRNCADNTDGPNCERCLDNYYRDGSGQR-----CLPCSCNPVGSL----STQCDI----TGRCSCKSGVMGDKCDRCQPGYHTLTEAGCSPCSCNPAGSTQECDVNTGR-CQCKDNVDGFN-CDRCKLGYFNLDPQNPQGCTPCFCFHHSTVCESADGYSIHTITSNFDRDDEGWKGKQRDGSSVPV----QWSLASQEISLISDDY---FPMYFVAPAKFLGNHLLSYGQNLTLNFRVE----RRDARLSAEDVMLEGAGLQVAVPLIAQGNSYPGEQMQTFVFRLHQTTDYPWRPVL-----THGDFQKLLHNLTSIKIRGT-YSERSAGYLDNVSLVSAQRGPGTPAR-WVEKCTCPPGYVGQHCGQCALGYRRSRPELGLYSPCEPCNCNGHSETCDPATGMC-NCQDNTAGMSCERCKDGFYGDATVGSSSDCKPCPCPS-----GATCALVPKTKEAVCTNCPAGTTGKRCELCDDGFFGDPLGKSGPVRACRECKCSSNIDPNAVGNCDRETGECLKCIYNTDGFFCDRCKEGFYGNALATNVADKCKPCSCSPYGTVDQQTTCMQVTGECTCLPHVTNRDCSACQPGFYNLQSGKGCERCNCNQIG--STNGHCDIVSGQCECQPGVTGQQCERCEVNFFGFSTSGCKPCDCDPEGSRLAQCREDGRCECRPGFVGARCDMCEENYFYNRST 1012          

HSP 2 Score: 165.236 bits (417), Expect = 6.498e-40
Identity = 158/562 (28.11%), Postives = 239/562 (42.53%), Query Frame = 2
Query: 3419 CPPNTIGNLCNKCSEDSWDFNETIGCKKCNCYINGSYSNICNKISGICACKTAFFGSKCDRCNEGYYGF--PNCQPCSCAENGTKSNELTKCDKITGQCQCKQNVIGTKCKVCRKGTFPSDGTYEGGCFSCFCFGVSEKCHAILNHRIVENSIYEYHIFDEKNSLESGKDYSTIHLNANYP-RRFGWPLTMFRPIY-VNVMKLFNSHDLSLFYRSIFMNVSVDCLDNKCGREIPEQTEVFMESYNGLFGMRYXXXXXXXXXXXXXXDFNEHSKNGKWVISQ---YQNDILDKFIILEDSNV---INSNLTRDIFMMALLNVTSLKVK-LYTDKVNPPLIKIKIITYKVMETTQAIGKRVTAVEKCICNALTFGNHCQNPISGYYKEYFNLPNSTKSGSMRTGNRILINLKKCNCNGYSKVCDSVTGDCQNCMGNREGNKCQLCREGFYKNDK--NYDQCEPCQCPSAHYNFAQNCTRIESSLELKC-QCRIGYSGKSCENCQQGFYGNPI-KGIP---CKSCDC--NQQGSQSLNCN-EFGIC-QCSPGVLGIKCDQCAPNY 5038
            C  NT G  C +C ++ +       C  C+C   GS S  C+ I+G C+CK+   G KCDRC  GY+      C PCSC   G+      +CD  TG+CQCK NV G  C  C+ G F  D     GC  CFCF  S  C +   + I  ++I      D++      +D S++ +  +   +        + P+Y V   K   +H LS + +++ +N  V+  D +   E     +V +E      G++  V                       +I+Q   Y  + +  F+              LT   F   L N+TS+K++  Y+++    L  + +++ +     +  G     VEKC C     G HC     GY +    L              +    + CNCNG+S+ CD  TG C NC  N  G  C+ C++GFY +    +   C+PC CPS        C  +  + E  C  C  G +GK CE C  GF+G+P+ K  P   C+ C C  N   +   NC+ E G C +C     G  CD+C   +
Sbjct:  357 CADNTDGPNCERCLDNYYRDGSGQRCLPCSCNPVGSLSTQCD-ITGRCSCKSGVMGDKCDRCQPGYHTLTEAGCSPCSCNPAGSTQ----ECDVNTGRCQCKDNVDGFNCDRCKLGYFNLDPQNPQGCTPCFCFHHSTVCESADGYSI--HTITSNFDRDDEGWKGKQRDGSSVPVQWSLASQEISLISDDYFPMYFVAPAKFLGNHLLS-YGQNLTLNFRVERRDARLSAE-----DVMLEGA----GLQVAVP----------------------LIAQGNSYPGEQMQTFVFRLHQTTDYPWRPVLTHGDFQKLLHNLTSIKIRGTYSERSAGYLDNVSLVSAQ-----RGPGTPARWVEKCTCPPGYVGQHCGQCALGYRRSRPELG-------------LYSPCEPCNCNGHSETCDPATGMC-NCQDNTAGMSCERCKDGFYGDATVGSSSDCKPCPCPS-----GATCALVPKTKEAVCTNCPAGTTGKRCELCDDGFFGDPLGKSGPVRACRECKCSSNIDPNAVGNCDRETGECLKCIYNTDGFFCDRCKEGF 855          

HSP 3 Score: 158.688 bits (400), Expect = 5.541e-38
Identity = 110/338 (32.54%), Postives = 157/338 (46.45%), Query Frame = 2
Query: 2594 GVHCDRCIEGYY-GNPKKKI--SCKRCKCNNNQESCDPVTGECRCSYNTMGTECQLCKHGFYGDALTKS---CKKCDCDSLGSTSENCDKLTGKC-DCRTNFVNRQCDSCTSGLYLKD-------KKCIPCNCEIQGRISSEKFCNTTSGQCF-CLENVNGDRCEKCVEGYFN-------YPNCKKCLCSPHAL---SADCDLNNGKCKCGSNVINRICDKCENLHY-WNNRTDCVPCNCGR-GSLNPKCDMETGNCKCAQNVARRDCSKCDVGYFGLDVTGCKKC---PPCYNGQVCNNEGICVCPPNTIGNLCNKCSEDSWDFNETIGCKKC-NCY 3514
            G HC +C  GY    P+  +   C+ C CN + E+CDP TG C C  NT G  C+ CK GFYGDA   S   CK C C S  + +         C +C      ++C+ C  G +          + C  C C      ++   C+  +G+C  C+ N +G  C++C EG++           CK C CSP+        C    G+C C  +V NR C  C+   Y   +   C  CNC + GS N  CD+ +G C+C   V  + C +C+V +FG   +GCK C   P       C  +G C C P  +G  C+ C E+ +    T GC++C NCY
Sbjct:  685 GQHCGQCALGYRRSRPELGLYSPCEPCNCNGHSETCDPATGMCNCQDNTAGMSCERCKDGFYGDATVGSSSDCKPCPCPSGATCALVPKTKEAVCTNCPAGTTGKRCELCDDGFFGDPLGKSGPVRACRECKCSSNIDPNAVGNCDRETGECLKCIYNTDGFFCDRCKEGFYGNALATNVADKCKPCSCSPYGTVDQQTTCMQVTGECTCLPHVTNRDCSACQPGFYNLQSGKGCERCNCNQIGSTNGHCDIVSGQCECQPGVTGQQCERCEVNFFGFSTSGCKPCDCDPEGSRLAQCREDGRCECRPGFVGARCDMCEENYFYNRSTPGCQQCPNCY 1022          

HSP 4 Score: 117.472 bits (293), Expect = 2.065e-25
Identity = 98/356 (27.53%), Postives = 152/356 (42.70%), Query Frame = 2
Query: 2855 KCDCRTNFVNRQCDSCTSGLYLKDKK-------CIPCNCEIQGRISSEKFCNTTSGQCFCLENVNGDRCEKCVEGYF------NYPNCKKCLCSPHALSADCDLNNGKC--KCGSNVINRICDKCENLHYWNNRTDCVP------CNCGRGSLNPK----CDMETGNC-KCAQNVARRDCSKCDVGYFG--LDVTGCKKCPPCY---NGQVCNNE------GICVCPPNTIGNLCNKCSEDSWDFNETIGCKKCNCYINGSYSNICNKISGICACKTAFFGSKCDRCNEGYYGF--PNCQPCSCAENGTKSNELTKCDKITGQCQCKQNVIGTKCKVCRKGTFPSDGTYEGGCFSC 3805
            KC C   +V + C  C  G Y + +        C PCNC         + C+  +G C C +N  G  CE+C +G++      +  +CK C C   A  A            C +    + C+ C++  + +      P      C C   +++P     CD ETG C KC  N     C +C  G++G  L      KC PC     G V          G C C P+     C+ C    ++     GC++CNC   GS +  C+ +SG C C+    G +C+RC   ++GF    C+PC C   G++   L +C +  G+C+C+   +G +C +C +  F +  T   GC  C
Sbjct:  676 KCTCPPGYVGQHCGQCALG-YRRSRPELGLYSPCEPCNCN-----GHSETCDPATGMCNCQDNTAGMSCERCKDGFYGDATVGSSSDCKPCPCPSGATCALVPKTKEAVCTNCPAGTTGKRCELCDDGFFGDPLGKSGPVRACRECKCS-SNIDPNAVGNCDRETGECLKCIYNTDGFFCDRCKEGFYGNALATNVADKCKPCSCSPYGTVDQQTTCMQVTGECTCLPHVTNRDCSACQPGFYNLQSGKGCERCNCNQIGSTNGHCDIVSGQCECQPGVTGQQCERCEVNFFGFSTSGCKPCDCDPEGSR---LAQC-REDGRCECRPGFVGARCDMCEENYFYNRST--PGCQQC 1018          

HSP 5 Score: 102.834 bits (255), Expect = 5.571e-21
Identity = 131/544 (24.08%), Postives = 208/544 (38.24%), Query Frame = 2
Query: 4484 CNALTFGNHCQNPISGYYKEYFNLPNSTKSGSMRTGNRILINLKKCNCNG-----YSKVCDSVTGDCQNCMGNREGNKCQLCREGFYKN---DKNYDQCEPCQCPS---------------------------------AHYNFAQ-------NCTRIESS------LELKCQCRIGYSGKSCENCQQGFYGNPIKGIPCKSCDCNQQGSQSLNCNEFGICQCSPGVLGIKCDQCAPNYVVEKKT-----CQSCYSGCTK----------------DLLVRIDTLNETVINFKWKTLPSTLDLRLNKINISIQMSSELLNSI--------NKFYKLKNEIKNFSIQFQKMKDDAKEKYGEIEKLKTRYNKVLEDLRSTFTDI------------NETISGHEQLGISNELIKNATAYLETIKNIYKEMPNITLAASVLKDVLKY-------VDELNQIIKYTQSHIQSDQINNLKILKNKTIMADEINTNNKE---YLNTMSTKK---KEHELYIILINERMKDLQKIFRKMTKQRDNLRKKIQ 5791
            C A T G  C+    G++ +        KSG +R         ++C C+          CD  TG+C  C+ N +G  C  C+EGFY N       D+C+PC C                                     YN          NC +I S+      +  +C+C+ G +G+ CE C+  F+G    G  CK CDC+ +GS+   C E G C+C PG +G +CD C  NY   + T     C +CYS                    D L   DT+++     + K     +   L +   S  +   LL+ +         ++ +L+N I+N       + D A+ +  E EKL  R    L+  +   + +            N T+   E   ++ +    A    +T K+        T A ++LK  L         +DELN+  KY+++    D   NL+   +K + A+     NK    Y N  S      K  E     I +   DL K+  K  K+ ++LR  ++
Sbjct:  782 CPAGTTGKRCELCDDGFFGDPLG-----KSGPVRA-------CRECKCSSNIDPNAVGNCDRETGECLKCIYNTDGFFCDRCKEGFYGNALATNVADKCKPCSCSPYGTVDQQTTCMQVTGECTCLPHVTNRDCSACQPGFYNLQSGKGCERCNCNQIGSTNGHCDIVSGQCECQPGVTGQQCERCEVNFFGFSTSG--CKPCDCDPEGSRLAQCREDGRCECRPGFVGARCDMCEENYFYNRSTPGCQQCPNCYSLVRDKVNQHRQKLHDLQTLIDNLGTQDTVSDKAFEDRLKEAEKAIMDLLKEAQASKDVDKGLLDRLKGINNTLTTQWNRLQN-IRNTVDNTGTLADKAQNRVREAEKLIDRARDELDKAKDAISKVDIKTPTTTGDPNNMTLLAEEARNLAEKHKLEADQIEKTAKDAND---TSTKAYNLLKKTLDGENKINSDIDELNK--KYSEAK---DLAKNLEKQASK-VQAEAEEAGNKALKIYANLTSLPPFDVKSLEDEASKIKKEASDLDKLIDKTEKEYNDLRDDLK 1301          

HSP 6 Score: 98.9821 bits (245), Expect = 8.954e-20
Identity = 76/255 (29.80%), Postives = 115/255 (45.10%), Query Frame = 2
Query: 2660 RCKCNNNQESCDPVTGE-----CRCSYNTMGTECQLCKHGFYGDALTKSCKKCDCDSLGSTSENCDKLTGKCDCRTNFVNRQCDSCTSGLYLKDKKCIPCNCEIQGR---ISSEKFCNTT-SGQCF-CLENVNGDRCEKCVEGYFNYPNCKKCL---CSP-HALSADCDLNNGKCKCGSNVINRICDKCENLHYWNNRTDCVPCNCGRGSLNPKCDMETGNCKCAQNVARRDCSKCDVGYFGLDVTGCKKCPPCY 3382
            RCKCN +   C  V  E     C C +NT G +C +CK  FY D   +           +T++N                               +C+PCNC  +       SE +  T   G C  C +N +G  CE+C++ Y+   + ++CL   C+P  +LS  CD+  G+C C S V+   CD+C+  ++      C PC+C       +CD+ TG C+C  NV   +C +C +GYF LD    + C PC+
Sbjct:  272 RCKCNGHASEC--VKDEYSKLVCNCKHNTEGDDCGVCKP-FYNDRPWRR----------ATADN-----------------------------PNECLPCNCNGKSGECYFDSELYRATGHGGHCRNCADNTDGPNCERCLDNYYRDGSGQRCLPCSCNPVGSLSTQCDIT-GRCSCKSGVMGDKCDRCQPGYHTLTEAGCSPCSCNPAGSTQECDVNTGRCQCKDNVDGFNCDRCKLGYFNLDPQNPQGCTPCF 483          

HSP 7 Score: 68.1662 bits (165), Expect = 1.964e-10
Identity = 84/312 (26.92%), Postives = 127/312 (40.71%), Query Frame = 2
Query: 4295 NVINSNLTRDIFMMALLNVTSLKVKLYTDKV--NPPLIK---IKIITYKVMETTQAIGKRVTAVEK------CICNALTFGNHCQNPISGYYKEYFNLPNSTKSGSMRTGNRILINLKKCNCNGYSKVC--DSV-------TGDCQNCMGNREGNKCQLCREGFYKNDKNYDQCEPCQCPSAHYNFAQNCTRIESSLELKCQCRIGYSGKSCENCQQGFYGNPIKGIPCKSCDCNQQGS-QSLNCNEFGICQCSPGVLGIKCDQCAPNYV-VEKKTCQSCYSGCTKDLLVRIDTLNETVINFKWKTLPSTLD 5164
            N  NS + +D      + VT  ++  + D+V  +P ++K     I  + V    +  G     V+       C C   T G+ C     G  K ++N     +  +    N  L     CNCNG S  C  DS         G C+NC  N +G  C+ C + +Y+ D +  +C PC C     + +  C      +  +C C+ G  G  C+ CQ G++     G  C  C CN  GS Q  + N  G CQC   V G  CD+C   Y  ++ +  Q    GCT        T+ E+   +   T+ S  D
Sbjct:  220 NFDNSPVLQDWVTATDIRVTLNRLNTFGDEVFNDPKVLKSYYYAISDFAVGGRCKCNGHASECVKDEYSKLVCNCKHNTEGDDC-----GVCKPFYN-DRPWRRATADNPNECL----PCNCNGKSGECYFDSELYRATGHGGHCRNCADNTDGPNCERCLDNYYR-DGSGQRCLPCSCNPVG-SLSTQC-----DITGRCSCKSGVMGDKCDRCQPGYHTLTEAG--CSPCSCNPAGSTQECDVNT-GRCQCKDNVDGFNCDRCKLGYFNLDPQNPQ----GCTPCFCFHHSTVCESADGYSIHTITSNFD 507          
BLAST of Laminin subunit alpha-2 vs. Ensembl Cavefish
Match: lamc3 (laminin, gamma 3 [Source:ZFIN;Acc:ZDB-GENE-060531-121])

HSP 1 Score: 383.645 bits (984), Expect = 1.559e-107
Identity = 303/1020 (29.71%), Postives = 449/1020 (44.02%), Query Frame = 2
Query:  311 CDVCD-NRNETKRHPIEFAKSDDDNLWWQSPSMAQGLKYQN-VNVTIDLKQVYQIVYILLKMGDSPRPGNWILERSLDGEIYMPWIFFAETPYSCYNLFQRQYPDLKLTTNAKPSSLADDEMFCTTYYSQPKSLNSGEIIISLINGRKSIMNEEYLSIKSVPQTLINFLSARYIRFRFLKHLTLAADLMTHKGYLEQSIYNRYYYSLRNIEIGGKCICNNHADKCDKVIENGISVAKCNCKHNTCGSNCETCCPLFNQRPWKPVAV-----CEECNCNRKSNECSYNQTVATLQLSVNKMGRMEGGGVCINCQENTEGINCEKCIKGFYRPWNVLATELYPCTPCQCHGLGTIGSCVSNGEDIGDQKPGDCICKKGYEGVNCDLCSIGYERYPNGECLPCPCSIDGSVRTSFYRCKPPCNCKVHVNSDDLCKTCKNGYFNLDSANPEGCEPCYCFGITNQCSSLS---AKNLK---ISDLKGWKLTTFTGEKIALPKFTSFQYLTSENSYIDERFNNPTVYYWTAPPPYLGNWITSYGTIF--------RYVVKIELQSTLKGSLIDSPDVIIKCGDFRL----FHSVSIEDRRLQRQVFIYIKPTEWK--IGKLTPDKA--ATKEEFISCLVKVDKLLIKAKYYSNQKSIELLNITLSRGEVHLALDEMPHIEKCNCPPGFNGLSCESCESGY-RRVNNVLYQGQCEACACYNHSNTCDSLNGECQNCTHNTAGAHCEDCASGYYGDAKSKNLNSCKKCPCPRLDYQMTELCSSYSSENYVCHKCLHNTSGVHCDRCIEGYYGNPKKKIS----CKRCKCNNNQES-----CDPVTGEC-RCSYNTMGTECQLCKHGFYGDAL------TKSCKKCDCDSLGS--TSENCDKLTGKCDCRTNFVNRQCDSCTSGLY--LKDKKCIPCNCEIQGRISSEKFCNTTSGQCFCLENVNGDRCEKCVEGYFNYPN--CKKCLCSPHALSADCDLNNGKCKCGSNVINRICDKCENLHYWNNRT 3214
            CD  D   N    +  +F  SD++  WWQS SM  G++Y N VN+T+ L + ++I Y+ LK   S RP ++ + +  D     PW      PY  Y+   R+    +     +P    +    CT  +S    L  G +  S + G+ S  N         P  L  +++A  +     +  T   +      + +  +   Y+Y++ +  +GG+C CN HA +C   + N      C C+H+T G +C+ C P +  RPW          C  CNC+ +++EC ++   A   LS +       GG CI C++NT G +CE C   FYRP     + L PC  C C+ +G+          +   + G C C+    G+ CD+C  G+     G C  C C   GSV          CNCK+ V  +  C  C+ G FNL   NP+GC+ C+C+G +  CSS S   A N+    + D  GW +  F+G++ +         L  E       ++     Y+ AP  ++GN + SYG           R ++  ++   L+GS I     +    D         S +   R ++R V   + P E++  +  LT  +   A  + + S L  V         Y +  S         RG +       P +E C CPPGF G  CE C  G+ R   N     +C  C C  H  TC    G C +CT  T G  CE C  GYYG+  + + N+C  CPCP      +       ++  VC  C  N  G  C+ C +G+YGNP  +      C RC+CN N +      CD VTG C +C  +T G  C+ C+ GF+G AL      ++ CK CDC   G+   S  CD  TG+C C  +   R C  C +G +       C  CNC   G  SS   C+  +GQC C   V G +C+ C  G+F + +  C+ C C P   S+     NG C C    +   CDKCE  HY N+ T
Sbjct:   79 CDALDLETNHNATYLTDF-HSDEEPTWWQSQSMFYGVQYPNSVNLTLHLGKAFEITYVRLKFYTS-RPESFAIYKRTDET--APW-----QPYQYYSASCRKTYGRETRGFIRPGE-EERTAVCTDEFSDISPLTGGNVAFSTLEGKPSAYN-----FDQSP-ALQEWVTATDLLISLNRLNTFGDEF-----FKDAKVLRSYFYAISDFSVGGRCKCNGHASEC---MPNEDGHLVCVCEHHTAGKDCQQCAPFYLDRPWARATADSANQCVMCNCSGRADECVFD---AEQYLSTSS------GGRCIGCRDNTAGPHCEHCRDNFYRP-----SPLLPCYNCSCNTMGSA--------SLQCDEEGVCACRPSVMGLKCDVCKAGFHSLSPGGCRLCKCDERGSVGVCSTE-DGRCNCKLSVEGNS-CDRCRPGSFNLQQDNPDGCQTCFCYGHSLACSSSSRHVAFNITSDFLEDPDGW-VGEFSGQQQS-------PLLWKEGEVYLLPYSEKDAGYYKAPEKFIGNQLLSYGQHLSLSFTAEARELLPRKVTVVLEGSGISVSASLYSEQDLESGTGHIPSNTFSLRLIERDVHPALSPFEFRRMLSNLTALRISNAGGQNYTSQLSGVSLASAFPIAYPSDSS---------RGPL------APWVEMCTCPPGFMGQFCEQCAPGFTRETPNTGPFSRCVPCDCNQH-GTCHPETGVC-DCTDFTTGVSCERCLDGYYGNPLTGSPNACLPCPCP----DRSSCVQILETKAVVCTNCPANQRGTRCELCEDGFYGNPLGQDGVVRPCVRCECNGNIDPNSVGICDHVTGHCLKCLGHTAGDHCERCQKGFFGSALDSTLGPSQKCKPCDCYPAGTFGLSNECDPDTGRCMCLNHVTGRDCGQCQAGYFNLQPGVGCERCNCNPVG--SSSPACHPITGQCTCRTGVEGKQCDICRMGFFGFSSRGCRACNCDPMGSSSMQCHENGTCPCRQGFVGYKCDKCELNHYLNHVT 1019          

HSP 2 Score: 135.576 bits (340), Expect = 5.750e-31
Identity = 107/339 (31.56%), Postives = 152/339 (44.84%), Query Frame = 2
Query: 2594 GVHCDRCIEGYYGNPKKKISCKRC-KCNNNQE-SCDPVTGECRCSYNTMGTECQLCKHGFYGDALTKS---CKKCDCDSLGSTSENCDKLTGKC-DCRTNFVNRQCDSCTSGLY----LKDKKCIPC-NCEIQGRI--SSEKFCNTTSGQCF-CLENVNGDRCEKCVEGYFNYP---------NCKKCLCSP---HALSADCDLNNGKCKCGSNVINRICDKCENLHY-WNNRTDCVPCNCGR-GSLNPKCDMETGNCKCAQNVARRDCSKCDVGYFGLDVTGCKKC---PPCYNGQVCNNEGICVCPPNTIGNLCNKCSEDSWDFNETIGCKKCN-CY 3514
            G  C++C  G+           RC  C+ NQ  +C P TG C C+  T G  C+ C  G+YG+ LT S   C  C C    S  +  +     C +C  N    +C+ C  G Y     +D    PC  CE  G I  +S   C+  +G C  CL +  GD CE+C +G+F             CK C C P     LS +CD + G+C C ++V  R C +C+  ++       C  CNC   GS +P C   TG C C   V  + C  C +G+FG    GC+ C   P   +   C+  G C C    +G  C+KC  + +  + T  C++C  CY
Sbjct:  691 GQFCEQCAPGFTRETPNTGPFSRCVPCDCNQHGTCHPETGVCDCTDFTTGVSCERCLDGYYGNPLTGSPNACLPCPCPDRSSCVQILETKAVVCTNCPANQRGTRCELCEDGFYGNPLGQDGVVRPCVRCECNGNIDPNSVGICDHVTGHCLKCLGHTAGDHCERCQKGFFGSALDSTLGPSQKCKPCDCYPAGTFGLSNECDPDTGRCMCLNHVTGRDCGQCQAGYFNLQPGVGCERCNCNPVGSSSPACHPITGQCTCRTGVEGKQCDICRMGFFGFSSRGCRACNCDPMGSSSMQCHENGTCPCRQGFVGYKCDKCELNHYLNHVTHQCEECPVCY 1029          

HSP 3 Score: 130.568 bits (327), Expect = 2.011e-29
Identity = 101/338 (29.88%), Postives = 154/338 (45.56%), Query Frame = 2
Query: 2858 CDCRTNFVNRQCDSCTSGLYLKD------KKCIPCNCEIQGRISSEKFCNTTSGQCFCLENVNGDRCEKCVEGYFNYP---NCKKCLCSPHALSADC----DLNNGKCK-CGSNVINRICDKCENLHYWNNRTD------CVPCNCGRGSLNPK----CDMETGNC-KCAQNVARRDCSKCDVGYFG--LDVT--GCKKCPPC---------YNGQVCNNEGICVCPPNTIGNLCNKCSEDSWDFNETIGCKKCNCYINGSYSNICNKISGICACKTAFFGSKCDRCNEGYYGFPN--CQPCSCAENGTKSNELTKCDKITGQCQCKQNVIGTKCKVC 3751
            C C   F+ + C+ C  G   +        +C+PC+C   G       C+  +G C C +   G  CE+C++GY+  P   +   CL  P    + C    +     C  C +N     C+ CE+  Y N          CV C C  G+++P     CD  TG+C KC  + A   C +C  G+FG  LD T    +KC PC          + +   + G C+C  +  G  C +C    ++    +GC++CNC   GS S  C+ I+G C C+T   G +CD C  G++GF +  C+ C+C   G+ S    +C +  G C C+Q  +G KC  C
Sbjct:  683 CTCPPGFMGQFCEQCAPGFTRETPNTGPFSRCVPCDCNQHGT------CHPETGVCDCTDFTTGVSCERCLDGYYGNPLTGSPNACLPCPCPDRSSCVQILETKAVVCTNCPANQRGTRCELCEDGFYGNPLGQDGVVRPCVRCEC-NGNIDPNSVGICDHVTGHCLKCLGHTAGDHCERCQKGFFGSALDSTLGPSQKCKPCDCYPAGTFGLSNECDPDTGRCMCLNHVTGRDCGQCQAGYFNLQPGVGCERCNCNPVGSSSPACHPITGQCTCRTGVEGKQCDICRMGFFGFSSRGCRACNCDPMGSSS---MQCHE-NGTCPCRQGFVGYKCDKC 1009          

HSP 4 Score: 118.242 bits (295), Expect = 1.156e-25
Identity = 139/635 (21.89%), Postives = 268/635 (42.20%), Query Frame = 2
Query: 4616 KCNCNG-----YSKVCDSVTGDCQNCMGNREGNKCQLCREGFYKNDKNY-----DQCEPC---------------------------------QCPSAHYNFAQ-------NCTRIESS------LELKCQCRIGYSGKSCENCQQGFYGNPIKGIPCKSCDCNQQGSQSLNCNEFGICQCSPGVLGIKCDQCAPNYVVEKKT-----CQSCYS---GCTKDLLVRIDTLNETVINFKWKTLPSTLDLRLNKINISIQMSSELLNSINKFYK---LKNEIKNFSIQFQKMKDDAKEKYGEIEKLKTRYNKVLEDLRSTFTDINETI-------SGHEQLGISNELIKNATAYLETIKNIYKEMPNITLAASVLKDVL-KYVDELNQIIKYTQSHIQSDQINNLKILKNKTIMADEINTNNKEYLNTMS-TKKKEHELYIILINERMKDLQKIFRKMTKQRDNLRKKIQKLDAISKSFQDEKDLISINVREIEDLMKNLS---SNHLVSKS--------LIIPDTLKKHVEQQLNKSSNLIK-KLTKDFNFLHNAEQAKEAYSNITRDILAVDYAINQTKKELDFNRSNMNIDSL-----------KKLLAEFNSNKSEIVENIKNIDKEHEKLLK 6223
            +C CNG        +CD VTG C  C+G+  G+ C+ C++GF+ +  +       +C+PC                                 QC + ++N          NC  + SS      +  +C CR G  GK C+ C+ GF+G   +G  C++C+C+  GS S+ C+E G C C  G +G KCD+C  N+ +   T     C  CYS        L V++  L   + N+  ++    L +R N +    Q  + L N +N       L N +++F +  Q+ +D    ++ ++E   T    +   LR+  T +N ++        G E +G +       T  + T   +  +   + L + V+  VL K   + N ++  +++ ++S +   ++I   + +  + +N +++ Y   +S  +    EL+I  + E++ ++Q++   +T Q +   + +    ++ +   D K +++     + +L KN++   +N   S S          + DTL +  EQ +NK+   +K +L K    +    Q       +     A+   I   K E +    + NI+ +           K  L   +  + +I+  +K   +  E+ LK
Sbjct:  819 RCECNGNIDPNSVGICDHVTGHCLKCLGHTAGDHCERCQKGFFGSALDSTLGPSQKCKPCDCYPAGTFGLSNECDPDTGRCMCLNHVTGRDCGQCQAGYFNLQPGVGCERCNCNPVGSSSPACHPITGQCTCRTGVEGKQCDICRMGFFGFSSRG--CRACNCDPMGSSSMQCHENGTCPCRQGFVGYKCDKCELNHYLNHVTHQCEECPVCYSLIRDQVSKLKVKLHDLERLLSNYDCRSR-HRLHVRPNHVRQHQQ--NVLDNQVNDHQGEDYLPNALEDF-LAIQEARDAFMSQFSQLE---TSAQTLELQLRNLATAVNCSLVVEGGSEQGEEAMGANECRAVVDTFVVVTDTQVRLQRMTLDLNSLVIPFVLPKGPTQWNALVNESEALVKSHKEMAIRI---EELAGEAMNVSSRTYSMLLSLLEDNSTELHIQDLTEQLSEMQELKENLTLQAN---ETLAAYLSVEEQHADAKAILNNITASLPELHKNVTTTEANATFSSSQQYNFWPLWFLLDTLIQVKEQLVNKTREEMKPELNKTLKTIQEFHQLTALTQGLKE--AALSSVIRGKKTESEAFSLHKNIEGIHQDWPVLQIQTKAALKRESIMEEKILTEVKKKVRHAERALK 1436          

HSP 5 Score: 116.701 bits (291), Expect = 3.951e-25
Identity = 139/566 (24.56%), Postives = 228/566 (40.28%), Query Frame = 2
Query: 3407 GICV-CPPNTIGNLCNKCSEDSWDFNETIGCKKCNCYINGSYSNICNKISGICACKTAFFGSKCDRCNEGYYGFP--NCQPCSCAENGTKSNELTKCDKITGQCQCKQNVIGTKCKVCRKGTFPSDGTYEGGCFSCFCFGVSEKCHAILNHRIVENSIYEYHIFDEKNSLE--SGKDYSTIHLNANYPRRFGWPLTMFRPIYVNVMKLFNSHDLSLFYRSIFMNVSVDCLDNKCGRE-IPEQTEVFMESYNGLFGMRYXXXXXXXXXXXXXXDFNEHSKNGKWVISQYQNDILDKFIILEDSNVINSNLTRDIFMMALLNVTSLKVKLYTDKVNP-PLIKIKIITYKVMETTQAIGKRVTAVEKCICNALTFGNHCQNPISGYYKEYFNLPNSTKSGSMRTGNRILINLKKCNCNGYSKVCDSVTGDCQNCMGNREGNKCQLCREGFYKN--DKNYDQCEPCQCPSAHYNFAQNCTRIESSLELKC-QCRIGYSGKSCENCQQGFYGNPI--KGI--PCKSCDCNQQGSQSLNCNEFGIC--------QCSPGVLGIKCDQCAPNY 5038
            G C+ C  NT G  C  C ++ +  +  + C  C+C   GS S  C++  G+CAC+ +  G KCD C  G++      C+ C C E G+    +  C    G+C CK +V G  C  CR G+F        GC +CFC+G S  C +   H  V  +I    + D    +   SG+  S +         +  P +     Y    + F  + L  + + + ++ + +       RE +P +  V +E  +G+         +   S   +     H  +  + +   + D+       E   ++ SNLT        L +++   + YT +++   L     I Y    +  + G     VE C C     G  C+    G+ +E    PN+                  C+CN +   C   TG C +C     G  C+ C +G+Y N    + + C PC CP        +C +I  +  + C  C     G  CE C+ GFYGNP+   G+  PC  C+CN     +++ N  GIC        +C     G  C++C   +
Sbjct:  352 GRCIGCRDNTAGPHCEHCRDNFYRPSPLLPCYNCSCNTMGSASLQCDE-EGVCACRPSVMGLKCDVCKAGFHSLSPGGCRLCKCDERGS----VGVCSTEDGRCNCKLSVEGNSCDRCRPGSFNLQQDNPDGCQTCFCYGHSLACSSSSRH--VAFNITSDFLEDPDGWVGEFSGQQQSPLLWKEG--EVYLLPYSEKDAGYYKAPEKFIGNQLLSYGQHLSLSFTAE------ARELLPRKVTVVLEG-SGI------SVSASLYSEQDLESGTGHIPSNTFSLRLIERDVHPALSPFEFRRML-SNLT-------ALRISNAGGQNYTSQLSGVSLASAFPIAYP---SDSSRGPLAPWVEMCTCPPGFMGQFCEQCAPGFTRE---TPNTGP----------FSRCVPCDCNQHG-TCHPETGVC-DCTDFTTGVSCERCLDGYYGNPLTGSPNACLPCPCPD-----RSSCVQILETKAVVCTNCPANQRGTRCELCEDGFYGNPLGQDGVVRPCVRCECN----GNIDPNSVGICDHVTGHCLKCLGHTAGDHCERCQKGF 860          

HSP 6 Score: 67.3958 bits (163), Expect = 2.928e-10
Identity = 47/151 (31.13%), Postives = 69/151 (45.70%), Query Frame = 2
Query: 4616 KCNCNGYSKVCDSVTGDCQNCM--GNREGNKCQLC------REGFYKNDKNYDQCEPCQCPSAHYNFAQNCTR-IESSLELKC-QCRIGYSGKSCENCQQGFYGNPIKGIPCKSCDCNQQGSQSLNCNEFGICQCSPGVLGIKCDQCAPNY 5038
            +C CNG++  C         C+   +  G  CQ C      R        + +QC  C C         +  + + +S   +C  CR   +G  CE+C+  FY  P   +PC +C CN  GS SL C+E G+C C P V+G+KCD C   +
Sbjct:  272 RCKCNGHASECMPNEDGHLVCVCEHHTAGKDCQQCAPFYLDRPWARATADSANQCVMCNCSGRADECVFDAEQYLSTSSGGRCIGCRDNTAGPHCEHCRDNFY-RPSPLLPCYNCSCNTMGSASLQCDEEGVCACRPSVMGLKCDVCKAGF 421          

HSP 7 Score: 63.1586 bits (152), Expect = 5.937e-9
Identity = 62/205 (30.24%), Postives = 87/205 (42.44%), Query Frame = 2
Query: 4478 CICNALTFGNHCQNPISGYYKEYFNLPNSTKSGSMRTG--NRILINLKKCNCNGYS---KVCDSVTGDCQNCMGNREGNKCQLCREGFYKNDKNYD----QCEPCQCPSAHYNFAQNCTRIESSLELKCQCRIGY-SGKSCENCQQGFYGNPIKGI-----PCKSCDCNQQGSQSLN--CN-EFGICQCSPGVLGIKCDQCAPNY 5038
            C C   T G  C+  + GYY            G+  TG  N  L     C C   S   ++ ++    C NC  N+ G +C+LC +GFY N    D     C  C+C   + N   N   I   +   C   +G+ +G  CE CQ+GF+G+ +         CK CDC   G+  L+  C+ + G C C   V G  C QC   Y
Sbjct:  732 CDCTDFTTGVSCERCLDGYY------------GNPLTGSPNACL----PCPCPDRSSCVQILETKAVVCTNCPANQRGTRCELCEDGFYGNPLGQDGVVRPCVRCEC---NGNIDPNSVGICDHVTGHCLKCLGHTAGDHCERCQKGFFGSALDSTLGPSQKCKPCDCYPAGTFGLSNECDPDTGRCMCLNHVTGRDCGQCQAGY 917          

HSP 8 Score: 61.6178 bits (148), Expect = 1.878e-8
Identity = 56/211 (26.54%), Postives = 83/211 (39.34%), Query Frame = 2
Query: 4478 CICNALTFGNHCQNPISGYYKEYFNLPNSTKSGSMRTGNRILINLKKCNCNGYSKVC---------DSVTGDCQNCMGNREGNKCQLCREGFYKNDKNYDQCEPCQCPSAHYNFAQNCTRIESSLELKCQCRIGYSGKSCENCQQGFYGNPIKGIPCKSCDCNQQGSQSLNCNEFGICQCSPGVLGIKCDQCAPNYVVEKKT----CQSCY 5071
            C+C   T G  CQ          F L       +  + N+ ++    CNC+G +  C          S  G C  C  N  G  C+ CR+ FY+       C  C C +           ++   E  C CR    G  C+ C+ GF+     G  C+ C C+++GS  +   E G C C   V G  CD+C P     ++     CQ+C+
Sbjct:  292 CVCEHHTAGKDCQQCAP------FYLDRPWARATADSANQCVM----CNCSGRADECVFDAEQYLSTSSGGRCIGCRDNTAGPHCEHCRDNFYRPSPLLP-CYNCSCNT------MGSASLQCDEEGVCACRPSVMGLKCDVCKAGFHSLSPGG--CRLCKCDERGSVGVCSTEDGRCNCKLSVEGNSCDRCRPGSFNLQQDNPDGCQTCF 483          

HSP 9 Score: 58.151 bits (139), Expect = 1.960e-7
Identity = 63/226 (27.88%), Postives = 87/226 (38.50%), Query Frame = 2
Query: 2660 RCKCNNNQESCDPVTGE---CRCSYNTMGTECQLCKHGFYGD-----ALTKSCKKC--------------DCDSLGSTSENCDKLTGKC-DCRTNFVNRQCDSCTSGLYLKDKKCIPC-NCEIQGRISSEKFCNTTSGQCFCLENVNGDRCEKCVEGYFNYP--NCKKCLCSPHALSADCDLNNGKCKCGSNVINRICDKCENLHY---WNNRTDCVPCNCGRGSL 3250
            RCKCN +   C P       C C ++T G +CQ C   FY D     A   S  +C              D +   STS       G+C  CR N     C+ C    Y +    +PC NC      S+   C+   G C C  +V G +C+ C  G+ +     C+ C C        C   +G+C C  +V    CD+C    +    +N   C  C C   SL
Sbjct:  272 RCKCNGHASECMPNEDGHLVCVCEHHTAGKDCQQCA-PFYLDRPWARATADSANQCVMCNCSGRADECVFDAEQYLSTSSG-----GRCIGCRDNTAGPHCEHCRDNFY-RPSPLLPCYNCSCNTMGSASLQCD-EEGVCACRPSVMGLKCDVCKAGFHSLSPGGCRLCKCDERGSVGVCSTEDGRCNCKLSVEGNSCDRCRPGSFNLQQDNPDGCQTCFCYGHSL 489          

HSP 10 Score: 56.6102 bits (135), Expect = 6.466e-7
Identity = 81/309 (26.21%), Postives = 114/309 (36.89%), Query Frame = 2
Query:  950 CICNNHADKCDKVIENGISVAKCNCKHNTCGSNCETCCPLFNQRPW------KPVAVCEECNCNRKSNECSYNQTVATLQLSVNKMGRMEGGGVCINCQENTEGINCEKCIKGFYRPWNVLATELYP---CTPCQCHGLGTIG------------SCVSN--GED------------------------IGDQKP------GDCICKKGYEGVNCDLCSIGYERYPNGECLPCPCSIDGSVRTSFYRCKPPCNCKVHVNSDDLCKTCK-NGYFNLDSANPEGCEPCYCFGITNQCSSLSAKNLKISDLK 1714
            C C + +  C +++E    V   NC  N  G+ CE C   F   P       +P   CE CN N   N       V                G C+ C  +T G +CE+C KGF+   + L + L P   C PC C+  GT G             C+++  G D                        +G   P      G C C+ G EG  CD+C +G+  + +  C  C C   GS     +     C C+        C  C+ N Y N  +   E C  CY   I +Q S L    +K+ DL+
Sbjct:  765 CPCPDRS-SCVQILETKAVVCT-NCPANQRGTRCELCEDGFYGNPLGQDGVVRPCVRCE-CNGNIDPNSVGICDHVT---------------GHCLKCLGHTAGDHCERCQKGFF--GSALDSTLGPSQKCKPCDCYPAGTFGLSNECDPDTGRCMCLNHVTGRDCGQCQAGYFNLQPGVGCERCNCNPVGSSSPACHPITGQCTCRTGVEGKQCDICRMGFFGFSSRGCRACNCDPMGSSSMQCHE-NGTCPCRQGFVGYK-CDKCELNHYLNHVTHQCEECPVCYSL-IRDQVSKL---KVKLHDLE 1047          
BLAST of Laminin subunit alpha-2 vs. Ensembl Cavefish
Match: lama5 (laminin, alpha 5 [Source:ZFIN;Acc:ZDB-GENE-030131-9823])

HSP 1 Score: 330.487 bits (846), Expect = 7.555e-90
Identity = 197/532 (37.03%), Postives = 273/532 (51.32%), Query Frame = 2
Query:  188 LMENAKITSSATCGTGGP-----EIFCRLVDEIAIQRLINPDSHVLCDVCDNRNETKRHPIEFAKSDDDNLWWQSPSMAQGLKYQNVNVTIDLKQVYQIVYILLKMGDSPRPGNWILERSLD-GEIYMPWIFFAETPYSCYNLF-QRQYPDLKLTTNAKPSSLADDEMFCTTYYSQPKSLNSGEIIISLINGRKSIMNEEYLSIKSVPQTLINFLSARYIRFRFLKHLTLAADLMTHKGYLEQSIYNRYYYSLRNIEIGGKCICNNHADKCDKVIENGISVAKCNCKHNTCGSNCETCCPLFNQRPWKPVAV-----CEECNCNRKSNECSYNQTVATLQLSVNKMGRMEGGGVCINCQENTEGINCEKCIKGFYRPWNVLATELYPCTPCQCHGLGTIGSCVSNGEDIGDQKPGDCICKKGYEGVNCDLCSIGYERYP----------NGECLP------CPCSIDGSVRTSFYRCKP-----PCNCKVHVNSDDLCKTCKNGYFNLDSANPE----GCEPCYCFGITNQC 1672
            L E  KIT++ATCG   P     +++C+LV                CD CD+ +  + HPI  A  D    WWQSP +++  +Y  VNVT+DL Q++ + Y+L+K  +SPRP  W+LERS+D G+ Y PW FFA +   C   F QR    +            D+++ CTT YS+   L +GEI++SL+NGR   MN  Y  +      L  F  A  IR RFL+  TL   LM  K   + ++  RYYYS+++I IGG+C+CN HA+ C+    N     +C+C+HNTCG +C+ CCP FNQ PWKP        CE CNC+  + +C Y+  V   + S++  G   GGGVC+ CQ +T GINCE+CI G+YR  +        C+ CQC    T G+C        +   G C CK  Y G +CD C+ GYE +P          NGE  P      C C+  G+   S   C+P      C CK     +  C  C  G++ L+    E    GC    C G+T QC
Sbjct:   53 LAEGTKITATATCGEDEPGRAIQDLYCKLVGGPVSGDPSQTIQGQYCDTCDSADSNRAHPITNAI-DGTERWWQSPPLSRSTEYNQVNVTLDLGQLFHVAYVLVKFANSPRPDLWVLERSVDFGKTYQPWQFFASSKRDCIEQFGQRTIERI----------YRDNDVICTTEYSRIVPLENGEIVVSLVNGRPGAMNFSYSPV------LREFTKATNIRLRFLRTNTLLGHLMG-KALRDPTVTRRYYYSIKDISIGGRCVCNGHAEACNAKDPNDPYKLQCDCQHNTCGPSCDHCCPGFNQLPWKPATTYSANECEPCNCHGHAFDCYYDPEVDQRRASLDIEGEFRGGGVCMECQHHTTGINCERCIPGYYRSPDHPLESPQACSKCQCESEFTDGTC--------EDHTGRCYCKPNYTGEHCDSCAEGYENFPSCYRKSPHVLNGEARPAGEIINCECNAAGTEGNS---CRPDPQTRTCVCKPGFTGEH-CDVCAPGHYTLNCLRCECSGPGCLDGSCDGLTGQC 554          

HSP 2 Score: 313.153 bits (801), Expect = 1.615e-84
Identity = 219/745 (29.40%), Postives = 336/745 (45.10%), Query Frame = 2
Query: 1010 AKCNCKHNTCGSNCETCCPLFNQRPWKPVAVCEECNCNRKSNECSYNQTVATLQLSVNKMGRMEGGGVCINCQENTEGINCEKCIKGFYRPWNVLATELYPCTPCQCHGLGTIGSCVSNGEDIG-DQKPGDCICKKGYEGVNCDLCSIGYERYPNGECLPCPCSIDGSVRTSFYRCKPPCNCKVHVNSDDLCKTCKNGYFNLDSANPEGCEPCYCFGITNQCSSLSAKNLKISDLKGWKLTTFTGEKIALPKFTSFQYLTSENSYIDERFNNPTVYYWTAPPPYLGNWITSYGTIFRYVVKIELQSTLKG------SLIDSPDVIIKCGDFRLFHSVSIEDRRLQRQVFIYIKPTEWKIGKLTPDKAATKEEFISCLVKVDKLLIKAKYYSNQKSIELLNITLSRGEVHLALDEMPHIEKCNCPPGFNGLSCESCESGYRRVNNVLYQGQCEACACYNHSNTCDSLNGECQNCTHNTAGAHCEDCASGYYG-DAKSKNLNSCKKCPCPRLDYQMTELCSSYSSENYVCHKCLHNTSGVHCDRCIEGYYGNPKKKIS-CKRCKCNNNQES------CDPVTGECR-CSYNTMGTECQLCKHGFYGDALT-KSCKKCDCDSLGSTSENCDKLTGKCDCRTNFVNRQCDSCTSGLYLKDKKCIPC-NCEIQGRISSEKFCNTTSGQCFCLENVNGDRCEKCVEGYFNYP--NCKKCLCSPHALSADCDLNNGKCKCGSNVINRICDKC 3184
             +C+CK N  G +C  C   +   P      C  CNC  +  E    + +   +  + +         C+ CQ  T G +                  L  C  C C   G         +DI  D   G C CK    G  CD C+ G+  YPN  C PC C+  G+ +         C CK +V     C  C  G F+LD  NP+GC  C+CFG T++C     +  +I +++GW L     +++ +  +     + ++ S + + + +    +W AP  YLG+ ++SY    RY ++ +   T++G      S +  PDVI+K     L + +  E    ++     +   E            ++EE +  LV ++ L I+A +  + +++ L    L   E         ++E C CP  + G SC+ C  GY R    L+ G+C  C C  HS+ C    G C +C HNTAG HCE C  G+ G ++   +  SC  CPCP                N +   C+   +G  C+RC  G+YGNP    S C+ C CN+N +       C P+TGEC+ C ++T G  C+LC  G+YGDA+T K+C +C+C   G+ S  CD  TG+C C+       CD C +G++  +  C  C +CE     + EK C+  +G C C    NG  C +C  GY++Y    CKKC C        CD   G+C C + +  + CD+C
Sbjct: 1445 GQCHCKPNVIGRDCSECATGYYGFP-----NCRPCNCGTRLCEPVTGECICPPRTLLPE---------CVQCQPQTFGCH-----------------PLVGCEMCNCSPPGV------TSQDINCDTNSGQCRCKTNVIGRQCDRCAPGFYGYPN--CRPCNCNEAGTEKNVCDSVTGQCLCKENVEGPR-CDQCSLGTFHLDPTNPKGCTKCFCFGATDRCRKSDKRRNEIINMEGWVLLRGDRQEVPVSVYLDQDLVEADLSDVPDVYQD---LHWHAPQTYLGDKVSSYSGYLRYQLRTQ---TMRGDALYLPSEVSRPDVILKGNQMTLVY-MEREYSSPEQPHEGVVHLVEGSFRHAQTGNVVSREELMMVLVALESLQIRALHAQSAQAVSLQAAVLEGAEHLPTGRHANNVEICLCPASYQGDSCQQCAPGYYRDTKGLFLGKCVPCNCNGHSDQCLDGTGVCVDCRHNTAGDHCEKCQGGFRGNNSVDGHAVSCTSCPCPMQVASNNFAIRCVEKPNQMQCLCMPGYAGPKCERCAPGFYGNPMVIGSTCQPCNCNDNSDPNMLFSDCHPITGECQSCMFDTAGPHCELCAPGYYGDAITAKNCTRCNCSPCGTAS--CDPHTGQCQCKPGVSGVHCDHCENGMFGFN-SCSGCHHCECTAAAALEKSCDPVTGSCKCQPGANGPNCRQCAPGYWDYSPTGCKKCDCK----GGRCDPRTGECHCPAGLTGKQCDRC 2135          

HSP 3 Score: 213.386 bits (542), Expect = 2.307e-54
Identity = 176/578 (30.45%), Postives = 244/578 (42.21%), Query Frame = 2
Query: 2234 PHIEKCNCPPGFNGLSCESCESGYRRV----NNVLYQGQCEACACYNHSNTC----------DSLN--------GECQNCTHNTAGAHCEDCASGYY--GDAKSKNLNSCKKCPCPRLDYQMTE-LCSSYSSENYVCHKCLHNTSGVHCDRCIEGYYGNPKKKISCKR------------------CKCN---NNQESC--DPVTGECRCSYNTMGTECQLCKHGFYGDALTKSCKKCDCDSLGSTSENCDKLTGKCDCRTNFVNRQCDSCTSGLY---LKDKKCIPCNCEIQGRISSEKFCNTTSGQCFCLENVNGDRCEKCVEGYFNYPNCKKCLCSPH-ALSADCDLNNGKCKCGSNVINRICDKCENLHYWNNRTDCVPCNCG-RGSLNPKCDMETGNCKCAQNVARRDCSKCDVGYFGLDVTGCKKCPPC--YNGQVCNNEGICVCPPNTIGNLCNKCSEDSWDFNETI--GCKKCNCYINGSYSNI--CNKISGICACKTAFFGSKCDRCNEGYYG-----FPNCQPCSCAENGTKSNELTKCDKITGQCQCKQNVIGTKCKVCRKGTFPSD 3775
            P+  +C+C     G SC+ C  G+ ++           +CE C C+ H+  C           SL+        G C  C H+T G +CE C  GYY   D   ++  +C KC C   + + T+  C  ++   Y    C  N +G HCD C EGY   P    SC R                  C+CN       SC  DP T  C C     G  C +C  G Y    T +C +C+C   G    +CD LTG+C CR+ F    CD CT G +   L  ++C+     + G +     C+ T G+C C     G RCE+C  G  +YPNCK+C C P  ++++ C +  G C C  N     CD+C    Y      C PC C  +GS   +CD  TG C C  NV  + C  C  G +   +     C P      Q+    G C C P   G  CNKC    W+ +     GC  C C   G+ S +  C + +G C CK       C  C +GY+      +  CQ C C   G+       C +  G+C+C+ NV G KC   R   +  D
Sbjct:  313 PYKLQCDCQHNTCGPSCDHCCPGFNQLPWKPATTYSANECEPCNCHGHAFDCYYDPEVDQRRASLDIEGEFRGGGVCMECQHHTTGINCERCIPGYYRSPDHPLESPQACSKCQC---ESEFTDGTCEDHTGRCY----CKPNYTGEHCDSCAEGYENFP----SCYRKSPHVLNGEARPAGEIINCECNAAGTEGNSCRPDPQTRTCVCKPGFTGEHCDVCAPGHY----TLNCLRCECSGPGCLDGSCDGLTGQCVCRSGFQGYSCDQCTPGYFNYPLCQRECV-----VLGTVPGG--CDPT-GRCVCRPEFTGPRCEQCSSGLHSYPNCKECTCDPRTSVNSSCSVA-GHCHCRPNYSGSKCDQCAPGFY--GFPSCSPCQCSLKGSRFTECDRVTGQCVCLPNVVGQHCDTCSPGSYSFPLCQADSCDPAGSVQNQILPTVGSCECKPYVEGVACNKCKPLYWNLSPDTLYGCSNCECNTGGTLSEVAECAQSNGQCYCKPNVCSGTCAVCKDGYFNLQKNNYFGCQGCQCDIGGSAG---LSCGERNGRCRCRPNVEGPKCNQPRPDHYFPD 861          

HSP 4 Score: 200.675 bits (509), Expect = 1.614e-50
Identity = 162/543 (29.83%), Postives = 230/543 (42.36%), Query Frame = 2
Query: 2348 CACYNHSNTC------DSLNGECQNCTHNTAGAHCEDCASGY----YGDAKSKNLNSCKKCPC----------PRLDYQMTEL-CSSYSSENYVCHKCLHNTSGVHCDRCIEGYYGNPKKKI----SCKRCKCNN--NQESCDPVTGECRCSYNTMGTECQLCKHGFY--------------GDALTKS-CKKCDCDSLGSTSENC--DKLTGKCDCRTNFVNRQCDSCTSGLYLKDKKCIPCNCEIQGRISSEKFCNTTSGQCFCLENVNGDRCEKCVEGYFNYPNCKKCLCSPHALSADCDLNNGKCKCGSNVINRICDKCEN-LHYWNNRTDCVPCNCG-RGSLNPKCDMETGNCKCAQNVARRDCSKCDVGYFGLDVTGCKKCPPCYNGQV---CNN-EGICVCPPNTIGNLCNKCSEDSWDFNETIGCKKCNCYINGSYSNICNKISGICACKTAFFGSKCDRCNEGYYGFP-----NCQPCSCAENGTKSNELTKCDKITGQCQCKQNVIGTKCKVCRKGTFPSDGTYEGGCFSCFC 3811
            C C  H+  C      D    +C +C HNT G  C+ C  G+    +  A + + N C+ C C          P +D +   L          VC +C H+T+G++C+RCI GYY +P   +    +C +C+C +     +C+  TG C C  N  G  C  C  G+               G+A        C+C++ G+   +C  D  T  C C+  F    CD C  G Y  +  C+ C C   G +     C+  +GQC C     G  C++C  GYFNYP C++       +   CD   G+C C        C++C + LH + N   C  C C  R S+N  C +  G+C C  N +   C +C  G++G     C  C     G     C+   G CVC PN +G  C+ CS  S+ F     C+  +C   GS  N      G C CK    G  C++C   Y+         C  C C   GT S E+ +C +  GQC CK NV    C VC+ G F        GC  C C
Sbjct:  296 CVCNGHAEACNAKDPNDPYKLQC-DCQHNTCGPSCDHCCPGFNQLPWKPATTYSANECEPCNCHGHAFDCYYDPEVDQRRASLDIEGEFRGGGVCMECQHHTTGINCERCIPGYYRSPDHPLESPQACSKCQCESEFTDGTCEDHTGRCYCKPNYTGEHCDSCAEGYENFPSCYRKSPHVLNGEARPAGEIINCECNAAGTEGNSCRPDPQTRTCVCKPGFTGEHCDVCAPGHYTLN--CLRCECSGPGCLDGS--CDGLTGQCVCRSGFQGYSCDQCTPGYFNYPLCQRECVVLGTVPGGCD-PTGRCVCRPEFTGPRCEQCSSGLHSYPN---CKECTCDPRTSVNSSCSV-AGHCHCRPNYSGSKCDQCAPGFYGF--PSCSPCQCSLKGSRFTECDRVTGQCVCLPNVVGQHCDTCSPGSYSFPL---CQADSCDPAGSVQNQILPTVGSCECKPYVEGVACNKCKPLYWNLSPDTLYGCSNCECNTGGTLS-EVAECAQSNGQCYCKPNVCSGTCAVCKDGYFNLQKNNYFGCQGCQC 822          

HSP 5 Score: 161.384 bits (407), Expect = 1.208e-38
Identity = 91/217 (41.94%), Postives = 121/217 (55.76%), Query Frame = 2
Query: 3197 YWNNRTDCVPCNCGR-GSLNPKCDMETGNCKCAQNVARRDCSKCDVGYFGLDVTGCKKCPPCYNG-QVCNN-EGICVCPPNTIGNLCNKCSEDSWDFNETIGCKKCNCYINGSYSNI--CNKISGICACKTAFFGSKCDRCNEGYYGFPNCQPCSCAENGTKSNELTKCDKITGQCQCKQNVIGTKCKVCRKGTFPSDGTYEGGCFSCFCFGVSEKC 3832
            ++NN    +PC C   G+ +  C    G C C  NV  RDCS+C  GY+G        C PC  G ++C    G C+CPP T+   C +C   ++  +  +GC+ CNC   G  S    C+  SG C CKT   G +CDRC  G+YG+PNC+PC+C E GT+ N    CD +TGQC CK+NV G +C  C  GTF  D T   GC  CFCFG +++C
Sbjct: 1420 FFNN--GALPCGCHEAGAESDMCQPFGGQCHCKPNVIGRDCSECATGYYGF-----PNCRPCNCGTRLCEPVTGECICPPRTLLPECVQCQPQTFGCHPLVGCEMCNCSPPGVTSQDINCDTNSGQCRCKTNVIGRQCDRCAPGFYGYPNCRPCNCNEAGTEKN---VCDSVTGQCLCKENVEGPRCDQCSLGTFHLDPTNPKGCTKCFCFGATDRC 1626          

HSP 6 Score: 135.191 bits (339), Expect = 1.277e-30
Identity = 89/252 (35.32%), Postives = 120/252 (47.62%), Query Frame = 2
Query: 2228 EMPHIEKCNCPPGFNGLSCESCESGYRRVNNVLYQGQCEACACYNHSNT------CDSLNGECQNCTHNTAGAHCEDCASGYYGDA-KSKNLNSCKKCPCPRLDYQMTELCSSYSSENYVCHKCLHNTSGVHCDRCIEGYYGNPKKKISCKRCKCNNN---QESCDPVTGECRCSYNTMGTECQLCKHGFYGDALTKSCKKCDCDSLGSTSENCDKLTGKCDCRTNFVNRQCDSCTSGLYLKDKKCIPCNCE 2953
            E P+  +C C PG+ G  CE C  G+   N ++    C+ C C ++S+       C  + GECQ+C  +TAG HCE CA GYYGDA  +KN   C   PC       T  C  ++ +   C +C    SGVHCD C  G +G       C  C+C      ++SCDPVTG C+C     G  C+ C  G++ D     CKKCDC         CD  TG+C C      +QCD C     +   +    +CE
Sbjct: 1919 EKPNQMQCLCMPGYAGPKCERCAPGFYG-NPMVIGSTCQPCNCNDNSDPNMLFSDCHPITGECQSCMFDTAGPHCELCAPGYYGDAITAKNCTRCNCSPC------GTASCDPHTGQ---C-QCKPGVSGVHCDHCENGMFGF-NSCSGCHHCECTAAAALEKSCDPVTGSCKCQPGANGPNCRQCAPGYW-DYSPTGCKKCDCKG-----GRCDPRTGECHCPAGLTGKQCDRCAEKYSVPVTRGADVHCE 2152          

HSP 7 Score: 125.176 bits (313), Expect = 1.109e-27
Identity = 100/335 (29.85%), Postives = 139/335 (41.49%), Query Frame = 2
Query: 2711 CRCSYNTMGTECQLCKHGFYGDA---LTKSCKKCDCDSLGSTSENCDKLTGKC-DCRTNFVNRQCDSCTSGLYLKDK------KCIPCNCEIQGRISSEKFC-----NTTSGQCFCLENVNGDRCEKCVEGYFNYP-----NCKKCLCS----PHALSADCDLNNGKCK-CGSNVINRICDKCENLHYWNNRT--DCVPCNCGRGSLNPKCDMETGNCKCAQNVARRDCSKCDVGYFGLDV-TGCKKCPPCYNGQVCNNE-----GICVCPPNTIGNLCNKCSEDSWDFNETIGCKKCNCYINGSYSNICNKISGICACKTAFFGSKCDRCNEGY 3616
            C C  +  G  CQ C  G+Y D        C  C+C+     S+ C   TG C DCR N     C+ C  G    +        C  C C +Q  ++S  F           QC C+    G +CE+C  G++  P      C+ C C+    P+ L +DC    G+C+ C  +     C+ C   +Y +  T  +C  CNC        CD  TG C+C   V+   C  C+ G FG +  +GC  C  C              G C C P   G  C +C+   WD++ T GCKKC+C         C+  +G C C     G +CDRC E Y
Sbjct: 1818 CLCPASYQGDSCQQCAPGYYRDTKGLFLGKCVPCNCNG---HSDQCLDGTGVCVDCRHNTAGDHCEKCQGGFRGNNSVDGHAVSCTSCPCPMQ--VASNNFAIRCVEKPNQMQCLCMPGYAGPKCERCAPGFYGNPMVIGSTCQPCNCNDNSDPNMLFSDCHPITGECQSCMFDTAGPHCELCAPGYYGDAITAKNCTRCNCSPCG-TASCDPHTGQCQCKPGVSGVHCDHCENGMFGFNSCSGCHHCE-CTAAAALEKSCDPVTGSCKCQPGANGPNCRQCAPGYWDYSPT-GCKKCDCK-----GGRCDPRTGECHCPAGLTGKQCDRCAEKY 2139          

HSP 8 Score: 115.161 bits (287), Expect = 1.158e-24
Identity = 70/201 (34.83%), Postives = 97/201 (48.26%), Query Frame = 2
Query: 2801 CDCDSLGSTSENCDKLTGKCDCRTNFVNRQCDSCTSGLYLKDKKCIPCNCEIQGRISSEKFCNTTSGQCFCLENVNGDRCEKCVEGYFN-YP--NCKKCLCSPHALSA---DCDLNNGKCKCGSNVINRICDKCENLHYWNNRTDCVPCNCGR-GSLNPKCDMETGNCKCAQNVARRDCSKCDVGYFGLDVTGCKKCPPCY 3382
            C C   G+ S+ C    G+C C+ N + R C  C +G Y     C PCNC         + C   +G+C C        C +C    F  +P   C+ C CSP  +++   +CD N+G+C+C +NVI R CD+C    Y     +C PCNC   G+    CD  TG C C +NV    C +C +G F LD T  K C  C+
Sbjct: 1428 CGCHEAGAESDMCQPFGGQCHCKPNVIGRDCSECATG-YYGFPNCRPCNC-------GTRLCEPVTGECICPPRTLLPECVQCQPQTFGCHPLVGCEMCNCSPPGVTSQDINCDTNSGQCRCKTNVIGRQCDRCAPGFY--GYPNCRPCNCNEAGTEKNVCDSVTGQCLCKENVEGPRCDQCSLGTFHLDPTNPKGCTKCF 1618          

HSP 9 Score: 114.775 bits (286), Expect = 1.704e-24
Identity = 93/331 (28.10%), Postives = 127/331 (38.37%), Query Frame = 2
Query: 2858 CDCRTNFVNRQCDSCTSGLYLKDK-----KCIPCNCEIQGRISSEKFCNTTSGQCF-CLENVNGDRCEKCVEGY-------FNYPNCKKCLCSPHALSADCDL------NNGKCKCGSNVINRICDKCENLHYWNNR---TDCVPCNCGRGS----LNPKCDMETGNCK-CAQNVARRDCSKCDVGYFGLDVTG--CKKC--PPCYNGQVCNNEGICVCPPNTIGNLCNKCSEDSWDFNETIGCKKCNCYINGSYSNICNKISGICACKTAFFGSKCDRCNEGYYGFP--NCQPCSCAENGTKSNELTKCDKITGQCQCKQNVIGTKCKVC 3751
            C C  ++    C  C  G Y   K     KC+PCNC           C   +G C  C  N  GD CEKC  G+        +  +C  C C     S +  +      N  +C C        C++C    Y N     + C PCNC   S    L   C   TG C+ C  + A   C  C  GY+G  +T   C +C   PC       + G C C P   G  C+ C    + FN   GC  C C    +    C+ ++G C C+    G  C +C  GY+ +    C+ C C           +CD  TG+C C   + G +C  C
Sbjct: 1818 CLCPASYQGDSCQQCAPGYYRDTKGLFLGKCVPCNCN-----GHSDQCLDGTGVCVDCRHNTAGDHCEKCQGGFRGNNSVDGHAVSCTSCPCPMQVASNNFAIRCVEKPNQMQCLCMPGYAGPKCERCAPGFYGNPMVIGSTCQPCNCNDNSDPNMLFSDCHPITGECQSCMFDTAGPHCELCAPGYYGDAITAKNCTRCNCSPCGTASCDPHTGQCQCKPGVSGVHCDHCENGMFGFNSCSGCHHCECTAAAALEKSCDPVTGSCKCQPGANGPNCRQCAPGYWDYSPTGCKKCDCKGG--------RCDPRTGECHCPAGLTGKQCDRC 2135          

HSP 10 Score: 114.005 bits (284), Expect = 2.657e-24
Identity = 83/265 (31.32%), Postives = 125/265 (47.17%), Query Frame = 2
Query: 4313 LTRDIFMMALLNVTSLKVKLYTDKVNPPLIKIKIITYKVMETTQAI--GKRVTAVEKCICNALTFGNHCQNPISGYYKEYFNLPNSTKSGSMRTGNRILINLKKCNCNGYSKVCDSVTGDCQNCMGNREGNKCQLCREGFYKN---DKNYDQCEPCQCPS--AHYNFAQNCTRIESSLELKCQCRIGYSGKSCENCQQGFYGNP-IKGIPCKSCDCNQQGSQSL---NCNEF-GICQ-CSPGVLGIKCDQCAPNYVVEKKTCQSC 5068
            ++R+  MM L+ + SL+++     ++    +   +   V+E  + +  G+    VE C+C A   G+ CQ    GYY++              T    L     CNCNG+S  C   TG C +C  N  G+ C+ C+ GF  N   D +   C  C CP   A  NFA  C  +E   +++C C  GY+G  CE C  GFYGNP + G  C+ C+CN     ++   +C+   G CQ C     G  C+ CAP Y  +  T ++C
Sbjct: 1765 VSREELMMVLVALESLQIR----ALHAQSAQAVSLQAAVLEGAEHLPTGRHANNVEICLCPASYQGDSCQQCAPGYYRD--------------TKGLFLGKCVPCNCNGHSDQCLDGTGVCVDCRHNTAGDHCEKCQGGFRGNNSVDGHAVSCTSCPCPMQVASNNFAIRC--VEKPNQMQCLCMPGYAGPKCERCAPGFYGNPMVIGSTCQPCNCNDNSDPNMLFSDCHPITGECQSCMFDTAGPHCELCAPGYYGDAITAKNC 2009          

HSP 11 Score: 99.3673 bits (246), Expect = 8.550e-20
Identity = 144/676 (21.30%), Postives = 254/676 (37.57%), Query Frame = 2
Query: 4475 KCICNALTFGNHCQNPISGYYKEYFNLPNSTKSGSMRTGNRILINL--KKCNCNGYSKV------CDSVTGDCQNCMGNREGNKCQLCREGFYKNDKNYDQCEPCQCPSAHYNFAQNCTRIESSLELKCQCRIGYSGKSCENCQQGFYG-NPIKGIPCKSCDCNQQGSQSLNCNEF-GICQCSPGVLGIKCDQCAPNYVVEKKT--------------------CQSCYSG-----CTKDLLVRIDTLNETVINFKWKTLPSTLDLRLNKINISIQMSSELLNSIN-------KFYKLKNEIKNFSI-QFQKMKDDAKEKYGEIEKLKTRYNKVLEDLRSTFTDINE--TISGHEQLGISNELI---KNATAYLETIKNIYKEMPNI-----TLAASVLKDVLKYVDELNQIIKYTQSHIQSDQIN------NLKILKNKTIMADEINTNNKEYLNTMSTKKKEHELYIIL---INERMKDLQKIFRKMT---KQRDNLRKKIQKLDAISKSFQDEKDLISINVREIEDLMKNLSSN-----HLVSKSLIIPDTLKKHVE------------QQLNKSSNLIKKLTKDFN----------FLHNAEQAKEAYSNITRDILAVDYAINQTKKE----------LDFNRSNMNIDSLKKLLAEFNSNKSEIVENIKNI 6196
            +C+C     G  C+    G+Y                 GN ++I    + CNCN  S        C  +TG+CQ+CM +  G  C+LC  G+Y +      C  C C           T        +CQC+ G SG  C++C+ G +G N   G  C  C+C    +   +C+   G C+C PG  G  C QCAP Y     T                    C +  +G     C +   V + T    V   +  +    L   L+K+N +   +   L +I+       +F+ L   I+N SI  +    D +++K   +E       K L+ + S   ++ E  ++S  +   + N  I   + A   L+T+KN  K++        T+    LK  L  V  + + +++  +  Q  Q +      N  + + K+ MAD    N        +   K H+    L   +NE   +      K     KQ D  ++K+  L    K   D   +   +V ++ D++  L  +      L ++       L + V+            ++  K + L+ +L K+ +          F+  A  A  AY+NI   +   D    +  K           L++      +  +K  L    + KS+++ +++ +
Sbjct: 1925 QCLCMPGYAGPKCERCAPGFY-----------------GNPMVIGSTCQPCNCNDNSDPNMLFSDCHPITGECQSCMFDTAGPHCELCAPGYYGDAITAKNCTRCNCSPCGTASCDPHTG-------QCQCKPGVSGVHCDHCENGMFGFNSCSG--CHHCECTAAAALEKSCDPVTGSCKCQPGANGPNCRQCAPGYWDYSPTGCKKCDCKGGRCDPRTGECHCPAGLTGKQCDRCAEKYSVPV-TRGADVHCERCDSCVVELLRDLDKVNGTYLSAEHQLKNISTTAFAWAQFHNLNKSIENKSINNYNSSLDGSRDKANTLE-------KELQTIDSDLFELQEKASLSSRKGATLENNTIATKERAQNLLDTVKNYMKDIEAAQNGSQTMDEEELKRKLAEVAAMLRDMRFRSTTPQGKQADYELSQANQLLDRVKSEMADRTAANEATVEEIKNKLNKFHQELTSLRDALNEAANNTALASEKNNANQKQLDENQQKVNDLKKKQKEVTDTMQMAEDDVAQVNDMLAMLQDSKEEYERLAAQLDGARQPLAEKVQNFSTSGAKSPLVEEAEKHAELLDQLAKNLSSVISDTNQDGFIQRALNASRAYNNIINSVNEADNLAKEANKSATEALEPKCVLNWTELKPQLQDIKNRLQNATTKKSDLMMDLQKV 2566          

HSP 12 Score: 97.8265 bits (242), Expect = 2.011e-19
Identity = 57/168 (33.93%), Postives = 83/168 (49.40%), Query Frame = 2
Query: 2690 CDPVTGECRCSYNTMGTECQLCKHGFYGDALTKSCKKCDCDSLGSTSENCDKLTGKCDCRTNFVNRQCDSCTSGLY--LKDKKCIPCNCEIQGRISSEKFCNTTSGQCFCLENVNGDRCEKCVEGYFNYPNCKKCLCSPHALSAD-CDLNNGKCKCGSNVINRICDKC 3184
            C P  G+C C  N +G +C  C  G+YG     +C+ C+C      +  C+ +TG+C C    +  +C  C    +       C  CNC   G  S +  C+T SGQC C  NV G +C++C  G++ YPNC+ C C+      + CD   G+C C  NV    CD+C
Sbjct: 1440 CQPFGGQCHCKPNVIGRDCSECATGYYG---FPNCRPCNCG-----TRLCEPVTGECICPPRTLLPECVQCQPQTFGCHPLVGCEMCNCSPPGVTSQDINCDTNSGQCRCKTNVIGRQCDRCAPGFYGYPNCRPCNCNEAGTEKNVCDSVTGQCLCKENVEGPRCDQC 1599          

HSP 13 Score: 70.0922 bits (170), Expect = 5.803e-11
Identity = 78/331 (23.56%), Postives = 127/331 (38.37%), Query Frame = 2
Query:  686 YSQPKSLNSGEIIISLINGRKSIMNEEYLSIKSVPQTLINFLSARYIRFRFLKHLTLAADLMTHKGYLEQSIYNRYYYSLRNIEIGGKCICNNHADKCDKVIENGISVAKCNCKHNTCGSNCETCCP-LFNQRPWKPVAVCEECNCNRKSNECSYNQTVATLQLSVNKMGRMEGGGVCINCQENTEGINCEKCIKGFYRPWNVLATELYPCTPCQCHGLGTIGSCVSNGEDIGDQKPG--DCICKKGYEGVNCDLCSIGYERYP---NGECLPCPCSIDGSVRTSFYRCKP---PCNCKVHVNSDDLCKTCKNGYFNLDSANPEGCEPCYC 1651
            YS P+  + G  ++ L+ G  S  + +  ++ S  + ++  ++   ++ R L H   A  +      LE + +        N+EI                         C C  +  G +C+ C P  +       +  C  CNCN  S++C                  ++G GVC++C+ NT G +CEKC  GF R  N +      CT C C     +    +N      +KP    C+C  GY G  C+ C+ G+   P      C PC C+ +      F  C P    C   +   +   C+ C  GY+  D+   + C  C C
Sbjct: 1738 YSSPEQPHEG--VVHLVEG--SFRHAQTGNVVSREELMMVLVALESLQIRAL-HAQSAQAVSLQAAVLEGAEHLPTGRHANNVEI-------------------------CLCPASYQGDSCQQCAPGYYRDTKGLFLGKCVPCNCNGHSDQC------------------LDGTGVCVDCRHNTAGDHCEKCQGGF-RGNNSVDGHAVSCTSCPC----PMQVASNNFAIRCVEKPNQMQCLCMPGYAGPKCERCAPGFYGNPMVIGSTCQPCNCNDNSDPNMLFSDCHPITGECQSCMFDTAGPHCELCAPGYYG-DAITAKNCTRCNC 2014          

HSP 14 Score: 67.0106 bits (162), Expect = 4.338e-10
Identity = 49/147 (33.33%), Postives = 69/147 (46.94%), Query Frame = 2
Query: 4607 NLKKCNCNGYSKVCDS--VTGDCQNCMGNREGNKCQLCREGFYKNDKNYDQCEPCQCPSAHYNFAQNCTRIESSLELKCQCRIGYSGKSCENCQQGFYGNPIKGIPCKSCDCNQQGS-QSLNCNEFGICQCSPGVLGIKCDQCAPNY 5038
            N K+C C+  + V  S  V G C +C  N  G+KC  C  GFY     +  C PCQC      F + C R+      +C C     G+ C+ C  G Y  P+    C++  C+  GS Q+      G C+C P V G+ C++C P Y
Sbjct:  621 NCKECTCDPRTSVNSSCSVAGHC-HCRPNYSGSKCDQCAPGFY----GFPSCSPCQCSLKGSRFTE-CDRVTG----QCVCLPNVVGQHCDTCSPGSYSFPL----CQADSCDPAGSVQNQILPTVGSCECKPYVEGVACNKCKPLY 753          

HSP 15 Score: 64.3142 bits (155), Expect = 3.188e-9
Identity = 52/195 (26.67%), Postives = 75/195 (38.46%), Query Frame = 2
Query: 4478 CICNALTFGNHCQNPISGYYKEYFNLPNSTKSGSMRTGNRILINLKKCNCNG---YSKVCDSVTGDCQNCMGNREGNKCQLCREGFYKNDKNYDQCEPCQCPSAHYNFAQNCTRIES-----SLELKCQCRIGYSGKSCENCQQGFYGNPIKGIPCKSCDCNQQGSQSLNCNEFGICQCSPGVLGIKCDQCAPNY 5038
            C+C     G HC     G+Y                      +N  +C C+G       CD +TG C  C    +G  C  C  G++    NY  C+            + C  + +         +C CR  ++G  CE C  G +  P     CK C C+ + S + +C+  G C C P   G KCDQCAP +
Sbjct:  509 CVCKPGFTGEHCDVCAPGHYT---------------------LNCLRCECSGPGCLDGSCDGLTGQCV-CRSGFQGYSCDQCTPGYF----NYPLCQ------------RECVVLGTVPGGCDPTGRCVCRPEFTGPRCEQCSSGLHSYPN----CKECTCDPRTSVNSSCSVAGHCHCRPNYSGSKCDQCAPGF 661          

HSP 16 Score: 63.5438 bits (153), Expect = 4.889e-9
Identity = 46/131 (35.11%), Postives = 60/131 (45.80%), Query Frame = 2
Query: 4646 CDSVTGDCQNCMGNREGNKCQLCREGFYKNDKNYDQCEPCQC-PSAHYNFAQNCTRIESSLELKCQCRIGYSGKSCENCQQGFYGNPIKGIPCKSCDCNQQGSQSLNCNEF-GICQCSPGVLGIKCDQCAP 5032
            CD  TG C  C     G +C+ C  G +    +Y  C+ C C P    N +        S+   C CR  YSG  C+ C  GFYG P     C  C C+ +GS+   C+   G C C P V+G  CD C+P
Sbjct:  592 CDP-TGRCV-CRPEFTGPRCEQCSSGLH----SYPNCKECTCDPRTSVNSS-------CSVAGHCHCRPNYSGSKCDQCAPGFYGFP----SCSPCQCSLKGSRFTECDRVTGQCVCLPNVVGQHCDTCSP 705          

HSP 17 Score: 62.003 bits (149), Expect = 1.541e-8
Identity = 78/311 (25.08%), Postives = 111/311 (35.69%), Query Frame = 2
Query:  911 YYYSLRNIEIGGKCI---CNNHADKCDKVIENGISVAKCNCKHNTCGSNCETC---------------------CPL-------------------------------------FNQRPWKPVAVCEECNCNRKSNECSYNQTVATLQLSVNKMGRMEGGGVCINCQENTEGINCEKCIKGFYRPWNVLATELYPCTPCQCHGLGTIGSCVSNGEDIGDQKPGDCICKKGYEGVNCDLCSIGYERYPN-GECLPCPCSIDGSVRTSFYRCKPPCNCKVHVNSDDLCKTCKNGYFNLDSANPEGCEPCYCFG 1657
            YY   + + +G KC+   CN H+D+C  +   G+ V   +C+HNT G +CE C                     CP+                                     F   P    + C+ CNCN  S+          +             G C +C  +T G +CE C  G+Y      A     CT C C   GT  SC        D   G C CK G  GV+CD C  G   + +   C  C C+   ++  S       C C+   N  + C+ C  GY++    +P GC+ C C G
Sbjct: 1836 YYRDTKGLFLG-KCVPCNCNGHSDQC--LDGTGVCV---DCRHNTAGDHCEKCQGGFRGNNSVDGHAVSCTSCPCPMQVASNNFAIRCVEKPNQMQCLCMPGYAGPKCERCAPGFYGNPMVIGSTCQPCNCNDNSDPNMLFSDCHPIT------------GECQSCMFDTAGPHCELCAPGYYGD----AITAKNCTRCNCSPCGT-ASC--------DPHTGQCQCKPGVSGVHCDHCENGMFGFNSCSGCHHCECTAAAALEKSCDPVTGSCKCQPGANGPN-CRQCAPGYWDY---SPTGCKKCDCKG 2111          

HSP 18 Score: 61.2326 bits (147), Expect = 2.818e-8
Identity = 78/334 (23.35%), Postives = 139/334 (41.62%), Query Frame = 2
Query: 4586 TGNRILINLKKCNCNGYSKVCDSVTGDCQNCMGNREGNKCQLCREGFYKNDKNYDQCEPCQC-PSAHYNFAQNCTRIESSLELKCQCRIGYSGKSCENCQQGFYGNPIKGIPCKSCDCNQQGSQSLNCNEF-GICQCSPGVLGIKCDQCAPNYV----VEKKTCQSCYSGCTKDLLVRIDTLNETVINFKWKTLPSTLDLRLNKINISIQMSSEL----LNSINKFYK----------LKNEIKNFS------IQFQKMKDDAKEKYGEIEKLKTRYNKVLEDLRSTFTDINETISGHEQL--GISNELIKNATAYLETIKNIYKEMPNITLAA 5503
            TG     N + CNC   +++C+ VTG+C  C       +C  C+   +        CE C C P    +   NC         +C+C+    G+ C+ C  GFYG P     C+ C+CN+ G++   C+   G C C   V G +CDQC+           K C  C+     D   + D     +IN +   L   L     ++ +S+ +  +L    L+ +   Y+          L +++ ++S      ++ Q M+ DA     E+    +R + +L+  + T   +    S  EQ   G+ + L++ +  + +T   + +E   + L A
Sbjct: 1463 TGYYGFPNCRPCNCG--TRLCEPVTGECI-CPPRTLLPECVQCQPQTFGCHPLVG-CEMCNCSPPGVTSQDINCDTNSG----QCRCKTNVIGRQCDRCAPGFYGYPN----CRPCNCNEAGTEKNVCDSVTGQCLCKENVEGPRCDQCSLGTFHLDPTNPKGCTKCFCFGATDRCRKSDKRRNEIINMEGWVL---LRGDRQEVPVSVYLDQDLVEADLSDVPDVYQDLHWHAPQTYLGDKVSSYSGYLRYQLRTQTMRGDALYLPSEV----SRPDVILKGNQMTLVYMEREYSSPEQPHEGVVH-LVEGSFRHAQTGNVVSREELMMVLVA 1776          

HSP 19 Score: 54.6842 bits (130), Expect = 2.714e-6
Identity = 57/213 (26.76%), Postives = 80/213 (37.56%), Query Frame = 2
Query: 1007 VAKCNCKHNTCGSNCETCCPLFNQRPWKPVAVCEECNCNRKSNECSYNQTVATLQLSVNKMGRMEGGGVCINCQENTEGINCEKCIKGFYRPWNVLATELYP-CTPCQCHGLGTIGSCVSNGEDIGDQKPGDCICKKGYEGVNCDLCSIGYERYPNGECLPCPCSIDGSVRTSFYRCKPPCNCKVHVNSDDLCKTCKNGYFNLDSANPEGCEP 1642
              +C C+    G +C+ C P +   P           C R   EC    TV          G  +  G C+ C+    G  CE+C  G +          YP C  C C    ++ S  S          G C C+  Y G  CD C+ G+  +P+  C PC CS+ GS  T   R    C C  +V     C TC  G ++      + C+P
Sbjct:  551 TGQCVCRSGFQGYSCDQCTPGYFNYPL----------CQR---ECVVLGTVP---------GGCDPTGRCV-CRPEFTGPRCEQCSSGLHS---------YPNCKECTCDPRTSVNSSCSVA--------GHCHCRPNYSGSKCDQCAPGFYGFPS--CSPCQCSLKGSRFTECDRVTGQCVCLPNVVGQH-CDTCSPGSYSFPLCQADSCDP 720          

HSP 20 Score: 53.5286 bits (127), Expect = 5.487e-6
Identity = 63/221 (28.51%), Postives = 85/221 (38.46%), Query Frame = 2
Query: 1007 VAKCNCKHNTCGSNCETCCPLFNQRPWKPVAVCEECNCNRKSNECSYNQTVATLQLSVNKMGRMEGGGVCINCQENTEGINCEKCIKGFYRPWNVLATELYPCTPCQCHGLGTIGSCVSNGEDIGDQKPGDCICKKGYEGVNCDLC-SIGYERYPNG--ECLPCPCSIDGSVRTSFYRCKPP---CNCKVHVNSDDLCKTCKNGYFNLDSANPEGCEPCYC 1651
               C+C+ N  GS C+ C P F   P      C  C C+ K +                +  R+ G  VC+    N  G +C+ C  G Y      A    P    Q   L T+GSC                CK   EGV C+ C  + +   P+    C  C C+  G++ +    C      C CK +V S   C  CK+GYFNL   N  GC+ C C
Sbjct:  640 AGHCHCRPNYSGSKCDQCAPGFYGFP-----SCSPCQCSLKGSR-------------FTECDRVTGQCVCL---PNVVGQHCDTCSPGSYSFPLCQADSCDPAGSVQNQILPTVGSCE---------------CKPYVEGVACNKCKPLYWNLSPDTLYGCSNCECNTGGTL-SEVAECAQSNGQCYCKPNVCSG-TCAVCKDGYFNLQKNNYFGCQGCQC 822          
BLAST of Laminin subunit alpha-2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008925.1 (pep scaffold:Pmarinus_7.0:GL476496:30277:70426:-1 gene:ENSPMAG00000008054.1 transcript:ENSPMAT00000008925.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 619.387 bits (1596), Expect = 0.000e+0
Identity = 374/1092 (34.25%), Postives = 541/1092 (49.54%), Query Frame = 2
Query:  455 QVYQIVYILLKMGDSPRPGNWILERSLDGEIYMPWIFFAETPYSCYNLFQRQYPDLKLTTNAKPSSLADDEMFCTTYYSQPKSLNSGEIIISLINGRKSIMNEEYLSIKSVPQTLINFLSARYIRFRFLKHLTLAADLMT--HKGYLEQS--IYNRYYYSLRNIEIGGKCICNNHADKCDKVIENGISVAKCNCKHNTCGSNCETCCPLFNQRPWKPVAV-----CEECNCNRKSNECSYNQTVATLQLSVNKMGRMEGGGVCINCQENTEGINCEKCIKGFYRPWNVLATELYPCTPCQCHGLGTIGSCVSNGEDIGDQK----PGDCICKKGYEGVNCDLCSIGYERYPNGECLPCPCSIDGSVRTSFYRCKPPCNCKVHVNSDDLCKTCKNGYFNLDSANPEGCEPCYCFGITNQCSSLSAKNLKISDLKGWKLTTFTGEKIALPKFTSFQYLTSENSYIDERFNNPTVYYWTAPPPYLGNWITSYGTIFRYVVKIELQ-STLKGSLIDSPDVIIKCGDFRLFHSVSIEDRRLQRQVF----IYIKPTEWKIGKLTPDKAATKEEFISCLVKVDKLLIKAKYYSNQKSIELL---NITLSRGEVHLALDEMPHIEKCNCPPGFNGLSCESCESGYRRVNNVLYQGQCEACACYNHSNTCDSLNGEC----QNCTHNTAGAHCEDCASGYYGDAKSKNLNSCKKCPCPR--LDYQMTELCSSYSSENYVCHKCLHNTSGVHCDRCIEGYYGNPKKK-ISCKRCKCNNNQES------CDPVTGEC-RCSYNTMGTECQLCKHGFYGDAL-TKSCKKCDCDSLGSTSENCDKLTGKCDCRTNFVNRQCDSCTSGLY--LKDKKCIPCNCEIQGRISSEKFCNTTSGQCFCLENVNGDRCEKCVEGYFNYP--NCKKCLCSPHALSADCDLNNGKCKCGSNVINRICDKCENLHYW-NNRTDCVPCNCGRG-SLNPKCDMETGNCKCAQNVARRDCSKCDVGYFGLDV----------TGCKKCPPCYNGQVCN---NEGICVCPPNTIGNLCNKCSEDSWDFN--ETIGCKKCNCYINGSYSNICNKISGI 3559
            QV+Q+ Y+++K  +SPRPGNWILERSLDG  Y PW +++ +   C   +          T   P    DDE+ CT+YY     L  G+I  SLINGR S  +            L++F SARYIR R  +  TL ADLMT  H+   E    +  RYYYS+++I +GG CIC+ HA  C           +C C+HNTCG NC+ CCP +NQR W+P  +     CE+CNC+ K+ +C Y+  V     S++  GR  GGGVC+NC  NT G NCE C  GFYRP  VL  + YPC  CQC   G++       E   D +    PG C+C+ G+ G  C+ C+  Y  YP  +C PC CS+ G   T+   C  PC CK  V  +  C  C+ G+++L   NP GC  C+CFG+++ C SL     ++ D++GW++T   G +  +  F     +   N+  D R   P +YYW AP  YLGN +T+Y    RY V  ++   +    +I   DVII+ G+ +   S S+    L  Q F    + ++           +   +++  ++ L  V +L I+A Y S ++++  L   ++ ++  +  +       +E+C+CP G+ G SCESC  G+RRV+  L+ G+CE C C+ H++ CD L+G+C      C HNT G HCE C  G+YG+A     + C  C CP        +  C         C +CL    G+ C+RC + ++G P     SC+RC+CN N+E+      CD  TG+C RC   T G  C+ C  GFYGDA  T  C+ C C   G+T+  CD++ G+C CR + V R C+ C  G Y       C PC C     + +     +  G+C C   V G  C++C  G++ +    C  C CS    +  CD   G+C C  N     C +C + H+  N    C  CNC    S   +CD  +G C C      R C +C  G +G             T    CP    G +C      G C C  N  G  C+ C   ++  N  +  GC  C C+     S++C ++ G 
Sbjct:    1 QVFQVAYVIVKAANSPRPGNWILERSLDGATYHPWQYYSVSDSECLTRYG------ITPTVGNPVYRRDDEVICTSYYVVLLMLARGKIHTSLINGRPSADDPS--------PKLLDFTSARYIRLRLQRIRTLNADLMTLSHRDPREVDPIVTRRYYYSIKDISVGGMCICSGHASTCP--WNEDTQKMECQCEHNTCGENCQHCCPGYNQRRWRPGTINNGNTCEKCNCHGKTEDCYYDAEVDRTNRSLSVHGRFSGGGVCVNCSANTAGTNCETCRDGFYRPTGVLPNDPYPCRLCQCDPQGSLSQVCIKDEKHADPEKDLSPGQCLCRPGFAGERCERCAFAYRGYP--DCKPCLCSMAGG--TNDDPCSEPCVCKERVEGEH-CDRCRAGFYDLRPRNPRGCSACFCFGLSSSCRSLPWGVTQVVDMRGWRVTDRQGLR-KVKTFVEVDQVAVRNA--DVRRTLPALYYWLAPTSYLGNKLTAYAGHLRYSVSYDIPVDSTDSEMISDVDVIIE-GNGQALSSGSLG---LMLQPFEEQTLSLRLLPENFFDFRSNAPVSRDALMTALANVTRLQIRASYSSVKQAVYRLSAVSLDVASPDAAVGSPAALDVEQCHCPHGYAGTSCESCMRGHRRVDGTLHGGRCEPCRCHGHADDCDDLSGDCMLPLSGCRHNTMGPHCELCRPGFYGNATRGTADDCLPCTCPLSIASNNFSPTCHQDPRGVLTCDQCLPGYIGLRCERCADDFFGEPSSPGGSCRRCECNGNEEAWGGGRVCDARTGQCLRCRERTAGFHCERCADGFYGDATGTGGCQPCQCHPEGATAPQCDRINGQCPCRPSVVGRTCEQCAIGFYGLSSGAGCSPCPCHP---VGTAGVACSADGRCHCWPGVEGRSCDRCTSGHYGFKEGGCTPCNCS--HTNHHCDQETGRCLCPPNTEGTRCHRCIDDHWGVNPHAGCRACNCSAAHSRGARCDEASGQCSCLDGYGGRTCGECAQGRWGYPACRPCECHPEGTRANTCPAPPTGSLCGCDERTGQCACKENVGGTRCDACLPGTFGLNREDPRGCTACFCF---GVSSVCRELQGF 1056          

HSP 2 Score: 241.891 bits (616), Expect = 1.999e-64
Identity = 189/700 (27.00%), Postives = 298/700 (42.57%), Query Frame = 2
Query: 2567 CHKCLHNTSGVHCDRCIEGY--YGNPKKKISCKRCKCNNNQESCDPVTGECR-----CSYNTMGTECQLCKHGFYGDALTKS---CKKCDC------DSLGSTSENCDKLTGKCD-CRTNFVNRQCDSCTSGLYLKDKK----CIPCNCEI-QGRISSEKFCNTTSGQCF-CLENVNGDRCEKCVEGYFN----YPNCKKCLCSPHALSA-DCDLNNGKCKCGSNVINRICDKCE-NLHYWNNRTDCVPCNCGR-GSLNPKCDMETGNCKCAQNVARRDCSKCDVGYFGLDVTGCKKCPPCYNGQVCNNE-GICVCPPNTIGNLCNKCSEDSWDFNETIGCKKCNCYINGSYSNICNKISGICACKTAFFGSKCDRCNEGYYGFPNCQPCSCAENGTKSN--------ELTKCDKITGQCQCKQNVIGTKCKVCRKGTFPSDGTYEGGCFSCFCFGVSEKCHAILNHRIVENSIYEYHIFDEKNSL----ESGKDYSTIHLNANYPRRFGWPLTMFR-----PIYVNVMKLFNSHDLSLFYRSIFMNVSVDCLDNKCGREIPEQTEVFMESYNG-LFGMRYXXXXXXXXXXXXXXDFNEHSKNGKWVISQYQNDILDKFIILEDSNVINSNLTRDIFMMALLNVTSLKVKL-YTDKVNPPLIKIKIITYKVMETTQAIGKRVTAVEKCICNALTFGNHCQ 4516
            CH C H  +G  C+ C+ G+           C+ C+C+ + + CD ++G+C      C +NTMG  C+LC+ GFYG+A   +   C  C C      ++   T     +    CD C   ++  +C+ C    + +       C  C C   +      + C+  +GQC  C E   G  CE+C +G++        C+ C C P   +A  CD  NG+C C  +V+ R C++C    +  ++   C PC C   G+    C  + G C C   V  R C +C  G++G    GC  C   +    C+ E G C+CPPNT G  C++C +D W  N   GC+ CNC    S    C++ SG C+C   + G  C  C +G +G+P C+PC C   GT++N         L  CD+ TGQC CK+NV GT+C  C  GTF  +     GC +CFCFGVS  C  +     V   ++   + + + S+    + G+  +   +   +P        + +     P Y  +   F    L+ +   +   V  +  D   GR   E   +     N  L   R +            +D  EH    +W   +Y N +LD+ +            +R  FM  L  + ++ +K  Y  ++    I    +         +  +    VE+C C     G  CQ
Sbjct:  592 CH-CPHGYAGTSCESCMRGHRRVDGTLHGGRCEPCRCHGHADDCDDLSGDCMLPLSGCRHNTMGPHCELCRPGFYGNATRGTADDCLPCTCPLSIASNNFSPTCHQDPRGVLTCDQCLPGYIGLRCERCADDFFGEPSSPGGSCRRCECNGNEEAWGGGRVCDARTGQCLRCRERTAGFHCERCADGFYGDATGTGGCQPCQCHPEGATAPQCDRINGQCPCRPSVVGRTCEQCAIGFYGLSSGAGCSPCPCHPVGTAGVACSAD-GRCHCWPGVEGRSCDRCTSGHYGFKEGGCTPCNCSHTNHHCDQETGRCLCPPNTEGTRCHRCIDDHWGVNPHAGCRACNCSAAHSRGARCDEASGQCSCLDGYGGRTCGECAQGRWGYPACRPCECHPEGTRANTCPAPPTGSLCGCDERTGQCACKENVGGTRCDACLPGTFGLNREDPRGCTACFCFGVSSVCRELQG--FVRMQVF---MVEGQRSMPVVNQVGQRETMSGVRYQHPEMILHAGEVLKTLHHEPFYWKLPSQFTGPKLTAYGGKLRYTVYFEAEDGS-GRSDREPQVLLRGGRNKELLIYRDMAPPRPGQRTQHQMDMTEH----EW---RYFNSVLDQPV------------SRADFMSILGGIGNIFIKASYGSRMTESRISEVSLEVAARGNGSSHLQAACQVEQCECPPGYSGLSCQ 1264          

HSP 3 Score: 165.236 bits (417), Expect = 8.381e-41
Identity = 147/591 (24.87%), Postives = 234/591 (39.59%), Query Frame = 2
Query: 3407 GICV-CPPNTIGNLCNKCSEDSWDF-----NETIGCKKCNCYINGSYSNICNK-----------ISGICACKTAFFGSKCDRCNEGYYGFPNCQPCSCAENGTKSNELTKCDKITGQCQCKQNVIGTKCKVCRKGTFPSDGTYEGGCFSCFCFGVSEKCHAILNHRIVENSIYEYHIFDEKNSLESGKDYSTIHLNANYPRRFGWPLTMFRPIYVNVMKLFNSHDLSLFYRSIFMNVSVDCLDNKCGREIPEQTEVFMESYNGLFGMRYXXXXXXXXXXXXXXDFNEHSKNGKWVISQYQNDILDKFIILEDSNVINSN--LTRDIFMMALLNVTSLKVKLYTDKVNPPLIKIKIITYKVMETTQAIGKRVTA-VEKCICNALTFGNHCQNPISGYYKEYFNLPNSTKSGSMRTGNRILINLKKCNCNGYSKVCDSVTGDC----QNCMGNREGNKCQLCREGFYKNDK--NYDQCEPCQCPS--AHYNFAQNCTRIESSLELKCQCRIGYSGKSCENCQQGFYGNPIK-GIPCKSCDCNQQ-----GSQSLNCNEFGICQCSPGVLGIKCDQCAPNY---VVEKKTCQSC 5068
            G+CV C  NT G  C  C +  +       N+   C+ C C   GS S +C K             G C C+  F G +C+RC   Y G+P+C+PC C+  G  ++     D  +  C CK+ V G  C  CR G +        GC +CFCFG+S  C ++         +  + + D +  L   K +  + ++    R      T+    Y      +  + L+ +   +  +VS D   +    E+    +V +E                             S +   ++  ++   L   ++ E+     SN  ++RD  M AL NVT L+++     V   + ++  ++  V     A+G      VE+C C     G  C++ + G+ +           G++  G       + C C+G++  CD ++GDC      C  N  G  C+LCR GFY N      D C PC CP   A  NF+  C +    +    QC  GY G  CE C   F+G P   G  C+ C+CN       G +  +       +C     G  C++CA  +         CQ C
Sbjct:  245 GVCVNCSANTAGTNCETCRDGFYRPTGVLPNDPYPCRLCQCDPQGSLSQVCIKDEKHADPEKDLSPGQCLCRPGFAGERCERCAFAYRGYPDCKPCLCSMAGGTND-----DPCSEPCVCKERVEGEHCDRCRAGFYDLRPRNPRGCSACFCFGLSSSCRSLPWGVTQVVDMRGWRVTD-RQGLRKVKTF--VEVDQVAVRNADVRRTLPALYYWLAPTSYLGNKLTAYAGHLRYSVSYDIPVDSTDSEMISDVDVIIEGNGQALS----------------------SGSLGLMLQPFEEQTLSLRLLPENFFDFRSNAPVSRDALMTALANVTRLQIRASYSSVKQAVYRLSAVSLDVASPDAAVGSPAALDVEQCHCPHGYAGTSCESCMRGHRR---------VDGTLHGGR-----CEPCRCHGHADDCDDLSGDCMLPLSGCRHNTMGPHCELCRPGFYGNATRGTADDCLPCTCPLSIASNNFSPTCHQDPRGVLTCDQCLPGYIGLRCERCADDFFGEPSSPGGSCRRCECNGNEEAWGGGRVCDARTGQCLRCRERTAGFHCERCADGFYGDATGTGGCQPC 791          

HSP 4 Score: 124.405 bits (311), Expect = 2.967e-28
Identity = 97/386 (25.13%), Postives = 157/386 (40.67%), Query Frame = 2
Query: 1208 GVCINCQENTEGINCEKCIKGFYRPWNVLATELYPCTPCQCHGLGTIGSCVSNGEDIGDQKPGDCICKKGYEGVNCDLCSIGYERYPNGECLPCPCSIDGSVRTSFYRCKPP--------------CNCKVHVNSDDLCKTCKNGYFNLDSANPEGCEPCYCFGITNQCSSLSA----KNLKISDLKGWKLTTFTGEKIALP--KFTSFQYLTSENSYIDERFNNPTVYYWTAPPPYLGNWITSYGTIFRYVVKIELQSTLKGSLIDSPDVIIKCG---DFRLFHSVSIEDRRLQRQVFIYIKPTEWKIGKLTPDKAATKEEFISCLVKVDKLLIKAKYYSNQKSIELLNITL---SRGEVHLALDEMPHIEKCNCPPGFNGLSCE 2287
            G C+ C  NTEG  C +CI      W V       C  C C    + G+         D+  G C C  GY G  C  C+ G   YP   C PC C  +G   T    C  P              C CK +V     C  C  G F L+  +P GC  C+CFG+++ C  L      +   +   +   +    G++  +   ++   + +      +    + P  +YW  P  + G  +T+YG   RY V  E +    G     P V+++ G   +  ++  ++      + Q  + +   EW+      D+  ++ +F+S L  +  + IKA Y S      +  ++L   +RG     L     +E+C CPPG++GLSC+
Sbjct:  901 GRCL-CPPNTEGTRCHRCIDDH---WGV--NPHAGCRACNCSAAHSRGARC-------DEASGQCSCLDGYGGRTCGECAQGRWGYP--ACRPCECHPEG---TRANTCPAPPTGSLCGCDERTGQCACKENVGGT-RCDACLPGTFGLNREDPRGCTACFCFGVSSVCRELQGFVRMQVFMVEGQRSMPVVNQVGQRETMSGVRYQHPEMILHAGEVLKTLHHEP--FYWKLPSQFTGPKLTAYGGKLRYTVYFEAEDG-SGRSDREPQVLLRGGRNKELLIYRDMAPPRPGQRTQHQMDMTEHEWRYFNSVLDQPVSRADFMSILGGIGNIFIKASYGSRMTESRISEVSLEVAARGNGSSHLQAACQVEQCECPPGYSGLSCQ 1264          

HSP 5 Score: 90.1225 bits (222), Expect = 8.349e-18
Identity = 56/159 (35.22%), Postives = 76/159 (47.80%), Query Frame = 2
Query: 4613 KKCNCNG------YSKVCDSVTGDCQNCMGNREGNKCQLCREGFYKNDKNYDQCEPCQCPSAHYNFAQNCTRIESSLELKCQCRIGYSGKSCENCQQGFYGNPIKGIPCKSCDCNQQGSQSLNCNEFGICQCSPGVLGIKCDQC-APNYVVEKKTCQSC 5068
            ++C CNG        +VCD+ TG C  C     G  C+ C +GFY +      C+PCQC       A  C RI      +C CR    G++CE C  GFYG    G  C  C C+  G+  + C+  G C C PGV G  CD+C + +Y  ++  C  C
Sbjct:  735 RRCECNGNEEAWGGGRVCDARTGQCLRCRERTAGFHCERCADGFYGDATGTGGCQPCQC-HPEGATAPQCDRING----QCPCRPSVVGRTCEQCAIGFYGL-SSGAGCSPCPCHPVGTAGVACSADGRCHCWPGVEGRSCDRCTSGHYGFKEGGCTPC 887          

HSP 6 Score: 65.855 bits (159), Expect = 1.911e-10
Identity = 77/322 (23.91%), Postives = 126/322 (39.13%), Query Frame = 2
Query: 4619 CNCNGYSKVCDSVTGDCQNCMGNREGNKCQLCREGFYKNDKNYDQCEPCQCPSAHYNFAQNCTRIESSLELKCQCRIGYSGKSCENCQQGFYGNPIKGIPCKSCDCNQQGSQSLNC------------NEFGICQCSPGVLGIKCDQCAPN-YVVEKKTCQSCYSGCTKDLLVRIDTLNETVINFKWKTLPSTLDLRLNKINISIQMSSELLNSINKFYKLKNEIKNFSIQFQKMKDDAKEKYGEIEKLKTRYNKVL-EDLRSTFTDINETISGHEQLGISNELIKNATAYLETIKNIYK--EMPNITLAASVLKDVLKYVD 5536
            CNC+  +  CD  TG C  C  N EG +C  C +  +  +  +  C  C C +AH   A+ C         +C C  GY G++C  C QG +G P     C+ C+C+ +G+++  C               G C C   V G +CD C P  + + ++  +    GCT      + ++   +  F          +R+    +  Q S  ++N + +    +  +     Q  +M   A    GE+  LKT +++     L S FT    T  G +            T Y E      +    P + L     K++L Y D
Sbjct:  887 CNCSHTNHHCDQETGRCL-CPPNTEGTRCHRCIDDHWGVNP-HAGCRACNCSAAHSRGAR-CDEASG----QCSCLDGYGGRTCGECAQGRWGYPA----CRPCECHPEGTRANTCPAPPTGSLCGCDERTGQCACKENVGGTRCDACLPGTFGLNREDPR----GCTACFCFGVSSVCRELQGF----------VRMQVFMVEGQRSMPVVNQVGQ----RETMSGVRYQHPEMILHA----GEV--LKTLHHEPFYWKLPSQFTGPKLTAYGGK---------LRYTVYFEAEDGSGRSDREPQVLLRGGRNKELLIYRD 1164          

HSP 7 Score: 63.5438 bits (153), Expect = 8.558e-10
Identity = 91/408 (22.30%), Postives = 154/408 (37.75%), Query Frame = 2
Query: 4475 KCICNALTFGNHCQNPISGYYKEYFNLPNSTKSGSMRTGNRILINLKKCNCNGYSKVCD------------------SVTGDCQNCMGNREGNKCQLCREGFYK------NDKNYDQCEPCQCPSAHYNFAQNCTRIESSLEL-------KCQCRIGYSGKSCENCQQGFYGNPIKGIPCKSCDCNQQGSQSLN-CNEFGICQCSPGVLGIKCDQCAPNYVVEK----KTCQSCYSGCTKDLLVRIDTLNETVINFKWKTLPSTLDLRLNKINISI-QMSSELLNSINKFYKLKNEIKNFSIQFQKMKDDAKEKYGEIEKLKTRYNKVLEDLRS-TFTDINETISGHEQ------LGISNELIKNATAYLETI-KNIYKEMPNITLAASVLKDVLKYVDELNQIIKYT 5563
            +C C   T G +CQ+   GY +  +      + G++  GN      +KCNC+G ++ C                   S  G C NC  N  G  C+ CR+GFY+      ND     C  CQC     + +Q C + E   +        +C CR G++G+ CE C   + G P     CK C C+  G  + + C+E   C C   V G  CD+C   +   +    + C +C+          +      V++ +   +     LR  K  + + Q++    +       L   +   S    K+       Y    +    Y+  ++   S   +D++  I G+ Q      LG+  +  +  T  L  + +N +    N  ++   L   L  V  L     Y+
Sbjct:  175 ECQCEHNTCGENCQHCCPGYNQRRW------RPGTINNGN----TCEKCNCHGKTEDCYYDAEVDRTNRSLSVHGRFSGGGVCVNCSANTAGTNCETCRDGFYRPTGVLPNDPY--PCRLCQC-DPQGSLSQVCIKDEKHADPEKDLSPGQCLCRPGFAGERCERCAFAYRGYPD----CKPCLCSMAGGTNDDPCSE--PCVCKERVEGEHCDRCRAGFYDLRPRNPRGCSACFCFGLSSSCRSLPWGVTQVVDMRGWRVTDRQGLRKVKTFVEVDQVAVRNADVRRTLPALYYWLAPTSYLGNKLT-----AYAGHLRYSVSYDIPVDSTDSEMISDVDVIIEGNGQALSSGSLGLMLQPFEEQTLSLRLLPENFFDFRSNAPVSRDALMTALANVTRLQIRASYS 558          
BLAST of Laminin subunit alpha-2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008872.1 (pep scaffold:Pmarinus_7.0:GL476733:325925:343343:-1 gene:ENSPMAG00000008023.1 transcript:ENSPMAT00000008872.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 343.969 bits (881), Expect = 3.176e-102
Identity = 239/710 (33.66%), Postives = 343/710 (48.31%), Query Frame = 2
Query: 1112 CNCNRKSNECSYNQTVATLQLSVNKMGRMEGGGVCINCQENTEGINCEKCIKGFYRPWNVLATELYPCTPCQCHGLGTIGS-CVSNGEDIGDQKPGDCICKKGYEGVNCDLCSIGYERYPNGECLPCPCSIDGSVRTSFYRCKPPCNCKVHVNSDDLCKTCKNGYFNLDSANPEGCEPCYCFGITNQCSSLSAKNLKISDLKGWK-LTTFTGEKIALPKFT-SFQYLTSENSYIDERFNNPTVYYWTAPPPYLGNWITSYGTIFRYVVKIELQSTLKGSLIDSPDVIIKCGDFRLFHSVSIEDR-RLQRQVFIYIKPTEWKIGKLTPDKAATKEEFISCLVKVDKLLIKAKYYSNQKSIELLNITLSRGEVHLALDEMPHIEKCNCPPGFNGLSCESCESGYRRVNNVLYQGQCEACACYNHSNTCDSLNGECQNCTHNTAGAHCEDCASGYYGDAKSKNLNSCKKCPCPRLDYQMTELCSSYSSENYVCHKCLHNTSGVHCDRCIEGYYGNPK-KKISCKRCKCNNNQE-----SCDPVTGEC-RCSYNTMGTECQLCKHGFYGDAL-TKSCKKCDCDSLGSTSENCDKLTGKCDCRTNFVNRQCDSCTSGLY--LKDKKCIPCNCEIQGRISSEKFCNTTSGQCFCLENVNGDRCEKCVEGYFNYP----NCKKCLC-SPHALSADCDLNNGKCKCGSNVINRICDKC 3184
            CNC+ K+ EC Y+  VA   LS+N  G+  GGGVC+NC +NT G+NCE C+  ++RP         PC PC C+ +G++   C++N           C CK GY G  C+ C+ GY+ +P  +C+ C CS +GS+      CK PC CK +V     C +CK G++NL  +N  GC  C+CFG+T  C S+     K+              +KI +   T  +  L+        R   PT                 YG   + + +I   +  +G     P V    G+    H   +  R    R       PT        P          + L  + +  + A    ++ S   L +        +A  +   +E C CPPG++G SCE+C  G+RRVN  LY G CE C C+ H+  CD ++G C NC HN+ G  CE C  G+YG+A+    + C+ C CP L +  T  C    S   +C +C    +G  CDRC +GYYG+P     SC+ C+CN N +     +CD VTGEC RC   T G  C+ C  G++GDA+  K+C+ C C S GS S  CD +TG+C+C+ N   RQCD C    +   + +KC PC C ++G +SS   C+   G+C C    +G RCE     ++        C  C C S  A S DCD  +G+C C   V+ R CD+C
Sbjct:    1 CNCHGKAGECYYDPDVARRNLSLNTAGKFVGGGVCLNCSQNTAGVNCEICVDEYFRP------PKNPCRPCNCNPVGSLSKVCINNSRS--------CRCKPGYGGERCNRCAFGYKGFP--KCVKCKCSTEGSINKD--PCKEPCICKSNVQGKH-CDSCKPGHYNLQESNALGCTECFCFGVTRMCDSIPWARAKVRGQAARHGADGRINKKIHVMDITLWWTRLSLAVQDTVSRGMMPTAQ-------------PDYGRGNKKMTRIHKTTYTRGPPPPPPCVSALVGEKLELHRCCLLPRASWARGPHHAPLPTPPSPCAPLPVPLCPHPSLHTPL-GLHRAPLPAPLSPHRLSSVTLEVAAEGTRGAVAASD---VELCQCPPGYSGTSCEACVRGHRRVNGSLYGGACEPCDCHGHATECDDVSGNCLNCEHNSVGPRCERCLPGFYGNAQEGTPHDCQPCACP-LGFSPT--CRVGPSGAMLCDRCAPGYAGARCDRCADGYYGSPGVPGGSCQPCQCNGNVDLSTPGACDAVTGECLRCVGQTSGWHCERCTTGYFGDAIVAKNCQPCKCSSNGSQSNTCDAVTGQCECKPNVAGRQCDHCVPNCWWDAQQRKCQPCRCSLEGAVSSA--CD-KHGRCACRPEFSGKRCEPSQARHYGMSQQPTGCAPCNCNSFGAFSFDCD-ESGQCHCQPGVVGRQCDRC 667          

HSP 2 Score: 117.087 bits (292), Expect = 1.956e-26
Identity = 98/326 (30.06%), Postives = 147/326 (45.09%), Query Frame = 2
Query: 2573 KCLHNTSGVHCDRCIEGY-------YGNPKKKISCKRCKCNNNQESCDPVTGEC-RCSYNTMGTECQLCKHGFYGDA---LTKSCKKCDCDSLGSTSENCDKLTGK--CD-CRTNFVNRQCDSCTSGLY----LKDKKCIPCNCEIQGRISSEKFCNTTSGQCF-CLENVNGDRCEKCVEGYFN----YPNCKKCLCSPHALSAD-CDLNNGKCKCGSNVINRICDKCENLHYWN-NRTDCVPCNCG-RGSLNPKCDMETGNCKCAQNVARRDCSKCDVGYFGLD--VTGCKKCPPCYNGQV---CNNEGICVCPPNTIGNLCNKC 3457
            +C    SG  C+ C+ G+       YG      +C+ C C+ +   CD V+G C  C +N++G  C+ C  GFYG+A       C+ C C  LG +       +G   CD C   +   +CD C  G Y    +    C PC C     +S+   C+  +G+C  C+   +G  CE+C  GYF       NC+ C CS +   ++ CD   G+C+C  NV  R CD C    +W+  +  C PC C   G+++  CD   G C C    + + C      ++G+    TGC  C     G     C+  G C C P  +G  C++C
Sbjct:  349 QCPPGYSGTSCEACVRGHRRVNGSLYGG-----ACEPCDCHGHATECDDVSGNCLNCEHNSVGPRCERCLPGFYGNAQEGTPHDCQPCAC-PLGFSPTCRVGPSGAMLCDRCAPGYAGARCDRCADGYYGSPGVPGGSCQPCQCNGNVDLSTPGACDAVTGECLRCVGQTSGWHCERCTTGYFGDAIVAKNCQPCKCSSNGSQSNTCDAVTGQCECKPNVAGRQCDHCVPNCWWDAQQRKCQPCRCSLEGAVSSACDKH-GRCACRPEFSGKRCEPSQARHYGMSQQPTGCAPCNCNSFGAFSFDCDESGQCHCQPGVVGRQCDRC 667          

HSP 3 Score: 108.612 bits (270), Expect = 7.541e-24
Identity = 99/332 (29.82%), Postives = 138/332 (41.57%), Query Frame = 2
Query: 2858 CDCRTNFVNRQCDSCTSGLY-----LKDKKCIPCNCEIQGRISSEKFCNTTSGQCF-CLENVNGDRCEKCVEGYFNYP------NCKKCLCSPHALSADCDLNNGKC----KCGSNVINRICDKCENLHYWNNRT---DCVPCNCGRG---SLNPKCDMETGNC-KCAQNVARRDCSKCDVGYFGLDVTGCKKCPPC---YNGQVCNN----EGICVCPPNTIGNLCNKCSEDSWDFNETIGCKKCNCYINGSYSNICNKISGICACKTAFFGSKCDRCNEGYYGFP----NCQPCSCAENGTKSNELTKCDKITGQCQCKQNVIGTKCKVC 3751
            C C   +    C++C  G       L    C PC+C           C+  SG C  C  N  G RCE+C+ G++         +C+ C C P   S  C +         +C        CD+C + +Y +       C PC C      S    CD  TG C +C    +   C +C  GYFG D    K C PC    NG   N      G C C PN  G  C+ C  + W   +   C+ C C + G+ S+ C+K  G CAC+  F G +C+     +YG       C PC+C   G  S +   CD+ +GQC C+  V+G +C  C
Sbjct:  348 CQCPPGYSGTSCEACVRGHRRVNGSLYGGACEPCDCH-----GHATECDDVSGNCLNCEHNSVGPRCERCLPGFYGNAQEGTPHDCQPCAC-PLGFSPTCRVGPSGAMLCDRCAPGYAGARCDRCADGYYGSPGVPGGSCQPCQCNGNVDLSTPGACDAVTGECLRCVGQTSGWHCERCTTGYFG-DAIVAKNCQPCKCSSNGSQSNTCDAVTGQCECKPNVAGRQCDHCVPNCWWDAQQRKCQPCRCSLEGAVSSACDK-HGRCACRPEFSGKRCEPSQARHYGMSQQPTGCAPCNCNSFGAFSFD---CDE-SGQCHCQPGVVGRQCDRC 667          

HSP 4 Score: 87.0409 bits (214), Expect = 4.181e-17
Identity = 76/296 (25.68%), Postives = 116/296 (39.19%), Query Frame = 2
Query: 4364 VKLYTDKVNPPLIKIKIITYKVMETTQAIGKRVTA--VEKCICNALTFGNHCQNPISGYYKEYFNLPNSTKSGSMRTGNRILINLKKCNCNGYSKVCDSVTGDCQNCMGNREGNKCQLCREGFYKN--DKNYDQCEPCQCPSAHYNFAQNCTRIESSLELKCQCRIGYSGKSCENCQQGFYGNP-IKGIPCKSCDCN-----------------------------------------------------QQGSQSLNCNEF-GICQCSPGVLGIKCDQCAPN--YVVEKKTCQSC 5068
            + L+   +  PL   ++ +  +    +     V A  VE C C     G  C+  + G+ +          +GS+  G       + C+C+G++  CD V+G+C NC  N  G +C+ C  GFY N  +     C+PC CP     F+  C    S   L  +C  GY+G  C+ C  G+YG+P + G  C+ C CN                                                       GSQS  C+   G C+C P V G +CD C PN  +  +++ CQ C
Sbjct:  308 LGLHRAPLPAPLSPHRLSSVTLEVAAEGTRGAVAASDVELCQCPPGYSGTSCEACVRGHRR---------VNGSLYGGA-----CEPCDCHGHATECDDVSGNCLNCEHNSVGPRCERCLPGFYGNAQEGTPHDCQPCACP---LGFSPTCRVGPSGAMLCDRCAPGYAGARCDRCADGYYGSPGVPGGSCQPCQCNGNVDLSTPGACDAVTGECLRCVGQTSGWHCERCTTGYFGDAIVAKNCQPCKCSSNGSQSNTCDAVTGQCECKPNVAGRQCDHCVPNCWWDAQQRKCQPC 586          

HSP 5 Score: 81.6481 bits (200), Expect = 2.161e-15
Identity = 68/213 (31.92%), Postives = 89/213 (41.78%), Query Frame = 2
Query: 3260 CDMETGNCKCAQNVARRDCSKCDVGYFGLDVTGCKKCPPCYNGQVCNNEGICVCPPNTIGNLCNKCSEDSWDFNETIGCKKCNCYINGSYSNICNKISGICACKTAFFGSKCDRCNEGYYGFPNCQPCSCAENGTKSNELTKCDKITGQCQCKQNVIGTKCKVCRKGTFPSDGTYEGGCFSCFCFGVSEKCHAILNHRIVENSIYEYHIFDEK 3898
            C  + G C    +VARR+ S    G F               G VC N     C  NT G  C  C ++ +   +   C+ CNC   GS S +C   S  C CK  + G +C+RC  GY GFP C  C C+  G+ +      D     C CK NV G  C  C+ G +    +   GC  CFCFGV+  C +I   R         H  D +
Sbjct:    3 CHGKAGECYYDPDVARRNLSLNTAGKF-------------VGGGVCLN-----CSQNTAGVNCEICVDEYFRPPKNP-CRPCNCNPVGSLSKVCINNSRSCRCKPGYGGERCNRCAFGYKGFPKCVKCKCSTEGSINK-----DPCKEPCICKSNVQGKHCDSCKPGHYNLQESNALGCTECFCFGVTRMCDSIPWARAKVRGQAARHGADGR 191          

HSP 6 Score: 77.7962 bits (190), Expect = 2.553e-14
Identity = 60/184 (32.61%), Postives = 85/184 (46.20%), Query Frame = 2
Query: 4484 CNALTFGNHCQNPISGYYKEYFNLPNSTKSGSMRTGNRILINLKKCNC--NG-YSKVCDSVTGDCQNCMGNREGNKCQLCREGFYKNDKNYDQCEPCQCPSAHYNFAQNCTRIESSLELKCQCRIGYSGKSCENCQQGFYGNPIKGIPCKSCDCNQQGSQSLNCNEFGICQCSPGVLGIKCDQC 5026
            C   T G HC+   +GY+ +                  +  N + C C  NG  S  CD+VTG C+ C  N  G +C  C    +  D    +C+PC+C S     +  C +       +C CR  +SGK CE  Q   YG   +   C  C+CN  G+ S +C+E G C C PGV+G +CD+C
Sbjct:  508 CVGQTSGWHCERCTTGYFGDAI----------------VAKNCQPCKCSSNGSQSNTCDAVTGQCE-CKPNVAGRQCDHCVPNCWW-DAQQRKCQPCRC-SLEGAVSSACDK-----HGRCACRPEFSGKRCEPSQARHYGMSQQPTGCAPCNCNSFGAFSFDCDESGQCHCQPGVVGRQCDRC 667          

HSP 7 Score: 60.8474 bits (146), Expect = 4.145e-9
Identity = 75/289 (25.95%), Postives = 109/289 (37.72%), Query Frame = 2
Query:  824 IRFRFLKHLTLAADLMTHKGYLEQSIYNRYYYSLRNIEIGGKCICNNHADKCDKVIENGISVAKCNCKHNTCGSNCETCCPLFNQRPWKPV------AVCEECNCNRKSNECSYNQTVATLQLSVNKMGRMEGGGVCINCQENTEGINCEKCIKGFYRPWNVLATELYPCTPCQCHGLGTIGSCV--SNGEDIGDQKPGDCICKKGYEGVNCDLCSIGY---ERYPNGECLPCPC--SIDGSVRTSFYRCKPPCNCKVHVNSDDLCKTCKNGYFNLDSANPEGCEPCYC 1651
            +      H +L   L  H+  L   +      S+  +E+         A +  +       V  C C     G++CE C      R  + V        CE C+C+  + EC                   +  G C+NC+ N+ G  CE+C+ GFY   N      + C PC C  LG   +C    +G  + D+      C  GY G  CD C+ GY      P G C PC C  ++D S   +       C   V   S   C+ C  GYF  D+   + C+PC C
Sbjct:  294 LPVPLCPHPSLHTPLGLHRAPLPAPLSPHRLSSV-TLEV---------AAEGTRGAVAASDVELCQCPPGYSGTSCEAC-----VRGHRRVNGSLYGGACEPCDCHGHATECD------------------DVSGNCLNCEHNSVGPRCERCLPGFY--GNAQEGTPHDCQPCACP-LGFSPTCRVGPSGAMLCDR------CAPGYAGARCDRCADGYYGSPGVPGGSCQPCQCNGNVDLSTPGACDAVTGECLRCVGQTSGWHCERCTTGYFG-DAIVAKNCQPCKC 539          

HSP 8 Score: 60.077 bits (144), Expect = 9.063e-9
Identity = 70/242 (28.93%), Postives = 96/242 (39.67%), Query Frame = 2
Query:  950 CICNNHADKCDKVIENGISVAKCNCKHNTCGSNCETCCPLF--NQRPWKPVAVCEECNCNRKSNECSYNQTVATLQLSVNKMGRMEGGGVCINCQENTEGINCEKCIKGFYRPWNVLATELYPCTPCQCHG---LGTIGSCVSNGEDIGDQKPGDCI-CKKGYEGVNCDLCSIGY--ERYPNGECLPCPCSIDGSVRTSFYRCKPPCNCKVHVNSDDLCKTCKNGYFNLDSANPEGCEPCYC 1651
            C C+ HA +CD V  N +     NC+HN+ G  CE C P F  N +   P   C+ C C               L  S        G  +C  C     G  C++C  G+Y    V       C PCQC+G   L T G+C        D   G+C+ C     G +C+ C+ GY  +      C PC CS +GS   +       C CK +V          N +++   A    C+PC C
Sbjct:  381 CDCHGHATECDDVSGNCL-----NCEHNSVGPRCERCLPGFYGNAQEGTP-HDCQPCAC--------------PLGFSPTCRVGPSGAMLCDRCAPGYAGARCDRCADGYYGSPGVPGGS---CQPCQCNGNVDLSTPGAC--------DAVTGECLRCVGQTSGWHCERCTTGYFGDAIVAKNCQPCKCSSNGSQSNTCDAVTGQCECKPNVAGRQCDHCVPNCWWD---AQQRKCQPCRC 588          

HSP 9 Score: 56.9954 bits (136), Expect = 6.512e-8
Identity = 41/114 (35.96%), Postives = 51/114 (44.74%), Query Frame = 2
Query: 2861 DCRTNFVNRQCDSCTSGLYLKDK-KCIPCNCEIQGRISSEKFCNTTSGQCFCLENVNGDRCEKCVEGYFNYPNCKKCLCSPHALSADCDLNNGKCKCGSNVINRICDKCENLHY 3199
            +C  N     C+ C    +   K  C PCNC   G +S  K C   S  C C     G+RC +C  GY  +P C KC CS    S + D     C C SNV  + CD C+  HY
Sbjct:   37 NCSQNTAGVNCEICVDEYFRPPKNPCRPCNCNPVGSLS--KVCINNSRSCRCKPGYGGERCNRCAFGYKGFPKCVKCKCSTEG-SINKDPCKEPCICKSNVQGKHCDSCKPGHY 147          

HSP 10 Score: 54.299 bits (129), Expect = 5.355e-7
Identity = 55/230 (23.91%), Postives = 96/230 (41.74%), Query Frame = 2
Query: 4661 GDCQNCMGNREGNKCQLCREGFYKNDKNYDQCEPCQCPSAHYNFAQNCTRIESSLELKCQCRIGYSGKSCENCQQGFYGNPIKGIPCKSCDCNQQGSQSLN-CNEFGICQCSPGVLGIKCDQCAPNYVVEKKTCQSCYSGCTKDLLVRIDTLNETVINFKWKTLPSTLDLRLNKINISIQMSSELLNSINKFYKLKNEIKNFSIQFQKMKDDAKEKYGEIEKLKTRYNKV 5347
            G C NC  N  G  C++C + +++  KN   C PC C     N   + +++  +    C+C+ GY G+ C  C  G+ G P     C  C C+ +GS + + C E   C C   V G  CD C P +   +   +S   GCT+     +  + +++    W           +  +  I     +++    + +L   +++     + M   A+  YG   K  TR +K 
Sbjct:   33 GVCLNCSQNTAGVNCEICVDEYFRPPKN--PCRPCNC-----NPVGSLSKVCINNSRSCRCKPGYGGERCNRCAFGYKGFPK----CVKCKCSTEGSINKDPCKE--PCICKSNVQGKHCDSCKPGHYNLQ---ESNALGCTECFCFGVTRMCDSI---PWARAKVRGQAARHGADGRINKKIHVMDITLWWTRLSLAVQD--TVSRGMMPTAQPDYGRGNKKMTRIHKT 241          

HSP 11 Score: 53.1434 bits (126), Expect = 1.093e-6
Identity = 40/146 (27.40%), Postives = 63/146 (43.15%), Query Frame = 2
Query: 3410 ICVCPPNTIGNLCNKCSEDSWDFNETI---GCKKCNCYINGSYSNICNKISGICA-CKTAFFGSKCDRCNEGYYGFP------NCQPCSCAENGTKSNELTKCDKITGQCQCKQNVIGTKCKVCRKGTFPSDGTYEGGCFSCFCFG 3817
            +C CPP   G  C  C       N ++    C+ C+C+    ++  C+ +SG C  C+    G +C+RC  G+YG        +CQPC+C    + +  +     +    +C     G +C  C  G + S G   G C  C C G
Sbjct:  347 LCQCPPGYSGTSCEACVRGHRRVNGSLYGGACEPCDCH---GHATECDDVSGNCLNCEHNSVGPRCERCLPGFYGNAQEGTPHDCQPCACPLGFSPTCRVGPSGAMLCD-RCAPGYAGARCDRCADGYYGSPGVPGGSCQPCQCNG 488          
BLAST of Laminin subunit alpha-2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000128.1 (pep scaffold:Pmarinus_7.0:GL482156:314:14887:1 gene:ENSPMAG00000000114.1 transcript:ENSPMAT00000000128.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 239.965 bits (611), Expect = 3.351e-67
Identity = 193/650 (29.69%), Postives = 281/650 (43.23%), Query Frame = 2
Query: 1406 CKKGYEGVNCDLCSIGYERYPNGECLPCPCSIDGSVRTSFYRCKPPCNCKVHVNSDDLCKTCKNGYFNLDSANPEGCEPCYCFGITNQCSSLSAKNLKISDLKGWKLTTFTGE------KIALPKFTSFQYLTSENSYIDERFNNPTVYYWTAPPPYLGNWITSYGTIFRYVVKI----ELQSTLKGSLIDSPDVIIKCGDFRLF-----HSVSIEDRRLQRQVFI------YIKPTEWKIGKLTPDKAATKEEFISCLVKVDKLLIKAKYYSNQKSIELLNITLSRGEVHLALDEMPHIEKCNCPPGFNGLSCESCESGYRRVNNVLYQGQCEACACYNHSNTCDSLNGECQNCTHNTAGAHCEDCASG-----YYGDAKSKNLNSCKKCPCPRLDYQMTELCSSYSSENYVCHKCLHNTSGVHCDRCIEGYYGNPKKKIS-CKRCKCNNNQE-----------SCDPVTGECR-CSYNTMGTECQLCKH---------GFYGDALTKS-----CKKCDCDSLGSTSENCDKLTGKCDCRTNFVNRQCDSCTSGLYLKD--KKCIPCNCEIQGRISSEKFCNTTSGQCFCLENVNGDRCEKCVEGYFNY-PN-CKKCLCSPHALSADCDLNNGKCKCGSNVINRICDKC 3184
            CK    G  C+ C  G+  YP  EC PC C   G            C CK +V     C  C+ G F+L + NP+GC  C+CFG+T +C+S       I+++ GW+L   +G       ++   +       T    ++D         YW AP  YLG+ ++SYG    + V+     +   T  G     PD+I++     +      H   I   R +RQ  +       ++  E         + A++EE    L  +  LL++ +       + L ++ +     +++      +E+C CP  + G SC+ C  G+ R +   + G+C  C C  HS+ C+      Q+C HNT G HCE C  G       GD  S   + C  CPCP      +  C     E   C  C     G +C+RC  GY+GNP    S CK C+CN N             SCDPVTG C  C ++  G  CQ C+          G    A  +S     C  C CD  G   + CD  +GKC C+   +   C +C  G Y  D  K C PC C +    S    C+  SG+C C  +V G RCE C  GY+NY PN C++C C+    +  CD ++G+C C   V    CD+C
Sbjct:    1 CKPNVGGQRCEHCLPGFFGYP--ECRPCDCDAAGVSGAGCDAVTGQCLCKENVEGR-RCDVCRLGTFDLGAENPKGCTACFCFGVTGECTSSELHQDTIANMSGWRLLMGSGGGGEESVQVKHDETAQRAEATLSKRHVDAELE----LYWAAPHAYLGDQLSSYGGELSFRVRASGGQDGHRTPPGDH-QQPDLILRVVKIEIVTKNGSHMSLIH--RAERQPVVGETFHGSVRLLEGGFQHDASGRPASREELAMVLQDLQALLLRGRTGPGPSRLTLSHVVMETASANVSGPLARGVERCLCPASYRGGSCQECARGHYRDSRGSFLGRCLPCDCNGHSDACE------QHCDHNTRGDHCELCREGCLPRDVQGDEPS---SQCFPCPCPMT--IRSNQCCVQKPEGLEC-LCREGYEGKNCERCAPGYFGNPMVIGSECKACQCNGNAADDGGGPGVPGSSCDPVTGRCHECRHHRAGPRCQDCERVTVAWVRRPGVTLAATVRSLVACPCAACRCDKCG--MKGCDGRSGKCICKLGVMGHSCSTCEPGYYGFDSCKGCEPCECAVAALGSQ---CDPRSGRCRCPPSVTGRRCELCQPGYWNYGPNGCQRCECT----TGSCDPHSGRCSCKGGVSGEQCDQC 619          

HSP 2 Score: 152.525 bits (384), Expect = 5.135e-38
Identity = 124/474 (26.16%), Postives = 197/474 (41.56%), Query Frame = 2
Query: 3566 CKTAFFGSKCDRCNEGYYGFPNCQPCSCAENGTKSNELTKCDKITGQCQCKQNVIGTKCKVCRKGTFPSDGTYEGGCFSCFCFGVSEKCHAILNHRIVENSIYEYHIF-----DEKNSLESGKDYSTIHLNANYPRRFGWPLTMFRPIYVNVMKLFNSHDLSLFYRSIFMNVSVDCLDNKCGREIP----EQTEVFMESYNGLFGMRYXXXXXXXXXXXXXXDFNEHSKNGKWVISQYQNDILDKFIILEDSNVINSNLTRDIFMMALLNVTSLKVKLYTDKVNPPLIKIKIITYKVMETTQA--IGKRVTAVEKCICNALTFGNHCQNPISGYYKEYFNLPNSTKSGSMRTGNRILINLKKCNCNGYSKVCDSVTGDCQNCMGNREGNKCQLCREGFYKNDKNYD----QCEPCQCPSAHYNFAQNCTRIESSLELKCQCRIGYSGKSCENCQQGFYGNP-IKGIPCKSCDCN 4939
            CK    G +C+ C  G++G+P C+PC C   G        CD +TGQC CK+NV G +C VCR GTF        GC +CFCFGV+ +C +   H+    ++  + +        + S++   D +     A   +R    +     +Y      +    LS +   +   V       + G   P    +Q ++ +         +   + S+            H    + V+ +  +  +         +      +R+   M L ++ +L   L   +  P   ++  +++ VMET  A   G     VE+C+C A   G  CQ    G+Y++              +    L     C+CNG+S  C+      Q+C  N  G+ C+LCREG    D   D    QC PC CP        N   ++    L+C CR GY GK+CE C  G++GNP + G  CK+C CN
Sbjct:    1 CKPNVGGQRCEHCLPGFFGYPECRPCDCDAAGVSG---AGCDAVTGQCLCKENVEGRRCDVCRLGTFDLGAENPKGCTACFCFGVTGECTSSELHQDTIANMSGWRLLMGSGGGGEESVQVKHDETAQRAEATLSKRH---VDAELELYWAAPHAYLGDQLSSYGGELSFRVRAS--GGQDGHRTPPGDHQQPDLILRVVKIEIVTKNGSHMSLI-----------HRAERQPVVGETFHGSVRLLEGGFQHDASGRPASREELAMVLQDLQAL---LLRGRTGPGPSRL-TLSHVVMETASANVSGPLARGVERCLCPASYRGGSCQECARGHYRD--------------SRGSFLGRCLPCDCNGHSDACE------QHCDHNTRGDHCELCREGCLPRDVQGDEPSSQCFPCPCP---MTIRSNQCCVQKPEGLECLCREGYEGKNCERCAPGYFGNPMVIGSECKACQCN 428          

HSP 3 Score: 104.76 bits (260), Expect = 9.521e-23
Identity = 99/347 (28.53%), Postives = 133/347 (38.33%), Query Frame = 2
Query: 2708 ECRCSYNTMGTECQLCKHGFYGDA---LTKSCKKCDCDSLGSTSENCDKLTGKCDCRTNFVNRQCDSCTSGLYLKD-------KKCIPCNCEIQGRISSEKFC--NTTSGQCFCLENVNGDRCEKCVEGYFNYP-----NCKKCLCSPHALSAD---------CDLNNGKC-KCGSNVINRICDKCENLHY-WNNRTD--------------CVPCNCGRGSLNPKCDMETGNCKCAQNVARRDCSKCDVGYFGLDVTGCKKCPPC------YNGQVCNNEGICVCPPNTIGNLCNKCSEDSWDFNETIGCKKCNCYINGSYSNICNKISGICACKTAFFGSKCDRC 3604
             C C  +  G  CQ C  G Y D+       C  CDC+     S+ C++      C  N     C+ C  G   +D        +C PC C +   I S + C       +C C E   G  CE+C  GYF  P      CK C C+ +A             CD   G+C +C  +     C  CE +   W  R                C  C C +  +   CD  +G C C   V    CS C+ GY+G D   CK C PC         Q     G C CPP+  G  C  C    W++    GC++C C      +  C+  SG C+CK    G +CD+C
Sbjct:  292 RCLCPASYRGGSCQECARGHYRDSRGSFLGRCLPCDCNG---HSDACEQ-----HCDHNTRGDHCELCREGCLPRDVQGDEPSSQCFPCPCPMT--IRSNQCCVQKPEGLECLCREGYEGKNCERCAPGYFGNPMVIGSECKACQCNGNAADDGGGPGVPGSSCDPVTGRCHECRHHRAGPRCQDCERVTVAWVRRPGVTLAATVRSLVACPCAACRCDKCGMK-GCDGRSGKCICKLGVMGHSCSTCEPGYYGFDS--CKGCEPCECAVAALGSQCDPRSGRCRCPPSVTGRRCELCQPGYWNYGPN-GCQRCECT-----TGSCDPHSGRCSCKGGVSGEQCDQC 619          

HSP 4 Score: 93.9745 bits (232), Expect = 2.553e-19
Identity = 88/332 (26.51%), Postives = 134/332 (40.36%), Query Frame = 2
Query: 2576 CLHNTSGVHCDRCIEGYYGNPKKKI--SCKRCKCNNNQESCDPVTGECRCSYNTMGTECQLCKHG-----FYGDALTKSCKKCDCDSLGSTSENC-DKLTG-KCDCRTNFVNRQCDSCTSGLY----LKDKKCIPCNC------EIQGRISSEKFCNTTSGQCF-CLENVNGDRCEKCVE---GYFNYPN--------------CKKCLCSPHALSADCDLNNGKCKCGSNVINRICDKCENLHY-WNNRTDCVPCNCGRGSLNPKCDMETGNCKCAQNVARRDCSKCDVGYFGLDVTGCKKCPPCYNGQVCNNEGICVCPPNTIGNLCNKC 3457
            C  +  G  C  C  G+Y + +      C  C CN + ++C     E  C +NT G  C+LC+ G       GD  +  C  C C     +++ C  K  G +C CR  +  + C+ C  G +    +   +C  C C      +  G       C+  +G+C  C  +  G RC+ C      +   P               C  C C    +   CD  +GKC C   V+   C  CE  +Y +++   C PC C   +L  +CD  +G C+C  +V  R C  C  GY+     GC++C  C  G    + G C C     G  C++C
Sbjct:  295 CPASYRGGSCQECARGHYRDSRGSFLGRCLPCDCNGHSDAC-----EQHCDHNTRGDHCELCREGCLPRDVQGDEPSSQCFPCPCPMTIRSNQCCVQKPEGLECLCREGYEGKNCERCAPGYFGNPMVIGSECKACQCNGNAADDGGGPGVPGSSCDPVTGRCHECRHHRAGPRCQDCERVTVAWVRRPGVTLAATVRSLVACPCAACRCDKCGMKG-CDGRSGKCICKLGVMGHSCSTCEPGYYGFDSCKGCEPCECAVAALGSQCDPRSGRCRCPPSVTGRRCELCQPGYWNYGPNGCQRC-ECTTGSCDPHSGRCSCKGGVSGEQCDQC 619          

HSP 5 Score: 62.003 bits (149), Expect = 1.883e-9
Identity = 84/347 (24.21%), Postives = 119/347 (34.29%), Query Frame = 2
Query: 2855 KCDCRTNFVNRQCDSCTSGLYLKDK-----KCIPCNCEIQGRISSEKFCNTTSGQC--FCLENVNGDRCEKCVEGYFNYPNCKKCLCSPHALSADCDLNNGKCKCGSNVINRICDKCENLHYWNNRTDCVPCNCGRGSLNPKC---DMETGNCKCAQNVARRDCSKCDVGYFGLDVTGCKKCPPCY-NGQVCNNE--------------GIC-VCPPNTIGNLCNKCSEDSWDFNETIG--------------CKKCNCYINGSYSNICNKISGICACKTAFFGSKCDRCNEGYYGFPN---CQPCSCAENGTKSNELTKCDKITGQCQCKQNVIGTKCKVCRKGTF 3766
            +C C  ++    C  C  G Y   +     +C+PC+C            N  S  C   C  N  GD CE C EG           C P  +  D                               + C PC C     + +C     E   C C +    ++C +C  GYFG  +    +C  C  NG   ++               G C  C  +  G  C  C   +  +    G              C  C C   G     C+  SG C CK    G  C  C  GYYGF +   C+PC CA     S    +CD  +G+C+C  +V G +C++C+ G +
Sbjct:  292 RCLCPASYRGGSCQECARGHYRDSRGSFLGRCLPCDC------------NGHSDACEQHCDHNTRGDHCELCREG-----------CLPRDVQGD----------------------------EPSSQCFPCPCPMTIRSNQCCVQKPEGLECLCREGYEGKNCERCAPGYFGNPMVIGSECKACQCNGNAADDGGGPGVPGSSCDPVTGRCHECRHHRAGPRCQDCERVTVAWVRRPGVTLAATVRSLVACPCAACRCDKCGMKG--CDGRSGKCICKLGVMGHSCSTCEPGYYGFDSCKGCEPCECAVAALGS----QCDPRSGRCRCPPSVTGRRCELCQPGYW 581          

HSP 6 Score: 57.3806 bits (137), Expect = 5.784e-8
Identity = 89/376 (23.67%), Postives = 141/376 (37.50%), Query Frame = 2
Query:  680 TYYSQPKSLNSGEIIISLINGRKSIMNEEYLSIKSVPQTLINFLSARYIRFRFLKHLTLAADLMTHKGYLEQSIYN----------------RYYYSLRNIEIGGKCI---CNNHADKCDKVIENGISVAKCNCKHNTCGSNCETC---CPLFNQRPWKPVAVCEECNCNRKSNECSYNQTVATLQLSVNKMGRMEGGGVCINCQENTEGINCEKCIKGFYRPWNVLATELYPCTPCQCHG-LGTIGSCVSNGEDIGDQKPGDCI-CKKGYEGVNCDLC---SIGYERYPN-------GECLPCPCSIDGSVRTSFYRC---KPPCNCKVHVNSDDLCKTCKNGYFNLDSANPEGCEPCYC--FGITNQCSSLSAK 1690
            T++   + L  G       +GR +   E  + ++ +   L+   +        L H+ +        G L + +                  R +Y        G+C+   CN H+D C++           +C HNT G +CE C   C   + +  +P + C  C C           T+ + Q  V K   +E    C+ C+E  EG NCE+C  G++    V+ +E   C  CQC+G     G          D   G C  C+    G  C  C   ++ + R P           + CPC+     +     C      C CK+ V     C TC+ GY+  DS   +GCEPC C    + +QC   S +
Sbjct:  219 TFHGSVRLLEGG--FQHDASGRPASREELAMVLQDLQALLLRGRTGPGPSRLTLSHVVMETASANVSGPLARGVERCLCPASYRGGSCQECARGHYRDSRGSFLGRCLPCDCNGHSDACEQ-----------HCDHNTRGDHCELCREGCLPRDVQGDEPSSQCFPCPC---------PMTIRSNQCCVQKPEGLE----CL-CREGYEGKNCERCAPGYFGNPMVIGSE---CKACQCNGNAADDGGGPGVPGSSCDPVTGRCHECRHHRAGPRCQDCERVTVAWVRRPGVTLAATVRSLVACPCAACRCDKCGMKGCDGRSGKCICKLGVMGHS-CSTCEPGYYGFDSC--KGCEPCECAVAALGSQCDPRSGR 561          

HSP 7 Score: 56.225 bits (134), Expect = 1.105e-7
Identity = 64/241 (26.56%), Postives = 91/241 (37.76%), Query Frame = 2
Query: 1013 KCNCKHNTCGSNCETCCPLFNQRPWKPVAVCEECNCNRKSNECSYNQTVATLQLSVNKMGRMEGGGVCINCQENTEGINCEKC----IKGFYRPWNVLATELY-----PCTPCQCHGLGTIGSCVSNGEDIGDQKPGDCICKKGYEGVNCDLCSIGYERYPNGE-CLPCPCSIDG-----SVRTSFYRCKPPCNCKVHVNSDDLCKTCKNGYFNLDSANPEGCEPCYCFGITNQCSSLSAK 1690
            +C C+    G NCE C P +   P    + C+ C CN   N             S + +      G C  C+ +  G  C+ C    +    RP   LA  +      PC  C+C   G  G          D + G CICK G  G +C  C  GY  + + + C PC C++         R+   RC P         +   C+ C+ GY+N     P GC+ C C   T  C   S +
Sbjct:  392 ECLCREGYEGKNCERCAPGYFGNPMVIGSECKACQCN--GNAADDGGGPGVPGSSCDPVT-----GRCHECRHHRAGPRCQDCERVTVAWVRRPGVTLAATVRSLVACPCAACRCDKCGMKGC---------DGRSGKCICKLGVMGHSCSTCEPGYYGFDSCKGCEPCECAVAALGSQCDPRSGRCRCPP-------SVTGRRCELCQPGYWNY---GPNGCQRCEC--TTGSCDPHSGR 604          

HSP 8 Score: 56.225 bits (134), Expect = 1.213e-7
Identity = 28/60 (46.67%), Postives = 33/60 (55.00%), Query Frame = 2
Query: 3011 CLENVNGDRCEKCVEGYFNYPNCKKCLCSPHALS-ADCDLNNGKCKCGSNVINRICDKCE 3187
            C  NV G RCE C+ G+F YP C+ C C    +S A CD   G+C C  NV  R CD C 
Sbjct:    1 CKPNVGGQRCEHCLPGFFGYPECRPCDCDAAGVSGAGCDAVTGQCLCKENVEGRRCDVCR 60          

HSP 9 Score: 55.8398 bits (133), Expect = 1.764e-7
Identity = 58/211 (27.49%), Postives = 80/211 (37.91%), Query Frame = 2
Query: 4475 KCICNALTFGNHCQNPISGYYKEYFNLPNSTKSGSMRTGNRILIN--LKKCNCNGYSKV-----------CDSVTGDCQNCMGNREGNKCQLC---------REGFYKNDKNYDQCEPCQCPSAHYNFAQNCTRIESSLELKCQCRIGYSGKSCENCQQGFYG-NPIKGIPCKSCDCNQQGSQSLNCNEFGICQCSPGVLGIKCDQCAPNY 5038
            +C+C     G +C+    GY+                 GN ++I    K C CNG +             CD VTG C  C  +R G +CQ C         R G               CP A     +   +       KC C++G  G SC  C+ G+YG +  KG  C+ C+C      S      G C+C P V G +C+ C P Y
Sbjct:  392 ECLCREGYEGKNCERCAPGYF-----------------GNPMVIGSECKACQCNGNAADDGGGPGVPGSSCDPVTGRCHECRHHRAGPRCQDCERVTVAWVRRPGVTLAATVRSLVA---CPCAACRCDKCGMKGCDGRSGKCICKLGVMGHSCSTCEPGYYGFDSCKG--CEPCECAVAALGSQCDPRSGRCRCPPSVTGRRCELCQPGY 580          
BLAST of Laminin subunit alpha-2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009682.1 (pep scaffold:Pmarinus_7.0:GL479835:738:11671:-1 gene:ENSPMAG00000008750.1 transcript:ENSPMAT00000009682.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 144.821 bits (364), Expect = 1.502e-37
Identity = 103/363 (28.37%), Postives = 167/363 (46.01%), Query Frame = 2
Query:  455 QVYQIVYILLKMGDSPRPGNWILER--SLDGEIYMPWIFFAETPYSCYNLFQRQYPDLKLTTNAKPSSLADDEM--FCTTYYSQPKSLNSGEIIISLINGRKSIMNEEYLSIKSVPQTLINFLSARYIRFRFLKHLTLAADLMTHKGYLEQSIYNRYYYSLRNIEIGGKCICNNHADKCDKVIENGISVAKCNCKHNTCGSNCETCCPLFNQRPWKPVAV-----CEECNCNRKSNECSYNQTVATLQLSVNKMGRMEG-GGVCINCQENTEGINCEKCIKGFYRPWNVLATELYPCTPCQCHGLGTIGSCVSNGEDIGDQKPGDCICKKGYEGVNCDLCSIGYERYPNGECLPCPCSIDGSV 1513
            + + I Y+ LK   S RP ++ + +  S+DG    PW  +     SC   + ++        N       DDE    CT  +S    L  G +  S + GR S  N +   +      L +++++  IR    +  T   ++       +  +   YYY++ +  +GG+C CN HA +C   ++N +    C C+HNT G++CE C PL+N RPW          C  C+CN +++EC ++           ++ R  G GG C NC++NT+G  CE+C++ FYR     A+E   C PC C+ +G+              + G C CK+G  G  CD C  G+       C PC C+  G++
Sbjct:    2 KAFDITYVRLKFHTS-RPESFAIYKRASMDG----PWTPYQYYSGSCEPTYGKR--------NRGFLRSGDDEQTPLCTDEFSDISPLTGGNVAFSTLEGRPSAYNFDNSPV------LQDWVTSTEIRVTLNRLNTFGDEVFN-----DHKVLRSYYYAISDFAVGGRCKCNGHASEC---VKNELGALACKCRHNTMGADCEKCLPLYNDRPWHRATSESANECTLCDCNGRADECYFDP----------ELYRATGHGGHCTNCRDNTDGKTCERCLENFYR---RSASEH--CLPCNCNPVGSYSRQC--------DEQGRCSCKQGVMGERCDQCLPGFHSMDEAGCRPCTCNPAGTL 314          

HSP 2 Score: 83.5741 bits (205), Expect = 8.217e-17
Identity = 56/175 (32.00%), Postives = 82/175 (46.86%), Query Frame = 2
Query: 2573 KCLHNTSGVHCDRCIEGYYGNPKKKIS------CKRCKCNNNQESC--DPVT-------GEC-RCSYNTMGTECQLCKHGFYGDALTKSCKKCDCDSLGSTSENCDKLTGKCDCRTNFVNRQCDSCTSGLYLKDKK-CIPCNCEIQGRISSEKFCNTTSGQCFCLENVNGDRCEK 3046
            KC HNT G  C++C+  Y   P  + +      C  C CN   + C  DP         G C  C  NT G  C+ C   FY  + ++ C  C+C+ +GS S  CD+  G+C C+   +  +CD C  G +  D+  C PC C   G +     C   +G+C C +NV G  C++
Sbjct:  167 KCRHNTMGADCEKCLPLYNDRPWHRATSESANECTLCDCNGRADECYFDPELYRATGHGGHCTNCRDNTDGKTCERCLENFYRRSASEHCLPCNCNPVGSYSRQCDE-QGRCSCKQGVMGERCDQCLPGFHSMDEAGCRPCTCNPAGTLED---CQPDTGRCVCKDNVEGYNCDR 337          

HSP 3 Score: 75.485 bits (184), Expect = 3.862e-14
Identity = 63/198 (31.82%), Postives = 92/198 (46.46%), Query Frame = 2
Query: 2660 RCKCNNNQESCDPVTGE-----CRCSYNTMGTECQLCKHGFYGD-----ALTKSCKKCD-CDSLGSTSE--------NCDKLTGKC-DCRTNFVNRQCDSCTSGLYLK--DKKCIPCNCEIQGRISSEKFCNTTSGQCFCLENVNGDRCEKCVEGY--FNYPNCKKCLCSPHALSADCDLNNGKCKCGSNVINRICDK 3181
            RCKCN +   C  V  E     C+C +NTMG +C+ C    Y D     A ++S  +C  CD  G   E              G C +CR N   + C+ C    Y +   + C+PCNC   G  S +  C+   G+C C + V G+RC++C+ G+   +   C+ C C+P     DC  + G+C C  NV    CD+
Sbjct:  146 RCKCNGHASEC--VKNELGALACKCRHNTMGADCEKCLP-LYNDRPWHRATSESANECTLCDCNGRADECYFDPELYRATGHGGHCTNCRDNTDGKTCERCLENFYRRSASEHCLPCNCNPVGSYSRQ--CD-EQGRCSCKQGVMGERCDQCLPGFHSMDEAGCRPCTCNPAGTLEDCQPDTGRCVCKDNVEGYNCDR 337          

HSP 4 Score: 67.781 bits (164), Expect = 1.168e-11
Identity = 57/175 (32.57%), Postives = 76/175 (43.43%), Query Frame = 2
Query: 3281 CKCAQNVARRDCSKC-----DVGYFGLDVTGCKKCPPCY-NGQV------------CNNEGICV-CPPNTIGNLCNKCSEDSWDFNETIGCKKCNCYINGSYSNICNKISGICACKTAFFGSKCDRCNEGYYGF--PNCQPCSCAENGTKSNELTKCDKITGQCQCKQNVIGTKC 3742
            CKC  N    DC KC     D  +         +C  C  NG+               + G C  C  NT G  C +C E+ +  + +  C  CNC   GSYS  C++  G C+CK    G +CD+C  G++      C+PC+C   GT    L  C   TG+C CK NV G  C
Sbjct:  166 CKCRHNTMGADCEKCLPLYNDRPWHRATSESANECTLCDCNGRADECYFDPELYRATGHGGHCTNCRDNTDGKTCERCLENFYRRSASEHCLPCNCNPVGSYSRQCDE-QGRCSCKQGVMGERCDQCLPGFHSMDEAGCRPCTCNPAGT----LEDCQPDTGRCVCKDNVEGYNC 335          

HSP 5 Score: 58.5362 bits (140), Expect = 1.018e-8
Identity = 64/266 (24.06%), Postives = 101/266 (37.97%), Query Frame = 2
Query: 4295 NVINSNLTRDIFMMALLNVTSLKVKLYTDKVNPPLIKIKIITYKVMETTQAIGKRVT-------------AVEKCICNALTFGNHCQNPISGYYKEYFNLPNSTKSGSMRTGNRILINLKKCNCNGYSKVC---------DSVTGDCQNCMGNREGNKCQLCREGFYKNDKNYDQCEPCQC-PSAHYNFAQNCTRIESSLELKCQCRIGYSGKSCENCQQGFYGNPIKGIPCKSCDCNQQGSQSLNCNEFGICQCSPGVLGIKCDQ 5023
            N  NS + +D      + VT  ++  + D+V      ++   Y + +   A+G R                   C C   T G  C+  +  Y    ++   S       + N   +    C+CNG +  C             G C NC  N +G  C+ C E FY+   + + C PC C P   Y  ++ C       + +C C+ G  G+ C+ C  GF+     G  C+ C CN  G+      + G C C   V G  CD+
Sbjct:   94 NFDNSPVLQDWVTSTEIRVTLNRLNTFGDEVFNDHKVLRSYYYAISDF--AVGGRCKCNGHASECVKNELGALACKCRHNTMGADCEKCLPLYNDRPWHRATS------ESANECTL----CDCNGRADECYFDPELYRATGHGGHCTNCRDNTDGKTCERCLENFYRRSAS-EHCLPCNCNPVGSY--SRQCDE-----QGRCSCKQGVMGERCDQCLPGFHSMDEAG--CRPCTCNPAGTLEDCQPDTGRCVCKDNVEGYNCDR 337          

HSP 6 Score: 56.9954 bits (136), Expect = 3.311e-8
Identity = 47/162 (29.01%), Postives = 69/162 (42.59%), Query Frame = 2
Query: 4616 KCNCNGYSKVC--DSVTGDCQNCMGNREGNKCQLC------REGFYKNDKNYDQCEPCQC--PSAHYNFAQNCTRIESSLELKCQCRIGYSGKSCENCQQGFYGNPIKGIPCKSCDCNQQGSQSLNCNEFGICQCSPGVLGIKCDQCAPNY-VVEKKTCQSC 5068
            +C CNG++  C  + +      C  N  G  C+ C      R       ++ ++C  C C   +    F     R          CR    GK+CE C + FY        C  C+CN  GS S  C+E G C C  GV+G +CDQC P +  +++  C+ C
Sbjct:  146 RCKCNGHASECVKNELGALACKCRHNTMGADCEKCLPLYNDRPWHRATSESANECTLCDCNGRADECYFDPELYRATGHGGHCTNCRDNTDGKTCERCLENFYRRSASEH-CLPCNCNPVGSYSRQCDEQGRCSCKQGVMGERCDQCLPGFHSMDEAGCRPC 306          
BLAST of Laminin subunit alpha-2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006618.1 (pep scaffold:Pmarinus_7.0:GL481588:182:19210:1 gene:ENSPMAG00000005955.1 transcript:ENSPMAT00000006618.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 110.153 bits (274), Expect = 4.211e-24
Identity = 83/246 (33.74%), Postives = 112/246 (45.53%), Query Frame = 2
Query: 2441 CASGYYGDAKSKNLNSCKKCPCPR---LDYQMTELCSSYSSENYVCHKCLHNTSGVHCDRCIEGYYGNPK-KKISCKRCKCNNN-----QESCDPVTGEC-RCSYNTMGTECQLCKHGFYGDALT-KSCKKCDCDSLGSTSENC---------DKLTGKCDCRTNFVNRQCDSCTS---GLYLKDKKCIPCNCEIQGRISSEKFCNTTSGQCFCLENVNGDRCEKCVEGYFNYPNCKKCLCSPHAL 3109
            CASGYYG   +     C+ C CP            CS       V   CL   +G  CD+C  G+YG+ +     C+ C+CN N       SCD  TG C RC  +T G+ CQ C+ G+YGDA + + C+KC C + G+   +C         D  +G+C C  N     CD CT    GL  +   C PC C+     S+   C+  +GQC CL    G  C +C E ++  P  K   C  H L
Sbjct:    4 CASGYYGSPGAGE--QCRPCQCPEGPGTGRHFASGCSHDPRSRAVACACLPGFTGARCDQCSPGHYGDLRVAGGRCQPCQCNGNIDPTDAASCDGRTGRCLRCLRDTEGSACQNCRPGYYGDATSQRRCQKCTCVTAGTERSSCGLADGACACDPRSGQCRCLPNVQGLACDRCTPNHWGLS-QGTGCRPCGCDPA--HSAGPSCSEFNGQCHCLPGFGGLTCSECQENHWGEPRVKCSECLTHNL 244          

HSP 2 Score: 90.5077 bits (223), Expect = 5.413e-18
Identity = 66/246 (26.83%), Postives = 98/246 (39.84%), Query Frame = 2
Query: 2405 CTHNTAGAHCEDCASGYYGDAKSKNLNSCKKCPC-PRLDYQMTELCSSYSSENYVCHKCLHNTSGVHCDRCIEGYYGNPKKKISCKRCKC------------NNNQESCDPVTGECRCSYNTMGTECQLCKHGFYGDALTKSCKKCDCDSLGSTSENCDKLTGKCDCRTNFVNRQCDSCTSGLYLKDK-KCIPCNCEIQGRISSEKFCNTTSGQCFCLENVN---GDRCEKCVEGYFN-YPNCKKC 3088
            C     GA C+ C+ G+YGD +      C+ C C   +D      C   +     C +CL +T G  C  C  GYYG+   +  C++C C             +   +CDP +G+CRC  N  G  C  C    +G +    C+ C CD   S   +C +  G+C C   F    C  C    + + + KC  C         +   C      C     V    G RC++C  G+   +P C+ C
Sbjct:   50 CLPGFTGARCDQCSPGHYGDLRVAG-GRCQPCQCNGNIDPTDAASCDGRTGR---CLRCLRDTEGSACQNCRPGYYGDATSQRRCQKCTCVTAGTERSSCGLADGACACDPRSGQCRCLPNVQGLACDRCTPNHWGLSQGTGCRPCGCDPAHSAGPSCSEFNGQCHCLPGFGGLTCSECQENHWGEPRVKCSEC--------LTHNLCMAQLAYCLFRPPVRSETGRRCDRCARGFSGAFPACEPC 283          

HSP 3 Score: 84.3445 bits (207), Expect = 3.597e-16
Identity = 73/252 (28.97%), Postives = 104/252 (41.27%), Query Frame = 2
Query: 2249 CNCPPGFNGLSCESCESGYRRVNNVLYQGQCEACACYNH-----SNTCDSLNGECQNCTHNTAGAHCEDCASGYYGDAKSKNLNSCKKCPCPRLDYQMTELCSSYSSENYVCH--------KCLHNTSGVHCDRCIEGYYGNPKKKISCKRCKCNNNQE---SCDPVTGECRCSYNTMGTECQLCKHGFYGDALTKSCKKCDCDSLGSTSENCDKLTGKCDCR---TNFVNRQCDSCTSGLYLKDKKCIPCN 2947
            C C PGF G  C+ C  G+     V   G+C+ C C  +     + +CD   G C  C  +T G+ C++C  GYYGDA S+    C+KC C     +     SS    +  C         +CL N  G+ CDRC   ++G   +   C+ C C+       SC    G+C C     G  C  C+   +G+   K C +C   +L      C      C  R    +   R+CD C  G       C PC+
Sbjct:   48 CACLPGFTGARCDQCSPGHYGDLRVAG-GRCQPCQCNGNIDPTDAASCDGRTGRCLRCLRDTEGSACQNCRPGYYGDATSQ--RRCQKCTCVTAGTER----SSCGLADGACACDPRSGQCRCLPNVQGLACDRCTPNHWG-LSQGTGCRPCGCDPAHSAGPSCSEFNGQCHCLPGFGGLTCSECQENHWGEPRVK-CSECLTHNL------CMAQLAYCLFRPPVRSETGRRCDRCARGFSGAFPACEPCH 284          

HSP 4 Score: 84.3445 bits (207), Expect = 3.659e-16
Identity = 66/236 (27.97%), Postives = 95/236 (40.25%), Query Frame = 2
Query: 3038 CEKCVEGYFNYPN----CKKCLCSPHALSADCDLNNG----------KCKCGSNVINRICDKCENLHYWNNRT---DCVPCNCGRGSLNP----KCDMETGNC-KCAQNVARRDCSKCDVGYFGLDVTGCKKCPPC--------------YNGQ-VCN-NEGICVCPPNTIGNLCNKCSEDSWDFNETIGCKKCNCYINGSYSNICNKISGICACKTAFFGSKCDRCNEGYYGFPN 3631
            C +C  GY+  P     C+ C C P          +G           C C        CD+C   HY + R     C PC C  G+++P     CD  TG C +C ++     C  C  GY+G D T  ++C  C               +G   C+   G C C PN  G  C++C+ + W  ++  GC+ C C    S    C++ +G C C   F G  C  C E ++G P 
Sbjct:    1 CCRCASGYYGSPGAGEQCRPCQC-PEGPGTGRHFASGCSHDPRSRAVACACLPGFTGARCDQCSPGHYGDLRVAGGRCQPCQCN-GNIDPTDAASCDGRTGRCLRCLRDTEGSACQNCRPGYYG-DATSQRRCQKCTCVTAGTERSSCGLADGACACDPRSGQCRCLPNVQGLACDRCTPNHWGLSQGTGCRPCGCDPAHSAGPSCSEFNGQCHCLPGFGGLTCSECQENHWGEPR 233          

HSP 5 Score: 70.8626 bits (172), Expect = 5.104e-12
Identity = 49/166 (29.52%), Postives = 79/166 (47.59%), Query Frame = 2
Query: 4613 KKCNCNGY-----SKVCDSVTGDCQNCMGNREGNKCQLCREGFYKNDKNYDQCEPCQCPSAHYNFAQNCTRIESS-----LELKCQCRIGYSGKSCENCQQGFYGNPIKGIPCKSCDCNQQGSQSLNCNEF-GICQCSPGVLGIKCDQCAPNYVVEKKT-CQSCYS 5074
            + C CNG      +  CD  TG C  C+ + EG+ CQ CR G+Y +  +  +C+ C C +A    + +C   + +        +C+C     G +C+ C    +G   +G  C+ C C+   S   +C+EF G C C PG  G+ C +C  N+  E +  C  C +
Sbjct:   78 QPCQCNGNIDPTDAASCDGRTGRCLRCLRDTEGSACQNCRPGYYGDATSQRRCQKCTCVTAGTERS-SCGLADGACACDPRSGQCRCLPNVQGLACDRCTPNHWGLS-QGTGCRPCGCDPAHSAGPSCSEFNGQCHCLPGFGGLTCSECQENHWGEPRVKCSECLT 241          

HSP 6 Score: 60.8474 bits (146), Expect = 5.247e-9
Identity = 40/130 (30.77%), Postives = 59/130 (45.38%), Query Frame = 2
Query: 4712 CREGFYKNDKNYDQCEPCQCPSA---HYNFAQNCTRIESSLELKCQCRIGYSGKSCENCQQGFYGN-PIKGIPCKSCDCNQ--QGSQSLNCN-EFGIC-QCSPGVLGIKCDQCAPNY---VVEKKTCQSC 5068
            C  G+Y +    +QC PCQCP       +FA  C+    S  + C C  G++G  C+ C  G YG+  + G  C+ C CN     + + +C+   G C +C     G  C  C P Y      ++ CQ C
Sbjct:    4 CASGYYGSPGAGEQCRPCQCPEGPGTGRHFASGCSHDPRSRAVACACLPGFTGARCDQCSPGHYGDLRVAGGRCQPCQCNGNIDPTDAASCDGRTGRCLRCLRDTEGSACQNCRPGYYGDATSQRRCQKC 133          
BLAST of Laminin subunit alpha-2 vs. Ensembl Nematostella
Match: EDO36523 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SIF3])

HSP 1 Score: 395.586 bits (1015), Expect = 4.545e-112
Identity = 306/1062 (28.81%), Postives = 495/1062 (46.61%), Query Frame = 2
Query:  203 KITSSATCGTGGPEIFCRLVDEIAIQRLINPDSHVLCDVCDNRNETKRHP---IEFAKSDDDNLWWQSPSMAQGLKYQNVNVTIDLKQVYQIVYILLKMGDSPRPGNW-ILERSLDGEIYMPWIFFAETPYSCYNLFQRQYPDLKLTTNAKPSSLADDEMFCTTYYSQPKSLNSGEIIISLINGRKSIMNEEYLSIKSVPQTLINFLSARYIRFRFLKHLTLAADLMTHKGYLEQSIYNRYYYSLRNIEIGGKCICNNHADKCDKV-IENGISVAKCNCKHNTCGSNCETCCPLFNQRPWKPVAV-----CEECNCNRKSNECSYNQTVATLQLSVNKMGRMEG-GGVCINCQENTEGINCEKCIKGFYRPWNVLATELYPCTPCQCHGLGTIGSCVSNGEDIGDQKPGDCICKKGYEGVNCDLCSIGYERYPNGECLPCPCSIDGSVRTSFYRC--KPPCNCKVHVNSDDLCKTCKNGYFNLDSANPEGCEPCYCFGITNQCSSL---SAKNLK---ISDLKGWKLTTFTGEKIALPKFTSFQYLTSENSYIDERFNNPTVYYWTAPPPYLGNWITSYGTIFRYVVKIELQSTLKGSLIDSPDVIIKC-GDFRLFHSVSIEDRRLQRQVFIYIKPTEWKIGKLTPDKAATKEEFISCLVKVDKLLIKAKYYSNQKSIELLNITLSRGEVH--LALDEMPHIEKCNCPPGFNGLSCESCESGY-RRVNNVLYQGQCEACACYNHSNTCDSLNGECQNCTHNTAGAHCEDCASGYYGDAKSKNLNSCKKCPCPRLDYQMTELCSSYSSENYVCHKCLHNTSGVHCDRCIEGYYGNPKKK----ISCKRCKCNNNQE-----SCDPVTGEC-RCSYNTMG---TECQLCKHGFYGDAL---TKSCKKCDCDSLGSTSENCDKLT--------GKCDCRTNFVNRQCDSCTSGLY--LKDKKCIPCNCEIQGRISSEKFCNTTSGQCFCLENVNGDRCEKC-VEGY-FNYPNCKKCLCSPH-ALSADCDLNNGKCKCGSNVINRICDKC-ENLHYWNNRTDCVPC 3229
            ++ S+ TCG   P+ FC     + +++         C++C++ +    HP   I   K D +  WWQS ++ +    + V +T+DL + Y + YI ++   SPRP +  I +++     ++P+ +F+ T    Y +          TTN            CT  +S    L  G +  S +  R    N       + P  L  +++A  +R    +  T   ++     + + ++   YYY++ ++ IGG+C CN HA +C++  + +G +  +C C+H+T G +CE C PL+N RPW   +      C  CNCN  +  C +++ +           R  G GG C NC++NT+G NCE+C + FYR      T L PC  C C+ +G++ S   N E       G C CK G  G+ CD C   Y  +    C PC C   G+   +  +C  K  C CK HV     C  C++GYF L+++NP GC+ C+C+G +  C +    +++N+     + L+GW +    G+      F S   +  E+             +  A   Y+GN  +SYG  F ++ ++    T+ G  +D+ D+ I+  G  ++   ++ +        F   +    +        + T  +F   L  +  + I+  Y    +   +L+       V+   + +++  +E+C+CP  + G +CE C+ GY R+  +     QC  C CY HS+TCD + G+C NC HNT G  C+ C  GYYG+      + CKKCPC     +    C    + N VC  C     G  CD C +GYYG+P  K     +C++C C+ N +     SCD +TG+C +C +NT     ++C+LC  G+YG+A       CK C+C   G+ S      T        G+C C  N    +CD+C    +     K C PCNC+  G  S    C+ T+GQC C   V G RC++C ++ Y F+   C  C C+   +L+  CD   G C+C   V+   CD C EN H  N    C+ C
Sbjct:   43 RVISNNTCGDP-PKKFCVQTGVLEVRKE--------CEMCNSSDPALEHPALKITDIKDDTNRTWWQSETLLENPD-KPVTLTLDLGKSYDVSYIRIRF-RSPRPESMAIYKKTTPSSKWIPYQYFSATCEKTYGV----------TTNGIVDPRNQQVALCTDAFSTITPLTGGNVAFSTLEDRPDAYN-----FDNSP-ALQEWVTAVAVRIHLRRMNTFGDEV-----FGDPNVLRSYYYAIIDLSIGGRCKCNGHASECEETRLWDGQTRLQCKCQHDTEGVDCERCKPLYNDRPWARASSRNANECVRCNCNGLAESCVFDEALY----------RQTGHGGRCQNCKQNTDGPNCERCKENFYR-----KTSLEPCVACGCNPVGSV-SLQCNSE-------GQCRCKPGVTGIKCDKCQANYFGFSQTGCRPCQCFGPGT-DPAKTQCNEKGECTCKRHVVGAK-CTLCRSGYFGLEASNPHGCKQCFCYGHSTVCKAAPGYTSRNITTDFTTGLEGWAVENDQGDSAG---FVSVTAIGKES------------LFARASLVYIGNRRSSYGQTFGFMFRV---GTVDGMQVDNGDITIEGEGGLKITTQLTAQGNPKPGVAFQQYRYRLHEDASFGWRPSLTSHDFQRLLTSIKSIKIRMNYAD--QGTGMLDGMFFESAVYDPTSPNQVNWVEQCSCPKEYKGNNCEQCKDGYTRQAGSTDRYAQCVPCQCYGHSDTCDPVTGKC-NCKHNTTGIRCDKCIDGYYGNPTQGTPDDCKKCPC-----KFGTRCIQIGA-NVVCTDCPEGHVGNLCDMCQDGYYGDPMGKRGAPTTCQKCNCSGNIDPNAIGSCDRLTGDCLKCIHNTRNGPISQCELCAIGYYGNATHYPKPQCKACECYVQGTVSPPGHDPTLPFPCDDKGRCTCLPNVSGDKCDTCRPEYWNVASGKGCEPCNCDTTG--SWNNTCSVTTGQCHCKPGVTGRRCDQCSIDHYAFSELGCLACNCNLQGSLNVTCD-EQGVCQCRPGVLGIKCDSCQENFH--NLTAGCIAC 1015          

HSP 2 Score: 141.354 bits (355), Expect = 3.972e-33
Identity = 117/412 (28.40%), Postives = 182/412 (44.17%), Query Frame = 2
Query: 2825 TSENCDKLTGKCDCRTNFVNRQCDSCTSGLYLKD------KKCIPCNCEIQGRISSEKFCNTTSGQCFCLENVNGDRCEKCVEGYFNYP------NCKKCLCSPHALSADCDLNNGKCKCGSNVINRICDKCENLHYWNNR------TDCVPCNCGRGSLNP----KCDMETGNC-KCAQNVARRDCSKCD---VGYFG----LDVTGCKKC---------PPCYNGQV---CNNEGICVCPPNTIGNLCNKCSEDSWDFNETIGCKKCNCYINGSYSNICNKISGICACKTAFFGSKCDRCNEGYYGFP--NCQPCSCAENGTKSNELTKCDKITGQCQCKQNVIGTKCKVCRKGTFPSDGTYEGGCFSC-FCFGVSEKCHAILNHRIVENSIYEYHIFDEKNSLESGKDY 3925
            TS N      +C C   +    C+ C  G   +        +C+PC C           C+  +G+C C  N  G RC+KC++GY+  P      +CKKC C           N     C    +  +CD C++ +Y +        T C  CNC  G+++P     CD  TG+C KC  N      S+C+   +GY+G         CK C         PP ++  +   C+++G C C PN  G+ C+ C  + W+     GC+ CNC   GS++N C+  +G C CK    G +CD+C+  +Y F    C  C+C   G+ +     CD+  G CQC+  V+G KC  C++           GC +C  C+ V +K    L  ++ +  IY    F+  +S+    D+
Sbjct:  659 TSPNQVNWVEQCSCPKEYKGNNCEQCKDGYTRQAGSTDRYAQCVPCQC-----YGHSDTCDPVTGKCNCKHNTTGIRCDKCIDGYYGNPTQGTPDDCKKCPCKFGTRCIQIGANVVCTDCPEGHVGNLCDMCQDGYYGDPMGKRGAPTTCQKCNCS-GNIDPNAIGSCDRLTGDCLKCIHNTRNGPISQCELCAIGYYGNATHYPKPQCKACECYVQGTVSPPGHDPTLPFPCDDKGRCTCLPNVSGDKCDTCRPEYWNVASGKGCEPCNCDTTGSWNNTCSVTTGQCHCKPGVTGRRCDQCSIDHYAFSELGCLACNCNLQGSLN---VTCDE-QGVCQCRPGVLGIKCDSCQENFH----NLTAGCIACPPCYDVIQKIVGGLRRKLYD-LIYIIDRFNTSSSVVVDVDF 1055          

HSP 3 Score: 140.198 bits (352), Expect = 8.920e-33
Identity = 141/536 (26.31%), Postives = 223/536 (41.60%), Query Frame = 2
Query: 3419 CPPNTIGNLCNKCSEDSWDFNETIGCKKCNCYINGSYSNICNKISGICACKTAFFGSKCDRCNEGYYGFPN--CQPCSCAENGTKSNELTKCDKITGQCQCKQNVIGTKCKVCRKGTFPSDGTYEGGCFSCFCFGVSEKCHAILNHRIVENSIYEYHIFDEKNSLESGKDYSTIHLNANYPRRF-GWPLTMFRPIYVNVMKLFNSHDLSLFYRSIFMNVSVDCLDNKCGREIPEQTEVFMESYNGLFGMRYXXXXXXXXXXXXXXDFNEHSKNGK----WVISQYQNDILDKFIILEDSNV-INSNLTRDIFMMALLNVTSLKVKLYTDKVNPPLIKIKIITYKVMETTQAIGKRVTAVEKCICNALTFGNHCQNPISGYYKEYFNLPNSTKSGSMRTGNRILINLKKCNCNGYSKVCDSVTGDCQNCMGNREGNKCQLCREGFYKN--DKNYDQCEPCQCPSAHYNFAQNCTRIESSLELKCQCRIGYSGKSCENCQQGFYGNPI--KGIP--CKSCDCNQQGSQSLNCNEFGIC 4984
            C  NT G  C +C E+ +       C  C C   GS S  CN   G C CK    G KCD+C   Y+GF    C+PC C   GT   + T+C++  G+C CK++V+G KC +CR G F  + +   GC  CFC+G S  C A                            Y++ ++  ++     GW +   +      + +      SLF R+  + +      N+  R    QT  FM     + GM+             +    + +  G         QY      ++ + ED++     +LT   F   L ++ S+K+++        ++        V + T     +V  VE+C C     GN+C+    GY ++         +GS     + +     C C G+S  CD VTG C NC  N  G +C  C +G+Y N      D C+ C C      F   C +I +++ +   C  G+ G  C+ CQ G+YG+P+  +G P  C+ C+C    S +++ N  G C
Sbjct:  352 CKQNTDGPNCERCKENFYRKTSLEPCVACGCNPVGSVSLQCNS-EGQCRCKPGVTGIKCDKCQANYFGFSQTGCRPCQCFGPGTDPAK-TQCNE-KGECTCKRHVVGAKCTLCRSGYFGLEASNPHGCKQCFCYGHSTVCKA-------------------------APGYTSRNITTDFTTGLEGWAVENDQGDSAGFVSVTAIGKESLFARASLVYIG-----NR--RSSYGQTFGFMFRVGTVDGMQVDNGDITIEGEGGLKITTQLTAQGNPKPGVAFQQY------RYRLHEDASFGWRPSLTSHDFQRLLTSIKSIKIRMNYADQGTGMLDGMFFESAVYDPTSP--NQVNWVEQCSCPKEYKGNNCEQCKDGYTRQ---------AGSTDRYAQCV----PCQCYGHSDTCDPVTGKC-NCKHNTTGIRCDKCIDGYYGNPTQGTPDDCKKCPC-----KFGTRCIQIGANV-VCTDCPEGHVGNLCDMCQDGYYGDPMGKRGAPTTCQKCNC----SGNIDPNAIGSC 820          

HSP 4 Score: 131.724 bits (330), Expect = 3.690e-30
Identity = 112/349 (32.09%), Postives = 150/349 (42.98%), Query Frame = 2
Query: 2576 CLHNTSGVHCDRCIEGY---YGNPKKKISCKRCKCNNNQESCDPVTGECRCSYNTMGTECQLCKHGFYGDALTKS---CKKCDCDSLGSTSENCDKLTGKCDCRTNFVNRQCDSCTSGLY-------LKDKKCIPCNCEIQGRISSEKFCNTTSGQCF-CLENV-NG--DRCEKCVEGYFN------YPNCKKCLC------SPHA----LSADCDLNNGKCKCGSNVINRICDKCENLHYWN--NRTDCVPCNCG-RGSLNPKCDMETGNCKCAQNVARRDCSKCDVGYFGLDVTGCKKCPPCYNGQV---CNNEGICVCPPNTIGNLCNKCSEDSWDFNETIGCKKC 3505
            C     G +C++C +GY    G+  +   C  C+C  + ++CDPVTG+C C +NT G  C  C  G+YG+    +   CKKC C   G+            DC    V   CD C  G Y            C  CNC      ++   C+  +G C  C+ N  NG   +CE C  GY+        P CK C C      SP      L   CD + G+C C  NV    CD C    YWN  +   C PCNC   GS N  C + TG C C   V  R C +C + ++     GC  C     G +   C+ +G+C C P  +G  C+ C E+    N T GC  C
Sbjct:  672 CPKEYKGNNCEQCKDGYTRQAGSTDRYAQCVPCQCYGHSDTCDPVTGKCNCKHNTTGIRCDKCIDGYYGNPTQGTPDDCKKCPC-KFGTRCIQIGANVVCTDCPEGHVGNLCDMCQDGYYGDPMGKRGAPTTCQKCNCSGNIDPNAIGSCDRLTGDCLKCIHNTRNGPISQCELCAIGYYGNATHYPKPQCKACECYVQGTVSPPGHDPTLPFPCD-DKGRCTCLPNVSGDKCDTCRP-EYWNVASGKGCEPCNCDTTGSWNNTCSVTTGQCHCKPGVTGRRCDQCSIDHYAFSELGCLACNCNLQGSLNVTCDEQGVCQCRPGVLGIKCDSCQENF--HNLTAGCIAC 1015          

HSP 5 Score: 82.8037 bits (203), Expect = 2.228e-15
Identity = 60/200 (30.00%), Postives = 95/200 (47.50%), Query Frame = 2
Query: 4676 CMGNREGNKCQLCREGFYKNDKNYDQCEPCQCPSAHYNFAQNCTRIESSLELKCQCRIGYSGKSCENCQQGFYGNPIKGIPCKSCDCNQQGSQSLNCNEFGICQCSPGVLGIKCDQCAPNY---VVEKKTCQSCYSGCTK----------DLLVRIDTLNET---VINFKWKTLPSTLDLRLNKINISIQMSSELLNSIN 5227
            C+ N  G+KC  CR  ++ N  +   CEPC C +   ++   C    S    +C C+ G +G+ C+ C    Y      + C +C+CN QGS ++ C+E G+CQC PGVLGIKCD C  N+         C  CY    K          DL+  ID  N +   V++  ++   + L  ++ ++    + S +   S+N
Sbjct:  893 CLPNVSGDKCDTCRPEYW-NVASGKGCEPCNCDTTG-SWNNTC----SVTTGQCHCKPGVTGRRCDQCSIDHYA--FSELGCLACNCNLQGSLNVTCDEQGVCQCRPGVLGIKCDSCQENFHNLTAGCIACPPCYDVIQKIVGGLRRKLYDLIYIIDRFNTSSSVVVDVDFEKRLALLKEQVERLLGQSRRSQQYRQSLN 1084          

HSP 6 Score: 73.9442 bits (180), Expect = 1.106e-12
Identity = 64/204 (31.37%), Postives = 94/204 (46.08%), Query Frame = 2
Query: 4523 ISGYYKEYFNLPNSTKSGSMRTGNRILINLK---KCNCNGYSKVCDSVT-GDCQN-----CMGNREGNKCQLC------REGFYKNDKNYDQCEPCQCPSAHYNFAQNCTRIESSLEL-----KCQ-CRIGYSGKSCENCQQGFYGNPIKGIPCKSCDCNQQGSQSLNCNEFGICQCSPGVLGIKCDQCAPNYVVEKKT-CQSC 5068
            ++ +  E F  PN      +R+    +I+L    +C CNG++  C+     D Q      C  + EG  C+ C      R     + +N ++C  C C       A++C   E+         +CQ C+    G +CE C++ FY       PC +C CN  GS SL CN  G C+C PGV GIKCD+C  NY    +T C+ C
Sbjct:  234 MNTFGDEVFGDPNV-----LRSYYYAIIDLSIGGRCKCNGHASECEETRLWDGQTRLQCKCQHDTEGVDCERCKPLYNDRPWARASSRNANECVRCNC----NGLAESCVFDEALYRQTGHGGRCQNCKQNTDGPNCERCKENFY-RKTSLEPCVACGCNPVGSVSLQCNSEGQCRCKPGVTGIKCDKCQANYFGFSQTGCRPC 427          

HSP 7 Score: 70.4774 bits (171), Expect = 1.367e-11
Identity = 67/259 (25.87%), Postives = 112/259 (43.24%), Query Frame = 2
Query: 2660 RCKCNNNQESCDPVTG-------ECRCSYNTMGTECQLCKHGFYGDALTKSCKKCDCDSLGSTSENCDKLTGKCDCRTNFVNRQCDSCTSGLYLKDKKCIPCNCE--IQGRISSEKFCNTTS--GQCF-CLENVNGDRCEKCVEGYFNYPN---CKKCLCSP-HALSADCDLNNGKCKCGSNVINRICDKCENLHYWNNRTDCVPCNCGRGSLNP---KCDMETGNCKCAQNVARRDCSKCDVGYFGLDVT---GCKKC 3370
            RCKCN +   C+           +C+C ++T G +C+ CK  +      ++           +S N ++                             C+ CNC    +  +  E     T   G+C  C +N +G  CE+C E ++   +   C  C C+P  ++S  C+ + G+C+C   V    CDKC+  ++  ++T C PC C     +P   +C+ E G C C ++V    C+ C  GYFGL+ +   GCK+C
Sbjct:  263 RCKCNGHASECEETRLWDGQTRLQCKCQHDTEGVDCERCKPLYNDRPWARA-----------SSRNANE-----------------------------CVRCNCNGLAESCVFDEALYRQTGHGGRCQNCKQNTDGPNCERCKENFYRKTSLEPCVACGCNPVGSVSLQCN-SEGQCRCKPGVTGIKCDKCQANYFGFSQTGCRPCQCFGPGTDPAKTQCN-EKGECTCKRHVVGAKCTLCRSGYFGLEASNPHGCKQC 479          

HSP 8 Score: 68.1662 bits (165), Expect = 7.407e-11
Identity = 47/152 (30.92%), Postives = 69/152 (45.39%), Query Frame = 2
Query: 4616 KCNCNGYSKVC---------DSVTGDCQNCMGNREGNKCQLCREGFYKNDKNYDQCEPCQCPSAHYNFAQNCTRIESSLELKCQCRIGYSGKSCENCQQGFYGNPIKGIPCKSCDCNQQGSQ--SLNCNEFGICQCSPGVLGIKCDQCAPNY 5038
            +CNCNG ++ C             G CQNC  N +G  C+ C+E FY+   + + C  C C             ++ + E +C+C+ G +G  C+ CQ  ++G    G  C+ C C   G+      CNE G C C   V+G KC  C   Y
Sbjct:  323 RCNCNGLAESCVFDEALYRQTGHGGRCQNCKQNTDGPNCERCKENFYRK-TSLEPCVACGCNPV------GSVSLQCNSEGQCRCKPGVTGIKCDKCQANYFGFSQTG--CRPCQCFGPGTDPAKTQCNEKGECTCKRHVVGAKCTLCRSGY 465          

HSP 9 Score: 61.2326 bits (147), Expect = 8.077e-9
Identity = 45/145 (31.03%), Postives = 67/145 (46.21%), Query Frame = 2
Query: 4673 NCMGNREGNKCQLCREGFYK---NDKNYDQCEPCQCPSAHYNFAQNCTRIESSLELKCQCRIGYSGKSCENCQQGFYGNPIKGIP--CKSCDCNQQGSQSLNCNEFGIC-QCSPGVLGIKCDQCAPNYVVE-------KKTCQSC 5068
            +C    +GN C+ C++G+ +   +   Y QC PCQC    Y  +  C  +      KC C+   +G  C+ C  G+YGNP +G P  CK C C + G++ +      +C  C  G +G  CD C   Y  +         TCQ C
Sbjct:  671 SCPKEYKGNNCEQCKDGYTRQAGSTDRYAQCVPCQC----YGHSDTCDPVTG----KCNCKHNTTGIRCDKCIDGYYGNPTQGTPDDCKKCPC-KFGTRCIQIGANVVCTDCPEGHVGNLCDMCQDGYYGDPMGKRGAPTTCQKC 806          
BLAST of Laminin subunit alpha-2 vs. Ensembl Nematostella
Match: EDO39502 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S9X8])

HSP 1 Score: 293.508 bits (750), Expect = 1.704e-79
Identity = 319/1205 (26.47%), Postives = 498/1205 (41.33%), Query Frame = 2
Query:  179 DGLLMENAKITSSATCGTGGPEIFCRLVDEIAIQRLINPDSHVLCDVCDNR----NETKRHPIEFAKSDDD----NLWWQSPSMAQGLKYQNVNVTIDLKQVYQIVYILLKMGDSPRPGNWILERSLD-GEIYMPWIFFAETPYSCYNLFQRQYPDLKLTTNAKPSSLADDEMFCTTYYSQPKSLNSGEIIISLINGRKSIMNEEYLSIKSVPQTLINFLSARYIRFRFLKHLTLAADLMTHKGYLEQSIYNRYYYSLRNIEIGGKCICNNHADKC----DKVIENGISVAKCNCKHNTCGSNCETCCPLFNQRPWKPVAV-----CEECNCNRKSNECSYNQTVATLQLSVNKMGRMEGGGVCINCQENTEGINCEKCIKGFYRPWNVLATELYPCTPCQCHGLGTI--GSCVSNGEDIGDQKPGDCICKKGYEGVNCDLCSIGY----ERYPNGECLPCPCSIDGSVRTSFYRCKPP---CNCKVHVNSDDLCKTCKNGYFNLDSANPEGCEPCYC---FGITNQCSSLSAKNLKISDLKGWKLTTF-TGEKIALPKFTSFQYLTSENSYIDE----RFNNPTVYYWTAPPPYLGNWITSYGTIFRYVVKIELQSTLKGSLI--DSPDVIIKCGDFRLFHSVSIED---------RRLQ------RQVFIYIKPTEWKIGKLTPDKAATKEEFISCLVKVDKLLIKAKYYSNQKSIELLNITLSRGEVHLALDEMPHIEKCNCPPGFNGLSC---------------ESCESGYRRVNNVLYQGQCEACAC--------YNHSNTCDSLNGECQNCTHNTAGAHCEDCASGYYGDAKSKNLNSCKKCPCPRLDYQMTELCSSYSSENYVCHKCLHNTSGVHCDRCIEGYYGNPKKKISCKRCKCNNNQESCDPVTGEC-RCSYNTMGTECQLCKHGFYGDALTKS---CKKCDCDSLGST---SENCDKLTGK------CD-CRTNFVNRQCDSCTSGLY----LKDKKCIPCNCEIQGRISSEKFCNTTSGQCF-CLENVNGDRCEKCVEGYFN---YPNCKKCLCSPHALSA----DCDLNNGKCKCGSNVINRICDKCENLHYWN--NRTDCVPCN-CGRGSLNPKCDMETGNCKCAQNVARRDCSKCDVGYFGLDVTGCKKCPPCYNGQV---CNNE-GICVCPPNTIGNLCNKCSEDS 3469
            D L+    KI +S+TCG  GPE +C +          N   +  C +CD+R    N    H  ++  S  D    + WWQS +       +NV + +DL+  +   +++++   + RP   ++ERS D G+ +  + +F+     C  +F    P +      +P  +  D++ CT  YS  +   +GE+I   +  +  I N     ++       N L    IR  F K  TL  DL+  +      I  +YYY++ ++ I G C C  HA++C     +    G+   +CNC HNT G NCE C   +   PW+P        C +CNCN  + +C ++  V     +V+       GGVC +C+ NT G NCE+C    Y+  +   ++   C  C C   G +  G C +  +       G CICK+   GV CD C  G+       P+G C  C C+  G++      C P    C CK +V  +D C  C + Y+ L S+ P GC  C C       NQC   + +      + G +     TG    LP    ++   +    + E     +       WT      G    + GT   Y +     S     L+  ++ D     G +R    +S  D         RR        R V I + P+   +    PD     E+ +S  ++V    ++    + + SI   +I L    V  ++D     E       F+   C               + C+     +++V+Y G   AC C         N +  CD + G+C+ C  N  G  C+ CA G +G +       C  C C R+   +   C+  + +     +C +  SG  C  C    +G P     C+ C+C  +  SC+P TG C  C +NT+G  C+ C  GFYG A   +   CK+C C    S    SE+C   T        CD C+  +  RQC+ C  G Y    +    C PC+C      +    C+  +G C  CL N  G  CE+C  GYF      NC  C+C     +      C+   G+C C  +V  + CD+C    +WN  +   C  C+ C  GSL   C+  TG C+C        C +C+  ++G    GC  C     G V   C+ + G C+C    IG+ C+ C+ D+
Sbjct:   29 DLLVGRENKIYASSTCGLRGPEEYCVVS---------NLQDYGDCHICDSRPYQTNPQFSHVPKYMLSSFDGRKKDEWWQSEN-----GRENVYLQLDLESEFHFTHLIMRF-RTFRPAGMVIERSWDYGKKWQIYRYFSA---DCDKIF----PGI---PKGEPKDI--DDVICTNKYSTVEPSTNGEVIFRALKSQIPIKNAYSSKVQ-------NLLKITNIRINFTKLHTLGDDLLDPR----PEIKRKYYYAVYDLVIRGSCSCYGHAEQCLPEPGQPTTPGMVYGRCNCTHNTTGKNCERCQDGYFDVPWRPADADNPNECRKCNCNGHAVKCRFDPAVYQASGNVS-------GGVCQDCEHNTVGRNCERCKPLHYQDPSKKFSDPDACIACNCDPTGGVNGGECEAKNDPAAGLVAGRCICKRNVGGVRCDRCKAGFFNLTTDNPDG-CKACGCNPLGTI----GECNPDTGRCTCKRYVEGED-CDRCASEYWGL-SSTPAGCSNCACDVGGSYDNQCDKQTGQCRCRKGITGRQCERVKTGNYYPLPDHLIYESEEARAVGVSEVARQEYPKNGAATWTGD----GLLDVADGTAVVYSITNIPNSGFYTPLLRYETKDA----GQWRAVVQISRPDGKPLTTGACRRPSGRDEYYRNVTIALNPSRRYV--TLPDDVCL-EKGVSYDIRV--RFVRDPVSNTRDSIFTDSIVLL--PVPGSVDIFQGSEGAKRQAQFDLYQCLDYHLAASQPRPKLSDVCKKLIFSMSSVIYDGAV-ACNCDPKGTQRDANGTLVCDPIGGQCK-CKSNVIGQRCDRCAPGSFGFSNK----GCSACDCDRIG-AIDNFCNILTGQ----CQCRNWASGRQCSLCPPNMWGFP----LCRPCRCYGHASSCNPKTGVCVDCQHNTVGKNCEACAVGFYGIATKGTPNDCKRCQCPGGSSGNKFSESCYVDTSTTPPSVLCDKCQVGYTGRQCEECADGYYGNPLVPGGSCKPCSCNNNIDPTVSGNCDRLTGSCLQCLYNTAGFNCERCKPGYFGDAIARNCTSCVCDKKGTNPGFHYSCNHKTGQCNCLPDVEGKQCDRCAE-GFWNLSSGKGCQQCDCCIEGSLRSMCNQITGQCQCKAGFGGPRCCECEDNFWGSPPDGCSACNCNPAGSVHLQCDRDTGKCLCKVGHIGDKCDMCAADT 1150          

HSP 2 Score: 184.111 bits (466), Expect = 4.340e-46
Identity = 132/393 (33.59%), Postives = 190/393 (48.35%), Query Frame = 2
Query: 2690 CDPVTGECRCSYNTMGTECQLCKHGFYGDALTKSCKKCDCDSLGSTSENCDKLTGKCDCRTNFVNRQCDSCTSGLYLKDKKCIPCNCEIQGRISSEKFCNTTSGQCF-CLENVNGDRCEKCVEGYFNY-----PN-CKKCLC----SPHALSADCDLNNGKC-------KCGSNVINRICDKCENLHYWNNRT---DCVPCNCGRG---SLNPKCDMETGNC-KCAQNVARRDCSKCDVGYFGLDV----TGC----KKCPPCYNGQVCNNEGICVCPPNTIGNLCNKCSEDSWDFNETIGCKKCNCYINGSYSNICNKISGICACKTAFFGSKCDRCNEGYYGFP--NCQPCSCAENGTKSNELTKCDKITGQCQCKQNVIGTKCKVCRKGT 3763
            CDP+ G+C+C  N +G  C  C  G +G +  K C  CDCD +G+    C+ LTG+C CR     RQC  C   ++     C PC C   G  SS   CN  +G C  C  N  G  CE C  G++       PN CK+C C    S +  S  C ++           KC      R C++C + +Y N       C PC+C      +++  CD  TG+C +C  N A  +C +C  GYFG  +    T C    K   P ++    +  G C C P+  G  C++C+E  W+ +   GC++C+C I GS  ++CN+I+G C CK  F G +C  C + ++G P   C  C+C   G+      +CD+ TG+C CK   IG KC +C   T
Sbjct:  768 CDPIGGQCKCKSNVIGQRCDRCAPGSFGFS-NKGCSACDCDRIGAIDNFCNILTGQCQCRNWASGRQCSLCPPNMW-GFPLCRPCRC--YGHASS---CNPKTGVCVDCQHNTVGKNCEACAVGFYGIATKGTPNDCKRCQCPGGSSGNKFSESCYVDTSTTPPSVLCDKCQVGYTGRQCEECADGYYGNPLVPGGSCKPCSCNNNIDPTVSGNCDRLTGSCLQCLYNTAGFNCERCKPGYFGDAIARNCTSCVCDKKGTNPGFHYSCNHKTGQCNCLPDVEGKQCDRCAEGFWNLSSGKGCQQCDCCIEGSLRSMCNQITGQCQCKAGFGGPRCCECEDNFWGSPPDGCSACNCNPAGSVH---LQCDRDTGKCLCKVGHIGDKCDMCAADT 1150          

HSP 3 Score: 123.25 bits (308), Expect = 1.390e-27
Identity = 83/241 (34.44%), Postives = 120/241 (49.79%), Query Frame = 2
Query: 2255 CPPGFNGLSCESCESGYRRVNNVLYQGQCEACACYNH-----SNTCDSLNGECQNCTHNTAGAHCEDCASGYYGDAKSKNLNSC---KKCPCPRLDYQMTELCSSYSSENYVCHKCLHNTSGVHCDRCIEGYYGNPKKKISCKRCKC---NNNQESCDPVTGECRCSYNTMGTECQLCKHGFYGDALTKSCKKCDCDSLGSTSENCDKLTGKCDCRTNFVNRQCDSCTSGLYLKDKKCIPC 2944
            C  G+ G  CE C  GY   N ++  G C+ C+C N+     S  CD L G C  C +NTAG +CE C  GY+GDA ++N  SC   KK   P   Y     C+  + +   C+ CL +  G  CDRC EG++ N      C++C C    + +  C+ +TG+C+C     G  C  C+  F+G +    C  C+C+  GS    CD+ TGKC C+   +  +CD C +    K  +C  C
Sbjct:  931 CQVGYTGRQCEECADGYYG-NPLVPGGSCKPCSCNNNIDPTVSGNCDRLTGSCLQCLYNTAGFNCERCKPGYFGDAIARNCTSCVCDKKGTNPGFHYS----CNHKTGQ---CN-CLPDVEGKQCDRCAEGFW-NLSSGKGCQQCDCCIEGSLRSMCNQITGQCQCKAGFGGPRCCECEDNFWG-SPPDGCSACNCNPAGSVHLQCDRDTGKCLCKVGHIGDKCDMCAADTSGKMPQCEIC 1160          

HSP 4 Score: 117.857 bits (294), Expect = 5.631e-26
Identity = 80/255 (31.37%), Postives = 118/255 (46.27%), Query Frame = 2
Query: 2999 GQCFCLENVNGDRCEKCVEGYFNYP----------NCKKCLCSPHAL---------SADCDLNNGKCK-CGSNVINRICDKCENLHY------WNNRTDCVPCNCG-RGSLN---------PKCDMETGNCKCAQNVARRDCSKCDVGYFGLDVT---GCKKC---PPCYNGQVCNNEGICVCPPNTIGNLCNKCSEDSWDFNET-IGCKKCNCYINGSYSNICNKISGICACKTAFFGSKCDRCNEG-YYGFPN 3631
            G+C C  N  G  CE+C +GYF+ P           C+KC C+ HA+          A  +++ G C+ C  N + R C++C+ LHY      +++   C+ CNC   G +N         P   +  G C C +NV    C +C  G+F L      GCK C   P    G+   + G C C     G  C++C+ + W  + T  GC  C C + GSY N C+K +G C C+    G +C+R   G YY  P+
Sbjct:  281 GRCNCTHNTTGKNCERCQDGYFDVPWRPADADNPNECRKCNCNGHAVKCRFDPAVYQASGNVSGGVCQDCEHNTVGRNCERCKPLHYQDPSKKFSDPDACIACNCDPTGGVNGGECEAKNDPAAGLVAGRCICKRNVGGVRCDRCKAGFFNLTTDNPDGCKACGCNPLGTIGECNPDTGRCTCKRYVEGEDCDRCASEYWGLSSTPAGCSNCACDVGGSYDNQCDKQTGQCRCRKGITGRQCERVKTGNYYPLPD 535          

HSP 5 Score: 91.2781 bits (225), Expect = 7.291e-18
Identity = 131/603 (21.72%), Postives = 235/603 (38.97%), Query Frame = 2
Query: 4589 GNRILINLKKCNCN------GYSKVCDSVTGDCQNCMGNREGNKCQLCREGFYKNDKNYDQCEPCQCPSAHYNFAQNCTRIESSLELKCQCRIGYSGKSCENCQQGFYGNPIKGIPCKSCDCNQQGSQSLNCN-EFGICQCSPGVLGIKCDQCAPNYVVEKKTCQSC----------YSGCTKDLLVRID-----TLNETVINFKWKT-----------LPSTLDLRLNKINISIQMSSELLNSINKFYKLKNEIKNFSIQFQKMKDDAKEKYGEIEKLKTRYNKVLE---------------DLRSTFTDINE----TISGHEQLGISNELIKNATAYLETIKNIYKEMPNITLAASV----LKDVLKYVD-------ELNQIIKYTQS-----------------------HIQSDQINNLKILKNKTIMAD-EINTNNKEYLNTMSTKKKEHELYIILINERMKDLQKIFRKMTKQRDNLRKKIQKLDAISKSFQD------------------EKDLISINVREIEDLMKNLSS-NHLVSKS---LIIPDTLKKHVEQQLNKS---SNLIKKLTKDFNFLHNAEQ-AKEAYSNITRDIL 6058
            G+ I  N   C C+      G+   C+  TG C NC+ + EG +C  C EGF+ N  +   C+ C C     +    C +I      +CQC+ G+ G  C  C+  F+G+P  G  C +C+CN  GS  L C+ + G C C  G +G KCD CA +   +   C+ C              ++++  +ID     TL  T   + +             +   LD +  K N +  + +EL  +  +  ++K      + +         +   EI +L+   N +L+               ++R  F  I E    +    +++  S + I  AT   + I+      P+     +     L D++K ++       ELN I+  T +                       ++  D +   K  ++   M + + N   KE +                I++ M D Q   +  TK+ D L K I  L+ +++ F D                    D I+   ++I +  K+L+  + ++ K+   L   + LK+  E+   K+   S++I+ +T   +   N +Q AK+A      DI+
Sbjct: 1003 GDAIARNCTSCVCDKKGTNPGFHYSCNHKTGQC-NCLPDVEGKQCDRCAEGFW-NLSSGKGCQQCDC-CIEGSLRSMCNQITG----QCQCKAGFGGPRCCECEDNFWGSPPDG--CSACNCNPAGSVHLQCDRDTGKCLCKVGHIGDKCDMCAADTSGKMPQCEICGECYYQWKATLGFLSRNVTYQIDRAANLTLKTTGGAYAYDKELKELEEKLKRVQKILDAQKTKENDTKMIEAELDAATKRLREIKENTDRIANEVNSTAVKTHQANDEIARLRKLLNDLLQKADQMKNDILSVRDTNIRGAFEGIKENQRRSREAEKRVNGSLDSIDRATKNRKKIQMTLDGPPSFNQTHTKNQVDLGDLMKRIEELKRNSVELNGIVCGTPASKCGECTATNCSVCGGPGCNGTRNLAQDAVKRAKEAEDAQRMREAKANMTLKETMEAEMMVNMSRTAAETAISKAM-DAQMRAQNATKRMDQLIKDI--LEFLAQPFPDIDMSRMLANKVLNMTLSVSPDQITKLAQDIREAWKSLTGVDEILEKTKQNLTRAEDLKRRAEEAREKALTVSDVIQNVTDALDMAANGQQLAKDAIQLAEDDIV 1593          

HSP 6 Score: 84.3445 bits (207), Expect = 8.862e-16
Identity = 58/166 (34.94%), Postives = 83/166 (50.00%), Query Frame = 2
Query: 4613 KKCNCNGYSKVCDSVTGDCQNCMGNREGNKCQLCREGFY--KNDKNYDQCEPCQCP--SAHYNFAQNC---TRIESSLELKCQCRIGYSGKSCENCQQGFYGNP-IKGIPCKSCDCNQ--QGSQSLNCNEF-GIC-QCSPGVLGIKCDQCAPNYVVE--KKTCQSC 5068
            + C C G++  C+  TG C +C  N  G  C+ C  GFY        + C+ CQCP  S+   F+++C   T       L  +C++GY+G+ CE C  G+YGNP + G  CK C CN     + S NC+   G C QC     G  C++C P Y  +   + C SC
Sbjct:  848 RPCRCYGHASSCNPKTGVCVDCQHNTVGKNCEACAVGFYGIATKGTPNDCKRCQCPGGSSGNKFSESCYVDTSTTPPSVLCDKCQVGYTGRQCEECADGYYGNPLVPGGSCKPCSCNNNIDPTVSGNCDRLTGSCLQCLYNTAGFNCERCKPGYFGDAIARNCTSC 1013          

HSP 7 Score: 65.4698 bits (158), Expect = 4.456e-10
Identity = 60/202 (29.70%), Postives = 83/202 (41.09%), Query Frame = 2
Query: 3260 CDMETGNCKCAQNVARRDCSKCDVGYFGLDVTGCKKCPPCYNGQVCNN----EGICVCPPNTIGNLCNKCSEDSWDFNETIGCKKCNCYINGSYSNICNKISGICA-CKTAFFGSKCDRCNEGYYGF-----PN-CQPCSC--AENGTKSNELTKCDKITGQC-----QCKQNVIGTKCKVCRKGTFPSDGTYEGGCFSCFC 3811
            CD   G CKC  NV  + C +C  G FG    GC  C     G + N      G C C     G  C+ C  + W F     C+ C CY    +++ CN  +G+C  C+    G  C+ C  G+YG      PN C+ C C    +G K +E    D  T        +C+    G +C+ C  G + +     G C  C C
Sbjct:  768 CDPIGGQCKCKSNVIGQRCDRCAPGSFGFSNKGCSACDCDRIGAIDNFCNILTGQCQCRNWASGRQCSLCPPNMWGFPL---CRPCRCY---GHASSCNPKTGVCVDCQHNTVGKNCEACAVGFYGIATKGTPNDCKRCQCPGGSSGNKFSESCYVDTSTTPPSVLCDKCQVGYTGRQCEECADGYYGNPLVPGGSCKPCSC 963          

HSP 8 Score: 57.7658 bits (138), Expect = 9.976e-8
Identity = 56/209 (26.79%), Postives = 86/209 (41.15%), Query Frame = 2
Query: 4475 KCICNALTFGNHCQNPISGYYKEYFNLPNSTKSGSMRTGNRILINLKKCNCNGYSKVC-----------DSVTGDCQNCMGNREGNKCQLCREGFYKNDK----NYDQCEPCQC-PSAHYNFAQNCTRIESSLEL---KCQCRIGYSGKSCENCQQGFYGNPIKGIP--CKSCDCNQQGSQSLNCNEFGICQCSPGVLGIKCDQCAPNY 5038
            +C C   T G +C+    GY+   +   ++      R          KCNCNG++  C           +   G CQ+C  N  G  C+ C+   Y++      + D C  C C P+   N  +   + + +  L   +C C+    G  C+ C+ GF+ N     P  CK+C CN  G+      + G C C   V G  CD+CA  Y
Sbjct:  282 RCNCTHNTTGKNCERCQDGYFDVPWRPADADNPNECR----------KCNCNGHAVKCRFDPAVYQASGNVSGGVCQDCEHNTVGRNCERCKPLHYQDPSKKFSDPDACIACNCDPTGGVNGGECEAKNDPAAGLVAGRCICKRNVGGVRCDRCKAGFF-NLTTDNPDGCKACGCNPLGTIGECNPDTGRCTCKRYVEGEDCDRCASEY 479          

HSP 9 Score: 51.6026 bits (122), Expect = 7.001e-6
Identity = 62/224 (27.68%), Postives = 93/224 (41.52%), Query Frame = 2
Query:  950 CICNNHADK-----CDKVIENGISVAKCNCKHNTCGSNCETCCPLFNQRPWKPVAVCEECNCNRKSNECSYNQTVATLQLSVNKMGRMEGGGVCINCQENTEGINCEKCIKGFYRPWNVLATELYPCTPCQCHGLGTIGSCVSNGEDIGDQKPGDCICKKGYEGVNCDLCSIGYERYPNGECLPCPCSIDGSVRTSFYRCKPPCNCKV-HVNSD-DLCKTCKNG 1600
            C CNN+ D      CD++  + +      C +NT G NCE C P +          C  C C++K     ++ +        +K G+        NC  + EG  C++C +GF   WN+ + +   C  C C   G++ S       + +Q  G C CK G+ G  C  C   +   P   C  C C+  GSV     R    C CKV H+    D+C    +G
Sbjct:  961 CSCNNNIDPTVSGNCDRLTGSCL-----QCLYNTAGFNCERCKPGYFGDAI--ARNCTSCVCDKKGTNPGFHYSCN------HKTGQ-------CNCLPDVEGKQCDRCAEGF---WNLSSGK--GCQQCDCCIEGSLRS-------MCNQITGQCQCKAGFGGPRCCECEDNFWGSPPDGCSACNCNPAGSVHLQCDRDTGKCLCKVGHIGDKCDMCAADTSG 1152          
BLAST of Laminin subunit alpha-2 vs. Ensembl Nematostella
Match: EDO31103 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SYW2])

HSP 1 Score: 262.692 bits (670), Expect = 2.244e-70
Identity = 202/719 (28.09%), Postives = 313/719 (43.53%), Query Frame = 2
Query: 1010 AKCNCKHNTCGSNCETCCPLFNQRPWKPVAVCEECNCNRKSNECSYNQTVATLQLSVNKMGRMEGGGVCINCQENTEGINCEKCIKGFYRPWNVLATELYPCTPCQCHGLGTIGSCVSNGEDIG-DQKPGDCICKKGYEGVNCDLCSIGYERYPNGECLPCPCSIDGSVRTSFYRCKPPCNCKVHVNSDDLCKTCKNGYFNLDSANPEGCEPCYCFGITNQCSSLSAKN-----------LKISDLKGWKLTTFTGEKIALPKFTSFQYLTSENSYIDERFNNPTVYYWTAPPPYL--GNWITSYGTIFRYVVKIELQSTLKGSLIDSPDVIIKCGDF--RLFHSVSIEDRRLQRQVFIYIKPTEWKIGKLTPDKAATKEEFISCLVKVDKLLIKAKYYS---NQKSIELLNITLSRGEVHLALDEMPHIEKCNCPPGFNGLSCESCESGYRRVN-NVLYQGQCEACACYNHSNTCDSLNGECQNCTHNTAGAHCEDCASGYYGDAKSKNLNSCKKCPCPRLDYQMTEL---CSSYSSENYVCHKCLHNTSGVHCDRCIEGYYGNPKKKIS--CKRCKCNNNQE-----SCDPVTGEC-RCSYNTMGTECQLCKHGFYGDALTKSCKKCDCDSLGSTSENCDKLTGKCDCRTNFVNRQCDSCTSGL--YLKDKKCIPCNCEIQGRISSEKFCNTTSGQCFCLENVNGDRCEKCVEGYFN 3067
             +C+C+ +  G  C+ C P +    +     C+ C CN   ++ S               G+ E       C  +     C +C+  ++       T    C PC C+ L +         D+  D   G C CK G  G  C  CS  +       C  C C ++GS+     +    C C+ +     LC +C +G + L + +P+GC  C+C G +  CS  S                 +DL GW      G+  +   F+S   L           ++   +Y++AP  YL  G +  ++   F     ++  +T   S     DVIIK   F   L  S+            +    + W+IG  T  + AT +E +  L  ++ L I+ ++ +         L++IT++        D + ++E C CP  + G  CE C  GY R   N      C  C+C NH++TCD  +G C +C HNT G HCE CA G YGDA +   + C++CPCP   +        C   S     C  C  + +G  C+RC +GYYG P   ++  C++C CN N +     +C+  TGEC +C YNT G  CQ C  GF+G+A  K+C+ C+C   GS    C+ +TG+CDC        C+ C      Y   K C  C C  QG  S++  C+   G C C  NV GD+C++C+  +++
Sbjct:  679 GQCSCRPHVIGRKCDECRPDYYD--FTSGLGCKACACNMTGSKRSSCHP---------DTGKCE-------CHPSITERQCSRCLDHYFN-----FTSGVGCQPCGCNELYS--------RDLQCDNDTGVCSCKDGVGGAKCTECSDAFYNLTTEGCTGCQCDLNGSLNPVCNKLNGNCTCRSNA-IGRLCDSCPDGSYGLRAGHPDGCLRCHCSGFSTNCSMASGYTRGQLISYLLLTADPTDLDGWTGRYPNGQLASNLIFSSISNLPGGFYRFYIEASSARDFYFSAPTKYLTRGRYAYTHAMTF----SLQQDNTTIPSSSTRGDVIIKGRYFNSELVTSLPTPPGLTFTTYKVVFLESNWRIGN-TSGRVATDKELVRVLSSLEYLWIRGRWTNLTDPSLKTRLMDITMTIANKSSIGDTVFNVETCQCPIQYVGQFCERCAPGYTRATPNGGAYTPCVPCSCNNHTDTCDPESGVCIDCQHNTTGDHCEKCAVGLYGDATNGTSSDCRECPCPGGPFSANSFARSCVLGSDGLPTCTNCSESHAGRQCERCQDGYYGTPTDPVNGQCRKCNCNGNVDPGVTGNCNTTTGECLKCLYNTSGFNCQWCVSGFHGNATAKTCQACNCTDRGSKHGECNNVTGQCDCHPLVTGLSCERCVKDAFNYTSGKGCTACGCHPQG--SNDTQCDAVFGNCTCNTNVKGDKCDQCMPNFYD 1358          

HSP 2 Score: 144.821 bits (364), Expect = 3.539e-34
Identity = 160/659 (24.28%), Postives = 246/659 (37.33%), Query Frame = 2
Query: 3242 GSLNPK-CDMETGNCKCAQNVARRDCSKCDVGYFGLDV-TGCKKCPPCYNGQ---VCN-NEGICVCPPNTIGNLCNKCSEDSWDFNETIGCKKCNCYINGSYSNICNKISGICACKTAFFGSKCDRCNEGYYGFP--NCQPCSCAENGTKSNELTKCDKITGQCQCKQNVIGTKCKVCRKGTFPSDGTYEGGCFSCFCFGVSEKCHAILNH-----------------------RIVENSIYEYHIFDEKNSLESGKDYSTIHLNANYPRRFGWP-----LTMFRPIYVNVMKLFNSHD-LSLFYRSIFMNVSVDCLDNKCGREIPEQTEVFMESYNGLFGMRYXXXXXXXXXXXXXXDFNEHSKNGKWVISQYQNDILDKFIILEDSNVINSNLTRDIFMMALLNVTSLKVKLYTDKVNPPLIKIKIITYKVMETTQAIGKRVTAVEKCICNALTFGNHCQNPISGYYKEYFNLPNSTKSGSMRTGNRILINLKKCNCNGYSKVCDSVTGDCQNCMGNREGNKCQLCREGFYKNDKN--YDQCEPCQCPSAHY---NFAQNCTRIESSLELKCQCRIGYSGKSCENCQQGFYGNPIKGI--PCKSCDCNQQGSQSL--NCN-EFGIC-QCSPGVLGIKCDQCAPNYV--VEKKTCQSC 5068
            G++ P  CD   G C C  +V  R C +C   Y+      GCK C     G     C+ + G C C P+     C++C +  ++F   +GC+ C C    S    C+  +G+C+CK    G+KC  C++ +Y      C  C C  NG+ +     C+K+ G C C+ N IG  C  C  G++     +  GC  C C G S  C     +                       R     +    IF   ++L  G  +   ++ A+  R F +      LT  R  Y + M      D  ++   S   +V +       GR    +    + +  GL    Y V             F E +    W I      +             +  L R +  +  L +      L    +   L+ I +     +    +IG  V  VE C C     G  C+    GY +       +T +G   T          C+CN ++  CD  +G C +C  N  G+ C+ C  G Y +  N     C  C CP   +   +FA++C      L     C   ++G+ CE CQ G+YG P   +   C+ C+CN      +  NCN   G C +C     G  C  C   +      KTCQ+C
Sbjct:  667 GAVTPSVCDQCGGQCSCRPHVIGRKCDECRPDYYDFTSGLGCKACACNMTGSKRSSCHPDTGKCECHPSITERQCSRCLDHYFNFTSGVGCQPCGCNELYSRDLQCDNDTGVCSCKDGVGGAKCTECSDAFYNLTTEGCTGCQCDLNGSLN---PVCNKLNGNCTCRSNAIGRLCDSCPDGSYGLRAGHPDGCLRCHCSGFSTNCSMASGYTRGQLISYLLLTADPTDLDGWTGRYPNGQLASNLIFSSISNLPGG--FYRFYIEASSARDFYFSAPTKYLTRGRYAYTHAMTFSLQQDNTTIPSSSTRGDVIIK------GRYFNSELVTSLPTPPGLTFTTYKVV------------FLESN----WRIGNTSGRV-----------ATDKELVRVLSSLEYLWIRGRWTNLTDPSLKTRLMDITM----TIANKSSIGDTVFNVETCQCPIQYVGQFCERCAPGYTR-------ATPNGGAYT------PCVPCSCNNHTDTCDPESGVCIDCQHNTTGDHCEKCAVGLYGDATNGTSSDCRECPCPGGPFSANSFARSCVLGSDGLPTCTNCSESHAGRQCERCQDGYYGTPTDPVNGQCRKCNCNGNVDPGVTGNCNTTTGECLKCLYNTSGFNCQWCVSGFHGNATAKTCQAC 1270          

HSP 3 Score: 109.383 bits (272), Expect = 1.813e-23
Identity = 93/327 (28.44%), Postives = 143/327 (43.73%), Query Frame = 2
Query:  317 VCDNRNETKRHPIEFAKSDDD-NLWWQSPSMAQGLKYQNVNVTIDLKQVYQIVYILLK---MGDSPRPGNWILERSLD-GEIYMPWIFFAETPYSCYNLFQRQYPDLKLTTNAKPSSLADDEMFCTTYYSQPKSLNSGEIIISLINGRKSIMNEEYLSIKSVPQTLINFLSARYIRFRFLKHLTLAA-DLMTHKGYLEQSIYNRYYYSLRNIEIGGKCICNNHADKCDKVIENGISVAKCNCKHNTCGSNCETCCPLFNQRPWKPVAVCEECNCNRKSNECSYNQTVATLQLSVNKMGRMEGGGVCINCQENTEGINCEKCIKGFYR 1279
            VCD  N    HP+       D   +W+S         +NV+  + +   +  VYI ++   + +   P    L +S D G  Y    F++    + YN+ + QY       N + +SL   E F     S  + +N   +  ++I  +          I+      + FL   + R    K++T    D  T    L++S    +Y+S++NI+I   C CN  AD CD         + C C+ NT G+NCE C PLFN +P+ P   CE+C CN  S  C Y+ +              +G GVC+NC +NT G  CE+C   FYR
Sbjct:   69 VCDASNPNTSHPVSHVNDAFDLKTFWKS---------RNVDQPVFIDFNFGAVYIFMQAMLLFEYELPAAMYLSKSKDFGSSYDVIGFYSSDCQAYYNMTETQY-------NRRNASLT--ECFKINPLSSDQRVNHMPMQDTVIAAK----------IRVDHNVQLKFLMTNF-RVVLDKYVTPPGYDPPTSSDTLKKS----FYFSIQNIDILAACFCNGQADTCDTK-----DPSVCVCEKNTAGNNCEKCLPLFNNKPYAPQRACEDCGCNNHSASCEYHSS--------------KGYGVCLNCTDNTMGDKCEQCKPEFYR 343          

HSP 4 Score: 96.6709 bits (239), Expect = 1.490e-19
Identity = 72/234 (30.77%), Postives = 109/234 (46.58%), Query Frame = 2
Query: 2615 IEGYYGNPKKKISCKRCKCNNN----QESCDPVTGECRCSYNTMGTECQLCKHGFYGDALTKSCKKCDCDSLGSTSENCDKLTGKCDCRTNFVNRQCDSCTSGLY--LKDKKCIPCNC-EIQGRISSEKFCNTTSGQCFCLENVNGDRCEKCVEGYFNYP--NCKKCLCSPH-ALSADCDLNNGKCKCGSNVINRICDKCENLHY---WNNRTDCVPCNCGRGSLNPKCDMETG 3277
            + G+YG+  +K   + C+CN         CD   G+C C  + +G +C  C+  +Y       CK C C+  GS   +C   TGKC+C  +   RQC  C    +       C PC C E+  R   +  C+  +G C C + V G +C +C + ++N     C  C C  + +L+  C+  NG C C SN I R+CD C +  Y     +   C+ C+C   S N  C M +G
Sbjct:  647 LAGFYGDLYQKG--QACECNATGAVTPSVCDQCGGQCSCRPHVIGRKCDECRPDYYDFTSGLGCKACACNMTGSKRSSCHPDTGKCECHPSITERQCSRCLDHYFNFTSGVGCQPCGCNELYSR---DLQCDNDTGVCSCKDGVGGAKCTECSDAFYNLTTEGCTGCQCDLNGSLNPVCNKLNGNCTCRSNAIGRLCDSCPDGSYGLRAGHPDGCLRCHCSGFSTN--CSMASG 873          

HSP 5 Score: 95.1301 bits (235), Expect = 4.343e-19
Identity = 64/186 (34.41%), Postives = 91/186 (48.92%), Query Frame = 2
Query: 3119 CDLNNGKCKCGSNVINRICDKCENLHY-WNNRTDCVPCNCG-RGSLNPKCDMETGNCKCAQNVARRDCSKCDVGYFGLDVTGCKKCPPC-------YNGQVCNNEGICVCPPNTIGNLCNKCSEDSWDFNETIGCKKCNCYINGSYSNICNKISGICACKTAFFGSKCDRCNEGYYGFPNCQPCSC 3649
            CD   G+C C  +VI R CD+C   +Y + +   C  C C   GS    C  +TG C+C  ++  R CS+C   YF  + T    C PC        + Q  N+ G+C C     G  C +CS+  ++   T GC  C C +NGS + +CNK++G C C++   G  CD C +G YG     P  C
Sbjct:  674 CDQCGGQCSCRPHVIGRKCDECRPDYYDFTSGLGCKACACNMTGSKRSSCHPDTGKCECHPSITERQCSRCLDHYF--NFTSGVGCQPCGCNELYSRDLQCDNDTGVCSCKDGVGGAKCTECSDAFYNLT-TEGCTGCQCDLNGSLNPVCNKLNGNCTCRSNAIGRLCDSCPDGSYGLRAGHPDGC 856          

HSP 6 Score: 92.0485 bits (227), Expect = 3.448e-18
Identity = 88/308 (28.57%), Postives = 129/308 (41.88%), Query Frame = 2
Query: 2813 SLGSTSENCDKLTGKCDCRTNFVNRQCDSCTSGLYLKD------KKCIPCNCEIQGRISSEKFCNTTSGQCF-CLENVNGDRCEKCVEGYFN------YPNCKKCLCSPHALSAD-----CDLNNGK----CKCGSNVINRICDKCENLHYWNNRTD-----CVPCNCGRGSLNP----KCDMETGNC-KCAQNVARRDCSKCDVGYFGLDVTGCKKCPPC-------YNGQVCNNEGICVCPPNTIGNLCNKCSEDSWDFNETIGCKKCNCYINGSYSNICNKISGICACKTAFFGSKCDRCNEGYY 3619
            S+G T  N +     C C   +V + C+ C  G             C+PC+C      +    C+  SG C  C  N  GD CEKC  G +         +C++C C     SA+     C L +        C  +   R C++C++  Y+   TD     C  CNC  G+++P     C+  TG C KC  N +  +C  C  G+ G      K C  C        +G+  N  G C C P   G  C +C +D++++    GC  C C+  GS    C+ + G C C T   G KCD+C   +Y
Sbjct: 1063 SIGDTVFNVET----CQCPIQYVGQFCERCAPGYTRATPNGGAYTPCVPCSCN-----NHTDTCDPESGVCIDCQHNTTGDHCEKCAVGLYGDATNGTSSDCRECPCPGGPFSANSFARSCVLGSDGLPTCTNCSESHAGRQCERCQD-GYYGTPTDPVNGQCRKCNC-NGNVDPGVTGNCNTTTGECLKCLYNTSGFNCQWCVSGFHGNATA--KTCQACNCTDRGSKHGECNNVTGQCDCHPLVTGLSCERCVKDAFNYTSGKGCTACGCHPQGSNDTQCDAVFGNCTCNTNVKGDKCDQCMPNFY 1357          

HSP 7 Score: 77.7962 bits (190), Expect = 7.112e-14
Identity = 54/155 (34.84%), Postives = 74/155 (47.74%), Query Frame = 2
Query: 4613 KKCNCNG-----YSKVCDSVTGDCQNCMGNREGNKCQLCREGFYKNDKNYDQCEPCQCPSAHYNFAQNCTRIESSLELKCQCRIGYSGKSCENCQQGFYGNPIKGIPCKSCDCNQQGSQSLNCNE-FGICQCSPGVLGIKCDQCAPNYVVEKKTC 5059
            +KCNCNG      +  C++ TG+C  C+ N  G  CQ C  GF+ N      C+ C C        + C  +      +C C    +G SCE C +  + N   G  C +C C+ QGS    C+  FG C C+  V G KCDQC PN+    K+C
Sbjct: 1216 RKCNCNGNVDPGVTGNCNTTTGECLKCLYNTSGFNCQWCVSGFHGN-ATAKTCQACNCTDRGSKHGE-CNNVTG----QCDCHPLVTGLSCERCVKDAF-NYTSGKGCTACGCHPQGSNDTQCDAVFGNCTCNTNVKGDKCDQCMPNFYDVGKSC 1363          

HSP 8 Score: 73.1738 bits (178), Expect = 1.801e-12
Identity = 78/266 (29.32%), Postives = 112/266 (42.11%), Query Frame = 2
Query: 3113 ADCDLNNGKCKCGSNVINRICDKCENLHY-----WNNRTDCVPCNCGRGSLNPKCDMETGNC-KCAQNVARRDCSKCDVGYFGLDVTG----CKKCPPCYNGQ----------VCNNEGICVC---PPNTIGNLCNKCSEDSWDFNETIG----CKKCNCY--INGSYSNICNKISGIC-ACKTAFFGSKCDRCNEGYYG---FPNCQPCSCAENGTKSNELTKCDKITGQCQCKQNVIGTKCKVCRKGTFPSDGTYEGGCFSCFC 3811
             D   N   C+C    + + C++C   +          T CVPC+C   +    CD E+G C  C  N     C KC VG +G    G    C++CP C  G           V  ++G+  C     +  G  C +C +D +    T      C+KCNC   ++   +  CN  +G C  C     G  C  C  G++G      CQ C+C + G+K  E   C+ +TGQC C   V G  C+ C K  F  + T   GC +C C
Sbjct: 1065 GDTVFNVETCQCPIQYVGQFCERCAPGYTRATPNGGAYTPCVPCSCNNHT--DTCDPESGVCIDCQHNTTGDHCEKCAVGLYGDATNGTSSDCRECP-CPGGPFSANSFARSCVLGSDGLPTCTNCSESHAGRQCERC-QDGYYGTPTDPVNGQCRKCNCNGNVDPGVTGNCNTTTGECLKCLYNTSGFNCQWCVSGFHGNATAKTCQACNCTDRGSKHGE---CNNVTGQCDCHPLVTGLSCERCVKDAF--NYTSGKGCTACGC 1321          

HSP 9 Score: 58.151 bits (139), Expect = 7.488e-8
Identity = 62/231 (26.84%), Postives = 94/231 (40.69%), Query Frame = 2
Query: 2240 IEKCNCPPGFNGLSCESC--ESGYRRVNNVLYQGQCEACACYNHSNTCDSLNGECQNCTHNTAGAHCEDCASGYYGDAKSKNLNSCKKCPCPRLDYQMTELCSSYSSENY-VCHKCLHNTSGVHCDRCIEGYYGNPKKKISCKRCKCNNNQESCDPVTGECRCSYNTMGTECQLCKHGFYG--DALTKSCKKCDCDSLGSTSENCDKLTGKCDCRTNFVNRQCDSCTSGLY 2917
            ++K   PPG++  +      +S Y  + N+       AC C   ++TCD+ +     C  NTAG +CE C    + +       +C+ C C       +  C  +SS+ Y VC  C  NT G  C++C   +Y NP   ++     C         +      +     T   + K GFY      T  C  C+CD  GS +  C    G C CR +F   +CD    G Y
Sbjct:  218 LDKYVTPPGYDPPTSSDTLKKSFYFSIQNIDILA---ACFCNGQADTCDTKDPSVCVCEKNTAGNNCEKCLP-LFNNKPYAPQRACEDCGC----NNHSASCEYHSSKGYGVCLNCTDNTMGDKCEQCKPEFYRNPDTPLNHTN-TCLGKTNHIMFINSIINQTKGFRPTRENIKKDGFYSLNAGNTAGCSACNCDPAGSINVTCSD-GGACHCRPHFSGLKCDVIERGFY 438          

HSP 10 Score: 52.7582 bits (125), Expect = 2.834e-6
Identity = 49/165 (29.70%), Postives = 71/165 (43.03%), Query Frame = 2
Query: 4613 KKCNCNGYS----KVCDSVTGDCQNCMGNREGNKCQLCREGFYKNDKNYDQCEPCQCPSAHYNFAQNCTRIESSLELKCQCRIGYSGKSCENCQQGFYGNPIKGIPCKSCDCNQQGSQSLNC-NEFGICQCSPGVLGIKCDQCAPNYVVEKKTCQSCYSGCTKDL 5092
            + C CN        VCD   G C +C  +  G KC  CR  +Y        C+ C C     N   +          KC+C    + + C  C   ++ N   G+ C+ C CN+  S+ L C N+ G+C C  GV G KC +C+  +     T + C +GC  DL
Sbjct:  659 QACECNATGAVTPSVCDQCGGQC-SCRPHVIGRKCDECRPDYYDFTSGLG-CKACAC-----NMTGSKRSSCHPDTGKCECHPSITERQCSRCLDHYF-NFTSGVGCQPCGCNELYSRDLQCDNDTGVCSCKDGVGGAKCTECSDAFY--NLTTEGC-TGCQCDL 812          

HSP 11 Score: 52.373 bits (124), Expect = 4.775e-6
Identity = 41/143 (28.67%), Postives = 63/143 (44.06%), Query Frame = 2
Query: 4613 KKCNCNGYSKVCDSVT----GDCQNCMGNREGNKCQLCREGFYKN-DKNYDQCEPCQCPSAHYNFAQNCTRIESSLELKCQCRIGYSGKSCENCQQ-GFYG-NPIKGIPCKSCDCNQQGSQSLNCNEFGICQCSPGVLGIKCD 5020
            + C CN +S  C+  +    G C NC  N  G+KC+ C+  FY+N D   +    C   + H  F  +                     + EN ++ GFY  N      C +C+C+  GS ++ C++ G C C P   G+KCD
Sbjct:  300 EDCGCNNHSASCEYHSSKGYGVCLNCTDNTMGDKCEQCKPEFYRNPDTPLNHTNTCLGKTNHIMFINSIINQTKGFR-----------PTRENIKKDGFYSLNAGNTAGCSACNCDPAGSINVTCSDGGACHCRPHFSGLKCD 431          
BLAST of Laminin subunit alpha-2 vs. Ensembl Nematostella
Match: EDO36501 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SIF6])

HSP 1 Score: 243.817 bits (621), Expect = 2.779e-64
Identity = 262/1045 (25.07%), Postives = 425/1045 (40.67%), Query Frame = 2
Query:   92 MR-IFIIFILLIVHKAHSQ-------DDEPEILSVNVDGLLMENAKITSSATCGTGGPEIFCRLVDEIAIQRLINPDSHVLCDVCDNRNETKRHPIEFAKS---DDDNLWWQSPSMAQGLKYQ-----NVNVTIDLKQVYQIVYILLKMGDSPRPGNWILERSLD-GEIYMPWIFFAETPYSCYNLFQRQYPDLKLTTNAKPSSLADDEMFCTTYYSQPKSLNSGEIIISLINGRKSIMNEEYLSIKSVPQTLINFLSARYIRFRF----LKHLTLAADLMTHKGYLEQSIYNRYYYSLRNIEIGGKCICNNHADKCDKVIENGISVAKCNCKHNTCGSNCETCCPLFNQRPWKPVAV------CEECNCNRKSNECSYNQTVATLQLSVNKMGRMEGGGVCINCQENTEGINCEKCIKGFYRPWNVLATELYPCTPCQC--HGLGTIGSCVSNGEDIGDQKPGDCICKKGYEGVNCDLCS---IGYERYPNGECLPCPCSIDGSVRTSFY--RCKPPCNCKVHVNSDDLCKTCKNGYFNLDSANPEGCEPCYC-FG--ITNQCSSLSAKNLKISDLKGWKLTTFTGEKIALPKFT--SFQ-------YLTSENSYIDERFNNPTVYYWTAPPPYLGNWITSYGTIFRYVVKIELQSTLKGSLIDSPDVIIKCGDFRLFHSVSIEDRRLQRQVFIYIKPTEWKIGKLTPDKAATKEEF-----------ISCLVKVDKLLIKAKYYSNQKSIELLNITLSRGEVHLALDEMPHIEKCNCPPGFNGLSCESCESGYRRVNNV------------------LYQGQ----CEACACYNHSNTCDSLNGECQNCTHNTAGAHCEDCASGYYGDAKSKNLNSCKKCPCPRLDYQMTELCSSYSSENYVCHK------CLHNTSGVHCDRCIEGYYGNPKKKISCKRCKCNNNQES---CDPVTGECRCSYNTMGTECQLCKHGFYGDALTKSCKKCDCDSLGSTSENCDKLTGKCDCRTNFVNRQCDSCTSGLYLKDKK----CIPCNC 2950
            MR + ++  LL V K +S+       DD    +        M++  ++S++TCG+  P  +CR+       + +N      C  C+  + T+RHPIE+        D  +WQS +     +        VNV+I   + Y I   ++   +SPRP   ILE+S D G+ + P  +++   ++C   F  +       T+   +   D    CT  YS      +G++    +          Y         +  +LSA  +R R        L +A D +T K         +YYY++ ++E+  +C C+ HA  CD   E G     C+C HNT G +CE C PLFN + W P         CE C C+  ++ C+Y+Q               EG G C +C  NTEG  CE+C   FYR  ++       C  C C   G+   G+C        +Q  G C C+    G  CD C+    GY   P G C  C C  +G+V  SF   +    C+CK +V++   C+ CK+GY++        C+ C C +G  +   CS  +   +  +++ G + T  T      P F+  +F+       Y+ + N+   + F + T Y    P  Y+ N+       +++ + +       G+  DS  + I          V++    +     +  +   W+    TP      + +           ++  + VD L+I            L ++T SR     A + + H        GF+  +   C + +  ++ +                  ++ G     C++   Y +S TCD   G+CQ C     G  C+ C  G+Y      N  S    PC          C S  S + VC+       C        C RC + +YG       C  C+CN +  +   CD VTG C C  +T G +C  C+ GFY +  +  C+ C+C   GS S+ C+  TG C C++N +  +C+SC  G Y  D      C PC C
Sbjct:    1 MRGLGMVLFLLTVSKVNSECFENEKYDDVQTCVPEPRFAAKMKHRAVSSTSTCGSP-PSEYCRV-------KPLNG-----CFKCNASSPTERHPIEYIADKSPGSDATFWQSETWWDWYQKNPRDDLKVNVSISFNKTYDITGHIMFTFESPRPSKAILEKSFDKGQTWDPLQYYS---FNCRKDFGME------NTDPTENRFGDFSAKCTEKYSSSSPQQNGKVTFDFL--------RRYNKASFFDTQVQQYLSATDLRLRMEYPGTDGLEVAKDEVTLK---------QYYYAVSDLEVIARCKCHGHARWCDFPHETG---KNCDCLHNTTGDDCERCLPLFNNKTWMPATSETEPNPCERCECHSHADSCTYSQ--------------QEGYGTCDDCYHNTEGHFCERCKDKFYRNMSLSLNHPEICPDCNCFPQGITNNGTC--------NQTTGQCECRANVTGRQCDSCADTFWGYTLEPIGYCTECLCVGNGTVNASFNCDQYNGQCSCKPNVHT-RTCQECKHGYWDFPKTLDTDCKRCDCDYGGSVLQICSKTTGSCMCRTNIIGTRCTDVTTGYFT-PSFSYLTFEAEEATGDYMQASNTLDLDMFFSGTGYGRITPGQYI-NFQARVDVNWKWFLMLRYTDLATGA--DSLQIHISAEAAGNCSGVNMT--VMNVTGLLAGQGLAWRAA--TPIVMCPGQTYNFNVTFSPGSSVNASIDVDSLVI------------LPDVTESRVYKVAAAEGVAH--------GFDSDTIRQCWNNWTTISTIVTSQPICSKNISFSVMSEVFHGAMACGCDSVGTYLNS-TCDRYGGKCQ-CKPGVTGRTCDKCKPGFY------NFTSSGCAPCD---------CVSTGSHHLVCNAVSGQCPCKPGVITRTCSRCNDSFYGYTTGS-GCVECRCNMSGSADAQCDDVTGNCTCKNSTDGAKCAECRFGFY-NFTSAGCQACNCHEGGSQSQQCNLQTGICTCKSNALGEKCESCRPGTYHSDPNNPDGCTPCYC 933          

HSP 2 Score: 157.147 bits (396), Expect = 6.869e-38
Identity = 149/595 (25.04%), Postives = 233/595 (39.16%), Query Frame = 2
Query: 3248 LNPKCDMETGNCKCAQNVARRDCSKCDVGYFGLDVTGCKKCPPCYNGQ---VCNN-EGICVCPPNTIGNLCNKCSEDSWDFNETIGCKKCNCYINGSYSNICNKISGICACKTAFFGSKCDRCNEGYYGF--PNCQPCSCAENGTKSNELTKCDKITGQCQCKQNVIGTKCKVCRKGTFPSDGTYEGGCFSCFCFGVSEKCHAILNHRIVENSIYEYHIFDEKNSLESGKDYSTIHLNANYPRRFGWP-----LTMFRPIYVNVMKLFNSHDLSLFYRSIF----MNVSVDCLDNKC--GREIPEQTEVFMESYNGLFGMRYXXXXXXXXXXXXXXDFNEHSKNGKWVISQYQNDILDKFIILEDSNVINSNLTRDIFMMALLNVTSLKVKLYTDKVNPPLIKIKIITYKVMETTQAIGKRVTAVEKCICNALTF-GNHCQNPISGYYKEYFNLPNSTKSGSMRTGNRILINLKKCNCNGYSKVCDSVTGDCQNCMGNREGNKCQLCREG-------------FYKNDKNYDQCEPCQC--PSAHYNFAQNCTRIESSLELKCQCRIGYSGKSCENCQQGFYGNPIKG-IPCKSC 4930
            LN  CD   G C+C   V  R C KC  G++    +GC  C     G    VCN   G C C P  I   C++C++  + +    GC +C C ++GS    C+ ++G C CK +  G+KC  C  G+Y F    CQ C+C E G++S +   C+  TG C CK N +G KC+ CR GT+ SD     GC  C+CFG S  C +                        SG   S I ++   P    W      ++M R           S +++L  +  F    +N   + L+ K     + P   ++F E      G+         +          H  NG W     + +  D   +L D   I  N       M+  +V   ++KL++                   +   +G++   VE C C +  + G  C+    G+ +   N PN++ S               C C G S  CD  TG C+ C    +G  C+ C+ G             ++   +  + C+ C C  P+  Y  +  C         +C C+   SG++C+ C +  Y    +G + C  C
Sbjct:  743 LNSTCDRYGGKCQCKPGVTGRTCDKCKPGFYNFTSSGCAPCDCVSTGSHHLVCNAVSGQCPCKPGVITRTCSRCNDSFYGYTTGSGCVECRCNMSGSADAQCDDVTGNCTCKNSTDGAKCAECRFGFYNFTSAGCQACNCHEGGSQSQQ---CNLQTGICTCKSNALGEKCESCRPGTYHSDPNNPDGCTPCYCFGRSNTCTSA-----------------------SGFVRSYIKVDLGSPFSIDWTFVQRDVSMARVSQGRNFSFVTSGNMTLGTKVNFTKNQLNSYGELLEMKLKYSSQGPLNVKMFWELEKTNGGIVRFDVKPTPSPEVTSYYVRLHEANGIWKTEPNRRNASDLQELLSDLMSITLNAQ----FMSNGSVLLSEIKLHS------------------ASQGIVGEKAGHVENCTCESGNYTGLSCELCNQGFTR---NRPNNSYSA-----------CSLCRCTGRSLDCDGETGQCKGCRLGSQGLYCEQCQPGVDNTTDCTQCLPEYWGLKEGSNGCQDCDCVLPNTLYGNSTVCNATTG----QCTCKEKISGRTCDRCHENAYNTSDRGCVECPEC 1271          

HSP 3 Score: 126.716 bits (317), Expect = 1.241e-28
Identity = 144/582 (24.74%), Postives = 230/582 (39.52%), Query Frame = 2
Query: 1010 AKCNCKHNTCGSNCETCCPLFNQRPWKPVAVCEECNCNRKSNECSYNQTVATLQLSVNKMGRMEGGGVCINCQENTEGINCEKCIKGFYRPWNVLATELYPCTPCQCHGLGTIGSCVSNGEDIGDQKPGDCICKKGYEGVNCDLCSIGYERYPNGECLPCPCSIDGSVRTSFYRCKPPCNCKVHVNSDDLCKTCKNGYFNLDSANPEGCEPCYCFGITNQCSSLSA---KNLKISDLKGWKLT-TFTGEKIALPKFT---SFQYLTSENSYIDERFNNPTVYYWTAPPPYLGNWITSYGTIFRYVVKIELQSTLKGSL---IDSPDVIIKCGDFRLFHSVSIEDRRLQRQVFIYIKPTEWK-IGKLTPDK--AATKEEFISCLVKVDKLLIKAKYYSNQKSIELLNITLSRGEVHLALDEMPHIEKCNCPPG-FNGLSCESCESGYRRVNNVLYQGQCEACACYNHSNTCDSLNGECQNCTHNTAGAHCEDCASG-------------YYGDAKSKNLNSCKKCPC--PRLDYQMTELCSSYSSENYVCHKCLHNTSGVHCDRCIEGYYGNPKKK-ISCKRC 2665
             KC CK    G  C+ C P F        + C  C+C           +  +  L  N +      G C  C+       C +C   FY       T    C  C+C+     GS  +  +D+     G+C CK   +G  C  C  G+  + +  C  C C   GS           C CK +   +  C++C+ G ++ D  NP+GC PCYCFG +N C+S S      +K+     + +  TF    +++ + +   +F ++TS N  +  + N            +  N + SYG +    +K   Q  L   +   ++  +  I   D +   S  +           Y++  E   I K  P++  A+  +E +S L+ +    + A++ SN  S+ L  I L      +  ++  H+E C C  G + GLSCE C  G+ R         C  C C   S  CD   G+C+ C   + G +CE C  G             Y+G  +    N C+ C C  P   Y  + +C++ + +   C  C    SG  CDRC E  Y    +  + C  C
Sbjct:  752 GKCQCKPGVTGRTCDKCKPGFYNFT---SSGCAPCDC----------VSTGSHHLVCNAVS-----GQCP-CKPGVITRTCSRCNDSFYG-----YTTGSGCVECRCN---MSGSADAQCDDV----TGNCTCKNSTDGAKCAECRFGFYNFTSAGCQACNCHEGGSQSQQCNLQTGICTCKSNALGEK-CESCRPGTYHSDPNNPDGCTPCYCFGRSNTCTSASGFVRSYIKVDLGSPFSIDWTFVQRDVSMARVSQGRNFSFVTSGNMTLGTKVN------------FTKNQLNSYGELLEMKLKYSSQGPLNVKMFWELEKTNGGIVRFDVKPTPSPEVTS--------YYVRLHEANGIWKTEPNRRNASDLQELLSDLMSI---TLNAQFMSN-GSVLLSEIKLHSASQGIVGEKAGHVENCTCESGNYTGLSCELCNQGFTRNRPNNSYSACSLCRCTGRSLDCDGETGQCKGCRLGSQGLYCEQCQPGVDNTTDCTQCLPEYWGLKEGS--NGCQDCDCVLPNTLYGNSTVCNATTGQ---C-TCKEKISGRTCDRCHENAYNTSDRGCVECPEC 1271          

HSP 4 Score: 121.709 bits (304), Expect = 4.317e-27
Identity = 209/922 (22.67%), Postives = 330/922 (35.79%), Query Frame = 2
Query: 2936 IPCNCEIQGRISSEKFCNTTSGQCFCLENVNGDRCEKCVEGYFN----------YPN-CKKCLCSPHALSADCDLNNGKCKCGS---NVINRICDKCENLHYWNNRTDCVPCNCGRGSLNPKCDMETGNCKCAQNVARRDCSKCDVGYFGLDVTGCKKCPPCYNGQVCNNEGICVCPPNTIGNLCNKCSEDSWDFN-ETIG-CKKCNCYINGSY--SNICNKISGICACKTAFFGSKCDRCNEGYYGFP-----NCQPCSCAENGTKSNELTKCDKITGQCQCKQNVIGTKCKVCRKGTF-PSDGTYEGGCFSCFCFGVSEKCHAILNHRIVENSIYEYHIFDEKNSLESGKDYSTIHLNANYPRRFGWPLTMFRPIYVNVMKLFNSHDLSLFYRSIFMNVSVDCLDNKCGREIPEQTEVFMESYNGLF---GMRYXXXXXXXXXXXXXXDFNEHSKNGKWVISQYQNDILDKFIILED-----------SNVINSNLTRDIFMMALLNVTSLKVKLYTDKVNPPLIKIKIITYKVMETTQA-----IGKRVTAV-----EKCICNALTFGNHCQNPISGYYKEYFNLPNSTKSGSMRTGNRILINLKKCNC---NGYSKVCDSVTGDCQNCMGNREGNKCQLCREGFYKNDKNYDQCEPCQCPSAHYNFAQNCTRIESSLELKCQCRIGYSGKSCENCQQGFYGNPIKGIPCKSCDCNQQGSQSLNCN-EFGICQCSPGVLGIKCDQCAPNYVVEKKT----CQSCYSGCTKDLLVRIDTLNETVINFKWKTLPSTLDLRLNKINISIQMSSELLNSINKFYKLKNEIKNFSIQFQKMKDDAKEKYGEIEKLKTRYNKVLEDLRSTFTDINETISGHEQLGISNELIKNATAY---LETIKNIYKEMPNITLAASVLKDVL 5524
            +   C+  G      F + T   C CL N  GD CE+C+  + N           PN C++C C  HA S       G   C     N     C++C++  Y N     +  +     + P C     NC                  F   +T         NG      G C C  N  G  C+ C++  W +  E IG C +C C  NG+   S  C++ +G C+CK       C  C  GY+ FP     +C+ C C   G+    L  C K TG C C+ N+IGT+C     G F PS        FS   F   E   A  ++    N++ +  +F              I+  A     + W L            +    DL+    S+ +++S +   N  G        + + +  GL    G+ +     +        +FN     G  V +      +D  +IL D           +  +      D       N T++   + +  +    I   +++ +V     A     +G  + +       KC C     G  C     G+Y       N T SG              C+C     +  VC++V+G C  C        C  C + FY        C  C+C  +    AQ C  +  +    C C+    G  C  C+ GFY     G  C++C+C++ GSQS  CN + GIC C    LG KC+ C P            C  CY     +          + I     + P ++D    + ++S+   S+  N    F    N      + F K + ++   YGE+ ++K +Y+         F ++ +T  G  +  +        T+Y   L     I+K  PN    AS L+++L
Sbjct:  265 VIARCKCHGHARWCDFPHETGKNCDCLHNTTGDDCERCLPLFNNKTWMPATSETEPNPCERCECHSHADSCTYSQQEGYGTCDDCYHNTEGHFCERCKDKFYRN-----MSLSLNHPEICPDC-----NC------------------FPQGITN--------NGTCNQTTGQCECRANVTGRQCDSCADTFWGYTLEPIGYCTECLCVGNGTVNASFNCDQYNGQCSCKPNVHTRTCQECKHGYWDFPKTLDTDCKRCDCDYGGSV---LQICSKTTGSCMCRTNIIGTRCTDVTTGYFTPS--------FSYLTFEAEE---ATGDYMQASNTL-DLDMFFSGTGYGRITPGQYINFQARVDVNWKWFL------------MLRYTDLATGADSLQIHISAEAAGNCSG------VNMTVMNVTGLLAGQGLAWRAATPIVMCPGQTYNFNVTFSPGSSVNASID---VDSLVILPDVTESRVYKVAAAEGVAHGFDSDTIRQCWNNWTTISTIVTSQPICSKNISFSVMS-EVFHGAMACGCDSVGTYLNSTCDRYGGKCQCKPGVTGRTCDKCKPGFY-------NFTSSG-----------CAPCDCVSTGSHHLVCNAVSGQCP-CKPGVITRTCSRCNDSFYGYTTG-SGCVECRCNMSGSADAQ-CDDVTGN----CTCKNSTDGAKCAECRFGFYNFTSAG--CQACNCHEGGSQSQQCNLQTGICTCKSNALGEKCESCRPGTYHSDPNNPDGCTPCYCFGRSNTCTSASGFVRSYIKVDLGS-PFSIDWTFVQRDVSMARVSQGRNF--SFVTSGNMTLGTKVNFTKNQLNS---YGELLEMKLKYSSQGPLNVKMFWELEKTNGGIVRFDVKPTPSPEVTSYYVRLHEANGIWKTEPN-RRNASDLQELL 1079          

HSP 5 Score: 100.908 bits (250), Expect = 7.707e-21
Identity = 61/191 (31.94%), Postives = 90/191 (47.12%), Query Frame = 2
Query: 2687 SCDPVTGECRCSYNTMGTECQLCKHGFYGDALTKSCKKCDCDSLGSTSENCDKLTGKCDCRTNFVNRQCDSCTSGLY--LKDKKCIPCNCEIQGRISSEKFCNTTSGQCFCLENVNGDRCEKCVEGYFNY--PNCKKCLC-SPHALSADCDLNNGKCKCGSNVINRICDKCENLHYW---NNRTDCVPCNC 3235
            +CD   G+C+C     G  C  CK GFY +  +  C  CDC S GS    C+ ++G+C C+   + R C  C    Y       C+ C C + G  S++  C+  +G C C  + +G +C +C  G++N+    C+ C C    + S  C+L  G C C SN +   C+ C    Y    NN   C PC C
Sbjct:  746 TCDRYGGKCQCKPGVTGRTCDKCKPGFY-NFTSSGCAPCDCVSTGSHHLVCNAVSGQCPCKPGVITRTCSRCNDSFYGYTTGSGCVECRCNMSG--SADAQCDDVTGNCTCKNSTDGAKCAECRFGFYNFTSAGCQACNCHEGGSQSQQCNLQTGICTCKSNALGEKCESCRPGTYHSDPNNPDGCTPCYC 933          

HSP 6 Score: 98.2117 bits (243), Expect = 5.066e-20
Identity = 71/228 (31.14%), Postives = 112/228 (49.12%), Query Frame = 2
Query: 2576 CLHNTSGVHCDRCIEGY-------YGNPKKKISCKRCKCNNNQESC----DPVTGECR-CSYNTMGTECQLCKHGFYGDAL-----TKSCKKCDCDSLGSTSEN-CDKLTGKCDCRTNFVNRQCDSCTSGLYLKDKK----CIPCNCEIQGRISSEKFCNTTSGQCFCLENVNGDRCEKCVEGYFNYP-----NCKKCLCS-PHALSADCDLNNGKCKCGSNVINRIC 3175
            CLHNT+G  C+RC+  +         +  +   C+RC+C+++ +SC        G C  C +NT G  C+ CK  FY +        + C  C+C   G T+   C++ TG+C+CR N   RQCDSC    +    +    C  C C   G +++   C+  +GQC C  NV+   C++C  GY+++P     +CK+C C    ++   C    G C C +N+I   C
Sbjct:  290 CLHNTTGDDCERCLPLFNNKTWMPATSETEPNPCERCECHSHADSCTYSQQEGYGTCDDCYHNTEGHFCERCKDKFYRNMSLSLNHPEICPDCNCFPQGITNNGTCNQTTGQCECRANVTGRQCDSCADTFWGYTLEPIGYCTECLCVGNGTVNASFNCDQYNGQCSCKPNVHTRTCQECKHGYWDFPKTLDTDCKRCDCDYGGSVLQICSKTTGSCMCRTNIIGTRC 517          

HSP 7 Score: 87.0409 bits (214), Expect = 1.226e-16
Identity = 64/217 (29.49%), Postives = 90/217 (41.47%), Query Frame = 2
Query: 2471 SKNLNSCKKCPCPRLDYQMTELCSSYSSENYVCHKCLHNTSGVHCDRCIEGYYGNPKKKISCKRCKC---NNNQESCDPVTGECRCSYNTMGTECQLCKHGFYGDALTKSCKKCDCDSLGSTSENCDKLTGKCDCRTNFVNRQCDSCTSGLY-LKDKKCIPCNCEIQGRISSEKFCNTTSGQCFCLENVNGDRCEKCVEG-YFNYPN----CKKCLC 3094
            S+  +    C C  +   +   C  Y  +   C +C    +G  CD+C  G+Y        C  C C    ++   C+ V+G+C C    +   C  C   FYG      C +C C+  GS    CD +TG C C+ +    +C  C  G Y      C  CNC   G  S +  CN  +G C C  N  G++CE C  G Y + PN    C  C C
Sbjct:  725 SEVFHGAMACGCDSVGTYLNSTCDRYGGK---C-QCKPGVTGRTCDKCKPGFYNFTSS--GCAPCDCVSTGSHHLVCNAVSGQCPCKPGVITRTCSRCNDSFYGYTTGSGCVECRCNMSGSADAQCDDVTGNCTCKNSTDGAKCAECRFGFYNFTSAGCQACNCHEGGSQSQQ--CNLQTGICTCKSNALGEKCESCRPGTYHSDPNNPDGCTPCYC 933          

HSP 8 Score: 56.225 bits (134), Expect = 2.755e-7
Identity = 99/476 (20.80%), Postives = 177/476 (37.18%), Query Frame = 2
Query: 4661 GDCQNCM---GNREGNKCQLCREGFYKNDKN--YDQCEPCQCPSAHYNFAQNCTRIESSLELKCQCRIGYSGKSCENCQQG-------------FYGNPIKGIPCKSCDC---NQQGSQSLNCNEF-GICQCSPGVLGIKCDQCAPN-YVVEKKTCQSCYSGCTKDLLVRIDTLNETVINFKWKTLPS--------TLDLRLNKINISIQ-MSSELLNSINKFYKLKNEIKNFSIQFQKMKDDAKEKYGEIEK-LKTRYNKVLEDLRS-TFTDINETISGHEQLGISNELIKNATAYLETIKNIYKEMPNITLAASVLKDVL-KYVDELNQIIKYTQSHIQSDQINNLKILKNKTIMADEINTNNKEYLNTMSTKKKEHELYIILINERMKDLQKIFRKMTKQRDNLRKKIQK-LDAISKSFQDEKDLISINVREIEDLMKNLSSNHLVSKSLIIPDTLKKHVEQQLNKSSNLIKK 5980
            G  +NC    GN  G  C+LC +GF +N  N  Y  C  C+C     +      + +        CR+G  G  CE CQ G             ++G       C+ CDC   N     S  CN   G C C   + G  CD+C  N Y    + C  C   C + L   +  L + + + +   L          T    L   N+S++ +SS   NS      L  E+        K+ D  K    E+E+ LK R    L  L   T T   E +   + + ++  L+++    + +      +  N T   + LK+++ ++  + +  +   QS  Q+   N+   + +KT  A  + T+          ++      ++ + ++ + ++++  +       L   +   LD  S++ Q    L   N   +  + +               D  K +    + + SNL K+
Sbjct: 1117 GHVENCTCESGNYTGLSCELCNQGFTRNRPNNSYSACSLCRCTGRSLDCDGETGQCKG-------CRLGSQGLYCEQCQPGVDNTTDCTQCLPEYWGLKEGSNGCQDCDCVLPNTLYGNSTVCNATTGQCTCKEKISGRTCDRCHENAYNTSDRGCVECPE-CFRQLQEHVFKLRDGIKDLQGLILRVKNGDIGDITFAQSLAAANVSVEAISSNAKNSSGIEGTLHQELL-------KLNDTLK----ELERVLKGRVTSELTSLEGVTMTTQQERVQIQDHIRLTEGLVRSGYGVVTSTMQAAVDQANAT--DTYLKELVPRFTSQAS--MATNQSARQNGTGND---ITSKTSSAGALVTSADVTSLEAGLRQNMTSQLLVALEQQAQSVRRLATETNATAHALYANVTAVLDGASRALQAANGLGPDNAAAVLSVKR-------------AADDAKANASSAVQRVSNLTKQ 1553          
BLAST of Laminin subunit alpha-2 vs. Ensembl Nematostella
Match: EDO46760 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNY3])

HSP 1 Score: 212.231 bits (539), Expect = 1.973e-54
Identity = 178/560 (31.79%), Postives = 247/560 (44.11%), Query Frame = 2
Query: 2303 YRRVNNVLYQGQCEACACYNHSNTCDSLNG----------ECQNCTHNTAGAHCEDCASGYYGDAKSKNLN----SCKKCPCPRLD---YQMTELCSSYSSENY----VCHKCLHNTSGVHCDRCIEGYYGNPKKKIS----CKRCKCNN------------NQESCDPVTGECRCSYNTMGTECQLCKHGFYG--DALTKSCKKCDCDSLGSTSEN--CDKLTGKCDCRTNFVNRQCDSCTSGLY-LKD---KKCIPCNCEIQGRISSEKFCNTTSGQCFCLENVNGDRCEKCVEGY--FNYPNCKKCLCSP----HALSADCDLNNGKCKCGSNVINRICDKCENLHY---WNNRTDCVPCNC---GRGSLNPKCDMETGNCKCAQNVARRDCSKCDVGYFGLDVT---GCKKC------------PPCYNGQVCNNEGICVCPPNTIGNLCNKCSEDSWDFNETIGCKKCNCYINGSYSNICNKISGICACKTAFFGSKCDRCNEGYYGFP-NCQPCSCAENGTKSNELTKCDKITGQCQCKQNVIGTKCKVCRKGT 3763
            Y  +  VL  G+CE   C+ H+     + G          EC   T  T G  CE C   Y   A  +  N     C KC C       Y  + L  S +S       VC  CLHNT+G  C  C + ++  P K +S    C  C+C              +  +   + G+C C   T G +C  CK GFY    + +  C  C C++ G+ + N  CD+  G+C C++N   R CD+C SG Y L+D     C  C C+  G +     C+  SGQC C     G RC  C +GY   +   CK C CS       L   CD  NG+C C + V  + CD+C+  +Y     N+  C  C+C   G    +  C++ +GNC C + V    C +C  GYF L  +   GC+ C             P    +   + G C C  N  G  C++C    +      GC  CNC  +GS +  CN  +G C CK    G +CDRC  G YG P +C+PC+C   G+ S+    CD  +G+C CK NV G KC  C+ GT
Sbjct:  487 YFALKRVLVTGRCE---CHGHAQKVTFIKGNSSSPGRCRCECDPSTF-TQGEKCESCLPMYNNKAFLRGTNDDPYPCVKCECNNHATACYYNSSLDPSPASRTVGGGGVCINCLHNTAGQFCHVCRDDFFREPGKSLSAVDVCSPCQCTGPGVETGKTSCARDDSTPGVIAGQCECKQYTQGRQCDACKPGFYDLKSSHSTGCVTCGCNTAGTVNRNASCDQSRGQCYCKSNVTGRTCDTCESGFYGLRDNDPSGCRACECDPFGTLPG-SVCDAGSGQCRCKAGSTGLRCHLCEDGYHSLDSSGCKTCNCSTIGAKPGLVNTCDKTNGQCYCKTYVEGKTCDRCKTGYYNLTTVNQDGCSLCSCDPKGIQGSSLTCEVSSGNCTCKKYVREPTCGQCMKGYFNLSSSNPEGCQACNCNPKGTLGGDRTPAGELECSGSNGKCACLTNVQGLRCDQCVSAYYWNPSGYGCSPCNCDASGSLATNCNS-TGYCQCKPNIGGRRCDRCMPGSYGGPGSCKPCNCNMAGSLSD---TCDD-SGKCNCKPNVQGDKCDTCKDGT 1036          

HSP 2 Score: 182.185 bits (461), Expect = 2.120e-45
Identity = 163/520 (31.35%), Postives = 223/520 (42.88%), Query Frame = 2
Query: 2246 KCNCPPGF--NGLSCESCESGY------RRVNNVLYQGQCEACACYNHSNTC---DSLN-----------GECQNCTHNTAGAHCEDCASGYYGDAKSKNLNSCKKC-PC----PRLDYQMTELCSSYSSENYVCHKC--LHNTSGVHCDRCIEGYYG-NPKKKISCKRCKCN-----NNQESCDPVTGECRCSYNTMGTECQLCKHGFYG--DALTKSCKKCDCDSLGSTSEN-CDKLTGKCDCRTNFVNRQCDSCTSGLY-LKDKKCIPCNCE-IQGRISSEKFCNTTSGQCFCLENVNGDRCEKCVEGYFNYP-----NCKKCLCSPHAL---SADCDLNNGKCKCGSNVINRICDKCENLHY---WNNRTDCVPCNCG-RGSL----NPKCDME----TGNCKCAQNVARRDCSKCDVGYF-GLDVTGCKKCPPCYNGQV---CNNEGICVCPPNTIGNLCNKCSEDSWDFNETIGCKKCNCYINGSYSNICNKISGICACKTAFFGSKCDRCNEG 3613
            +C C P     G  CESC   Y      R  N+  Y   C  C C NH+  C    SL+           G C NC HNTAG  C  C   ++ +   K+L++   C PC    P ++   T      S+   +  +C     T G  CD C  G+Y         C  C CN     N   SCD   G+C C  N  G  C  C+ GFYG  D     C+ C+CD  G+   + CD  +G+C C+      +C  C  G + L    C  CNC  I  +      C+ T+GQC+C   V G  C++C  GY+N        C  C C P  +   S  C++++G C C   V    C +C   ++    +N   C  CNC  +G+L     P  ++E     G C C  NV    C +C   Y+      GC  C    +G +   CN+ G C C PN  G  C++C   S+    +  CK CNC + GS S+ C+  SG C CK    G KCD C +G
Sbjct:  522 RCECDPSTFTQGEKCESCLPMYNNKAFLRGTNDDPYP--CVKCECNNHATACYYNSSLDPSPASRTVGGGGVCINCLHNTAGQFCHVCRDDFFRE-PGKSLSAVDVCSPCQCTGPGVETGKTSCARDDSTPGVIAGQCECKQYTQGRQCDACKPGFYDLKSSHSTGCVTCGCNTAGTVNRNASCDQSRGQCYCKSNVTGRTCDTCESGFYGLRDNDPSGCRACECDPFGTLPGSVCDAGSGQCRCKAGSTGLRCHLCEDGYHSLDSSGCKTCNCSTIGAKPGLVNTCDKTNGQCYCKTYVEGKTCDRCKTGYYNLTTVNQDGCSLCSCDPKGIQGSSLTCEVSSGNCTCKKYVREPTCGQCMKGYFNLSSSNPEGCQACNCNPKGTLGGDRTPAGELECSGSNGKCACLTNVQGLRCDQCVSAYYWNPSGYGCSPCNCDASGSLATNCNSTGYCQCKPNIGGRRCDRCMPGSYGGPGS--CKPCNCNMAGSLSDTCDD-SGKCNCKPNVQGDKCDTCKDG 1035          

HSP 3 Score: 158.688 bits (400), Expect = 3.265e-38
Identity = 135/470 (28.72%), Postives = 203/470 (43.19%), Query Frame = 2
Query: 2588 TSGVHCDRCIEGY------YGNPKKKISCKRCKCNNNQESC------DPVT--------GEC-RCSYNTMGTECQLCKHGFY---GDALTKS--CKKCDCDSLG--STSENCDK-------LTGKCDCRTNFVNRQCDSCTSGLY-LKDKK---CIPCNCEIQGRISSEKFCNTTSGQCFCLENVNGDRCEKCVEGYF----NYPN-CKKCLCSPHAL--SADCDLNNGKCKCGSNVINRICDKCENLHYWNNRTDCVPCNCGRGSLNP----KCDMETGNCKCAQNVARRDCSKCDVGYFGLDVT---GCKKC---PPCYNGQVCN---NEGICVCPPNTIGNLCNKCSEDSWDFNET--IGCKKCNCYINGSYSNI--------CNKISGICACKTAFFGSKCDRCNEGYYGFPN---CQPCSCAENGTKSNELTKCDKITGQCQCKQNVIGTKCKVCRKGTFPSDGT 3781
            T G  C+ C+  Y       G       C +C+CNN+  +C      DP          G C  C +NT G  C +C+  F+   G +L+    C  C C   G  +   +C +       + G+C+C+     RQCD+C  G Y LK      C+ C C   G ++    C+ + GQC+C  NV G  C+ C  G++    N P+ C+ C C P      + CD  +G+C+C +      C  CE+ ++  + + C  CNC      P     CD   G C C   V  + C +C  GY+ L      GC  C   P    G       + G C C        C +C +  ++ + +   GC+ CNC   G+            C+  +G CAC T   G +CD+C   YY  P+   C PC+C  +G+ +   T C+  TG CQCK N+ G +C  C  G++   G+
Sbjct:  531 TQGEKCESCLPMYNNKAFLRGTNDDPYPCVKCECNNHATACYYNSSLDPSPASRTVGGGGVCINCLHNTAGQFCHVCRDDFFREPGKSLSAVDVCSPCQCTGPGVETGKTSCARDDSTPGVIAGQCECKQYTQGRQCDACKPGFYDLKSSHSTGCVTCGCNTAGTVNRNASCDQSRGQCYCKSNVTGRTCDTCESGFYGLRDNDPSGCRACECDPFGTLPGSVCDAGSGQCRCKAGSTGLRCHLCEDGYHSLDSSGCKTCNCSTIGAKPGLVNTCDKTNGQCYCKTYVEGKTCDRCKTGYYNLTTVNQDGCSLCSCDPKGIQGSSLTCEVSSGNCTCKKYVREPTCGQCMKGYFNLSSSNPEGCQACNCNPKGTLGGDRTPAGELECSGSNGKCACLTNVQGLRCDQCVSAYYWNPSGYGCSPCNCDASGSLA---TNCNS-TGYCQCKPNIGGRRCDRCMPGSYGGPGS 996          

HSP 4 Score: 130.568 bits (327), Expect = 9.756e-30
Identity = 96/295 (32.54%), Postives = 133/295 (45.08%), Query Frame = 2
Query: 2246 KCNCPPGFNGLSCESCESGYRRVNNVLYQGQCEACACYNHS------NTCDSLNGECQNCTHNTAGAHCEDCASGYYGDAKSKNLNSCKKCPCPRLDYQMTELCSSYSSENYVCHKCLHNTSGVHCDRCIEGYY----GNPKKKISCKRCKCN-----------NNQESCDPVTGECRCSYNTMGTECQLCKHGFYGDALTKSCKKCDCDSLGSTSENCDKLTGKCDCRTNFVNRQCDSCTSGLYLKDKKCIPCNCEIQGRISSEKFCNTTSGQCFCLENVNGDRCEKCVEGYFN 3067
            +C C  G  GL C  CE GY  +++      C+ C C          NTCD  NG+C  C     G  C+ C +GYY +  + N + C  C C     Q + L    SS N  C K +   +   C +C++GY+     NP+    C+ C CN             +  C    G+C C  N  G  C  C   +Y +     C  C+CD+ GS + NC+  TG C C+ N   R+CD C  G Y     C PCNC + G +S    C+  SG+C C  NV GD+C+ C +G  N
Sbjct:  760 QCRCKAGSTGLRCHLCEDGYHSLDS----SGCKTCNCSTIGAKPGLVNTCDKTNGQCY-CKTYVEGKTCDRCKTGYY-NLTTVNQDGCSLCSCDPKGIQGSSLTCEVSSGNCTCKKYVREPT---CGQCMKGYFNLSSSNPE---GCQACNCNPKGTLGGDRTPAGELECSGSNGKCACLTNVQGLRCDQCVSAYYWNPSGYGCSPCNCDASGSLATNCNS-TGYCQCKPNIGGRRCDRCMPGSYGGPGSCKPCNCNMAGSLSDT--CD-DSGKCNCKPNVQGDKCDTCKDGTQN 1038          

HSP 5 Score: 127.487 bits (319), Expect = 8.285e-29
Identity = 125/462 (27.06%), Postives = 192/462 (41.56%), Query Frame = 2
Query:  329 RNETKRHPIEFAKSDDDNLWWQSPSMAQGLKYQNVNVTIDL-KQVYQIVYILLKMGDSPRPGNWILERSLD-GEIYMPWIFFAETPYSCYNLFQRQYPDLKLTTNAKPSSLADDEMFCTTYYSQPKSLNSGEIIISLINGRKSIMNEEYLSIKSVPQTLINFLSARYIRFRFLKHLTLAADLMTHKGYLEQSIYNRYYYSLRNIEIGGKCICNNHADKCDKVIENGISVAKCNCKHN----TCGSNCETCCPLFNQRPW------KPVAVCEECNCNRKSNECSYNQTVATLQLSVNKMGRMEGGGVCINCQENTEGINCEKCIKGFYRPWNVLATELYPCTPCQCHGLGTIGSCVSNGEDIGDQKP----GDCICKKGYEGVNCDLCSIGYERYPNGE---CLPCPCSIDGSV--RTSFYRCKPPCNCKVHVNSDDLCKTCKNGYFNLDSANPEGCEPCYC 1651
            R  T  HP E+    D   +WQS          N  V +DL  Q  QI ++++ +   P P   ++ERS D G  Y PW +FA    S + +                + +  D + C  Y  Q    +     ++ I G  S  +      +  P T      A  +R +   H  +  +   H+           Y++L+ + + G+C C+ HA K   +  N  S  +C C+ +    T G  CE+C P++N + +       P   C +C CN  +  C YN ++     S      + GGGVCINC  NT G  C  C   F+R      + +  C+PCQC G G      S   D  D  P    G C CK+  +G  CD C  G+    +     C+ C C+  G+V    S  + +  C CK +V +   C TC++G++ L   +P GC  C C
Sbjct:  326 RLATTAHPSEYMTDADTTTYWQSAVT------DNATVEVDLLYQELQIFFVIM-LFYGPPPEAILIERSRDRGSTYKPWQYFASDCQSSFGMENNG------------NLVNPDSINCIQY--QRCECHGHAQKVTFIKGNSS--SPGRCRCECDPSTFTQGEKASNVRIQLYNHTLIQNE--KHR-----------YFALKRVLVTGRCECHGHAQKVTFIKGNSSSPGRCRCECDPSTFTQGEKCESCLPMYNNKAFLRGTNDDPYP-CVKCECNNHATACYYNSSLDPSPASRT----VGGGGVCINCLHNTAGQFCHVCRDDFFREPGKSLSAVDVCSPCQCTGPGVETGKTSCARD--DSTPGVIAGQCECKQYTQGRQCDACKPGFYDLKSSHSTGCVTCGCNTAGTVNRNASCDQSRGQCYCKSNV-TGRTCDTCESGFYGLRDNDPSGCRACEC 743          

HSP 6 Score: 90.8929 bits (224), Expect = 9.017e-18
Identity = 106/400 (26.50%), Postives = 148/400 (37.00%), Query Frame = 2
Query: 2798 KCDCDSLGSTSENCDKLTGKCDCRTNFVNRQCDSCTSGLYLKDKKC-IPCNCEIQGRISSEKFC---NTTSGQCFC----LENVNGDRCEKCVEGYFN-----------YPNCKKCLCSPHALS-----------ADCDLNNGKC--KCGSNVINRICDKCENLHYWNNRTD------CVPCNC-GRGSLNPKCD---------METGNCKCAQNVARRDCSKCDVGYFGLDV---TGCKKCPPCYNGQVCNN------EGICVCPPNTIGNLCNKCSEDSWDF--NETIGCKKCNCYINGSY-SNICNKISGICACKTAFFGSKCDRCNEGYYGF--PNCQPCSCAENGTKSNELTKCDKITGQCQCKQNVIGTKCKVCRKGTFPSDGTYEGGCFSCFC 3811
            +C+CD   ST    +K +   + R    N          Y   K+  +   CE  G      F    +++ G+C C         G++CE C+  Y N           YP C KC C+ HA +           A   +  G     C  N   + C  C +  +            C PC C G G    K           +  G C+C Q    R C  C  G++ L     TGC  C     G V  N       G C C  N  G  C+ C    +    N+  GC+ C C   G+   ++C+  SG C CK    G +C  C +GY+      C+ C+C+  G K   +  CDK  GQC CK  V G  C  C+ G +      + GC  C C
Sbjct:  453 RCECDP--STFTQGEKAS---NVRIQLYNHTLIQNEKHRYFALKRVLVTGRCECHGHAQKVTFIKGNSSSPGRCRCECDPSTFTQGEKCESCLPMYNNKAFLRGTNDDPYP-CVKCECNNHATACYYNSSLDPSPASRTVGGGGVCINCLHNTAGQFCHVCRDDFFREPGKSLSAVDVCSPCQCTGPGVETGKTSCARDDSTPGVIAGQCECKQYTQGRQCDACKPGFYDLKSSHSTGCVTCGCNTAGTVNRNASCDQSRGQCYCKSNVTGRTCDTCESGFYGLRDNDPSGCRACECDPFGTLPGSVCDAGSGQCRCKAGSTGLRCHLCEDGYHSLDSSGCKTCNCSTIGAKPGLVNTCDKTNGQCYCKTYVEGKTCDRCKTGYYNLTTVNQDGCSLCSC 846          

HSP 7 Score: 78.5666 bits (192), Expect = 4.873e-14
Identity = 59/174 (33.91%), Postives = 73/174 (41.95%), Query Frame = 2
Query: 4538 KEYFNLPNSTKSGSMRTGNRILINLKKCNCNGYSKV-----------CDSVTGDCQNCMGNREGNKCQLCREGFYKNDKNYDQCEPCQCPSAHYNFAQNCTRIESSLELKCQCRIGYSGKSCENCQQGFYGNPIKGIPCKSCDCNQQGSQSLNCNEFGICQCSPGVLGIKCDQC 5026
            K YFNL +S   G            + CNCN    +           C    G C  C+ N +G +C  C   +Y N   Y  C PC C  A  + A NC          CQC+    G+ C+ C  G YG P     CK C+CN  GS S  C++ G C C P V G KCD C
Sbjct:  881 KGYFNLSSSNPEG-----------CQACNCNPKGTLGGDRTPAGELECSGSNGKCA-CLTNVQGLRCDQCVSAYYWNPSGYG-CSPCNC-DASGSLATNCNSTG-----YCQCKPNIGGRRCDRCMPGSYGGPGS---CKPCNCNMAGSLSDTCDDSGKCNCKPNVQGDKCDTC 1032          

HSP 8 Score: 75.485 bits (184), Expect = 5.228e-13
Identity = 70/233 (30.04%), Postives = 90/233 (38.63%), Query Frame = 2
Query:  998 GISVAKCNCKHNTCGSNCETCCPLFNQRPWKPVAVCEECNCNRKSNECSYNQTVATLQLSVNKMGR-MEGGGVCINCQENTEGINCEKCIKGFYRPWNVLATELYPCTPCQCHGLGTIGSCVSNGEDIGDQKPGDCICKKGYEGVNCDLCSIGYERYPNGECLPCPCSIDGSVRTSFYRCKPP---CNCKVHVNSDDLCKTCKNGYFNLDSANPEGCEPCYCFGITNQCSSLS 1684
            G+   +C CK  T G  C+ C P F          C  C CN                 +VN+     +  G C  C+ N  G  C+ C  GFY    +   +   C  C+C   GT+   V       D   G C CK G  G+ C LC  GY    +  C  C CS  G+       C      C CK +V     C  CK GY+NL + N +GC  C C     Q SSL+
Sbjct:  650 GVIAGQCECKQYTQGRQCDACKPGFYDLKSSHSTGCVTCGCNTAG--------------TVNRNASCDQSRGQCY-CKSNVTGRTCDTCESGFY---GLRDNDPSGCRACECDPFGTLPGSVC------DAGSGQCRCKAGSTGLRCHLCEDGYHSLDSSGCKTCNCSTIGAKPGLVNTCDKTNGQCYCKTYVEGKT-CDRCKTGYYNLTTVNQDGCSLCSCDPKGIQGSSLT 857          

HSP 9 Score: 66.6254 bits (161), Expect = 2.012e-10
Identity = 79/254 (31.10%), Postives = 102/254 (40.16%), Query Frame = 2
Query:  914 YYSLRNIEIGGKCICNNHADKCDKVIENG------ISVAKCNCKHNTCGSNCETCCP-LFNQRPWKPVAVCEECNCNRKSNECSYNQTVATLQLSVNKMGRME---GGGVCINCQENTEGINCEKCIKGFYRPWNVLATELYPCTPCQCHGLGTIGS-CVSNGEDIGDQKPGDCICKKGYEGVNCDLCSIGYERYPNGECLPCPCSIDGSVRTSFYRCKPP--CNCKVHVNSDDLCKTCKNGYFNLDSANPEGC 1636
            YY+L  +   G  +C+     CD     G      +S   C CK       C  C    FN     P   C+ CNCN K           TL       G +E     G C  C  N +G+ C++C+  +Y  WN      Y C+PC C   G++ + C S G          C CK    G  CD C  G    P G C PC C++ GS+  +   C     CNCK +V  D  C TCK+G  NL   N  GC
Sbjct:  830 YYNLTTVNQDGCSLCS-----CDPKGIQGSSLTCEVSSGNCTCKKYVREPTCGQCMKGYFNLSSSNPEG-CQACNCNPK----------GTLGGDRTPAGELECSGSNGKCA-CLTNVQGLRCDQCVSAYY--WNPSG---YGCSPCNCDASGSLATNCNSTGY---------CQCKPNIGGRRCDRCMPGSYGGP-GSCKPCNCNMAGSLSDT---CDDSGKCNCKPNVQGDK-CDTCKDGTQNLQVNNDFGC 1047          

HSP 10 Score: 65.855 bits (159), Expect = 3.589e-10
Identity = 46/150 (30.67%), Postives = 67/150 (44.67%), Query Frame = 2
Query: 4631 GYSKVCDSVTGDCQNCMGNREGNKCQLCREGFYK-NDKNYDQCEPCQC-PSAHYNFAQN-CTRIE-SSLELKCQCRIGYSGKSCENCQQGFYGNPIKGIPCKSCDCNQQGSQSLNCNEFGICQCSPGVLGIKCDQCAPNYVVEKKTCQSC 5068
            G S  C+  +G+C  C        C  C +G++  +  N + C+ C C P       +     +E S    KC C     G  C+ C   +Y NP  G  C  C+C+  GS + NCN  G CQC P + G +CD+C P       +C+ C
Sbjct:  853 GSSLTCEVSSGNC-TCKKYVREPTCGQCMKGYFNLSSSNPEGCQACNCNPKGTLGGDRTPAGELECSGSNGKCACLTNVQGLRCDQCVSAYYWNP-SGYGCSPCNCDASGSLATNCNSTGYCQCKPNIGGRRCDRCMPGSYGGPGSCKPC 1000          

HSP 11 Score: 60.4622 bits (145), Expect = 1.484e-8
Identity = 42/134 (31.34%), Postives = 62/134 (46.27%), Query Frame = 2
Query: 4661 GDCQNCMGNREGNKCQLCREGFY----KNDKNYDQCEPCQCPSAHYNFAQ-NCTRIESS---LELKCQCRIGYSGKSCENCQQGFYG-NPIKGIPCKSCDCNQQGSQSLNCN---EFGICQCSPGVLGIKCDQC 5026
            G C NC+ N  G  C +CR+ F+    K+    D C PCQC        + +C R +S+   +  +C+C+    G+ C+ C+ GFY         C +C CN  G+ + N +     G C C   V G  CD C
Sbjct:  590 GVCINCLHNTAGQFCHVCRDDFFREPGKSLSAVDVCSPCQCTGPGVETGKTSCARDDSTPGVIAGQCECKQYTQGRQCDACKPGFYDLKSSHSTGCVTCGCNTAGTVNRNASCDQSRGQCYCKSNVTGRTCDTC 723          

HSP 12 Score: 51.6026 bits (122), Expect = 8.609e-6
Identity = 42/163 (25.77%), Postives = 75/163 (46.01%), Query Frame = 2
Query: 4604 INLKKCNCNGYSKVCDSVTGDCQNCMGNREGNKCQLCREGFYKNDKNYDQ-CEPCQCPSAH-YNFAQNCTRIESSLELKCQCRIGYSGKSCENCQQGFYG---NPIKGIPCKSCDCNQQGSQSLNCNEFGI--CQCSPGVLGIKCDQCAPNY-VVEKKTCQSC 5068
            +   K +C         + G C+ C    +G +C  C+ GFY    ++   C  C C +A   N   +C +       +C C+   +G++C+ C+ GFYG   N   G  C++C+C+  G+   +  + G   C+C  G  G++C  C   Y  ++   C++C
Sbjct:  635 VETGKTSCARDDSTPGVIAGQCE-CKQYTQGRQCDACKPGFYDLKSSHSTGCVTCGCNTAGTVNRNASCDQSRG----QCYCKSNVTGRTCDTCESGFYGLRDNDPSG--CRACECDPFGTLPGSVCDAGSGQCRCKAGSTGLRCHLCEDGYHSLDSSGCKTC 790          
BLAST of Laminin subunit alpha-2 vs. Ensembl Medaka
Match: lamc1 (laminin subunit gamma 1 [Source:NCBI gene;Acc:100529197])

HSP 1 Score: 428.328 bits (1100), Expect = 3.834e-122
Identity = 313/1056 (29.64%), Postives = 492/1056 (46.59%), Query Frame = 2
Query:  197 NAKITSSATCGTGGPEIFCRLVDEIAIQRLINPDSHVLCDVCDNRNETKRHPIEFA---KSDDDNLWWQSPSMAQGLKYQ-NVNVTIDLKQVYQIVYILLKMGDSPRPGNW-ILERSLDGEIYMPWIFFAETPYSCYNLFQRQYPDLKLTTNAKPSSLADDEM--FCTTYYSQPKSLNSGEIIISLINGRKSIMNEEYLSIKSVPQTLINFLSARYIRFRFLKHLTLAADLMTHKGYLEQSIYNRYYYSLRNIEIGGKCICNNHADKCDKVIENGISVAKCNCKHNTCGSNCETCCPLFNQRPWKPVAV-----CEECNCNRKSNECSYNQTVATLQLSVNKMGRMEG-GGVCINCQENTEGINCEKCIKGFYRPWNVLATELYPCTPCQCHGLGTIGSCVSNGEDIGDQKPGDCICKKGYEGVNCDLCSIGYERYPNGECLPCPCSIDGSVRTSFYRCKPPCNCKVHVNSDDLCKTCKNGYFNLDSANPEGCEPCYCFGITNQCSSL---SAKNLKISDLKG---WKLTTFTGEKIALPKFTSFQYLT-SENSYIDERFNNPTVYYWTAPPPYLGNWITSYGTIFRYVVKIELQSTLKGSLIDSPDVIIKCGDFR-----LFHSVSIEDRRLQRQVFIYIKPTE--WKIGKLTPDKAATKEEFISCLVKVDKLLIKAKYYSNQKSIELLN----ITLSRGEVHLALDEMPHIEKCNCPPGFNGLSCESCESGYRRVNNVLYQ-GQCEACACYNHSNTCDSLNGECQNCTHNTAGAHCEDCASGYYGDAKSKNLNSCKKCPCPRLDYQMTELCSSY-SSENYVCHKCLHNTSGVHCDRCIEGYYGNPKKK----ISCKRCKCNNNQE-----SCDPVTGEC-RCSYNTMGTECQLCKHGFYGDALT----KSCKKCDCDSLGSTSE--NCDKLTGKCDCRTNFVNRQCDSCTSGLY--LKDKKCIPCNCEIQGRISSEKFCNTTSGQCFCLENVNGDRCEKCVEGYFNYPN--CKKCLCSPHALSADCDLNNGKCKCGSNVINRICDKCENLHYWN 3205
            N  + ++ TCG+  PE +C       + +         C +CD R+    H   +     +  D  WWQS +M  G++Y  ++N+T+ L + + I Y+ LK   S RP ++ I +R+ +G  ++P+ +++    SC   +Q+         N      ADDE    CT  +S    L  G +  S + GR S  N +   +      L ++++A  I+    +  T   ++     + +  +   YYY++ +  +GG+C CN HA +C   ++N +    C+CKHNT G +C TC P FN RPW+         C  CNCN KS EC ++           ++ R  G GG C NC +NT+G NCE+C+  +YR  +        C PC C  +G++      G        G C CK G  G  CD C  GY       C  C CS  GS +         C CK +V     C  CK G+FNLD  NP+GC PC+CF  ++ C+S    S  ++  S   G   W+     G  +++    S Q ++ S +S++          Y+ AP  +LGN I SYG       ++E     +   + + D+I++  + R     +    +  +  +Q  VF     T+  W+          +  +F   L  +  + I+  Y  +++S   L+    +T  RG    A      +E+C+CP G+ G  CE C  GYRR    L     CE C+C  HS+ C+ + G C +C  NTAG  CE C  G+YGDA   + N C+ CPCP         C+   S+   VC  C   T+G  C+ C +G++G+P  +     SC +C C+ N +     +C+  TGEC +C  +T G  C  CK GFYG+AL+    K CK C C   G+  +  +C ++TG+C+C  N   R C +C  G +     K C  CNC   G  + +  C+  +GQC C   V+G  C++C   +F + +  CK C C     S+    ++G+C+C    +   CD CE  +++N
Sbjct:   46 NVTVVATNTCGSP-PEEYCVQTGATGVTKS--------CHICDARDPRNHHGAAYLTDYNNHQDATWWQSQTMLAGVQYPYSINLTLHLGKAFDITYVRLKFHTS-RPESFAIYKRTKEGGPWVPYQYYS---GSCEKTYQK--------VNRGFIRTADDEQQALCTDEFSDISPLTGGNVAFSTLEGRPSSHNFDNSPV------LQDWVTATDIKVTLNRLNTFGDEV-----FNDPKVLKSYYYAISDFAVGGRCKCNGHASEC---VKNSVGRLVCDCKHNTAGDDCNTCRPFFNDRPWRRATADSANECLSCNCNGKSAECYFDP----------ELYRATGHGGHCRNCADNTDGPNCERCLDNYYRDQSG-----NRCQPCSCSPIGSLSPQCDRG--------GVCACKPGVTGEKCDRCLPGYHSLTEAGCRQCSCSPAGSTQECDV-ATGQCRCKENVEGFS-CDRCKLGFFNLDPHNPQGCTPCFCFQHSSVCNSAEGYSVHSITSSFTNGNEQWRGQQQDGSSVSIQWSPSGQEVSLSSDSFL--------PMYFVAPEKFLGNQILSYGQNLSLNFRVE----RRDHRLSAEDLILEGANMRVAVPLIAQGNAYPNENMQTYVFRLHDSTDYPWR-------PHISHADFQKLLQNLTAIKIRGTY--SERSAGFLDDVSLVTARRGPGVPAR----WVEQCDCPQGYQGQHCEQCTLGYRRARPDLGAFSPCEPCSCNGHSDACNPVTGAC-DCQDNTAGLSCERCKDGFYGDATQGSPNDCQPCPCP-----GGATCAIVPSTREVVCTNCPTGTTGKRCELCDDGHFGDPLGQNGPVRSCHKCMCSGNIDLNAVGNCNRETGECLKCVNDTEGFFCDRCKEGFYGNALSTGPGKRCKSCSCSPFGTVGQQTSCSEVTGQCECLPNVAERDCSACQPGHFNLQSGKGCERCNCNPIGSTNGQ--CDIVTGQCECQPGVSGLHCDRCEVNFFGFSSSGCKPCDCDSEGSSSGQCKDDGRCQCRPGFVGARCDMCEENYFYN 1008          

HSP 2 Score: 164.466 bits (415), Expect = 9.440e-40
Identity = 156/577 (27.04%), Postives = 252/577 (43.67%), Query Frame = 2
Query: 3419 CPPNTIGNLCNKCSEDSWDFNETIGCKKCNCYINGSYSNICNKISGICACKTAFFGSKCDRCNEGYYGF--PNCQPCSCAENGTKSNELTKCDKITGQCQCKQNVIGTKCKVCRKGTFPSDGTYEGGCFSCFCFGVSEKCHAILNHRIVENSIYEYHIFDEKNSLESGKDYSTIHLN-ANYPRRFGWPLTMFRPIYVNVMKLFNSHDLSLFYRSIFMNVSVDCLDNKCGREIPEQTEVFMESYNGLFGMRYXXXXXXXXXXXXXXDFNEHSKNGKWVISQ---YQNDILDKFII-LEDSN--VINSNLTRDIFMMALLNVTSLKVK-LYTDKVNPPLIKIKIITYKVMETTQAIGKRVTAVEKCICNALTFGNHCQNPISGYYKEYFNLPNSTKSGSMRTGNRILINLKKCNCNGYSKVCDSVTGDCQNCMGNREGNKCQLCREGFYKN--DKNYDQCEPCQCPSAHYNFAQNCTRIESSLELKC-QCRIGYSGKSCENCQQGFYGNPI-KGIPCKSC-DCNQQGSQSL----NCN-EFGIC-QCSPGVLGIKCDQCAPNY------VVEKKTCQSC 5068
            C  NT G  C +C ++ +       C+ C+C   GS S  C++  G+CACK    G KCDRC  GY+      C+ CSC+  G+      +CD  TGQC+CK+NV G  C  C+ G F  D     GC  CFCF  S  C++   + +  +SI        +      +D S++ +  +   +        F P+Y    + F  + +  + +++ +N  V+  D++   E     ++ +E  N    MR  V                       +I+Q   Y N+ +  ++  L DS       +++   F   L N+T++K++  Y+++    L  + ++T +     +  G     VE+C C     G HC+    GY +   +L                   + C+CNG+S  C+ VTG C +C  N  G  C+ C++GFY +    + + C+PC CP         C  + S+ E+ C  C  G +GK CE C  G +G+P+ +  P +SC  C   G+  L    NCN E G C +C     G  CD+C   +          K C+SC
Sbjct:  356 CADNTDGPNCERCLDNYYRDQSGNRCQPCSCSPIGSLSPQCDR-GGVCACKPGVTGEKCDRCLPGYHSLTEAGCRQCSCSPAGSTQ----ECDVATGQCRCKENVEGFSCDRCKLGFFNLDPHNPQGCTPCFCFQHSSVCNSAEGYSV--HSITSSFTNGNEQWRGQQQDGSSVSIQWSPSGQEVSLSSDSFLPMYFVAPEKFLGNQILSYGQNLSLNFRVERRDHRLSAE-----DLILEGAN----MRVAVP----------------------LIAQGNAYPNENMQTYVFRLHDSTDYPWRPHISHADFQKLLQNLTAIKIRGTYSERSAGFLDDVSLVTAR-----RGPGVPARWVEQCDCPQGYQGQHCEQCTLGYRRARPDLG-------------AFSPCEPCSCNGHSDACNPVTGAC-DCQDNTAGLSCERCKDGFYGDATQGSPNDCQPCPCPG-----GATCAIVPSTREVVCTNCPTGTTGKRCELCDDGHFGDPLGQNGPVRSCHKCMCSGNIDLNAVGNCNRETGECLKCVNDTEGFFCDRCKEGFYGNALSTGPGKRCKSC 870          

HSP 3 Score: 152.91 bits (385), Expect = 3.076e-36
Identity = 109/345 (31.59%), Postives = 160/345 (46.38%), Query Frame = 2
Query: 2576 CLHNTSGVHCDRCIEGYY-GNPKKKI--SCKRCKCNNNQESCDPVTGECRCSYNTMGTECQLCKHGFYGDALTKS---CKKCDCDSLGSTSENCDKLTGKC-DCRTNFVNRQCDSCTSGLYLKD-------KKCIPCNCEIQGRISSEKFCNTTSGQCF-CLENVNGDRCEKCVEGYFNYP-------NCKKCLCSPHAL---SADCDLNNGKCKCGSNVINRICDKCENLHY-WNNRTDCVPCNCGR-GSLNPKCDMETGNCKCAQNVARRDCSKCDVGYFGLDVTGCKKC----PPCYNGQVCNNEGICVCPPNTIGNLCNKCSEDSWDFNETIGCKKC-NCY 3514
            C     G HC++C  GY    P       C+ C CN + ++C+PVTG C C  NT G  C+ CK GFYGDA   S   C+ C C    + +         C +C T    ++C+ C  G +          + C  C C     +++   CN  +G+C  C+ +  G  C++C EG++           CK C CSP         C    G+C+C  NV  R C  C+  H+   +   C  CNC   GS N +CD+ TG C+C   V+   C +C+V +FG   +GCK C        +GQ C ++G C C P  +G  C+ C E+ +      GC++C +CY
Sbjct:  678 CPQGYQGQHCEQCTLGYRRARPDLGAFSPCEPCSCNGHSDACNPVTGACDCQDNTAGLSCERCKDGFYGDATQGSPNDCQPCPCPGGATCAIVPSTREVVCTNCPTGTTGKRCELCDDGHFGDPLGQNGPVRSCHKCMCSGNIDLNAVGNCNRETGECLKCVNDTEGFFCDRCKEGFYGNALSTGPGKRCKSCSCSPFGTVGQQTSCSEVTGQCECLPNVAERDCSACQPGHFNLQSGKGCERCNCNPIGSTNGQCDIVTGQCECQPGVSGLHCDRCEVNFFGFSSSGCKPCDCDSEGSSSGQ-CKDDGRCQCRPGFVGARCDMCEENYFYNRSVPGCQQCPSCY 1021          

HSP 4 Score: 117.857 bits (294), Expect = 1.453e-25
Identity = 97/342 (28.36%), Postives = 147/342 (42.98%), Query Frame = 2
Query: 2855 KCDCRTNFVNRQCDSCTSGLYLKDKK-------CIPCNCEIQGRISSEKFCNTTSGQCFCLENVNGDRCEKCVEGYFN-----YPN-CKKCLCSPHALSADCDLNNGKC--KCGSNVINRICDKCENLHYWNNR------TDCVPCNC-GRGSLNP--KCDMETGNC-KCAQNVARRDCSKCDVGYFG--LDVTGCKKCPPC-------YNGQVCNNE--GICVCPPNTIGNLCNKCSEDSWDFNETIGCKKCNCYINGSYSNICNKISGICACKTAFFGSKCDRCNEGYYGFPN--CQPCSCAENGTKSNELTKCDKITGQCQCKQNVIGTKCKVCRKGTF 3766
            +CDC   +  + C+ CT G Y + +        C PC+C           CN  +G C C +N  G  CE+C +G++       PN C+ C C   A  A            C +    + C+ C++ H+ +          C  C C G   LN    C+ ETG C KC  +     C +C  G++G  L     K+C  C          Q   +E  G C C PN     C+ C    ++     GC++CNC   GS +  C+ ++G C C+    G  CDRC   ++GF +  C+PC C   G+ S +     K  G+CQC+   +G +C +C +  F
Sbjct:  675 QCDCPQGYQGQHCEQCTLG-YRRARPDLGAFSPCEPCSCN-----GHSDACNPVTGACDCQDNTAGLSCERCKDGFYGDATQGSPNDCQPCPCPGGATCAIVPSTREVVCTNCPTGTTGKRCELCDDGHFGDPLGQNGPVRSCHKCMCSGNIDLNAVGNCNRETGECLKCVNDTEGFFCDRCKEGFYGNALSTGPGKRCKSCSCSPFGTVGQQTSCSEVTGQCECLPNVAERDCSACQPGHFNLQSGKGCERCNCNPIGSTNGQCDIVTGQCECQPGVSGLHCDRCEVNFFGFSSSGCKPCDCDSEGSSSGQC----KDDGRCQCRPGFVGARCDMCEENYF 1006          

HSP 5 Score: 101.679 bits (252), Expect = 1.374e-20
Identity = 165/714 (23.11%), Postives = 285/714 (39.92%), Query Frame = 2
Query: 4613 KKCNCNGYSKV-----CDSVTGDCQNCMGNREGNKCQLCREGFYKNDKNYDQCEPCQCPSAHYNFAQNCTRIESSLELKCQCRIGYSGKSCENCQQGFYGNPIKGIPCKSCDCNQQGSQSLNCNEFGICQCSPGVLGIKCDQCAPNYVVEK-----KTCQSCYSGCTKDLLVRIDTLNETVINFKWKTLPSTLD-LRLNKINISIQMSSELLNSINKFYKLKNEIKNFSIQFQKMKDDAKEKYGEIE----KLKTRYNKVLEDLRSTFTDIN-ETISGHEQLGISNELIKNATAYLETIKNIYK-----------EMPNITLAASVLKDVL-KYVDELNQIIKYTQ-SHIQSDQINN--LKILKNKTIMADEINTNNKEYLNTMSTKK---KEHELYIILINERMKDLQKIFRKMTKQRDNLRKKIQKLDAISKSFQDEKDLISINVREIEDLMKNLSSNH------LVSKSLIIPDTLKKHVEQQLNKSSNLIKKLTKDFNFLHNAEQAKEAYS---NITRDILAVDYAINQTKKELD-----FNRSNMNIDSLKKLLAEFNSNKSEIVENIKNIDKEHEKLLKQYKNCSYXXXXXXXXXXXXSSEIPTGFYDVEILKRNLSXXXXXXXXXXXXFILPINQTILNLGTPNVKSGLDTRN-----LEKLIKVVDNQYRDLVNESSFVENKIKDLRKSIKSLRERLQKARVMSEL 6595
            K C+C+ +  V     C  VTG C+ C+ N     C  C+ G + N ++   CE C C        Q C  +      +C+C+ G SG  C+ C+  F+G    G  CK CDC+ +GS S  C + G CQC PG +G +CD C  NY   +     + C SCY       LVR D +N+     K   L + +D L   +  +S +   + L    K       I     + Q  KD  +     ++     L T++N+ L+ +R+T  D   +      ++  +  LI  A   L+  K+              E  N+TL A   + +  K+  E +QI K  + ++  S +  N  LK L+ ++    EI   NK+Y  +    K   K+ +      +E      KIF  +T         +   DA  K+ +DE + I     ++++L+  +  N+      L SK   +   L+K   +Q      L +           A++ K  ++   NI  D+   D  +N  K   +         N  I S  +   E  +      EN     ++ E+  K   N      K K   EK   +      DV  +   LS  + +    +       +  +  + + N K   D        ++K++KV+ +    L N      +K+ D+ +S+K  +E+++ +++  +L
Sbjct:  868 KSCSCSPFGTVGQQTSCSEVTGQCE-CLPNVAERDCSACQPGHF-NLQSGKGCERCNCNPIGSTNGQ-CDIVTG----QCECQPGVSGLHCDRCEVNFFGFSSSG--CKPCDCDSEGSSSGQCKDDGRCQCRPGFVGARCDMCEENYFYNRSVPGCQQCPSCYG------LVR-DKVNQQ--RQKLHDLQTLIDNLGSGQETVSDKAFEDRLKEAEK------AIAELLSEAQASKDLDRGLMDRLDTINNTLTTQWNR-LQSIRNTVDDTGAQADRARSRVQDAESLIDRARQELDKAKDALSKVDIKPPTGTGEPNNMTLLAEEARRLAEKHKTEADQIEKIAKDANDTSTKAYNLLLKTLEGESRTGQEIEELNKKYNESKELAKNLEKQAKKVQDEADEAGNQALKIFANLT--------SLPPFDA--KALEDEANKIKKEATDLDNLVDKMEKNYNDMRDDLKSKEQEVRKLLEKGKSEQQTADQLLARADAAKALAEEAAQKGKATFAEAENILEDLRDFDRRVNDNKTAAEEALKKIPAINATIMSANEKTREAKTALGNATENALEAKRKAEEAEKIASNVQIGSAKTKEDAEKALQDTNNLENDVNNMMDQLSAAEQDLAKKKVEAD--ADMMMAAMASDNAKEAEDNARKAKNMVKKVLKVITDLLAQLGNIDKVDLSKLNDIDESLKKAKEKMRDSKLDEKL 1544          

HSP 6 Score: 87.0409 bits (214), Expect = 3.597e-16
Identity = 76/261 (29.12%), Postives = 116/261 (44.44%), Query Frame = 2
Query: 2726 NTMGTEC----QLCKHGFYGDALTKSCKKCDCDSLGSTSENCDKLTGK--CDCRTNFVNRQCDSCTSGLYLKDK-----------KCIPCNCEIQGR---ISSEKFCNTT-SGQCF-CLENVNGDRCEKCVEGYFNYPN---CKKCLCSP-HALSADCDLNNGKCKCGSNVINRICDKCENLHYWNNRTDCVPCNCGRGSLNPKCDMETGNCKCAQNVARRDCSKCDVGYFGLDVTGCKKCPPCY---NGQVCNN-EGICV 3418
            NT G E     ++ K  +Y  +      +C C+  G  SE      G+  CDC+ N     C++C    +  D+           +C+ CNC  +        E +  T   G C  C +N +G  CE+C++ Y+   +   C+ C CSP  +LS  CD   G C C   V    CD+C   ++      C  C+C       +CD+ TG C+C +NV    C +C +G+F LD    + C PC+   +  VCN+ EG  V
Sbjct:  243 NTFGDEVFNDPKVLKSYYYAISDFAVGGRCKCN--GHASECVKNSVGRLVCDCKHNTAGDDCNTCRP--FFNDRPWRRATADSANECLSCNCNGKSAECYFDPELYRATGHGGHCRNCADNTDGPNCERCLDNYYRDQSGNRCQPCSCSPIGSLSPQCD-RGGVCACKPGVTGEKCDRCLPGYHSLTEAGCRQCSCSPAGSTQECDVATGQCRCKENVEGFSCDRCKLGFFNLDPHNPQGCTPCFCFQHSSVCNSAEGYSV 498          

HSP 7 Score: 66.6254 bits (161), Expect = 5.584e-10
Identity = 69/267 (25.84%), Postives = 114/267 (42.70%), Query Frame = 2
Query: 4295 NVINSNLTRDIFMMALLNVTSLKVKLYTDKV-NPPLIKIKIITYKVMETTQAIGKRVT---AVEKCICNAL----------TFGNHCQNPISGYYKEYFNLPNSTKSGSMRTGNRILINLKKCNCNGYSKVC---------DSVTGDCQNCMGNREGNKCQLCREGFYKNDKNYDQCEPCQCPSAHYNFAQNCTRIESSLELKCQCRIGYSGKSCENCQQGFYGNPIKGIPCKSCDCNQQGSQSLNCNEFGICQCSPGVLGIKCDQC 5026
            N  NS + +D      + VT  ++  + D+V N P + +K   Y + +   A+G R        +C+ N++          T G+ C        + +FN     +  +  + N  L     CNCNG S  C             G C+NC  N +G  C+ C + +Y+ D++ ++C+PC C S   + +  C R        C C+ G +G+ C+ C  G++     G  C+ C C+  GS        G C+C   V G  CD+C
Sbjct:  219 NFDNSPVLQDWVTATDIKVTLNRLNTFGDEVFNDPKV-LKSYYYAISDF--AVGGRCKCNGHASECVKNSVGRLVCDCKHNTAGDDCNT-----CRPFFN-DRPWRRATADSANECL----SCNCNGKSAECYFDPELYRATGHGGHCRNCADNTDGPNCERCLDNYYR-DQSGNRCQPCSC-SPIGSLSPQCDRGGV-----CACKPGVTGEKCDRCLPGYHSLTEAG--CRQCSCSPAGSTQECDVATGQCRCKENVEGFSCDRC 463          

HSP 8 Score: 64.6994 bits (156), Expect = 1.922e-9
Identity = 59/197 (29.95%), Postives = 85/197 (43.15%), Query Frame = 2
Query: 4517 NPISGYYKEYFNLPNSTKSGSMRTGNRILINLKKCNCNGYSKVC--DSVTGDCQNCMGNREGNKCQLCREGFYKNDKNY--------DQCEPCQC--PSAHYNFAQNCTRIESSLELKCQCRIGYSGKSCENCQQGFYGNPIKGIPCKSCDCNQQGSQSLNCNEFGICQCSPGVLGIKCDQCAPNY-VVEKKTCQSC 5068
            N ++ +  E FN P   KS      +  +    +C CNG++  C  +SV     +C  N  G+ C  CR  F  ND+ +        ++C  C C   SA   F     R          C     G +CE C   +Y +   G  C+ C C+  GS S  C+  G+C C PGV G KCD+C P Y  + +  C+ C
Sbjct:  240 NRLNTFGDEVFNDPKVLKSYYYAISDFAVGG--RCKCNGHASECVKNSVGRLVCDCKHNTAGDDCNTCRPFF--NDRPWRRATADSANECLSCNCNGKSAECYFDPELYRATGHGGHCRNCADNTDGPNCERCLDNYYRDQ-SGNRCQPCSCSPIGSLSPQCDRGGVCACKPGVTGEKCDRCLPGYHSLTEAGCRQC 431          
BLAST of Laminin subunit alpha-2 vs. Ensembl Medaka
Match: lamc3 (laminin subunit gamma 3 [Source:NCBI gene;Acc:105355198])

HSP 1 Score: 368.622 bits (945), Expect = 5.541e-103
Identity = 308/1068 (28.84%), Postives = 466/1068 (43.63%), Query Frame = 2
Query:  197 NAKITSSATCGTGGPEIFCRLVDEIAIQRLINPDSHVLCDVCDNRNETKRHPIEFA---KSDDDNLWWQSPSMAQGLKY-QNVNVTIDLKQVYQIVYILLKMGDSPRPGNWILERSLDGEIYMPWIFFAETPYSCYNLFQRQYPDLKLTTNAKPSSLADDEMFCTTYYSQPKSLNSGEIIISLINGRKSIMNEEYLSIKSVPQTLINFLSARYIRFRFLKHLTLAADLMTHKGYL---------EQSIYNRYYYSLRNIEIGGKCICNNHADKCDKVIENGISVAKCNCKHNTCGSNCETCCPLFNQRPWKPVA-----VCEECNCNRKSNECSYNQTVATLQLSVNKMGRMEGGGVCINCQENTEGINCEKCIKGFYRPWNVLATELYPCTPCQCHGLGTIGSCVSNGEDIGDQKPGDCICKKGYEGVNCDLCSIGYERYPNGECLPCPCSIDGSVRTSFYRCKP---PCNCKVHVNSDDLCKTCKNGYFNLDSANPEGCEPCYCFGITNQCSS------LSAKNLKISDLKGWKLTTFTGEKIALPKFTSFQY---LTSENSYIDERFNNPTVYYWTAPPPYLGNWITSYGTIFRYVVKIELQSTLKGSLIDSPDVIIKCGDFRLFHSVSIEDRRLQRQVFIYIKPTEWKI-----GKLTPDKAATKEEFISCLVKVDKLLIKAKYYSNQKSIELLNITLSRGEVHLALDEMPH--IEKCNCPPGFNGLSCESCESGY-RRVNNVLYQGQCEACACYNHSNTCDSLNGECQNCTHNTAGAHCEDCASGYYGDAKSKNLNSCKKCPCPRLD--YQMTELCSSYSSENYVCHKCLHNTSGVHCDRCIEGYYGNPKKKIS----CKRCKCNNNQES-----CDPVTGEC-RCSYNTMGTECQLCKHGFYGDALTKS----CKKCDCDSLGSTSE--NCDKLTGKCDCRTNFVNRQCDSCTSGLY--LKDKKCIPCNCEIQGRISSEKFCNTTSGQCFCLENVNGDRCEKCVEGYFNYPN--CKKCLCSPH-ALSADCDLNNGKCKCGSNVINRICDKCENLHYWNNRTD 3217
            N  + +S  CG+  PE +C           +   S   C  CD  +    H          +++  WWQS SM  G++Y ++VN+T+ L + ++I YI LK   S      I +R+ +G  ++P+ +++    SC   + +           + ++L      CT  +S    L  G +  S + GR S  N +        Q+L            FL+    A DL+     L         +  +   Y+Y++ +  +GG+C CN HA +C   +E       C C+H+T G++C+ C P +  RPW          C +CNCN +S++C ++         + +      GG C++C++NT+G +CE C    YR    +A E  PC  C C+  G++ S   N E       G C+C+ G  G  C++C  G+       C PC C   GSV      C P    C CK +V     C  CK G+FNL   NP GC+PC+CFG +  CSS      ++  +  I D   W    F GE+  L       Y   LT E+S            ++ AP  +LG+ I SYG         E    L  SL     VI++     L          L  +  ++  P+   I         P  +A + + +  L  +  L I      N  S +L  +TL+   +      +P   +E+C+CP GF+G  CE C  G+ R+         C  C C+ H   CD   G C+ C+H T G  CE C  GYYG+A       C+ CPCP      Q+ E      +   VC  C    +G+ C  C +GYYG+P  +      C RC CN N +      CD  TG+C +C  +T G  CQ C+ GFYG+AL ++    CK C C S G++     C   TG C C ++   R C  C  G +       C  C C   G  S+ + C+  +G+C C   V G  C+ C  G+F + +  C+ C C P  ++S  C   NG C+C    +   CDKCE ++Y++NR +
Sbjct:   53 NRTVEASNVCGST-PEDYC-----------MQTGSTRSCHYCDASDPELSHNASLLTDFHRNEEPTWWQSQSMFYGIQYPKSVNLTLHLGKAFEITYIRLKFYTSRPESFAIYKRTEEGGPWLPYQYYSA---SCKKTYGKDAKGFIRPGEEEKTAL------CTDEFSDISPLTGGNVAFSTLEGRPSAYNFD--------QSL------------FLQEWVTATDLLISLDRLNTFGDEFFKDAKVLRSYFYAISDFSVGGRCKCNGHASEC---VEGERGDLVCACQHHTVGADCQKCHPFYQDRPWARATGDSANECLKCNCNGRSDQCIFD---------MEQYRSTGSGGRCVDCRDNTDGAHCEHCKANHYR----VAPE-DPCLACNCNINGSV-SLQCNAE-------GRCVCRPGVTGAKCNMCQDGFHSLGPSGCRPCECHHSGSVG----ECSPLDGQCFCKRNVEGHR-CGRCKPGFFNLQLQNPAGCQPCFCFGHSLACSSSNHYTPVNITSDFIEDQDRWVGEFFGGEEYILQWKEGEVYLLPLTEEDS-----------GFYKAPDKFLGHQIYSYGQPLHITFTSETYDLLPNSLT----VILEGSGMTL-------SADLYPKPILHPDPSNSPILHEYETSFKPRLSAFELQHL--LYNLTALKISNAGGHNYTS-QLARVTLASASISSRPLSLPAAWVEQCSCPLGFSGQFCEGCAPGFTRQEPGGGPLSACVPCKCHQH-GICDPETGVCE-CSHFTTGMTCEHCLPGYYGNALIGTPGDCQPCPCPDRSSCVQIAE------TGQVVCTNCPAGQTGMRCQMCEDGYYGDPMGQSGTVRPCVRCNCNGNVDFNAVGICDHFTGQCLKCMGHTEGDHCQRCQRGFYGNALEQTSGQKCKPCSCSSAGTSGHVNECHPQTGSCHCLSHVTGRDCSYCEVGFFNLQPGYGCERCKCSPIG--STSQACHPFTGECVCRPGVEGTLCDSCRLGFFGFSSRGCRACNCDPMGSVSMQCH-GNGTCQCRQGFVGYKCDKCE-VNYFHNRAN 1012          

HSP 2 Score: 126.716 bits (317), Expect = 2.995e-28
Identity = 140/571 (24.52%), Postives = 222/571 (38.88%), Query Frame = 2
Query: 3407 GICV-CPPNTIGNLCNKCSEDSWDFNETIGCKKCNCYINGSYSNICNKISGICACKTAFFGSKCDRCNEGYY--GFPNCQPCSCAENGTKSNELTKCDKITGQCQCKQNVIGTKCKVCRKGTFPSDGTYEGGCFSCFCFGVSEKCHAILNHRIVENSIYEYHIFDEK---NSLESGKDYSTIHLNANYPRRFGWPLTMFRPIYVNVMKLFNSHDLSLFYRSIFMNVSVDCLDNKCGREIPEQTEVFMESYNGLFGMRYXXXXXXXXXXXXXXDFNEHSKNGKWVISQYQ-NDILDKFIILEDSNVINSNLTRDIFMMALLNVTSLKVKLYTDKVNPPLIKIKIITYKVMETTQAIGKRVTAVEKCICNALTFGNHCQNPISGYYKEYFNLPNSTKSGSMRTGNRILINLKKCNCNGYSKVCDSVTGDCQNCMGNREGNKCQLCREGFYKND--KNYDQCEPCQCPSAHYNFAQNCTRIESSLELKC-QCRIGYSGKSCENCQQGFYGNPIKGI----PCKSCDCNQQGSQSLNCNEFGICQCSPGVLGIKCDQCAPNYVVEKKTCQSCYSG 5077
            G CV C  NT G  C  C  + +       C  CNC INGS S  CN   G C C+    G+KC+ C +G++  G   C+PC C  +G+    + +C  + GQC CK+NV G +C  C+ G F        GC  CFCFG S  C +  NH    N   ++ I D+         G++Y    L       +  PLT     +      F  H +  + + + +  + +  D      +P    V +E               +    +     +E+  + K  +S ++   +L     L+ SN    N T  +  + L + +                           +++ +      VE+C C     G  C+    G+ ++               G   L     C C+ +  +CD  TG C+ C     G  C+ C  G+Y N        C+PC CP        +C +I  + ++ C  C  G +G  C+ C+ G+YG+P+       PC  C+CN     +++ N  GIC    G    +C +C  +   E   CQ C  G
Sbjct:  355 GRCVDCRDNTDGAHCEHCKANHYRVAPEDPCLACNCNINGSVSLQCNA-EGRCVCRPGVTGAKCNMCQDGFHSLGPSGCRPCECHHSGS----VGECSPLDGQCFCKRNVEGHRCGRCKPGFFNLQLQNPAGCQPCFCFGHSLACSSS-NHYTPVNITSDF-IEDQDRWVGEFFGGEEYI---LQWKEGEVYLLPLTEEDSGFYKAPDKFLGHQIYSYGQPLHITFTSETYD-----LLPNSLTVILEGSGMTLSADLYPKPILHPDPSNSPILHEYETSFKPRLSAFELQHLLYNLTALKISNAGGHNYTSQLARVTLASASI--------------------------SSRPLSLPAAWVEQCSCPLGFSGQFCEGCAPGFTRQ-------------EPGGGPLSACVPCKCHQHG-ICDPETGVCE-CSHFTTGMTCEHCLPGYYGNALIGTPGDCQPCPCPD-----RSSCVQIAETGQVVCTNCPAGQTGMRCQMCEDGYYGDPMGQSGTVRPCVRCNCN----GNVDFNAVGICDHFTG----QCLKCMGH--TEGDHCQRCQRG 854          

HSP 3 Score: 120.553 bits (301), Expect = 2.453e-26
Identity = 99/338 (29.29%), Postives = 143/338 (42.31%), Query Frame = 2
Query: 2591 SGVHCDRCIEGYY-----GNPKKKISCKRCKCNNNQESCDPVTGECRCSYNTMGTECQLCKHGFYGDALTKS---CKKCDCDSLGSTSENCDKLTGKC-DCRTNFVNRQCDSCTSGLYLKD-------KKCIPCNCEIQGRISSEKFCNTTSGQCF-CLENVNGDRCEKCVEGYFNYP-------NCKKCLCSPHALSA---DCDLNNGKCKCGSNVINRICDKCENLHYWNNRT--DCVPCNCGR-GSLNPKCDMETGNCKCAQNVARRDCSKCDVGYFGLDVTGCKKC---PPCYNGQVCNNEGICVCPPNTIGNLCNKCSEDSWDFNETIGCKKC 3505
            SG  C+ C  G+      G P    +C  CKC+ +   CDP TG C CS+ T G  C+ C  G+YG+AL  +   C+ C C    S  +  +     C +C       +C  C  G Y          + C+ CNC      ++   C+  +GQC  C+ +  GD C++C  G++           CK C CS    S    +C    G C C S+V  R C  CE + ++N +    C  C C   GS +  C   TG C C   V    C  C +G+FG    GC+ C   P       C+  G C C    +G  C+KC  + +       C++C
Sbjct:  685 SGQFCEGCAPGFTRQEPGGGPLS--ACVPCKCHQHG-ICDPETGVCECSHFTTGMTCEHCLPGYYGNALIGTPGDCQPCPCPDRSSCVQIAETGQVVCTNCPAGQTGMRCQMCEDGYYGDPMGQSGTVRPCVRCNCNGNVDFNAVGICDHFTGQCLKCMGHTEGDHCQRCQRGFYGNALEQTSGQKCKPCSCSSAGTSGHVNECHPQTGSCHCLSHVTGRDCSYCE-VGFFNLQPGYGCERCKCSPIGSTSQACHPFTGECVCRPGVEGTLCDSCRLGFFGFSSRGCRACNCDPMGSVSMQCHGNGTCQCRQGFVGYKCDKCEVNYFHNRANHQCEEC 1018          

HSP 4 Score: 117.087 bits (292), Expect = 2.869e-25
Identity = 111/405 (27.41%), Postives = 167/405 (41.23%), Query Frame = 2
Query: 2855 KCDCRTNFVNRQCDSCTSGLYLKD------KKCIPCNCEIQGRISSEKFCNTTSGQCFCLENVNGDRCEKCVEGYFNYP------NCKKCLCSPHALSADCDLNNGKC---KCGSNVINRICDKCENLHYWNNRTD------CVPCNC-GRGSLNPK--CDMETGNC-KCAQNVARRDCSKCDVGYFG--LDVTGCKKCPPC------YNGQV--CNNE-GICVCPPNTIGNLCNKCSEDSWDFNETIGCKKCNCYINGSYSNICNKISGICACKTAFFGSKCDRCNEGYYGFPN--CQPCSCAENGTKSNELTKCDKITGQCQCKQNVIGTKCKVCRKGTFPSDGTYEGGCFSC-FCFGVSEKCHAILNHRIVENSIYEYHIFDEKNSLESGKDYSTIHLNANY 3952
            +C C   F  + C+ C  G   ++        C+PC C   G       C+  +G C C     G  CE C+ GY+         +C+ C C P   S       G+     C +      C  CE+ +Y +          CV CNC G    N    CD  TG C KC  +     C +C  G++G  L+ T  +KC PC       +G V  C+ + G C C  +  G  C+ C    ++     GC++C C   GS S  C+  +G C C+    G+ CD C  G++GF +  C+ C+C   G+ S    +C    G CQC+Q  +G KC  C    F +   ++  C  C  C+ + +K    L  R+ +      H FD +  L    +    H+   Y
Sbjct:  677 QCSCPLGFSGQFCEGCAPGFTRQEPGGGPLSACVPCKCHQHG------ICDPETGVCECSHFTTGMTCEHCLPGYYGNALIGTPGDCQPCPC-PDRSSCVQIAETGQVVCTNCPAGQTGMRCQMCEDGYYGDPMGQSGTVRPCVRCNCNGNVDFNAVGICDHFTGQCLKCMGHTEGDHCQRCQRGFYGNALEQTSGQKCKPCSCSSAGTSGHVNECHPQTGSCHCLSHVTGRDCSYCEVGFFNLQPGYGCERCKCSPIGSTSQACHPFTGECVCRPGVEGTLCDSCRLGFFGFSSRGCRACNCDPMGSVS---MQCHG-NGTCQCRQGFVGYKCDKCEVNYFHNRANHQ--CEECPVCYSLVKKQAEKLQTRLQDLEKLLSH-FDCRGRLGRQPNLQQYHMAGFY 1067          

HSP 5 Score: 102.449 bits (254), Expect = 6.553e-21
Identity = 95/354 (26.84%), Postives = 141/354 (39.83%), Query Frame = 2
Query: 4484 CNALTFGNHCQNPISGYYKEYFNLPNSTKSGSMRTGNRILINLKKCNCNG-----YSKVCDSVTGDCQNCMGNREGNKCQLCREGFYKN---DKNYDQCEPCQCPSA----HYNFAQ------------------------------------NCTRIESSLEL------KCQCRIGYSGKSCENCQQGFYGNPIKGIPCKSCDCNQQGSQSLNCNEFGICQCSPGVLGIKCDQCAPNYVVEK-----KTCQSCYSGCTKD---LLVRIDTLNETVINF----KWKTLPSTLDLRLNKINISIQMSSE--LLNSINKFYKLKNEIKNFSIQFQKMKDDAKEKYGEIEKLKTRYN 5341
            C A   G  CQ    GYY +        +SG++R   R       CNCNG        +CD  TG C  CMG+ EG+ CQ C+ GFY N     +  +C+PC C SA    H N                                        C+ I S+ +       +C CR G  G  C++C+ GF+G   +G  C++C+C+  GS S+ C+  G CQC  G +G KCD+C  NY   +     + C  CYS   K    L  R+  L + + +F    +    P+     +       Q+  E  L N++  F   +   + F  QF  ++        ++  L    N
Sbjct:  782 CPAGQTGMRCQMCEDGYYGDPMG-----QSGTVRPCVR-------CNCNGNVDFNAVGICDHFTGQCLKCMGHTEGDHCQRCQRGFYGNALEQTSGQKCKPCSCSSAGTSGHVNECHPQTGSCHCLSHVTGRDCSYCEVGFFNLQPGYGCERCKCSPIGSTSQACHPFTGECVCRPGVEGTLCDSCRLGFFGFSSRG--CRACNCDPMGSVSMQCHGNGTCQCRQGFVGYKCDKCEVNYFHNRANHQCEECPVCYSLVKKQAEKLQTRLQDLEKLLSHFDCRGRLGRQPNLQQYHMAGFYQHDQLRGEDSLPNALEDFLAFQEAREAFIKQFSSLEAATGTLSAQLHGLTFTLN 1121          

HSP 6 Score: 79.337 bits (194), Expect = 7.406e-14
Identity = 70/227 (30.84%), Postives = 97/227 (42.73%), Query Frame = 2
Query: 2660 RCKCNNNQESCDPVTGE-----CRCSYNTMGTECQLCKHGFYGDA--------LTKSCKKCDCDSLGSTSENC---------DKLTGKC-DCRTNFVNRQCDSCTSGLY--LKDKKCIPCNCEIQGRISSEKFCNTTSGQCFCLENVNGDRCEKCVEGYFNY--PNCKKCLCSPHALSADCDLNNGKCKCGSNVINRICDKCENLHY---WNNRTDCVPCNCGRGSL 3250
            RCKCN +   C  V GE     C C ++T+G +CQ C H FY D             C KC+C+     S+ C             G+C DCR N     C+ C +  Y    +  C+ CNC I G +S +  CN   G+C C   V G +C  C +G+ +     C+ C C       +C   +G+C C  NV    C +C+   +     N   C PC C   SL
Sbjct:  275 RCKCNGHASEC--VEGERGDLVCACQHHTVGADCQKC-HPFYQDRPWARATGDSANECLKCNCN---GRSDQCIFDMEQYRSTGSGGRCVDCRDNTDGAHCEHCKANHYRVAPEDPCLACNCNINGSVSLQ--CN-AEGRCVCRPGVTGAKCNMCQDGFHSLGPSGCRPCECHHSGSVGECSPLDGQCFCKRNVEGHRCGRCKPGFFNLQLQNPAGCQPCFCFGHSL 492          

HSP 7 Score: 61.6178 bits (148), Expect = 1.675e-8
Identity = 60/213 (28.17%), Postives = 84/213 (39.44%), Query Frame = 2
Query: 4478 CICNALTFGNHCQ--NPISGYYKEYFNLPNSTKSGSMRTGNRILINLKKCNCNGYSKVC---------DSVTGDCQNCMGNREGNKCQLCREGFYKNDKNYDQCEPCQCPSAHYNFAQNCTRIESSLELKCQCRIGYSGKSCENCQQGFYGNPIKGIPCKSCDCNQQGSQSLNCNEFGICQCSPGVLGIKCDQCAPNY----VVEKKTCQSCY 5071
            C C   T G  CQ  +P       Y + P +  +G   + N  L    KCNCNG S  C             G C +C  N +G  C+ C+   Y+     D C  C C             ++ + E +C CR G +G  C  CQ GF+     G  C+ C+C+  GS        G C C   V G +C +C P +    +     CQ C+
Sbjct:  295 CACQHHTVGADCQKCHPF------YQDRPWARATGD--SANECL----KCNCNGRSDQCIFDMEQYRSTGSGGRCVDCRDNTDGAHCEHCKANHYRVAPE-DPCLACNCN------INGSVSLQCNAEGRCVCRPGVTGAKCNMCQDGFHSLGPSG--CRPCECHHSGSVGECSPLDGQCFCKRNVEGHRCGRCKPGFFNLQLQNPAGCQPCF 486          

HSP 8 Score: 55.8398 bits (133), Expect = 1.057e-6
Identity = 49/152 (32.24%), Postives = 66/152 (43.42%), Query Frame = 2
Query: 4616 KCNCNGYSKVC-DSVTGDCQ-NCMGNREGNKCQLCREGFYKN-------DKNYDQCEPCQC--PSAHYNFAQNCTRIESSLELKCQCRIGYSGKSCENCQQGFYGNPIKGIPCKSCDCNQQGSQSLNCNEFGICQCSPGVLGIKCDQCAPNY 5038
            +C CNG++  C +   GD    C  +  G  CQ C   FY++         + ++C  C C   S    F     R   S      CR    G  CE+C+   Y    +  PC +C+CN  GS SL CN  G C C PGV G KC+ C   +
Sbjct:  275 RCKCNGHASECVEGERGDLVCACQHHTVGADCQKCHP-FYQDRPWARATGDSANECLKCNCNGRSDQCIFDMEQYRSTGSGGRCVDCRDNTDGAHCEHCKANHYRVAPED-PCLACNCNINGSVSLQCNAEGRCVCRPGVTGAKCNMCQDGF 424          
BLAST of Laminin subunit alpha-2 vs. Ensembl Medaka
Match: lamc3 (laminin subunit gamma 3 [Source:NCBI gene;Acc:105355198])

HSP 1 Score: 367.466 bits (942), Expect = 1.264e-102
Identity = 307/1065 (28.83%), Postives = 463/1065 (43.47%), Query Frame = 2
Query:  197 NAKITSSATCGTGGPEIFCRLVDEIAIQRLINPDSHVLCDVCDNRNETKRHPIEFA---KSDDDNLWWQSPSMAQGLKY-QNVNVTIDLKQVYQIVYILLKMGDSPRPGNWILERSLDGEIYMPWIFFAETPYSCYNLFQRQYPDLKLTTNAKPSSLADDEMFCTTYYSQPKSLNSGEIIISLINGRKSIMNEEYLSIKSVPQTLINFLSARYIRFRFLKHLTLAADLMTHKGYL---------EQSIYNRYYYSLRNIEIGGKCICNNHADKCDKVIENGISVAKCNCKHNTCGSNCETCCPLFNQRPWKPVA-----VCEECNCNRKSNECSYNQTVATLQLSVNKMGRMEGGGVCINCQENTEGINCEKCIKGFYRPWNVLATELYPCTPCQCHGLGTIGSCVSNGEDIGDQKPGDCICKKGYEGVNCDLCSIGYERYPNGECLPCPCSIDGSVRTSFYRCKP---PCNCKVHVNSDDLCKTCKNGYFNLDSANPEGCEPCYCFGITNQCSS------LSAKNLKISDLKGWKLTTFTGEKIALPKFTSFQY---LTSENSYIDERFNNPTVYYWTAPPPYLGNWITSYGTIFRYVVKIELQSTLKGSL--IDSPDVIIKCGDFRLFHSVSIEDRRLQRQVFIYIKPTEWKIGKLTPDKAATKEEFISCLVKVDKLLIKAKYYSNQKSIELLNITLSRGEVHLALDEMPH--IEKCNCPPGFNGLSCESCESGY-RRVNNVLYQGQCEACACYNHSNTCDSLNGECQNCTHNTAGAHCEDCASGYYGDAKSKNLNSCKKCPCPRLD--YQMTELCSSYSSENYVCHKCLHNTSGVHCDRCIEGYYGNPKKKIS----CKRCKCNNNQES-----CDPVTGEC-RCSYNTMGTECQLCKHGFYGDALTKS----CKKCDCDSLGSTSE--NCDKLTGKCDCRTNFVNRQCDSCTSGLY--LKDKKCIPCNCEIQGRISSEKFCNTTSGQCFCLENVNGDRCEKCVEGYFNYPN--CKKCLCSPH-ALSADCDLNNGKCKCGSNVINRICDKCENLHYWNNRTD 3217
            N  + +S  CG+  PE +C           +   S   C  CD  +    H          +++  WWQS SM  G++Y ++VN+T+ L + ++I YI LK   S      I +R+ +G  ++P+ +++    SC   + +           + ++L      CT  +S    L  G +  S + GR S  N                    + +  FL+    A DL+     L         +  +   Y+Y++ +  +GG+C CN HA +C   +E       C C+H+T G++C+ C P +  RPW          C +CNCN +S++C ++         + +      GG C++C++NT+G +CE C    YR    +A E  PC  C C+  G++ S   N E       G C+C+ G  G  C++C  G+       C PC C   GSV      C P    C CK +V     C  CK G+FNL   NP GC+PC+CFG +  CSS      ++  +  I D   W    F GE+  L       Y   LT E+S            ++ AP  +LG+ I SYG         E    L  SL  I     +    D      +  +      Q FI ++  E++     P  +A   E    L  +  L I      N  S +L  +TL+   +      +P   +E+C+CP GF+G  CE C  G+ R+         C  C C+ H   CD   G C+ C+H T G  CE C  GYYG+A       C+ CPCP      Q+ E      +   VC  C    +G+ C  C +GYYG+P  +      C RC CN N +      CD  TG+C +C  +T G  CQ C+ GFYG+AL ++    CK C C S G++     C   TG C C ++   R C  C  G +       C  C C   G  S+ + C+  +G+C C   V G  C+ C  G+F + +  C+ C C P  ++S  C   NG C+C    +   CDKCE ++Y++NR +
Sbjct:   59 NRTVEASNVCGST-PEDYC-----------MQTGSTRSCHYCDASDPELSHNASLLTDFHRNEEPTWWQSQSMFYGIQYPKSVNLTLHLGKAFEITYIRLKFYTSRPESFAIYKRTEEGGPWLPYQYYSA---SCKKTYGKDAKGFIRPGEEEKTAL------CTDEFSDISPLTGGNVAFSTLEGRPSAYN--------------------FDQSLFLQEWVTATDLLISLDRLNTFGDEFFKDAKVLRSYFYAISDFSVGGRCKCNGHASEC---VEGERGDLVCACQHHTVGADCQKCHPFYQDRPWARATGDSANECLKCNCNGRSDQCIFD---------MEQYRSTGSGGRCVDCRDNTDGAHCEHCKANHYR----VAPE-DPCLACNCNINGSV-SLQCNAE-------GRCVCRPGVTGAKCNMCQDGFHSLGPSGCRPCECHHSGSVG----ECSPLDGQCFCKRNVEGHR-CGRCKPGFFNLQLQNPAGCQPCFCFGHSLACSSSNHYTPVNITSDFIEDQDRWVGEFFGGEEYILQWKEGEVYLLPLTEEDS-----------GFYKAPDKFLGHQIYSYGQPLHITFTSETYDLLPNSLTVILEGSGMTLSADLYPKPILHPDPSNSPMQHFI-VRLHEYET-SFKPRLSAF--ELQHLLYNLTALKISNAGGHNYTS-QLARVTLASASISSRPLSLPAAWVEQCSCPLGFSGQFCEGCAPGFTRQEPGGGPLSACVPCKCHQH-GICDPETGVCE-CSHFTTGMTCEHCLPGYYGNALIGTPGDCQPCPCPDRSSCVQIAE------TGQVVCTNCPAGQTGMRCQMCEDGYYGDPMGQSGTVRPCVRCNCNGNVDFNAVGICDHFTGQCLKCMGHTEGDHCQRCQRGFYGNALEQTSGQKCKPCSCSSAGTSGHVNECHPQTGSCHCLSHVTGRDCSYCEVGFFNLQPGYGCERCKCSPIG--STSQACHPFTGECVCRPGVEGTLCDSCRLGFFGFSSRGCRACNCDPMGSVSMQCH-GNGTCQCRQGFVGYKCDKCE-VNYFHNRAN 1024          

HSP 2 Score: 127.102 bits (318), Expect = 2.596e-28
Identity = 143/573 (24.96%), Postives = 224/573 (39.09%), Query Frame = 2
Query: 3407 GICV-CPPNTIGNLCNKCSEDSWDFNETIGCKKCNCYINGSYSNICNKISGICACKTAFFGSKCDRCNEGYY--GFPNCQPCSCAENGTKSNELTKCDKITGQCQCKQNVIGTKCKVCRKGTFPSDGTYEGGCFSCFCFGVSEKCHAILNHRIVENSIYEYHIFDEK---NSLESGKDYSTIHLNANYPRRFGWPLTMFRPIYVNVMKLFNSHDLSLFYRSIFMNVSVDCLDNKCGREIPEQTEVFMESYNGLFGMRYXXXXXXXXXXXXXXDFNEHSKNGKWVISQYQNDILDKFIIL--EDSNVINSNLTRDIFMMALLNVTSLKVK-LYTDKVNPPLIKIKIITYKVMETTQAIGKRVTAVEKCICNALTFGNHCQNPISGYYKEYFNLPNSTKSGSMRTGNRILINLKKCNCNGYSKVCDSVTGDCQNCMGNREGNKCQLCREGFYKND--KNYDQCEPCQCPSAHYNFAQNCTRIESSLELKC-QCRIGYSGKSCENCQQGFYGNPIKGI----PCKSCDCNQQGSQSLNCNEFGICQCSPGVLGIKCDQCAPNYVVEKKTCQSCYSG 5077
            G CV C  NT G  C  C  + +       C  CNC INGS S  CN   G C C+    G+KC+ C +G++  G   C+PC C  +G+    + +C  + GQC CK+NV G +C  C+ G F        GC  CFCFG S  C +  NH    N   ++ I D+         G++Y    L       +  PLT     +      F  H +  + + + +  + +  D      +P    V +E      GM    +                      +     N  +  FI+   E        L+       L N+T+LK+           L ++ + +  +  +++ +      VE+C C     G  C+    G+ ++               G   L     C C+ +  +CD  TG C+ C     G  C+ C  G+Y N        C+PC CP        +C +I  + ++ C  C  G +G  C+ C+ G+YG+P+       PC  C+CN     +++ N  GIC    G    +C +C  +   E   CQ C  G
Sbjct:  361 GRCVDCRDNTDGAHCEHCKANHYRVAPEDPCLACNCNINGSVSLQCNA-EGRCVCRPGVTGAKCNMCQDGFHSLGPSGCRPCECHHSGS----VGECSPLDGQCFCKRNVEGHRCGRCKPGFFNLQLQNPAGCQPCFCFGHSLACSSS-NHYTPVNITSDF-IEDQDRWVGEFFGGEEYI---LQWKEGEVYLLPLTEEDSGFYKAPDKFLGHQIYSYGQPLHITFTSETYD-----LLPNSLTVILEGS----GMTLSADLYPK----------------PILHPDPSNSPMQHFIVRLHEYETSFKPRLSAFELQHLLYNLTALKISNAGGHNYTSQLARVTLASASI--SSRPLSLPAAWVEQCSCPLGFSGQFCEGCAPGFTRQ-------------EPGGGPLSACVPCKCHQHG-ICDPETGVCE-CSHFTTGMTCEHCLPGYYGNALIGTPGDCQPCPCPD-----RSSCVQIAETGQVVCTNCPAGQTGMRCQMCEDGYYGDPMGQSGTVRPCVRCNCN----GNVDFNAVGICDHFTG----QCLKCMGH--TEGDHCQRCQRG 866          

HSP 3 Score: 119.398 bits (298), Expect = 5.555e-26
Identity = 99/338 (29.29%), Postives = 143/338 (42.31%), Query Frame = 2
Query: 2591 SGVHCDRCIEGYY-----GNPKKKISCKRCKCNNNQESCDPVTGECRCSYNTMGTECQLCKHGFYGDALTKS---CKKCDCDSLGSTSENCDKLTGKC-DCRTNFVNRQCDSCTSGLYLKD-------KKCIPCNCEIQGRISSEKFCNTTSGQCF-CLENVNGDRCEKCVEGYFNYP-------NCKKCLCSPHALSA---DCDLNNGKCKCGSNVINRICDKCENLHYWNNRT--DCVPCNCGR-GSLNPKCDMETGNCKCAQNVARRDCSKCDVGYFGLDVTGCKKC---PPCYNGQVCNNEGICVCPPNTIGNLCNKCSEDSWDFNETIGCKKC 3505
            SG  C+ C  G+      G P    +C  CKC+ +   CDP TG C CS+ T G  C+ C  G+YG+AL  +   C+ C C    S  +  +     C +C       +C  C  G Y          + C+ CNC      ++   C+  +GQC  C+ +  GD C++C  G++           CK C CS    S    +C    G C C S+V  R C  CE + ++N +    C  C C   GS +  C   TG C C   V    C  C +G+FG    GC+ C   P       C+  G C C    +G  C+KC  + +       C++C
Sbjct:  697 SGQFCEGCAPGFTRQEPGGGPLS--ACVPCKCHQHG-ICDPETGVCECSHFTTGMTCEHCLPGYYGNALIGTPGDCQPCPCPDRSSCVQIAETGQVVCTNCPAGQTGMRCQMCEDGYYGDPMGQSGTVRPCVRCNCNGNVDFNAVGICDHFTGQCLKCMGHTEGDHCQRCQRGFYGNALEQTSGQKCKPCSCSSAGTSGHVNECHPQTGSCHCLSHVTGRDCSYCE-VGFFNLQPGYGCERCKCSPIGSTSQACHPFTGECVCRPGVEGTLCDSCRLGFFGFSSRGCRACNCDPMGSVSMQCHGNGTCQCRQGFVGYKCDKCEVNYFHNRANHQCEEC 1030          

HSP 4 Score: 116.316 bits (290), Expect = 4.962e-25
Identity = 111/405 (27.41%), Postives = 167/405 (41.23%), Query Frame = 2
Query: 2855 KCDCRTNFVNRQCDSCTSGLYLKD------KKCIPCNCEIQGRISSEKFCNTTSGQCFCLENVNGDRCEKCVEGYFNYP------NCKKCLCSPHALSADCDLNNGKC---KCGSNVINRICDKCENLHYWNNRTD------CVPCNC-GRGSLNPK--CDMETGNC-KCAQNVARRDCSKCDVGYFG--LDVTGCKKCPPC------YNGQV--CNNE-GICVCPPNTIGNLCNKCSEDSWDFNETIGCKKCNCYINGSYSNICNKISGICACKTAFFGSKCDRCNEGYYGFPN--CQPCSCAENGTKSNELTKCDKITGQCQCKQNVIGTKCKVCRKGTFPSDGTYEGGCFSC-FCFGVSEKCHAILNHRIVENSIYEYHIFDEKNSLESGKDYSTIHLNANY 3952
            +C C   F  + C+ C  G   ++        C+PC C   G       C+  +G C C     G  CE C+ GY+         +C+ C C P   S       G+     C +      C  CE+ +Y +          CV CNC G    N    CD  TG C KC  +     C +C  G++G  L+ T  +KC PC       +G V  C+ + G C C  +  G  C+ C    ++     GC++C C   GS S  C+  +G C C+    G+ CD C  G++GF +  C+ C+C   G+ S    +C    G CQC+Q  +G KC  C    F +   ++  C  C  C+ + +K    L  R+ +      H FD +  L    +    H+   Y
Sbjct:  689 QCSCPLGFSGQFCEGCAPGFTRQEPGGGPLSACVPCKCHQHG------ICDPETGVCECSHFTTGMTCEHCLPGYYGNALIGTPGDCQPCPC-PDRSSCVQIAETGQVVCTNCPAGQTGMRCQMCEDGYYGDPMGQSGTVRPCVRCNCNGNVDFNAVGICDHFTGQCLKCMGHTEGDHCQRCQRGFYGNALEQTSGQKCKPCSCSSAGTSGHVNECHPQTGSCHCLSHVTGRDCSYCEVGFFNLQPGYGCERCKCSPIGSTSQACHPFTGECVCRPGVEGTLCDSCRLGFFGFSSRGCRACNCDPMGSVS---MQCHG-NGTCQCRQGFVGYKCDKCEVNYFHNRANHQ--CEECPVCYSLVKKQAEKLQTRLQDLEKLLSH-FDCRGRLGRQPNLQQYHMAGFY 1079          

HSP 5 Score: 102.449 bits (254), Expect = 7.888e-21
Identity = 95/354 (26.84%), Postives = 141/354 (39.83%), Query Frame = 2
Query: 4484 CNALTFGNHCQNPISGYYKEYFNLPNSTKSGSMRTGNRILINLKKCNCNG-----YSKVCDSVTGDCQNCMGNREGNKCQLCREGFYKN---DKNYDQCEPCQCPSA----HYNFAQ------------------------------------NCTRIESSLEL------KCQCRIGYSGKSCENCQQGFYGNPIKGIPCKSCDCNQQGSQSLNCNEFGICQCSPGVLGIKCDQCAPNYVVEK-----KTCQSCYSGCTKD---LLVRIDTLNETVINF----KWKTLPSTLDLRLNKINISIQMSSE--LLNSINKFYKLKNEIKNFSIQFQKMKDDAKEKYGEIEKLKTRYN 5341
            C A   G  CQ    GYY +        +SG++R   R       CNCNG        +CD  TG C  CMG+ EG+ CQ C+ GFY N     +  +C+PC C SA    H N                                        C+ I S+ +       +C CR G  G  C++C+ GF+G   +G  C++C+C+  GS S+ C+  G CQC  G +G KCD+C  NY   +     + C  CYS   K    L  R+  L + + +F    +    P+     +       Q+  E  L N++  F   +   + F  QF  ++        ++  L    N
Sbjct:  794 CPAGQTGMRCQMCEDGYYGDPMG-----QSGTVRPCVR-------CNCNGNVDFNAVGICDHFTGQCLKCMGHTEGDHCQRCQRGFYGNALEQTSGQKCKPCSCSSAGTSGHVNECHPQTGSCHCLSHVTGRDCSYCEVGFFNLQPGYGCERCKCSPIGSTSQACHPFTGECVCRPGVEGTLCDSCRLGFFGFSSRG--CRACNCDPMGSVSMQCHGNGTCQCRQGFVGYKCDKCEVNYFHNRANHQCEECPVCYSLVKKQAEKLQTRLQDLEKLLSHFDCRGRLGRQPNLQQYHMAGFYQHDQLRGEDSLPNALEDFLAFQEAREAFIKQFSSLEAATGTLSAQLHGLTFTLN 1133          

HSP 6 Score: 79.337 bits (194), Expect = 8.474e-14
Identity = 70/227 (30.84%), Postives = 97/227 (42.73%), Query Frame = 2
Query: 2660 RCKCNNNQESCDPVTGE-----CRCSYNTMGTECQLCKHGFYGDA--------LTKSCKKCDCDSLGSTSENC---------DKLTGKC-DCRTNFVNRQCDSCTSGLY--LKDKKCIPCNCEIQGRISSEKFCNTTSGQCFCLENVNGDRCEKCVEGYFNY--PNCKKCLCSPHALSADCDLNNGKCKCGSNVINRICDKCENLHY---WNNRTDCVPCNCGRGSL 3250
            RCKCN +   C  V GE     C C ++T+G +CQ C H FY D             C KC+C+     S+ C             G+C DCR N     C+ C +  Y    +  C+ CNC I G +S +  CN   G+C C   V G +C  C +G+ +     C+ C C       +C   +G+C C  NV    C +C+   +     N   C PC C   SL
Sbjct:  281 RCKCNGHASEC--VEGERGDLVCACQHHTVGADCQKC-HPFYQDRPWARATGDSANECLKCNCN---GRSDQCIFDMEQYRSTGSGGRCVDCRDNTDGAHCEHCKANHYRVAPEDPCLACNCNINGSVSLQ--CN-AEGRCVCRPGVTGAKCNMCQDGFHSLGPSGCRPCECHHSGSVGECSPLDGQCFCKRNVEGHRCGRCKPGFFNLQLQNPAGCQPCFCFGHSL 498          

HSP 7 Score: 61.6178 bits (148), Expect = 1.869e-8
Identity = 60/213 (28.17%), Postives = 84/213 (39.44%), Query Frame = 2
Query: 4478 CICNALTFGNHCQ--NPISGYYKEYFNLPNSTKSGSMRTGNRILINLKKCNCNGYSKVC---------DSVTGDCQNCMGNREGNKCQLCREGFYKNDKNYDQCEPCQCPSAHYNFAQNCTRIESSLELKCQCRIGYSGKSCENCQQGFYGNPIKGIPCKSCDCNQQGSQSLNCNEFGICQCSPGVLGIKCDQCAPNY----VVEKKTCQSCY 5071
            C C   T G  CQ  +P       Y + P +  +G   + N  L    KCNCNG S  C             G C +C  N +G  C+ C+   Y+     D C  C C             ++ + E +C CR G +G  C  CQ GF+     G  C+ C+C+  GS        G C C   V G +C +C P +    +     CQ C+
Sbjct:  301 CACQHHTVGADCQKCHPF------YQDRPWARATGD--SANECL----KCNCNGRSDQCIFDMEQYRSTGSGGRCVDCRDNTDGAHCEHCKANHYRVAPE-DPCLACNCN------INGSVSLQCNAEGRCVCRPGVTGAKCNMCQDGFHSLGPSG--CRPCECHHSGSVGECSPLDGQCFCKRNVEGHRCGRCKPGFFNLQLQNPAGCQPCF 492          

HSP 8 Score: 55.4546 bits (132), Expect = 1.251e-6
Identity = 49/152 (32.24%), Postives = 66/152 (43.42%), Query Frame = 2
Query: 4616 KCNCNGYSKVC-DSVTGDCQ-NCMGNREGNKCQLCREGFYKN-------DKNYDQCEPCQC--PSAHYNFAQNCTRIESSLELKCQCRIGYSGKSCENCQQGFYGNPIKGIPCKSCDCNQQGSQSLNCNEFGICQCSPGVLGIKCDQCAPNY 5038
            +C CNG++  C +   GD    C  +  G  CQ C   FY++         + ++C  C C   S    F     R   S      CR    G  CE+C+   Y    +  PC +C+CN  GS SL CN  G C C PGV G KC+ C   +
Sbjct:  281 RCKCNGHASECVEGERGDLVCACQHHTVGADCQKCHP-FYQDRPWARATGDSANECLKCNCNGRSDQCIFDMEQYRSTGSGGRCVDCRDNTDGAHCEHCKANHYRVAPED-PCLACNCNINGSVSLQCNAEGRCVCRPGVTGAKCNMCQDGF 430          

HSP 9 Score: 53.5286 bits (127), Expect = 5.778e-6
Identity = 54/202 (26.73%), Postives = 86/202 (42.57%), Query Frame = 2
Query: 4478 CICNALTFGNHCQNPISGYYKEYFNLPNSTKSGSMRTGNRILI---NLKKCNCNGYS---KVCDSVTGDCQNCMGNREGNKCQLCREGFYKNDKNYD-QCEPCQCPSAHYNFAQNCTRIESSLELKCQCRIGYS-GKSCENCQQGFYGNPIK---GIPCKSCDCNQQGSQSLNCNE----FGICQCSPGVLGIKCDQCAPNY 5038
            C C+  T G  C++ + GYY                 GN ++    + + C C   S   ++ ++    C NC   + G +CQ+C +G+Y +         PC   + + N   N   I      +C   +G++ G  C+ CQ+GFYGN ++   G  CK C C+  G+ S + NE     G C C   V G  C  C   +
Sbjct:  739 CECSHFTTGMTCEHCLPGYY-----------------GNALIGTPGDCQPCPCPDRSSCVQIAETGQVVCTNCPAGQTGMRCQMCEDGYYGDPMGQSGTVRPCVRCNCNGNVDFNAVGICDHFTGQCLKCMGHTEGDHCQRCQRGFYGNALEQTSGQKCKPCSCSSAGT-SGHVNECHPQTGSCHCLSHVTGRDCSYCEVGF 922          
BLAST of Laminin subunit alpha-2 vs. Ensembl Medaka
Match: lamc3 (laminin subunit gamma 3 [Source:NCBI gene;Acc:105355198])

HSP 1 Score: 367.851 bits (943), Expect = 1.993e-102
Identity = 307/1065 (28.83%), Postives = 463/1065 (43.47%), Query Frame = 2
Query:  197 NAKITSSATCGTGGPEIFCRLVDEIAIQRLINPDSHVLCDVCDNRNETKRHPIEFA---KSDDDNLWWQSPSMAQGLKY-QNVNVTIDLKQVYQIVYILLKMGDSPRPGNWILERSLDGEIYMPWIFFAETPYSCYNLFQRQYPDLKLTTNAKPSSLADDEMFCTTYYSQPKSLNSGEIIISLINGRKSIMNEEYLSIKSVPQTLINFLSARYIRFRFLKHLTLAADLMTHKGYL---------EQSIYNRYYYSLRNIEIGGKCICNNHADKCDKVIENGISVAKCNCKHNTCGSNCETCCPLFNQRPWKPVA-----VCEECNCNRKSNECSYNQTVATLQLSVNKMGRMEGGGVCINCQENTEGINCEKCIKGFYRPWNVLATELYPCTPCQCHGLGTIGSCVSNGEDIGDQKPGDCICKKGYEGVNCDLCSIGYERYPNGECLPCPCSIDGSVRTSFYRCKP---PCNCKVHVNSDDLCKTCKNGYFNLDSANPEGCEPCYCFGITNQCSS------LSAKNLKISDLKGWKLTTFTGEKIALPKFTSFQY---LTSENSYIDERFNNPTVYYWTAPPPYLGNWITSYGTIFRYVVKIELQSTLKGSL--IDSPDVIIKCGDFRLFHSVSIEDRRLQRQVFIYIKPTEWKIGKLTPDKAATKEEFISCLVKVDKLLIKAKYYSNQKSIELLNITLSRGEVHLALDEMPH--IEKCNCPPGFNGLSCESCESGY-RRVNNVLYQGQCEACACYNHSNTCDSLNGECQNCTHNTAGAHCEDCASGYYGDAKSKNLNSCKKCPCPRLD--YQMTELCSSYSSENYVCHKCLHNTSGVHCDRCIEGYYGNPKKKIS----CKRCKCNNNQES-----CDPVTGEC-RCSYNTMGTECQLCKHGFYGDALTKS----CKKCDCDSLGSTSE--NCDKLTGKCDCRTNFVNRQCDSCTSGLY--LKDKKCIPCNCEIQGRISSEKFCNTTSGQCFCLENVNGDRCEKCVEGYFNYPN--CKKCLCSPH-ALSADCDLNNGKCKCGSNVINRICDKCENLHYWNNRTD 3217
            N  + +S  CG+  PE +C           +   S   C  CD  +    H          +++  WWQS SM  G++Y ++VN+T+ L + ++I YI LK   S      I +R+ +G  ++P+ +++    SC   + +           + ++L      CT  +S    L  G +  S + GR S  N                    + +  FL+    A DL+     L         +  +   Y+Y++ +  +GG+C CN HA +C   +E       C C+H+T G++C+ C P +  RPW          C +CNCN +S++C ++         + +      GG C++C++NT+G +CE C    YR    +A E  PC  C C+  G++ S   N E       G C+C+ G  G  C++C  G+       C PC C   GSV      C P    C CK +V     C  CK G+FNL   NP GC+PC+CFG +  CSS      ++  +  I D   W    F GE+  L       Y   LT E+S            ++ AP  +LG+ I SYG         E    L  SL  I     +    D      +  +      Q FI ++  E++     P  +A   E    L  +  L I      N  S +L  +TL+   +      +P   +E+C+CP GF+G  CE C  G+ R+         C  C C+ H   CD   G C+ C+H T G  CE C  GYYG+A       C+ CPCP      Q+ E      +   VC  C    +G+ C  C +GYYG+P  +      C RC CN N +      CD  TG+C +C  +T G  CQ C+ GFYG+AL ++    CK C C S G++     C   TG C C ++   R C  C  G +       C  C C   G  S+ + C+  +G+C C   V G  C+ C  G+F + +  C+ C C P  ++S  C   NG C+C    +   CDKCE ++Y++NR +
Sbjct:   59 NRTVEASNVCGST-PEDYC-----------MQTGSTRSCHYCDASDPELSHNASLLTDFHRNEEPTWWQSQSMFYGIQYPKSVNLTLHLGKAFEITYIRLKFYTSRPESFAIYKRTEEGGPWLPYQYYSA---SCKKTYGKDAKGFIRPGEEEKTAL------CTDEFSDISPLTGGNVAFSTLEGRPSAYN--------------------FDQSLFLQEWVTATDLLISLDRLNTFGDEFFKDAKVLRSYFYAISDFSVGGRCKCNGHASEC---VEGERGDLVCACQHHTVGADCQKCHPFYQDRPWARATGDSANECLKCNCNGRSDQCIFD---------MEQYRSTGSGGRCVDCRDNTDGAHCEHCKANHYR----VAPE-DPCLACNCNINGSV-SLQCNAE-------GRCVCRPGVTGAKCNMCQDGFHSLGPSGCRPCECHHSGSVG----ECSPLDGQCFCKRNVEGHR-CGRCKPGFFNLQLQNPAGCQPCFCFGHSLACSSSNHYTPVNITSDFIEDQDRWVGEFFGGEEYILQWKEGEVYLLPLTEEDS-----------GFYKAPDKFLGHQIYSYGQPLHITFTSETYDLLPNSLTVILEGSGMTLSADLYPKPILHPDPSNSPMQHFI-VRLHEYET-SFKPRLSAF--ELQHLLYNLTALKISNAGGHNYTS-QLARVTLASASISSRPLSLPAAWVEQCSCPLGFSGQFCEGCAPGFTRQEPGGGPLSACVPCKCHQH-GICDPETGVCE-CSHFTTGMTCEHCLPGYYGNALIGTPGDCQPCPCPDRSSCVQIAE------TGQVVCTNCPAGQTGMRCQMCEDGYYGDPMGQSGTVRPCVRCNCNGNVDFNAVGICDHFTGQCLKCMGHTEGDHCQRCQRGFYGNALEQTSGQKCKPCSCSSAGTSGHVNECHPQTGSCHCLSHVTGRDCSYCEVGFFNLQPGYGCERCKCSPIG--STSQACHPFTGECVCRPGVEGTLCDSCRLGFFGFSSRGCRACNCDPMGSVSMQCH-GNGTCQCRQGFVGYKCDKCE-VNYFHNRAN 1024          

HSP 2 Score: 127.102 bits (318), Expect = 2.517e-28
Identity = 143/573 (24.96%), Postives = 224/573 (39.09%), Query Frame = 2
Query: 3407 GICV-CPPNTIGNLCNKCSEDSWDFNETIGCKKCNCYINGSYSNICNKISGICACKTAFFGSKCDRCNEGYY--GFPNCQPCSCAENGTKSNELTKCDKITGQCQCKQNVIGTKCKVCRKGTFPSDGTYEGGCFSCFCFGVSEKCHAILNHRIVENSIYEYHIFDEK---NSLESGKDYSTIHLNANYPRRFGWPLTMFRPIYVNVMKLFNSHDLSLFYRSIFMNVSVDCLDNKCGREIPEQTEVFMESYNGLFGMRYXXXXXXXXXXXXXXDFNEHSKNGKWVISQYQNDILDKFIIL--EDSNVINSNLTRDIFMMALLNVTSLKVK-LYTDKVNPPLIKIKIITYKVMETTQAIGKRVTAVEKCICNALTFGNHCQNPISGYYKEYFNLPNSTKSGSMRTGNRILINLKKCNCNGYSKVCDSVTGDCQNCMGNREGNKCQLCREGFYKND--KNYDQCEPCQCPSAHYNFAQNCTRIESSLELKC-QCRIGYSGKSCENCQQGFYGNPIKGI----PCKSCDCNQQGSQSLNCNEFGICQCSPGVLGIKCDQCAPNYVVEKKTCQSCYSG 5077
            G CV C  NT G  C  C  + +       C  CNC INGS S  CN   G C C+    G+KC+ C +G++  G   C+PC C  +G+    + +C  + GQC CK+NV G +C  C+ G F        GC  CFCFG S  C +  NH    N   ++ I D+         G++Y    L       +  PLT     +      F  H +  + + + +  + +  D      +P    V +E      GM    +                      +     N  +  FI+   E        L+       L N+T+LK+           L ++ + +  +  +++ +      VE+C C     G  C+    G+ ++               G   L     C C+ +  +CD  TG C+ C     G  C+ C  G+Y N        C+PC CP        +C +I  + ++ C  C  G +G  C+ C+ G+YG+P+       PC  C+CN     +++ N  GIC    G    +C +C  +   E   CQ C  G
Sbjct:  361 GRCVDCRDNTDGAHCEHCKANHYRVAPEDPCLACNCNINGSVSLQCNA-EGRCVCRPGVTGAKCNMCQDGFHSLGPSGCRPCECHHSGS----VGECSPLDGQCFCKRNVEGHRCGRCKPGFFNLQLQNPAGCQPCFCFGHSLACSSS-NHYTPVNITSDF-IEDQDRWVGEFFGGEEYI---LQWKEGEVYLLPLTEEDSGFYKAPDKFLGHQIYSYGQPLHITFTSETYD-----LLPNSLTVILEGS----GMTLSADLYPK----------------PILHPDPSNSPMQHFIVRLHEYETSFKPRLSAFELQHLLYNLTALKISNAGGHNYTSQLARVTLASASI--SSRPLSLPAAWVEQCSCPLGFSGQFCEGCAPGFTRQ-------------EPGGGPLSACVPCKCHQHG-ICDPETGVCE-CSHFTTGMTCEHCLPGYYGNALIGTPGDCQPCPCPD-----RSSCVQIAETGQVVCTNCPAGQTGMRCQMCEDGYYGDPMGQSGTVRPCVRCNCN----GNVDFNAVGICDHFTG----QCLKCMGH--TEGDHCQRCQRG 866          

HSP 3 Score: 119.398 bits (298), Expect = 4.814e-26
Identity = 99/338 (29.29%), Postives = 143/338 (42.31%), Query Frame = 2
Query: 2591 SGVHCDRCIEGYY-----GNPKKKISCKRCKCNNNQESCDPVTGECRCSYNTMGTECQLCKHGFYGDALTKS---CKKCDCDSLGSTSENCDKLTGKC-DCRTNFVNRQCDSCTSGLYLKD-------KKCIPCNCEIQGRISSEKFCNTTSGQCF-CLENVNGDRCEKCVEGYFNYP-------NCKKCLCSPHALSA---DCDLNNGKCKCGSNVINRICDKCENLHYWNNRT--DCVPCNCGR-GSLNPKCDMETGNCKCAQNVARRDCSKCDVGYFGLDVTGCKKC---PPCYNGQVCNNEGICVCPPNTIGNLCNKCSEDSWDFNETIGCKKC 3505
            SG  C+ C  G+      G P    +C  CKC+ +   CDP TG C CS+ T G  C+ C  G+YG+AL  +   C+ C C    S  +  +     C +C       +C  C  G Y          + C+ CNC      ++   C+  +GQC  C+ +  GD C++C  G++           CK C CS    S    +C    G C C S+V  R C  CE + ++N +    C  C C   GS +  C   TG C C   V    C  C +G+FG    GC+ C   P       C+  G C C    +G  C+KC  + +       C++C
Sbjct:  697 SGQFCEGCAPGFTRQEPGGGPLS--ACVPCKCHQHG-ICDPETGVCECSHFTTGMTCEHCLPGYYGNALIGTPGDCQPCPCPDRSSCVQIAETGQVVCTNCPAGQTGMRCQMCEDGYYGDPMGQSGTVRPCVRCNCNGNVDFNAVGICDHFTGQCLKCMGHTEGDHCQRCQRGFYGNALEQTSGQKCKPCSCSSAGTSGHVNECHPQTGSCHCLSHVTGRDCSYCE-VGFFNLQPGYGCERCKCSPIGSTSQACHPFTGECVCRPGVEGTLCDSCRLGFFGFSSRGCRACNCDPMGSVSMQCHGNGTCQCRQGFVGYKCDKCEVNYFHNRANHQCEEC 1030          

HSP 4 Score: 116.701 bits (291), Expect = 3.309e-25
Identity = 111/405 (27.41%), Postives = 167/405 (41.23%), Query Frame = 2
Query: 2855 KCDCRTNFVNRQCDSCTSGLYLKD------KKCIPCNCEIQGRISSEKFCNTTSGQCFCLENVNGDRCEKCVEGYFNYP------NCKKCLCSPHALSADCDLNNGKC---KCGSNVINRICDKCENLHYWNNRTD------CVPCNC-GRGSLNPK--CDMETGNC-KCAQNVARRDCSKCDVGYFG--LDVTGCKKCPPC------YNGQV--CNNE-GICVCPPNTIGNLCNKCSEDSWDFNETIGCKKCNCYINGSYSNICNKISGICACKTAFFGSKCDRCNEGYYGFPN--CQPCSCAENGTKSNELTKCDKITGQCQCKQNVIGTKCKVCRKGTFPSDGTYEGGCFSC-FCFGVSEKCHAILNHRIVENSIYEYHIFDEKNSLESGKDYSTIHLNANY 3952
            +C C   F  + C+ C  G   ++        C+PC C   G       C+  +G C C     G  CE C+ GY+         +C+ C C P   S       G+     C +      C  CE+ +Y +          CV CNC G    N    CD  TG C KC  +     C +C  G++G  L+ T  +KC PC       +G V  C+ + G C C  +  G  C+ C    ++     GC++C C   GS S  C+  +G C C+    G+ CD C  G++GF +  C+ C+C   G+ S    +C    G CQC+Q  +G KC  C    F +   ++  C  C  C+ + +K    L  R+ +      H FD +  L    +    H+   Y
Sbjct:  689 QCSCPLGFSGQFCEGCAPGFTRQEPGGGPLSACVPCKCHQHG------ICDPETGVCECSHFTTGMTCEHCLPGYYGNALIGTPGDCQPCPC-PDRSSCVQIAETGQVVCTNCPAGQTGMRCQMCEDGYYGDPMGQSGTVRPCVRCNCNGNVDFNAVGICDHFTGQCLKCMGHTEGDHCQRCQRGFYGNALEQTSGQKCKPCSCSSAGTSGHVNECHPQTGSCHCLSHVTGRDCSYCEVGFFNLQPGYGCERCKCSPIGSTSQACHPFTGECVCRPGVEGTLCDSCRLGFFGFSSRGCRACNCDPMGSVS---MQCHG-NGTCQCRQGFVGYKCDKCEVNYFHNRANHQ--CEECPVCYSLVKKQAEKLQTRLQDLEKLLSH-FDCRGRLGRQPNLQQYHMAGFY 1079          

HSP 5 Score: 102.449 bits (254), Expect = 7.335e-21
Identity = 93/336 (27.68%), Postives = 137/336 (40.77%), Query Frame = 2
Query: 4484 CNALTFGNHCQNPISGYYKEYFNLPNSTKSGSMRTGNRILINLKKCNCNG-----YSKVCDSVTGDCQNCMGNREGNKCQLCREGFYKN---DKNYDQCEPCQCPSA----HYNFAQ------------------------------------NCTRIESSLEL------KCQCRIGYSGKSCENCQQGFYGNPIKGIPCKSCDCNQQGSQSLNCNEFGICQCSPGVLGIKCDQCAPNYVVEK-----KTCQSCYSGCTKD---LLVRIDTLNETVINF----KWKTLPSTLDLRLNKINISIQMSSE--LLNSINKFYKLKNEIKNFSIQFQKMK 5287
            C A   G  CQ    GYY +        +SG++R   R       CNCNG        +CD  TG C  CMG+ EG+ CQ C+ GFY N     +  +C+PC C SA    H N                                        C+ I S+ +       +C CR G  G  C++C+ GF+G   +G  C++C+C+  GS S+ C+  G CQC  G +G KCD+C  NY   +     + C  CYS   K    L  R+  L + + +F    +    P+     +       Q+  E  L N++  F   +   + F  QF  ++
Sbjct:  794 CPAGQTGMRCQMCEDGYYGDPMG-----QSGTVRPCVR-------CNCNGNVDFNAVGICDHFTGQCLKCMGHTEGDHCQRCQRGFYGNALEQTSGQKCKPCSCSSAGTSGHVNECHPQTGSCHCLSHVTGRDCSYCEVGFFNLQPGYGCERCKCSPIGSTSQACHPFTGECVCRPGVEGTLCDSCRLGFFGFSSRG--CRACNCDPMGSVSMQCHGNGTCQCRQGFVGYKCDKCEVNYFHNRANHQCEECPVCYSLVKKQAEKLQTRLQDLEKLLSHFDCRGRLGRQPNLQQYHMAGFYQHDQLRGEDSLPNALEDFLAFQEAREAFIKQFSSLE 1115          

HSP 6 Score: 79.7221 bits (195), Expect = 6.674e-14
Identity = 70/227 (30.84%), Postives = 97/227 (42.73%), Query Frame = 2
Query: 2660 RCKCNNNQESCDPVTGE-----CRCSYNTMGTECQLCKHGFYGDA--------LTKSCKKCDCDSLGSTSENC---------DKLTGKC-DCRTNFVNRQCDSCTSGLY--LKDKKCIPCNCEIQGRISSEKFCNTTSGQCFCLENVNGDRCEKCVEGYFNY--PNCKKCLCSPHALSADCDLNNGKCKCGSNVINRICDKCENLHY---WNNRTDCVPCNCGRGSL 3250
            RCKCN +   C  V GE     C C ++T+G +CQ C H FY D             C KC+C+     S+ C             G+C DCR N     C+ C +  Y    +  C+ CNC I G +S +  CN   G+C C   V G +C  C +G+ +     C+ C C       +C   +G+C C  NV    C +C+   +     N   C PC C   SL
Sbjct:  281 RCKCNGHASEC--VEGERGDLVCACQHHTVGADCQKC-HPFYQDRPWARATGDSANECLKCNCN---GRSDQCIFDMEQYRSTGSGGRCVDCRDNTDGAHCEHCKANHYRVAPEDPCLACNCNINGSVSLQ--CN-AEGRCVCRPGVTGAKCNMCQDGFHSLGPSGCRPCECHHSGSVGECSPLDGQCFCKRNVEGHRCGRCKPGFFNLQLQNPAGCQPCFCFGHSL 498          

HSP 7 Score: 61.6178 bits (148), Expect = 1.649e-8
Identity = 60/213 (28.17%), Postives = 84/213 (39.44%), Query Frame = 2
Query: 4478 CICNALTFGNHCQ--NPISGYYKEYFNLPNSTKSGSMRTGNRILINLKKCNCNGYSKVC---------DSVTGDCQNCMGNREGNKCQLCREGFYKNDKNYDQCEPCQCPSAHYNFAQNCTRIESSLELKCQCRIGYSGKSCENCQQGFYGNPIKGIPCKSCDCNQQGSQSLNCNEFGICQCSPGVLGIKCDQCAPNY----VVEKKTCQSCY 5071
            C C   T G  CQ  +P       Y + P +  +G   + N  L    KCNCNG S  C             G C +C  N +G  C+ C+   Y+     D C  C C             ++ + E +C CR G +G  C  CQ GF+     G  C+ C+C+  GS        G C C   V G +C +C P +    +     CQ C+
Sbjct:  301 CACQHHTVGADCQKCHPF------YQDRPWARATGD--SANECL----KCNCNGRSDQCIFDMEQYRSTGSGGRCVDCRDNTDGAHCEHCKANHYRVAPE-DPCLACNCN------INGSVSLQCNAEGRCVCRPGVTGAKCNMCQDGFHSLGPSG--CRPCECHHSGSVGECSPLDGQCFCKRNVEGHRCGRCKPGFFNLQLQNPAGCQPCF 492          

HSP 8 Score: 55.8398 bits (133), Expect = 1.066e-6
Identity = 49/152 (32.24%), Postives = 66/152 (43.42%), Query Frame = 2
Query: 4616 KCNCNGYSKVC-DSVTGDCQ-NCMGNREGNKCQLCREGFYKN-------DKNYDQCEPCQC--PSAHYNFAQNCTRIESSLELKCQCRIGYSGKSCENCQQGFYGNPIKGIPCKSCDCNQQGSQSLNCNEFGICQCSPGVLGIKCDQCAPNY 5038
            +C CNG++  C +   GD    C  +  G  CQ C   FY++         + ++C  C C   S    F     R   S      CR    G  CE+C+   Y    +  PC +C+CN  GS SL CN  G C C PGV G KC+ C   +
Sbjct:  281 RCKCNGHASECVEGERGDLVCACQHHTVGADCQKCHP-FYQDRPWARATGDSANECLKCNCNGRSDQCIFDMEQYRSTGSGGRCVDCRDNTDGAHCEHCKANHYRVAPED-PCLACNCNINGSVSLQCNAEGRCVCRPGVTGAKCNMCQDGF 430          

HSP 9 Score: 53.5286 bits (127), Expect = 5.005e-6
Identity = 54/202 (26.73%), Postives = 86/202 (42.57%), Query Frame = 2
Query: 4478 CICNALTFGNHCQNPISGYYKEYFNLPNSTKSGSMRTGNRILI---NLKKCNCNGYS---KVCDSVTGDCQNCMGNREGNKCQLCREGFYKNDKNYD-QCEPCQCPSAHYNFAQNCTRIESSLELKCQCRIGYS-GKSCENCQQGFYGNPIK---GIPCKSCDCNQQGSQSLNCNE----FGICQCSPGVLGIKCDQCAPNY 5038
            C C+  T G  C++ + GYY                 GN ++    + + C C   S   ++ ++    C NC   + G +CQ+C +G+Y +         PC   + + N   N   I      +C   +G++ G  C+ CQ+GFYGN ++   G  CK C C+  G+ S + NE     G C C   V G  C  C   +
Sbjct:  739 CECSHFTTGMTCEHCLPGYY-----------------GNALIGTPGDCQPCPCPDRSSCVQIAETGQVVCTNCPAGQTGMRCQMCEDGYYGDPMGQSGTVRPCVRCNCNGNVDFNAVGICDHFTGQCLKCMGHTEGDHCQRCQRGFYGNALEQTSGQKCKPCSCSSAGT-SGHVNECHPQTGSCHCLSHVTGRDCSYCEVGF 922          
BLAST of Laminin subunit alpha-2 vs. Ensembl Medaka
Match: ENSORLT00000031008.1 (pep primary_assembly:ASM223467v1:17:25500792:25530071:1 gene:ENSORLG00000029606.1 transcript:ENSORLT00000031008.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 309.301 bits (791), Expect = 3.800e-91
Identity = 182/539 (33.77%), Postives = 277/539 (51.39%), Query Frame = 2
Query:   83 HLKMRIFIIFILLIVHKAHSQDDEPEILSVNVDGL---LMENAKITSSATCG---TGGP--EIFCRLVDEIAIQRLINPDSHVLCDVCDNRNETKRHPIEFAKSDDDNLWWQSPSMAQGLKYQNVNVTIDLKQVYQIVYILLKMGDSPRPGNWILERSLD-GEIYMPWIFFAETPYSCYNLFQRQYPDLKLTTNAKPSSLADDEMFCTTYYSQPKSLNSGEIIISLINGRKSIMNEEYLSIKSVPQTLINFLSARYIRFRFLKHLTLAADLMTHKGYLEQSIYNRYYYSLRNIEIGGKCICNNHADKCDKVIENGISVAKCNCKHNTCGSNCETCCPLFNQRPWKPVAV-----CEECNCNRKSNECSYNQTVATLQLSVNKMGRMEGGGVCINCQENTEGINCEKCIKGFYRPWNVLATELYPCTPCQCHGLGTIGSCVSNGEDIGDQKPGDCICKKGYEGVNCDLCSIGYERYPN---------------GECLPCPCSIDGSVRTSFYRCKPPCNCKVHVNSDDLCKTCKNGYFNL 1612
            HL + +F+     ++  A  Q+   ++   +++     L E  KI++SATCG    G P  +++C+LV                CD C++ + +K HP   A  D    WWQSP +++G  Y  VNVT+DL Q++ + Y+L+K  +SPRP  W+LERS+D G  + PW FFA +   C   F +  P+ ++        L DD+  CTT YS+   L +GEI++SLINGR    N  Y  +      L  F  A  IR RFL+  TL   L++ K   + S+  RYYYS+++I +GG+C+C+ HA          ++  KC C+HNTCG +C+ CCP FNQ+PW+         C  C C   +++C Y+  V     S++  GR  GGGVC++CQ NT G+NCE+C +GF+RP++V       C  C C          ++G ++G    G C+C+  + G NCD C+ GY  YP                G  + C C   G+V +        C C+  V+  + C  C+ GY++ 
Sbjct:    9 HL-LAVFLTSWATVLRDAGGQEPFNDLTGFSLNPPYFNLAEGIKISASATCGQDEAGAPRQDLYCKLVGGPNYGLSNQHIQGQFCDHCNSADPSKAHPATNAI-DGTERWWQSPPLSRGSGYNEVNVTLDLGQLFHVAYVLIKFANSPRPDLWVLERSVDNGRTFTPWQFFAHSKRECIERFGKP-PNARV--------LKDDDQLCTTEYSRIIPLENGEIVVSLINGRPGSKNFTYSPV------LQQFTKATNIRLRFLRTSTLLGHLIS-KAQRDPSVTRRYYYSIKDISVGGRCVCHGHAQ---------VNREKCECQHNTCGESCDRCCPGFNQKPWRAATADSPNECRPCQCFSHASDCYYDPEVERRGASLDTFGRYSGGGVCVDCQHNTAGVNCERCAEGFFRPYDVPPESHTGCISCSCDDR------TASGCEMGS---GRCVCRPQFAGENCDRCADGYYLYPQCISYPVRLTTTESPAGPIVACSCDYRGTV-SRVCDASGRCLCREGVDG-ERCDRCRRGYYSF 509          

HSP 2 Score: 95.1301 bits (235), Expect = 3.914e-19
Identity = 68/229 (29.69%), Postives = 104/229 (45.41%), Query Frame = 2
Query: 2534 LCSSYSSENYVCHKCLHNTSGVHCDRCIEGYYGNPKKKIS------CKRCKCNNNQESC--DPVT----------------GEC-RCSYNTMGTECQLCKHGFYG--DALTKS---CKKCDCDSLGSTSENCDKLTGKCDCRTNFVNRQCDSCTSGLYLKDK----------------KCIPCNCEIQGRISSEKFCNTTSGQCFCLENVNGDRCEKCVEGYFNYPNCK 3082
            +C  ++  N    +C HNT G  CDRC  G+   P +  +      C+ C+C ++   C  DP                  G C  C +NT G  C+ C  GF+   D   +S   C  C CD    T+  C+  +G+C CR  F    CD C  G YL  +                  + C+C+ +G +S  + C+  SG+C C E V+G+RC++C  GY+++PNC+
Sbjct:  290 VCHGHAQVNREKCECQHNTCGESCDRCCPGFNQKPWRAATADSPNECRPCQCFSHASDCYYDPEVERRGASLDTFGRYSGGGVCVDCQHNTAGVNCERCAEGFFRPYDVPPESHTGCISCSCDD--RTASGCEMGSGRCVCRPQFAGENCDRCADGYYLYPQCISYPVRLTTTESPAGPIVACSCDYRGTVS--RVCDA-SGRCLCREGVDGERCDRCRRGYYSFPNCQ 513          

HSP 3 Score: 72.4034 bits (176), Expect = 5.793e-12
Identity = 78/262 (29.77%), Postives = 106/262 (40.46%), Query Frame = 2
Query: 3083 KCLCSPHALSADCDLNNGKCKCGSNVINRICDKC---ENLHYWNNRT-----DCVPCNCGRGSLNPKCDMETGNCKCAQNVARRDCSKCDVGYFGLDVTGCKKCPPCYNGQVCNNEGICV-CPPNTIGNLCNKCSEDSWDFNET-----IGCKKCNCYINGSYSNICNKISGICACKTAFFGSKCDRCNEGYYGFPNC-----------------QPCSCAENGTKSNELTKCDKITGQCQCKQNVIGTKCKVCRKG--TFP 3769
            +C+C  HA      +N  KC+C  N     CD+C    N   W   T     +C PC         +C     +C     V RR  S        LD  G       Y+G      G+CV C  NT G  C +C+E  +   +       GC  C+C  +   ++ C   SG C C+  F G  CDRC +GYY +P C                   CSC   GT S     CD  +G+C C++ V G +C  CR+G  +FP
Sbjct:  288 RCVCHGHA-----QVNREKCECQHNTCGESCDRCCPGFNQKPWRAATADSPNECRPC---------QCFSHASDCYYDPEVERRGAS--------LDTFGR------YSGG-----GVCVDCQHNTAGVNCERCAEGFFRPYDVPPESHTGCISCSC--DDRTASGCEMGSGRCVCRPQFAGENCDRCADGYYLYPQCISYPVRLTTTESPAGPIVACSCDYRGTVSR---VCDA-SGRCLCREGVDGERCDRCRRGYYSFP 510          

HSP 4 Score: 62.003 bits (149), Expect = 9.161e-9
Identity = 63/250 (25.20%), Postives = 92/250 (36.80%), Query Frame = 2
Query: 2141 IKAKYYSNQKSIELLNITLSRGEVHLALDEMPHIEKCNCPPGFNGLSCESCESGYR----RVNNVLYQGQCEACACYNHSNTCD------------------SLNGECQNCTHNTAGAHCEDCASGYYG--DAKSKNLNSCKKCPCPRLDYQMTELCSSYSSENYVCHKCLHNTSGVHCDRCIEGYYGNPK-------------KKISCKRCKCNNN---QESCDPVTGECRCSYNTMGTECQLCKHGFY 2770
            +  +YY + K I +    +  G   +      + EKC C     G SC+ C  G+     R        +C  C C++H++ C                   S  G C +C HNTAG +CE CA G++   D   ++   C  C C   D +    C   S        C    +G +CDRC +GYY  P+                    C C+        CD  +G C C     G  C  C+ G+Y
Sbjct:  272 VTRRYYYSIKDISVGGRCVCHGHAQV------NREKCECQHNTCGESCDRCCPGFNQKPWRAATADSPNECRPCQCFSHASDCYYDPEVERRGASLDTFGRYSGGGVCVDCQHNTAGVNCERCAEGFFRPYDVPPESHTGCISCSC---DDRTASGCEMGSGRCV----CRPQFAGENCDRCADGYYLYPQCISYPVRLTTTESPAGPIVACSCDYRGTVSRVCD-ASGRCLCREGVDGERCDRCRRGYY 507          

HSP 5 Score: 56.9954 bits (136), Expect = 3.287e-7
Identity = 42/148 (28.38%), Postives = 66/148 (44.59%), Query Frame = 2
Query: 4652 SVTGDCQNCMGNREGNKCQLCREGFYKNDKNYDQCEPCQCPSAHYNFAQNCT---RIESSLEL---KCQCRIGYSGKSCENCQQGFY------GNPIK-------GIPCKSCDCNQQGSQSLNCNEFGICQCSPGVLGIKCDQCAPNY 5038
            S  G C +C  N  G  C+ C EGF++         P   P   +    +C+   R  S  E+   +C CR  ++G++C+ C  G+Y        P++         P  +C C+ +G+ S  C+  G C C  GV G +CD+C   Y
Sbjct:  368 SGGGVCVDCQHNTAGVNCERCAEGFFR---------PYDVPPESHTGCISCSCDDRTASGCEMGSGRCVCRPQFAGENCDRCADGYYLYPQCISYPVRLTTTESPAGPIVACSCDYRGTVSRVCDASGRCLCREGVDGERCDRCRRGY 506          
BLAST of Laminin subunit alpha-2 vs. Planmine SMEST
Match: SMESG000056013.1 (SMESG000056013.1)

HSP 1 Score: 5771.82 bits (14972), Expect = 0.000e+0
Identity = 2850/2858 (99.72%), Postives = 2853/2858 (99.83%), Query Frame = 2
Query: 1253 EKCIKGFYRPWNVLATELYPCTPCQCHGLGTIGSCVSNGEDIGDQKPGDCICKKGYEGVNCDLCSIGYERYPNGECLPCPCSIDGSVRTSFYRCKPPCNCKVHVNSDDLCKTCKNGYFNLDSANPEGCEPCYCFGITNQCSSLSAKNLKISDLKGWKLTTFTGEKIALPKFTSFQYLTSENSYIDERFNNPTVYYWTAPPPYLGNWITSYGTIFRYVVKIELQSTLKGSLIDSPDVIIKCGDFRLFHSVSIEDRRLQRQVFIYIKPTEWKIGKLTPDKAATKEEFISCLVKVDKLLIKAKYYSNQKSIELLNITLSRGEVHLALDEMPHIEKCNCPPGFNGLSCESCESGYRRVNNVLYQGQCEACACYNHSNTCDSLNGECQNCTHNTAGAHCEDCASGYYGDAKSKNLNSCKKCPCPRLDYQMTELCSSYSSENYVCHKCLHNTSGVHCDRCIEGYYGNPKKKISCKRCKCNNNQESCDPVTGECRCSYNTMGTECQLCKHGFYGDALTKSCKKCDCDSLGSTSENCDKLTGKCDCRTNFVNRQCDSCTSGLYLKDKKCIPCNCEIQGRISSEKFCNTTSGQCFCLENVNGDRCEKCVEGYFNYPNCKKCLCSPHALSADCDLNNGKCKCGSNVINRICDKCENLHYWNNRTDCVPCNCGRGSLNPKCDMETGNCKCAQNVARRDCSKCDVGYFGLDVTGCKKCPPCYNGQVCNNEGICVCPPNTIGNLCNKCSEDSWDFNETIGCKKCNCYINGSYSNICNKISGICACKTAFFGSKCDRCNEGYYGFPNCQPCSCAENGTKSNELTKCDKITGQCQCKQNVIGTKCKVCRKGTFPSDGTYEGGCFSCFCFGVSEKCHAILNHRIVENSIYEYHIFDEKNSLESGKDYSTIHLNANYPRRFGWPLTMFRPIYVNVMKLFNSHDLSLFYRSIFMNVSVDCLDNKCGREIPEQTEVFMESYNGLFGMRYXXXXXXXXXXXXXXDFNEHSKNGKWVISQYQNDILDKFIILEDSNVINSNLTRDIFMMALLNVTSLKVKLYTDKVNPPLIKIKIITYKVMETTQAIGKRVTAVEKCICNALTFGNHCQNPISGYYKEYFNLPNSTKSGSMRTGNRILINLKKCNCNGYSKVCDSVTGDCQNCMGNREGNKCQLCREGFYKNDKNYDQCEPCQCPSAHYNFAQNCTRIESSLELKCQCRIGYSGKSCENCQQGFYGNPIKGIPCKSCDCNQQGSQSLNCNEFGICQCSPGVLGIKCDQCAPNYVVEKKTCQSCYSGCTKDLLVRIDTLNETVINFKWKTLPSTLDLRLNKINISIQMSSELLNSINKFYKLKNEIKNFSIQFQKMKDDAKEKYGEIEKLKTRYNKVLEDLRSTFTDINETISGHEQLGISNELIKNATAYLETIKNIYKEMPNITLAASVLKDVLKYVDELNQIIKYTQSHIQSDQINNLKILKNKTIMADEINTNNKEYLNTMSTKKKEHELYIILINERMKDLQKIFRKMTKQRDNLRKKIQKLDAISKSFQDEKDLISINVREIEDLMKNLSSNHLVSKSLIIPDTLKKHVEQQLNKSSNLIKKLTKDFNFLHNAEQAKEAYSNITRDILAVDYAINQTKKELDFNRSNMNIDSLKKLLAEFNSNKSEIVENIKNIDKEHEKLLKQYKNCSYXXXXXXXXXXXXSSEIPTGFYDVEILKRNLSXXXXXXXXXXXXFILPINQTILNLGTPNVKSGLDTRNLEKLIKVVDNQYRDLVNESSFVENKIKDLRKSIKSLRERLQKARVMSELIHGAAARSVEPIRHVVRCVRHYVTYYLPTSNAFSLEFYMKPQILNDQSLVLFGYDDSGSIPHAFAFTLERNNQYKFWYDSGNSVESIELTGKFSNENYVGIMITWKLGKWHMVIRSISDGRTEQVETSSITNNILSNVRIGPQTNIFVGGFPSSKLLRSLKLEGRLISDLKENYDNYFYKGCLFGVKLMNTEFGLQDIEAIEEECRNTISIDNLLLGKFNCKFNPNSSIIFLDSNIESVNTFKRSVRRQKRDVQTNFDLHFTGNGFAMINTSRTKNGKCATSLNKVLTISTMALPKTHPDTFQLIAVFANKIMKYGFVLGQKNNSYHFGYWKKDVDYPLFPIQNASDSFTWFIFKSKIEKLSETLFGIDEICDHNSLFYLSSIPDNDSYLIEKLKKLKVPNYGFTGKMKFLINKKPLFQVLATRFINVIFLFTEQVRENKFHSLLISPNAINPIEITEHSPNDILQNGFGFTVNFMGQPIAKTLKLLTIELEAGSVNVEVSRALVFSVIVNDVKIDKELQKFNNDNLDWEAHYIVVFLEQKQSSIIVTFTVDNEDIKSQEIMINIGSVNRMTLNPSSTNNHSYYIYNLFIGQKLVNFNELNYLPPGVFLKMRPTNLQPVDIQNPRVDTDKSIPRVSYKHGQNLQRDAVALPYIKSIPLYTNSNINAPFPKHKVKTLNLYSFKSQSYPAHSAWLAGISSNVLKLDASILNQYQITENNEISLKILSGSKRPEILMSLNYGTDKILNILTFNGQLILNNPSTKWTAELPILLINEQWHTLRITSNPLNSSTGVRVYQDNHSFNFQSLGFTITFPSKVELGGFSQTNPVFSYKDKNYMLKPFTGCLDELQINNNTVSILNSGSSNSVKQCPRVLELLNSGGQILAPYAEVTSKPIQLIFEPNQKFETDYFIKFKFKYTGYESGIILTIGDGKRFCSISIKNQEIQLIYLNMINKEKAVEKVEIDKERWYKIIFVVYHQADVLTICRMSINDDKIVRLHTLADSQMFDSNYKMSNLYFGYHPGLLADTKLVSEWDKNFVGCISDVECFVGNVPVSCQFDNSEYFIRGRCSIDKNTYLLRKY 9826
             KCIKGFYRPWNVLATELYPCTPCQCHGLGTIGSCVSNGEDIGDQKPGDCICKKGYEGVNCDLCSIGYERYPNGECLPCPCSIDGSVRTSFYRCKPPCNCKVHVNSDDLCKTCKNGYFNLDSANPEGCEPCYCFGITNQCSSLSAKNLKISDLKGWKLTTFTGEKIALPKFTSFQYLTSENSYIDERFNNPTVYYWTAPPPYLGNWITSYGTIFRYVVKIELQSTLKGSLIDSPDVIIKCGDFRLFHSVSIEDRRLQRQVFIYIKPTEWKIGKLTPDKAATKEEFISCLVKVDKLLIKAKYYSNQKSIELLNITLSRGEVHLALDEMPHIEKCNCPPGFNGLSCESCESGYRRVNNVLYQGQCEACACYNHSNTCDSLNGECQNCTHNTAGAHCEDCASGYYGDAKSKNLN CKKCPCPRLDYQMTELCSSYSSENYVCHKCLHNTSGVHCDRCIEGYYGNPKKKISCKRCKCNNNQESCDPVTGECRCSYNTMGTECQLCKHGFYGDALTKSCKKCDCDSLGSTSENCDKLTG+CDCRTNFVNRQCDSCTSGLYLKDKKCIPCNCEIQGRISSEKFCNTTSGQCFCLE+VNGDRCEKCVEGYFNYPNCKKCLCSPHALSADCDLNNGKCKCGSNVINRICDKCENLHYWNNRTDCVPCNCGRGSLNPKCDMETGNCKCAQNVARRDCSKCDVGYFGLDVTGCKKCPPCYNGQVCNNEGICVCPPNTIGNLCNKCSEDSWDFNETIGCKKCNCYINGSYSNICNKISGICACKTAFFGSKCDRCNEGYYGFPNCQPCSCAENGTKSNELTKCDKITGQCQCKQNVIGTKCKVCRKGTFPSDGTYEGGCFSCFCFGVSEKCHAILNHRIVENSIYEYHIFDEKNSLESGKDYSTIHLNANYPRRFGWPLTMFRPIYVNVMKLFNSHDLSLFYRSIFMNVSVDCLDNKCGREIPEQTEVFMESYNGLFGMRYIVNHSVSNSNNIIVDFNEHSKNGKWVISQYQNDILDKFIILEDSNVINSNLTRDIFMMALLNVTSLKVKLYTDKVNPPLIKIKIITYKVMETTQAIGKRVTAVEKCICNALTFGNHCQNPISGYYKEYFNLPNSTKSGSMRTGNRILINLKKCNCNGYSKVCDSVTGDCQNCMGNREGNKCQLCREGFYKNDKNYDQCEPCQCPSAHYNFAQNCTRIESSLELKCQCRIGYSGKSCENCQQGFYGNPIKGIPCKSCDCNQQGSQSLNCNEFGICQCSPGVLGIKCDQCAPNYVVEKKTCQSCYSGCTKDLLVRIDTLNETVINFKWKTLPSTLDLRLNKINISIQMSSELLNSINKFYKLKNEIKNFSIQFQKMKDDAKEKYGEIEKLKTRYNK+LEDLRSTFTDINETISGHEQLGISNELIKNATAYLETIKNIYKEMPNITLAASVLKDVLKYVDELNQIIKYTQSHIQSDQINNLKILKNKTIMADEINTNNKEYLNTMSTKKKEHELYIILINERMKDLQKIFRKMTKQRDNLRKKIQKLDAISKSFQDEKDLISINVREIEDLMKNLSSNHLVSKSLIIPDTLKKHVEQQLNKSSNLIKKLTKDFNFLHNAEQAKEAYSNITRDILAVDYAINQTKKELDFNRSNMNIDSLKKLLAEFNSNKSEIVENIKNIDKEHEKLLKQYKNCSYNEKKLKNMNEKLSSEIPTGFYDVEILKRNLSEIQMEQNNIENN ILPINQTILNLGTPNVKSGLDTRNLEKLIKVVDNQYRDLVNESSFVENKIKDLRKSIKSLRERLQKARVMSELIHGAAARSVEPIRHVVRCVRHYVTYYLPTSNAFSLEFYMKPQILNDQSLVLFGYDDSGSIPHAFAFTLERNNQYKFWYDSGNSVESIELTGKFSNENYVGIMITWKLGKWHMVIRSISDGRTEQVETSSITNNILSNVRIGPQTNIFVGGFPSSKLLRSLKLEGRLISDLKENYDNYFYKGCLFGVKLMNTEFGLQDIEAIEEECRNTISIDNLLLGKFNCKFNPNSSIIFLDSNIESVNTFKRSVRRQKRDVQTNFDLHFTGNGFAMINTSRTKNGKCATSLNKVLTISTMALPKTHPDTFQLIAVFANKIMKYGFVLGQKNNSYHFGYWKKDVDYPLFPIQN SDSFTWFIFKSKIEKLSETLFGIDEICDHNSLFYLSSIPDNDSYLIEKLKKLKVPNYGFTGKMKFLINKKPLFQVLATRFINVIFLFTEQVRENKFHSLLISPNAINPIEITEHSPNDILQNGFGFTVNFMGQPIAKTLKL TIELEAGSVNVEVSRALVFSVIVNDVKIDKELQKFNNDNLDWEAHYIVVFLEQKQSSIIVTFTVDNEDIKSQEIMINIGSVNRMTLNPSSTNNHSYYIYNLFIGQKLVNFNELNYLPPGVFLKMRPTNLQPVDIQNPRVDTDKSIPRVSYKHGQNLQRDAVALPYIKSIPLYTNSNINAPFPKHKVKTLNLYSFKSQSYPAHSAWLAGISSNVLKLDASILNQYQITENNEISLKILSGSKRPEILMSLNYGTDKILNILTFNGQLILNNPSTKWTAELPILLINEQWHTLRITSNPLNSSTGVRVYQDNHSFNFQSLGFTITFPSKVELGGFSQTNPVFSYKDKNYMLKPFTGCLDELQINNNTVSILNSGSSNSVKQCPRVLELLNSGGQILAPYAEVTSKPIQLIFEPNQKFETDYFIKFKFKYTGYESGIILTIGDGKRFCSISIKNQEIQLIYLNMINKEKAVEKVEIDKERWYKIIFVVYHQADVLTICRMSINDDKIVRLHTLADSQMFDSNYKMSNLYFGYHPGLLADTKLVSEWDKNFVGCISDVECFVGNVPVSCQFDNSEYFIRGRCSIDKNTYLLRKY
Sbjct:   27 RKCIKGFYRPWNVLATELYPCTPCQCHGLGTIGSCVSNGEDIGDQKPGDCICKKGYEGVNCDLCSIGYERYPNGECLPCPCSIDGSVRTSFYRCKPPCNCKVHVNSDDLCKTCKNGYFNLDSANPEGCEPCYCFGITNQCSSLSAKNLKISDLKGWKLTTFTGEKIALPKFTSFQYLTSENSYIDERFNNPTVYYWTAPPPYLGNWITSYGTIFRYVVKIELQSTLKGSLIDSPDVIIKCGDFRLFHSVSIEDRRLQRQVFIYIKPTEWKIGKLTPDKAATKEEFISCLVKVDKLLIKAKYYSNQKSIELLNITLSRGEVHLALDEMPHIEKCNCPPGFNGLSCESCESGYRRVNNVLYQGQCEACACYNHSNTCDSLNGECQNCTHNTAGAHCEDCASGYYGDAKSKNLNFCKKCPCPRLDYQMTELCSSYSSENYVCHKCLHNTSGVHCDRCIEGYYGNPKKKISCKRCKCNNNQESCDPVTGECRCSYNTMGTECQLCKHGFYGDALTKSCKKCDCDSLGSTSENCDKLTGECDCRTNFVNRQCDSCTSGLYLKDKKCIPCNCEIQGRISSEKFCNTTSGQCFCLESVNGDRCEKCVEGYFNYPNCKKCLCSPHALSADCDLNNGKCKCGSNVINRICDKCENLHYWNNRTDCVPCNCGRGSLNPKCDMETGNCKCAQNVARRDCSKCDVGYFGLDVTGCKKCPPCYNGQVCNNEGICVCPPNTIGNLCNKCSEDSWDFNETIGCKKCNCYINGSYSNICNKISGICACKTAFFGSKCDRCNEGYYGFPNCQPCSCAENGTKSNELTKCDKITGQCQCKQNVIGTKCKVCRKGTFPSDGTYEGGCFSCFCFGVSEKCHAILNHRIVENSIYEYHIFDEKNSLESGKDYSTIHLNANYPRRFGWPLTMFRPIYVNVMKLFNSHDLSLFYRSIFMNVSVDCLDNKCGREIPEQTEVFMESYNGLFGMRYIVNHSVSNSNNIIVDFNEHSKNGKWVISQYQNDILDKFIILEDSNVINSNLTRDIFMMALLNVTSLKVKLYTDKVNPPLIKIKIITYKVMETTQAIGKRVTAVEKCICNALTFGNHCQNPISGYYKEYFNLPNSTKSGSMRTGNRILINLKKCNCNGYSKVCDSVTGDCQNCMGNREGNKCQLCREGFYKNDKNYDQCEPCQCPSAHYNFAQNCTRIESSLELKCQCRIGYSGKSCENCQQGFYGNPIKGIPCKSCDCNQQGSQSLNCNEFGICQCSPGVLGIKCDQCAPNYVVEKKTCQSCYSGCTKDLLVRIDTLNETVINFKWKTLPSTLDLRLNKINISIQMSSELLNSINKFYKLKNEIKNFSIQFQKMKDDAKEKYGEIEKLKTRYNKILEDLRSTFTDINETISGHEQLGISNELIKNATAYLETIKNIYKEMPNITLAASVLKDVLKYVDELNQIIKYTQSHIQSDQINNLKILKNKTIMADEINTNNKEYLNTMSTKKKEHELYIILINERMKDLQKIFRKMTKQRDNLRKKIQKLDAISKSFQDEKDLISINVREIEDLMKNLSSNHLVSKSLIIPDTLKKHVEQQLNKSSNLIKKLTKDFNFLHNAEQAKEAYSNITRDILAVDYAINQTKKELDFNRSNMNIDSLKKLLAEFNSNKSEIVENIKNIDKEHEKLLKQYKNCSYNEKKLKNMNEKLSSEIPTGFYDVEILKRNLSEIQMEQNNIENNLILPINQTILNLGTPNVKSGLDTRNLEKLIKVVDNQYRDLVNESSFVENKIKDLRKSIKSLRERLQKARVMSELIHGAAARSVEPIRHVVRCVRHYVTYYLPTSNAFSLEFYMKPQILNDQSLVLFGYDDSGSIPHAFAFTLERNNQYKFWYDSGNSVESIELTGKFSNENYVGIMITWKLGKWHMVIRSISDGRTEQVETSSITNNILSNVRIGPQTNIFVGGFPSSKLLRSLKLEGRLISDLKENYDNYFYKGCLFGVKLMNTEFGLQDIEAIEEECRNTISIDNLLLGKFNCKFNPNSSIIFLDSNIESVNTFKRSVRRQKRDVQTNFDLHFTGNGFAMINTSRTKNGKCATSLNKVLTISTMALPKTHPDTFQLIAVFANKIMKYGFVLGQKNNSYHFGYWKKDVDYPLFPIQNTSDSFTWFIFKSKIEKLSETLFGIDEICDHNSLFYLSSIPDNDSYLIEKLKKLKVPNYGFTGKMKFLINKKPLFQVLATRFINVIFLFTEQVRENKFHSLLISPNAINPIEITEHSPNDILQNGFGFTVNFMGQPIAKTLKLFTIELEAGSVNVEVSRALVFSVIVNDVKIDKELQKFNNDNLDWEAHYIVVFLEQKQSSIIVTFTVDNEDIKSQEIMINIGSVNRMTLNPSSTNNHSYYIYNLFIGQKLVNFNELNYLPPGVFLKMRPTNLQPVDIQNPRVDTDKSIPRVSYKHGQNLQRDAVALPYIKSIPLYTNSNINAPFPKHKVKTLNLYSFKSQSYPAHSAWLAGISSNVLKLDASILNQYQITENNEISLKILSGSKRPEILMSLNYGTDKILNILTFNGQLILNNPSTKWTAELPILLINEQWHTLRITSNPLNSSTGVRVYQDNHSFNFQSLGFTITFPSKVELGGFSQTNPVFSYKDKNYMLKPFTGCLDELQINNNTVSILNSGSSNSVKQCPRVLELLNSGGQILAPYAEVTSKPIQLIFEPNQKFETDYFIKFKFKYTGYESGIILTIGDGKRFCSISIKNQEIQLIYLNMINKEKAVEKVEIDKERWYKIIFVVYHQADVLTICRMSINDDKIVRLHTLADSQMFDSNYKMSNLYFGYHPGLLADTKLVSEWDKNFVGCISDVECFVGNVPVSCQFDNSEYFIRGRCSIDKNTYLLRKY 2884          

HSP 2 Score: 75.0998 bits (183), Expect = 1.373e-12
Identity = 78/295 (26.44%), Postives = 114/295 (38.64%), Query Frame = 2
Query:  914 YYSLRNIEIGGKC---ICNNHADKCDKVIENGISVAKC-NCKHNTCGSNCETCCP-LFNQRPWKPVAVCEECNCNRKSNECSYNQTVATLQLSVNKMGRMEGGGVCINCQENTEGINCEKCIKGFYR-----------------------------PWNVLATE-------------LYPCTPCQCHGLGTIGSCVSNGEDIGDQKPGDCICKKGYEGVNCDLCSIGYERYPNGECLPCPCSIDGSVRTSFY--RCKPPCNCKVHVNSDDLCKTCKNGYFNLDSANPEGCEPCYC 1651
            Y  + N+   G+C    C NH++ CD +  NG    +C NC HNT G++CE C    +     K +  C++C C R      Y  T      S           VC  C  NT G++C++CI+G+Y                               +N + TE                C  C C  LG      S  E+  D+  G+C C+  +    CD C+ G     + +C+PC C I G + +  +       C C   VN D  C+ C  GYFN  +     C+ C C
Sbjct:  377 YRRVNNVLYQGQCEACACYNHSNTCDSL--NG----ECQNCTHNTAGAHCEDCASGYYGDAKSKNLNFCKKCPCPR----LDYQMTELCSSYSSENY-------VCHKCLHNTSGVHCDRCIEGYYGNPKKKISCKRCKCNNNQESCDPVTGECRCSYNTMGTECQLCKHGFYGDALTKSCKKCDCDSLG------STSENC-DKLTGECDCRTNFVNRQCDSCTSGL-YLKDKKCIPCNCEIQGRISSEKFCNTTSGQCFCLESVNGDR-CEKCVEGYFNYPN-----CKKCLC 640          

HSP 3 Score: 63.929 bits (154), Expect = 2.626e-9
Identity = 68/266 (25.56%), Postives = 96/266 (36.09%), Query Frame = 2
Query:  947 KCICNNHADKCDKVIENGISVAKCNCKHNTCGSNCETC-CPLFNQRPWKPVAVCE----------------ECNC-----NRKSNECS---YNQTVATLQLSVNKMGRMEGGGVCIN------CQENTEGINCEKCIKGFYRPWNVLATELYP-CTPCQCHGLGTIGSCVSNGEDIGDQKPGDCICKKGYEGVNCDLCSIGYERYPNGECLPCPCSIDGSVRTSFYRCKPPCNCKVHVNSDDLCKTCKNGYFNLDSANPEGCEPCY 1648
            +C CNN+ + CD V        +C C +NT G+ C+ C    +     K    C+                EC+C     NR+ + C+   Y +    +  +    GR+     C        C E+  G  CEKC++G++          YP C  C C        C        D   G C C        CD C   +      +C+PC C   GS+          C C  +V   D C  C  GYF LD    + C PCY
Sbjct:  496 RCKCNNNQESCDPV------TGECRCSYNTMGTECQLCKHGFYGDALTKSCKKCDCDSLGSTSENCDKLTGECDCRTNFVNRQCDSCTSGLYLKDKKCIPCNCEIQGRISSEKFCNTTSGQCFCLESVNGDRCEKCVEGYFN---------YPNCKKCLCSPHALSADC--------DLNNGKCKCGSNVINRICDKCENLHYWNNRTDCVPCNCG-RGSLNPKCDMETGNCKCAQNVARRD-CSKCDVGYFGLDVTGCKKCPPCY 736          
BLAST of Laminin subunit alpha-2 vs. Planmine SMEST
Match: SMESG000056013.1 (SMESG000056013.1)

HSP 1 Score: 5768.35 bits (14963), Expect = 0.000e+0
Identity = 2850/2858 (99.72%), Postives = 2853/2858 (99.83%), Query Frame = 2
Query: 1253 EKCIKGFYRPWNVLATELYPCTPCQCHGLGTIGSCVSNGEDIGDQKPGDCICKKGYEGVNCDLCSIGYERYPNGECLPCPCSIDGSVRTSFYRCKPPCNCKVHVNSDDLCKTCKNGYFNLDSANPEGCEPCYCFGITNQCSSLSAKNLKISDLKGWKLTTFTGEKIALPKFTSFQYLTSENSYIDERFNNPTVYYWTAPPPYLGNWITSYGTIFRYVVKIELQSTLKGSLIDSPDVIIKCGDFRLFHSVSIEDRRLQRQVFIYIKPTEWKIGKLTPDKAATKEEFISCLVKVDKLLIKAKYYSNQKSIELLNITLSRGEVHLALDEMPHIEKCNCPPGFNGLSCESCESGYRRVNNVLYQGQCEACACYNHSNTCDSLNGECQNCTHNTAGAHCEDCASGYYGDAKSKNLNSCKKCPCPRLDYQMTELCSSYSSENYVCHKCLHNTSGVHCDRCIEGYYGNPKKKISCKRCKCNNNQESCDPVTGECRCSYNTMGTECQLCKHGFYGDALTKSCKKCDCDSLGSTSENCDKLTGKCDCRTNFVNRQCDSCTSGLYLKDKKCIPCNCEIQGRISSEKFCNTTSGQCFCLENVNGDRCEKCVEGYFNYPNCKKCLCSPHALSADCDLNNGKCKCGSNVINRICDKCENLHYWNNRTDCVPCNCGRGSLNPKCDMETGNCKCAQNVARRDCSKCDVGYFGLDVTGCKKCPPCYNGQVCNNEGICVCPPNTIGNLCNKCSEDSWDFNETIGCKKCNCYINGSYSNICNKISGICACKTAFFGSKCDRCNEGYYGFPNCQPCSCAENGTKSNELTKCDKITGQCQCKQNVIGTKCKVCRKGTFPSDGTYEGGCFSCFCFGVSEKCHAILNHRIVENSIYEYHIFDEKNSLESGKDYSTIHLNANYPRRFGWPLTMFRPIYVNVMKLFNSHDLSLFYRSIFMNVSVDCLDNKCGREIPEQTEVFMESYNGLFGMRYXXXXXXXXXXXXXXDFNEHSKNGKWVISQYQNDILDKFIILEDSNVINSNLTRDIFMMALLNVTSLKVKLYTDKVNPPLIKIKIITYKVMETTQAIGKRVTAVEKCICNALTFGNHCQNPISGYYKEYFNLPNSTKSGSMRTGNRILINLKKCNCNGYSKVCDSVTGDCQNCMGNREGNKCQLCREGFYKNDKNYDQCEPCQCPSAHYNFAQNCTRIESSLELKCQCRIGYSGKSCENCQQGFYGNPIKGIPCKSCDCNQQGSQSLNCNEFGICQCSPGVLGIKCDQCAPNYVVEKKTCQSCYSGCTKDLLVRIDTLNETVINFKWKTLPSTLDLRLNKINISIQMSSELLNSINKFYKLKNEIKNFSIQFQKMKDDAKEKYGEIEKLKTRYNKVLEDLRSTFTDINETISGHEQLGISNELIKNATAYLETIKNIYKEMPNITLAASVLKDVLKYVDELNQIIKYTQSHIQSDQINNLKILKNKTIMADEINTNNKEYLNTMSTKKKEHELYIILINERMKDLQKIFRKMTKQRDNLRKKIQKLDAISKSFQDEKDLISINVREIEDLMKNLSSNHLVSKSLIIPDTLKKHVEQQLNKSSNLIKKLTKDFNFLHNAEQAKEAYSNITRDILAVDYAINQTKKELDFNRSNMNIDSLKKLLAEFNSNKSEIVENIKNIDKEHEKLLKQYKNCSYXXXXXXXXXXXXSSEIPTGFYDVEILKRNLSXXXXXXXXXXXXFILPINQTILNLGTPNVKSGLDTRNLEKLIKVVDNQYRDLVNESSFVENKIKDLRKSIKSLRERLQKARVMSELIHGAAARSVEPIRHVVRCVRHYVTYYLPTSNAFSLEFYMKPQILNDQSLVLFGYDDSGSIPHAFAFTLERNNQYKFWYDSGNSVESIELTGKFSNENYVGIMITWKLGKWHMVIRSISDGRTEQVETSSITNNILSNVRIGPQTNIFVGGFPSSKLLRSLKLEGRLISDLKENYDNYFYKGCLFGVKLMNTEFGLQDIEAIEEECRNTISIDNLLLGKFNCKFNPNSSIIFLDSNIESVNTFKRSVRRQKRDVQTNFDLHFTGNGFAMINTSRTKNGKCATSLNKVLTISTMALPKTHPDTFQLIAVFANKIMKYGFVLGQKNNSYHFGYWKKDVDYPLFPIQNASDSFTWFIFKSKIEKLSETLFGIDEICDHNSLFYLSSIPDNDSYLIEKLKKLKVPNYGFTGKMKFLINKKPLFQVLATRFINVIFLFTEQVRENKFHSLLISPNAINPIEITEHSPNDILQNGFGFTVNFMGQPIAKTLKLLTIELEAGSVNVEVSRALVFSVIVNDVKIDKELQKFNNDNLDWEAHYIVVFLEQKQSSIIVTFTVDNEDIKSQEIMINIGSVNRMTLNPSSTNNHSYYIYNLFIGQKLVNFNELNYLPPGVFLKMRPTNLQPVDIQNPRVDTDKSIPRVSYKHGQNLQRDAVALPYIKSIPLYTNSNINAPFPKHKVKTLNLYSFKSQSYPAHSAWLAGISSNVLKLDASILNQYQITENNEISLKILSGSKRPEILMSLNYGTDKILNILTFNGQLILNNPSTKWTAELPILLINEQWHTLRITSNPLNSSTGVRVYQDNHSFNFQSLGFTITFPSKVELGGFSQTNPVFSYKDKNYMLKPFTGCLDELQINNNTVSILNSGSSNSVKQCPRVLELLNSGGQILAPYAEVTSKPIQLIFEPNQKFETDYFIKFKFKYTGYESGIILTIGDGKRFCSISIKNQEIQLIYLNMINKEKAVEKVEIDKERWYKIIFVVYHQADVLTICRMSINDDKIVRLHTLADSQMFDSNYKMSNLYFGYHPGLLADTKLVSEWDKNFVGCISDVECFVGNVPVSCQFDNSEYFIRGRCSIDKNTYLLRKY 9826
             KCIKGFYRPWNVLATELYPCTPCQCHGLGTIGSCVSNGEDIGDQKPGDCICKKGYEGVNCDLCSIGYERYPNGECLPCPCSIDGSVRTSFYRCKPPCNCKVHVNSDDLCKTCKNGYFNLDSANPEGCEPCYCFGITNQCSSLSAKNLKISDLKGWKLTTFTGEKIALPKFTSFQYLTSENSYIDERFNNPTVYYWTAPPPYLGNWITSYGTIFRYVVKIELQSTLKGSLIDSPDVIIKCGDFRLFHSVSIEDRRLQRQVFIYIKPTEWKIGKLTPDKAATKEEFISCLVKVDKLLIKAKYYSNQKSIELLNITLSRGEVHLALDEMPHIEKCNCPPGFNGLSCESCESGYRRVNNVLYQGQCEACACYNHSNTCDSLNGECQNCTHNTAGAHCEDCASGYYGDAKSKNLN CKKCPCPRLDYQMTELCSSYSSENYVCHKCLHNTSGVHCDRCIEGYYGNPKKKISCKRCKCNNNQESCDPVTGECRCSYNTMGTECQLCKHGFYGDALTKSCKKCDCDSLGSTSENCDKLTG+CDCRTNFVNRQCDSCTSGLYLKDKKCIPCNCEIQGRISSEKFCNTTSGQCFCLE+VNGDRCEKCVEGYFNYPNCKKCLCSPHALSADCDLNNGKCKCGSNVINRICDKCENLHYWNNRTDCVPCNCGRGSLNPKCDMETGNCKCAQNVARRDCSKCDVGYFGLDVTGCKKCPPCYNGQVCNNEGICVCPPNTIGNLCNKCSEDSWDFNETIGCKKCNCYINGSYSNICNKISGICACKTAFFGSKCDRCNEGYYGFPNCQPCSCAENGTKSNELTKCDKITGQCQCKQNVIGTKCKVCRKGTFPSDGTYEGGCFSCFCFGVSEKCHAILNHRIVENSIYEYHIFDEKNSLESGKDYSTIHLNANYPRRFGWPLTMFRPIYVNVMKLFNSHDLSLFYRSIFMNVSVDCLDNKCGREIPEQTEVFMESYNGLFGMRYIVNHSVSNSNNIIVDFNEHSKNGKWVISQYQNDILDKFIILEDSNVINSNLTRDIFMMALLNVTSLKVKLYTDKVNPPLIKIKIITYKVMETTQAIGKRVTAVEKCICNALTFGNHCQNPISGYYKEYFNLPNSTKSGSMRTGNRILINLKKCNCNGYSKVCDSVTGDCQNCMGNREGNKCQLCREGFYKNDKNYDQCEPCQCPSAHYNFAQNCTRIESSLELKCQCRIGYSGKSCENCQQGFYGNPIKGIPCKSCDCNQQGSQSLNCNEFGICQCSPGVLGIKCDQCAPNYVVEKKTCQSCYSGCTKDLLVRIDTLNETVINFKWKTLPSTLDLRLNKINISIQMSSELLNSINKFYKLKNEIKNFSIQFQKMKDDAKEKYGEIEKLKTRYNK+LEDLRSTFTDINETISGHEQLGISNELIKNATAYLETIKNIYKEMPNITLAASVLKDVLKYVDELNQIIKYTQSHIQSDQINNLKILKNKTIMADEINTNNKEYLNTMSTKKKEHELYIILINERMKDLQKIFRKMTKQRDNLRKKIQKLDAISKSFQDEKDLISINVREIEDLMKNLSSNHLVSKSLIIPDTLKKHVEQQLNKSSNLIKKLTKDFNFLHNAEQAKEAYSNITRDILAVDYAINQTKKELDFNRSNMNIDSLKKLLAEFNSNKSEIVENIKNIDKEHEKLLKQYKNCSYNEKKLKNMNEKLSSEIPTGFYDVEILKRNLSEIQMEQNNIENN ILPINQTILNLGTPNVKSGLDTRNLEKLIKVVDNQYRDLVNESSFVENKIKDLRKSIKSLRERLQKARVMSELIHGAAARSVEPIRHVVRCVRHYVTYYLPTSNAFSLEFYMKPQILNDQSLVLFGYDDSGSIPHAFAFTLERNNQYKFWYDSGNSVESIELTGKFSNENYVGIMITWKLGKWHMVIRSISDGRTEQVETSSITNNILSNVRIGPQTNIFVGGFPSSKLLRSLKLEGRLISDLKENYDNYFYKGCLFGVKLMNTEFGLQDIEAIEEECRNTISIDNLLLGKFNCKFNPNSSIIFLDSNIESVNTFKRSVRRQKRDVQTNFDLHFTGNGFAMINTSRTKNGKCATSLNKVLTISTMALPKTHPDTFQLIAVFANKIMKYGFVLGQKNNSYHFGYWKKDVDYPLFPIQN SDSFTWFIFKSKIEKLSETLFGIDEICDHNSLFYLSSIPDNDSYLIEKLKKLKVPNYGFTGKMKFLINKKPLFQVLATRFINVIFLFTEQVRENKFHSLLISPNAINPIEITEHSPNDILQNGFGFTVNFMGQPIAKTLKL TIELEAGSVNVEVSRALVFSVIVNDVKIDKELQKFNNDNLDWEAHYIVVFLEQKQSSIIVTFTVDNEDIKSQEIMINIGSVNRMTLNPSSTNNHSYYIYNLFIGQKLVNFNELNYLPPGVFLKMRPTNLQPVDIQNPRVDTDKSIPRVSYKHGQNLQRDAVALPYIKSIPLYTNSNINAPFPKHKVKTLNLYSFKSQSYPAHSAWLAGISSNVLKLDASILNQYQITENNEISLKILSGSKRPEILMSLNYGTDKILNILTFNGQLILNNPSTKWTAELPILLINEQWHTLRITSNPLNSSTGVRVYQDNHSFNFQSLGFTITFPSKVELGGFSQTNPVFSYKDKNYMLKPFTGCLDELQINNNTVSILNSGSSNSVKQCPRVLELLNSGGQILAPYAEVTSKPIQLIFEPNQKFETDYFIKFKFKYTGYESGIILTIGDGKRFCSISIKNQEIQLIYLNMINKEKAVEKVEIDKERWYKIIFVVYHQADVLTICRMSINDDKIVRLHTLADSQMFDSNYKMSNLYFGYHPGLLADTKLVSEWDKNFVGCISDVECFVGNVPVSCQFDNSEYFIRGRCSIDKNTYLLRKY
Sbjct:    9 RKCIKGFYRPWNVLATELYPCTPCQCHGLGTIGSCVSNGEDIGDQKPGDCICKKGYEGVNCDLCSIGYERYPNGECLPCPCSIDGSVRTSFYRCKPPCNCKVHVNSDDLCKTCKNGYFNLDSANPEGCEPCYCFGITNQCSSLSAKNLKISDLKGWKLTTFTGEKIALPKFTSFQYLTSENSYIDERFNNPTVYYWTAPPPYLGNWITSYGTIFRYVVKIELQSTLKGSLIDSPDVIIKCGDFRLFHSVSIEDRRLQRQVFIYIKPTEWKIGKLTPDKAATKEEFISCLVKVDKLLIKAKYYSNQKSIELLNITLSRGEVHLALDEMPHIEKCNCPPGFNGLSCESCESGYRRVNNVLYQGQCEACACYNHSNTCDSLNGECQNCTHNTAGAHCEDCASGYYGDAKSKNLNFCKKCPCPRLDYQMTELCSSYSSENYVCHKCLHNTSGVHCDRCIEGYYGNPKKKISCKRCKCNNNQESCDPVTGECRCSYNTMGTECQLCKHGFYGDALTKSCKKCDCDSLGSTSENCDKLTGECDCRTNFVNRQCDSCTSGLYLKDKKCIPCNCEIQGRISSEKFCNTTSGQCFCLESVNGDRCEKCVEGYFNYPNCKKCLCSPHALSADCDLNNGKCKCGSNVINRICDKCENLHYWNNRTDCVPCNCGRGSLNPKCDMETGNCKCAQNVARRDCSKCDVGYFGLDVTGCKKCPPCYNGQVCNNEGICVCPPNTIGNLCNKCSEDSWDFNETIGCKKCNCYINGSYSNICNKISGICACKTAFFGSKCDRCNEGYYGFPNCQPCSCAENGTKSNELTKCDKITGQCQCKQNVIGTKCKVCRKGTFPSDGTYEGGCFSCFCFGVSEKCHAILNHRIVENSIYEYHIFDEKNSLESGKDYSTIHLNANYPRRFGWPLTMFRPIYVNVMKLFNSHDLSLFYRSIFMNVSVDCLDNKCGREIPEQTEVFMESYNGLFGMRYIVNHSVSNSNNIIVDFNEHSKNGKWVISQYQNDILDKFIILEDSNVINSNLTRDIFMMALLNVTSLKVKLYTDKVNPPLIKIKIITYKVMETTQAIGKRVTAVEKCICNALTFGNHCQNPISGYYKEYFNLPNSTKSGSMRTGNRILINLKKCNCNGYSKVCDSVTGDCQNCMGNREGNKCQLCREGFYKNDKNYDQCEPCQCPSAHYNFAQNCTRIESSLELKCQCRIGYSGKSCENCQQGFYGNPIKGIPCKSCDCNQQGSQSLNCNEFGICQCSPGVLGIKCDQCAPNYVVEKKTCQSCYSGCTKDLLVRIDTLNETVINFKWKTLPSTLDLRLNKINISIQMSSELLNSINKFYKLKNEIKNFSIQFQKMKDDAKEKYGEIEKLKTRYNKILEDLRSTFTDINETISGHEQLGISNELIKNATAYLETIKNIYKEMPNITLAASVLKDVLKYVDELNQIIKYTQSHIQSDQINNLKILKNKTIMADEINTNNKEYLNTMSTKKKEHELYIILINERMKDLQKIFRKMTKQRDNLRKKIQKLDAISKSFQDEKDLISINVREIEDLMKNLSSNHLVSKSLIIPDTLKKHVEQQLNKSSNLIKKLTKDFNFLHNAEQAKEAYSNITRDILAVDYAINQTKKELDFNRSNMNIDSLKKLLAEFNSNKSEIVENIKNIDKEHEKLLKQYKNCSYNEKKLKNMNEKLSSEIPTGFYDVEILKRNLSEIQMEQNNIENNLILPINQTILNLGTPNVKSGLDTRNLEKLIKVVDNQYRDLVNESSFVENKIKDLRKSIKSLRERLQKARVMSELIHGAAARSVEPIRHVVRCVRHYVTYYLPTSNAFSLEFYMKPQILNDQSLVLFGYDDSGSIPHAFAFTLERNNQYKFWYDSGNSVESIELTGKFSNENYVGIMITWKLGKWHMVIRSISDGRTEQVETSSITNNILSNVRIGPQTNIFVGGFPSSKLLRSLKLEGRLISDLKENYDNYFYKGCLFGVKLMNTEFGLQDIEAIEEECRNTISIDNLLLGKFNCKFNPNSSIIFLDSNIESVNTFKRSVRRQKRDVQTNFDLHFTGNGFAMINTSRTKNGKCATSLNKVLTISTMALPKTHPDTFQLIAVFANKIMKYGFVLGQKNNSYHFGYWKKDVDYPLFPIQNTSDSFTWFIFKSKIEKLSETLFGIDEICDHNSLFYLSSIPDNDSYLIEKLKKLKVPNYGFTGKMKFLINKKPLFQVLATRFINVIFLFTEQVRENKFHSLLISPNAINPIEITEHSPNDILQNGFGFTVNFMGQPIAKTLKLFTIELEAGSVNVEVSRALVFSVIVNDVKIDKELQKFNNDNLDWEAHYIVVFLEQKQSSIIVTFTVDNEDIKSQEIMINIGSVNRMTLNPSSTNNHSYYIYNLFIGQKLVNFNELNYLPPGVFLKMRPTNLQPVDIQNPRVDTDKSIPRVSYKHGQNLQRDAVALPYIKSIPLYTNSNINAPFPKHKVKTLNLYSFKSQSYPAHSAWLAGISSNVLKLDASILNQYQITENNEISLKILSGSKRPEILMSLNYGTDKILNILTFNGQLILNNPSTKWTAELPILLINEQWHTLRITSNPLNSSTGVRVYQDNHSFNFQSLGFTITFPSKVELGGFSQTNPVFSYKDKNYMLKPFTGCLDELQINNNTVSILNSGSSNSVKQCPRVLELLNSGGQILAPYAEVTSKPIQLIFEPNQKFETDYFIKFKFKYTGYESGIILTIGDGKRFCSISIKNQEIQLIYLNMINKEKAVEKVEIDKERWYKIIFVVYHQADVLTICRMSINDDKIVRLHTLADSQMFDSNYKMSNLYFGYHPGLLADTKLVSEWDKNFVGCISDVECFVGNVPVSCQFDNSEYFIRGRCSIDKNTYLLRKY 2866          

HSP 2 Score: 74.7146 bits (182), Expect = 1.810e-12
Identity = 78/295 (26.44%), Postives = 114/295 (38.64%), Query Frame = 2
Query:  914 YYSLRNIEIGGKC---ICNNHADKCDKVIENGISVAKC-NCKHNTCGSNCETCCP-LFNQRPWKPVAVCEECNCNRKSNECSYNQTVATLQLSVNKMGRMEGGGVCINCQENTEGINCEKCIKGFYR-----------------------------PWNVLATE-------------LYPCTPCQCHGLGTIGSCVSNGEDIGDQKPGDCICKKGYEGVNCDLCSIGYERYPNGECLPCPCSIDGSVRTSFY--RCKPPCNCKVHVNSDDLCKTCKNGYFNLDSANPEGCEPCYC 1651
            Y  + N+   G+C    C NH++ CD +  NG    +C NC HNT G++CE C    +     K +  C++C C R      Y  T      S           VC  C  NT G++C++CI+G+Y                               +N + TE                C  C C  LG      S  E+  D+  G+C C+  +    CD C+ G     + +C+PC C I G + +  +       C C   VN D  C+ C  GYFN  +     C+ C C
Sbjct:  359 YRRVNNVLYQGQCEACACYNHSNTCDSL--NG----ECQNCTHNTAGAHCEDCASGYYGDAKSKNLNFCKKCPCPR----LDYQMTELCSSYSSENY-------VCHKCLHNTSGVHCDRCIEGYYGNPKKKISCKRCKCNNNQESCDPVTGECRCSYNTMGTECQLCKHGFYGDALTKSCKKCDCDSLG------STSENC-DKLTGECDCRTNFVNRQCDSCTSGL-YLKDKKCIPCNCEIQGRISSEKFCNTTSGQCFCLESVNGDR-CEKCVEGYFNYPN-----CKKCLC 622          

HSP 3 Score: 63.5438 bits (153), Expect = 3.490e-9
Identity = 68/266 (25.56%), Postives = 96/266 (36.09%), Query Frame = 2
Query:  947 KCICNNHADKCDKVIENGISVAKCNCKHNTCGSNCETC-CPLFNQRPWKPVAVCE----------------ECNC-----NRKSNECS---YNQTVATLQLSVNKMGRMEGGGVCIN------CQENTEGINCEKCIKGFYRPWNVLATELYP-CTPCQCHGLGTIGSCVSNGEDIGDQKPGDCICKKGYEGVNCDLCSIGYERYPNGECLPCPCSIDGSVRTSFYRCKPPCNCKVHVNSDDLCKTCKNGYFNLDSANPEGCEPCY 1648
            +C CNN+ + CD V        +C C +NT G+ C+ C    +     K    C+                EC+C     NR+ + C+   Y +    +  +    GR+     C        C E+  G  CEKC++G++          YP C  C C        C        D   G C C        CD C   +      +C+PC C   GS+          C C  +V   D C  C  GYF LD    + C PCY
Sbjct:  478 RCKCNNNQESCDPV------TGECRCSYNTMGTECQLCKHGFYGDALTKSCKKCDCDSLGSTSENCDKLTGECDCRTNFVNRQCDSCTSGLYLKDKKCIPCNCEIQGRISSEKFCNTTSGQCFCLESVNGDRCEKCVEGYFN---------YPNCKKCLCSPHALSADC--------DLNNGKCKCGSNVINRICDKCENLHYWNNRTDCVPCNCG-RGSLNPKCDMETGNCKCAQNVARRD-CSKCDVGYFGLDVTGCKKCPPCY 718          
BLAST of Laminin subunit alpha-2 vs. Planmine SMEST
Match: SMESG000056013.1 (SMESG000056013.1)

HSP 1 Score: 5767.19 bits (14960), Expect = 0.000e+0
Identity = 2850/2857 (99.75%), Postives = 2853/2857 (99.86%), Query Frame = 2
Query: 1256 KCIKGFYRPWNVLATELYPCTPCQCHGLGTIGSCVSNGEDIGDQKPGDCICKKGYEGVNCDLCSIGYERYPNGECLPCPCSIDGSVRTSFYRCKPPCNCKVHVNSDDLCKTCKNGYFNLDSANPEGCEPCYCFGITNQCSSLSAKNLKISDLKGWKLTTFTGEKIALPKFTSFQYLTSENSYIDERFNNPTVYYWTAPPPYLGNWITSYGTIFRYVVKIELQSTLKGSLIDSPDVIIKCGDFRLFHSVSIEDRRLQRQVFIYIKPTEWKIGKLTPDKAATKEEFISCLVKVDKLLIKAKYYSNQKSIELLNITLSRGEVHLALDEMPHIEKCNCPPGFNGLSCESCESGYRRVNNVLYQGQCEACACYNHSNTCDSLNGECQNCTHNTAGAHCEDCASGYYGDAKSKNLNSCKKCPCPRLDYQMTELCSSYSSENYVCHKCLHNTSGVHCDRCIEGYYGNPKKKISCKRCKCNNNQESCDPVTGECRCSYNTMGTECQLCKHGFYGDALTKSCKKCDCDSLGSTSENCDKLTGKCDCRTNFVNRQCDSCTSGLYLKDKKCIPCNCEIQGRISSEKFCNTTSGQCFCLENVNGDRCEKCVEGYFNYPNCKKCLCSPHALSADCDLNNGKCKCGSNVINRICDKCENLHYWNNRTDCVPCNCGRGSLNPKCDMETGNCKCAQNVARRDCSKCDVGYFGLDVTGCKKCPPCYNGQVCNNEGICVCPPNTIGNLCNKCSEDSWDFNETIGCKKCNCYINGSYSNICNKISGICACKTAFFGSKCDRCNEGYYGFPNCQPCSCAENGTKSNELTKCDKITGQCQCKQNVIGTKCKVCRKGTFPSDGTYEGGCFSCFCFGVSEKCHAILNHRIVENSIYEYHIFDEKNSLESGKDYSTIHLNANYPRRFGWPLTMFRPIYVNVMKLFNSHDLSLFYRSIFMNVSVDCLDNKCGREIPEQTEVFMESYNGLFGMRYXXXXXXXXXXXXXXDFNEHSKNGKWVISQYQNDILDKFIILEDSNVINSNLTRDIFMMALLNVTSLKVKLYTDKVNPPLIKIKIITYKVMETTQAIGKRVTAVEKCICNALTFGNHCQNPISGYYKEYFNLPNSTKSGSMRTGNRILINLKKCNCNGYSKVCDSVTGDCQNCMGNREGNKCQLCREGFYKNDKNYDQCEPCQCPSAHYNFAQNCTRIESSLELKCQCRIGYSGKSCENCQQGFYGNPIKGIPCKSCDCNQQGSQSLNCNEFGICQCSPGVLGIKCDQCAPNYVVEKKTCQSCYSGCTKDLLVRIDTLNETVINFKWKTLPSTLDLRLNKINISIQMSSELLNSINKFYKLKNEIKNFSIQFQKMKDDAKEKYGEIEKLKTRYNKVLEDLRSTFTDINETISGHEQLGISNELIKNATAYLETIKNIYKEMPNITLAASVLKDVLKYVDELNQIIKYTQSHIQSDQINNLKILKNKTIMADEINTNNKEYLNTMSTKKKEHELYIILINERMKDLQKIFRKMTKQRDNLRKKIQKLDAISKSFQDEKDLISINVREIEDLMKNLSSNHLVSKSLIIPDTLKKHVEQQLNKSSNLIKKLTKDFNFLHNAEQAKEAYSNITRDILAVDYAINQTKKELDFNRSNMNIDSLKKLLAEFNSNKSEIVENIKNIDKEHEKLLKQYKNCSYXXXXXXXXXXXXSSEIPTGFYDVEILKRNLSXXXXXXXXXXXXFILPINQTILNLGTPNVKSGLDTRNLEKLIKVVDNQYRDLVNESSFVENKIKDLRKSIKSLRERLQKARVMSELIHGAAARSVEPIRHVVRCVRHYVTYYLPTSNAFSLEFYMKPQILNDQSLVLFGYDDSGSIPHAFAFTLERNNQYKFWYDSGNSVESIELTGKFSNENYVGIMITWKLGKWHMVIRSISDGRTEQVETSSITNNILSNVRIGPQTNIFVGGFPSSKLLRSLKLEGRLISDLKENYDNYFYKGCLFGVKLMNTEFGLQDIEAIEEECRNTISIDNLLLGKFNCKFNPNSSIIFLDSNIESVNTFKRSVRRQKRDVQTNFDLHFTGNGFAMINTSRTKNGKCATSLNKVLTISTMALPKTHPDTFQLIAVFANKIMKYGFVLGQKNNSYHFGYWKKDVDYPLFPIQNASDSFTWFIFKSKIEKLSETLFGIDEICDHNSLFYLSSIPDNDSYLIEKLKKLKVPNYGFTGKMKFLINKKPLFQVLATRFINVIFLFTEQVRENKFHSLLISPNAINPIEITEHSPNDILQNGFGFTVNFMGQPIAKTLKLLTIELEAGSVNVEVSRALVFSVIVNDVKIDKELQKFNNDNLDWEAHYIVVFLEQKQSSIIVTFTVDNEDIKSQEIMINIGSVNRMTLNPSSTNNHSYYIYNLFIGQKLVNFNELNYLPPGVFLKMRPTNLQPVDIQNPRVDTDKSIPRVSYKHGQNLQRDAVALPYIKSIPLYTNSNINAPFPKHKVKTLNLYSFKSQSYPAHSAWLAGISSNVLKLDASILNQYQITENNEISLKILSGSKRPEILMSLNYGTDKILNILTFNGQLILNNPSTKWTAELPILLINEQWHTLRITSNPLNSSTGVRVYQDNHSFNFQSLGFTITFPSKVELGGFSQTNPVFSYKDKNYMLKPFTGCLDELQINNNTVSILNSGSSNSVKQCPRVLELLNSGGQILAPYAEVTSKPIQLIFEPNQKFETDYFIKFKFKYTGYESGIILTIGDGKRFCSISIKNQEIQLIYLNMINKEKAVEKVEIDKERWYKIIFVVYHQADVLTICRMSINDDKIVRLHTLADSQMFDSNYKMSNLYFGYHPGLLADTKLVSEWDKNFVGCISDVECFVGNVPVSCQFDNSEYFIRGRCSIDKNTYLLRKY 9826
            KCIKGFYRPWNVLATELYPCTPCQCHGLGTIGSCVSNGEDIGDQKPGDCICKKGYEGVNCDLCSIGYERYPNGECLPCPCSIDGSVRTSFYRCKPPCNCKVHVNSDDLCKTCKNGYFNLDSANPEGCEPCYCFGITNQCSSLSAKNLKISDLKGWKLTTFTGEKIALPKFTSFQYLTSENSYIDERFNNPTVYYWTAPPPYLGNWITSYGTIFRYVVKIELQSTLKGSLIDSPDVIIKCGDFRLFHSVSIEDRRLQRQVFIYIKPTEWKIGKLTPDKAATKEEFISCLVKVDKLLIKAKYYSNQKSIELLNITLSRGEVHLALDEMPHIEKCNCPPGFNGLSCESCESGYRRVNNVLYQGQCEACACYNHSNTCDSLNGECQNCTHNTAGAHCEDCASGYYGDAKSKNLN CKKCPCPRLDYQMTELCSSYSSENYVCHKCLHNTSGVHCDRCIEGYYGNPKKKISCKRCKCNNNQESCDPVTGECRCSYNTMGTECQLCKHGFYGDALTKSCKKCDCDSLGSTSENCDKLTG+CDCRTNFVNRQCDSCTSGLYLKDKKCIPCNCEIQGRISSEKFCNTTSGQCFCLE+VNGDRCEKCVEGYFNYPNCKKCLCSPHALSADCDLNNGKCKCGSNVINRICDKCENLHYWNNRTDCVPCNCGRGSLNPKCDMETGNCKCAQNVARRDCSKCDVGYFGLDVTGCKKCPPCYNGQVCNNEGICVCPPNTIGNLCNKCSEDSWDFNETIGCKKCNCYINGSYSNICNKISGICACKTAFFGSKCDRCNEGYYGFPNCQPCSCAENGTKSNELTKCDKITGQCQCKQNVIGTKCKVCRKGTFPSDGTYEGGCFSCFCFGVSEKCHAILNHRIVENSIYEYHIFDEKNSLESGKDYSTIHLNANYPRRFGWPLTMFRPIYVNVMKLFNSHDLSLFYRSIFMNVSVDCLDNKCGREIPEQTEVFMESYNGLFGMRYIVNHSVSNSNNIIVDFNEHSKNGKWVISQYQNDILDKFIILEDSNVINSNLTRDIFMMALLNVTSLKVKLYTDKVNPPLIKIKIITYKVMETTQAIGKRVTAVEKCICNALTFGNHCQNPISGYYKEYFNLPNSTKSGSMRTGNRILINLKKCNCNGYSKVCDSVTGDCQNCMGNREGNKCQLCREGFYKNDKNYDQCEPCQCPSAHYNFAQNCTRIESSLELKCQCRIGYSGKSCENCQQGFYGNPIKGIPCKSCDCNQQGSQSLNCNEFGICQCSPGVLGIKCDQCAPNYVVEKKTCQSCYSGCTKDLLVRIDTLNETVINFKWKTLPSTLDLRLNKINISIQMSSELLNSINKFYKLKNEIKNFSIQFQKMKDDAKEKYGEIEKLKTRYNK+LEDLRSTFTDINETISGHEQLGISNELIKNATAYLETIKNIYKEMPNITLAASVLKDVLKYVDELNQIIKYTQSHIQSDQINNLKILKNKTIMADEINTNNKEYLNTMSTKKKEHELYIILINERMKDLQKIFRKMTKQRDNLRKKIQKLDAISKSFQDEKDLISINVREIEDLMKNLSSNHLVSKSLIIPDTLKKHVEQQLNKSSNLIKKLTKDFNFLHNAEQAKEAYSNITRDILAVDYAINQTKKELDFNRSNMNIDSLKKLLAEFNSNKSEIVENIKNIDKEHEKLLKQYKNCSYNEKKLKNMNEKLSSEIPTGFYDVEILKRNLSEIQMEQNNIENN ILPINQTILNLGTPNVKSGLDTRNLEKLIKVVDNQYRDLVNESSFVENKIKDLRKSIKSLRERLQKARVMSELIHGAAARSVEPIRHVVRCVRHYVTYYLPTSNAFSLEFYMKPQILNDQSLVLFGYDDSGSIPHAFAFTLERNNQYKFWYDSGNSVESIELTGKFSNENYVGIMITWKLGKWHMVIRSISDGRTEQVETSSITNNILSNVRIGPQTNIFVGGFPSSKLLRSLKLEGRLISDLKENYDNYFYKGCLFGVKLMNTEFGLQDIEAIEEECRNTISIDNLLLGKFNCKFNPNSSIIFLDSNIESVNTFKRSVRRQKRDVQTNFDLHFTGNGFAMINTSRTKNGKCATSLNKVLTISTMALPKTHPDTFQLIAVFANKIMKYGFVLGQKNNSYHFGYWKKDVDYPLFPIQN SDSFTWFIFKSKIEKLSETLFGIDEICDHNSLFYLSSIPDNDSYLIEKLKKLKVPNYGFTGKMKFLINKKPLFQVLATRFINVIFLFTEQVRENKFHSLLISPNAINPIEITEHSPNDILQNGFGFTVNFMGQPIAKTLKL TIELEAGSVNVEVSRALVFSVIVNDVKIDKELQKFNNDNLDWEAHYIVVFLEQKQSSIIVTFTVDNEDIKSQEIMINIGSVNRMTLNPSSTNNHSYYIYNLFIGQKLVNFNELNYLPPGVFLKMRPTNLQPVDIQNPRVDTDKSIPRVSYKHGQNLQRDAVALPYIKSIPLYTNSNINAPFPKHKVKTLNLYSFKSQSYPAHSAWLAGISSNVLKLDASILNQYQITENNEISLKILSGSKRPEILMSLNYGTDKILNILTFNGQLILNNPSTKWTAELPILLINEQWHTLRITSNPLNSSTGVRVYQDNHSFNFQSLGFTITFPSKVELGGFSQTNPVFSYKDKNYMLKPFTGCLDELQINNNTVSILNSGSSNSVKQCPRVLELLNSGGQILAPYAEVTSKPIQLIFEPNQKFETDYFIKFKFKYTGYESGIILTIGDGKRFCSISIKNQEIQLIYLNMINKEKAVEKVEIDKERWYKIIFVVYHQADVLTICRMSINDDKIVRLHTLADSQMFDSNYKMSNLYFGYHPGLLADTKLVSEWDKNFVGCISDVECFVGNVPVSCQFDNSEYFIRGRCSIDKNTYLLRKY
Sbjct:   43 KCIKGFYRPWNVLATELYPCTPCQCHGLGTIGSCVSNGEDIGDQKPGDCICKKGYEGVNCDLCSIGYERYPNGECLPCPCSIDGSVRTSFYRCKPPCNCKVHVNSDDLCKTCKNGYFNLDSANPEGCEPCYCFGITNQCSSLSAKNLKISDLKGWKLTTFTGEKIALPKFTSFQYLTSENSYIDERFNNPTVYYWTAPPPYLGNWITSYGTIFRYVVKIELQSTLKGSLIDSPDVIIKCGDFRLFHSVSIEDRRLQRQVFIYIKPTEWKIGKLTPDKAATKEEFISCLVKVDKLLIKAKYYSNQKSIELLNITLSRGEVHLALDEMPHIEKCNCPPGFNGLSCESCESGYRRVNNVLYQGQCEACACYNHSNTCDSLNGECQNCTHNTAGAHCEDCASGYYGDAKSKNLNFCKKCPCPRLDYQMTELCSSYSSENYVCHKCLHNTSGVHCDRCIEGYYGNPKKKISCKRCKCNNNQESCDPVTGECRCSYNTMGTECQLCKHGFYGDALTKSCKKCDCDSLGSTSENCDKLTGECDCRTNFVNRQCDSCTSGLYLKDKKCIPCNCEIQGRISSEKFCNTTSGQCFCLESVNGDRCEKCVEGYFNYPNCKKCLCSPHALSADCDLNNGKCKCGSNVINRICDKCENLHYWNNRTDCVPCNCGRGSLNPKCDMETGNCKCAQNVARRDCSKCDVGYFGLDVTGCKKCPPCYNGQVCNNEGICVCPPNTIGNLCNKCSEDSWDFNETIGCKKCNCYINGSYSNICNKISGICACKTAFFGSKCDRCNEGYYGFPNCQPCSCAENGTKSNELTKCDKITGQCQCKQNVIGTKCKVCRKGTFPSDGTYEGGCFSCFCFGVSEKCHAILNHRIVENSIYEYHIFDEKNSLESGKDYSTIHLNANYPRRFGWPLTMFRPIYVNVMKLFNSHDLSLFYRSIFMNVSVDCLDNKCGREIPEQTEVFMESYNGLFGMRYIVNHSVSNSNNIIVDFNEHSKNGKWVISQYQNDILDKFIILEDSNVINSNLTRDIFMMALLNVTSLKVKLYTDKVNPPLIKIKIITYKVMETTQAIGKRVTAVEKCICNALTFGNHCQNPISGYYKEYFNLPNSTKSGSMRTGNRILINLKKCNCNGYSKVCDSVTGDCQNCMGNREGNKCQLCREGFYKNDKNYDQCEPCQCPSAHYNFAQNCTRIESSLELKCQCRIGYSGKSCENCQQGFYGNPIKGIPCKSCDCNQQGSQSLNCNEFGICQCSPGVLGIKCDQCAPNYVVEKKTCQSCYSGCTKDLLVRIDTLNETVINFKWKTLPSTLDLRLNKINISIQMSSELLNSINKFYKLKNEIKNFSIQFQKMKDDAKEKYGEIEKLKTRYNKILEDLRSTFTDINETISGHEQLGISNELIKNATAYLETIKNIYKEMPNITLAASVLKDVLKYVDELNQIIKYTQSHIQSDQINNLKILKNKTIMADEINTNNKEYLNTMSTKKKEHELYIILINERMKDLQKIFRKMTKQRDNLRKKIQKLDAISKSFQDEKDLISINVREIEDLMKNLSSNHLVSKSLIIPDTLKKHVEQQLNKSSNLIKKLTKDFNFLHNAEQAKEAYSNITRDILAVDYAINQTKKELDFNRSNMNIDSLKKLLAEFNSNKSEIVENIKNIDKEHEKLLKQYKNCSYNEKKLKNMNEKLSSEIPTGFYDVEILKRNLSEIQMEQNNIENNLILPINQTILNLGTPNVKSGLDTRNLEKLIKVVDNQYRDLVNESSFVENKIKDLRKSIKSLRERLQKARVMSELIHGAAARSVEPIRHVVRCVRHYVTYYLPTSNAFSLEFYMKPQILNDQSLVLFGYDDSGSIPHAFAFTLERNNQYKFWYDSGNSVESIELTGKFSNENYVGIMITWKLGKWHMVIRSISDGRTEQVETSSITNNILSNVRIGPQTNIFVGGFPSSKLLRSLKLEGRLISDLKENYDNYFYKGCLFGVKLMNTEFGLQDIEAIEEECRNTISIDNLLLGKFNCKFNPNSSIIFLDSNIESVNTFKRSVRRQKRDVQTNFDLHFTGNGFAMINTSRTKNGKCATSLNKVLTISTMALPKTHPDTFQLIAVFANKIMKYGFVLGQKNNSYHFGYWKKDVDYPLFPIQNTSDSFTWFIFKSKIEKLSETLFGIDEICDHNSLFYLSSIPDNDSYLIEKLKKLKVPNYGFTGKMKFLINKKPLFQVLATRFINVIFLFTEQVRENKFHSLLISPNAINPIEITEHSPNDILQNGFGFTVNFMGQPIAKTLKLFTIELEAGSVNVEVSRALVFSVIVNDVKIDKELQKFNNDNLDWEAHYIVVFLEQKQSSIIVTFTVDNEDIKSQEIMINIGSVNRMTLNPSSTNNHSYYIYNLFIGQKLVNFNELNYLPPGVFLKMRPTNLQPVDIQNPRVDTDKSIPRVSYKHGQNLQRDAVALPYIKSIPLYTNSNINAPFPKHKVKTLNLYSFKSQSYPAHSAWLAGISSNVLKLDASILNQYQITENNEISLKILSGSKRPEILMSLNYGTDKILNILTFNGQLILNNPSTKWTAELPILLINEQWHTLRITSNPLNSSTGVRVYQDNHSFNFQSLGFTITFPSKVELGGFSQTNPVFSYKDKNYMLKPFTGCLDELQINNNTVSILNSGSSNSVKQCPRVLELLNSGGQILAPYAEVTSKPIQLIFEPNQKFETDYFIKFKFKYTGYESGIILTIGDGKRFCSISIKNQEIQLIYLNMINKEKAVEKVEIDKERWYKIIFVVYHQADVLTICRMSINDDKIVRLHTLADSQMFDSNYKMSNLYFGYHPGLLADTKLVSEWDKNFVGCISDVECFVGNVPVSCQFDNSEYFIRGRCSIDKNTYLLRKY 2899          

HSP 2 Score: 74.3294 bits (181), Expect = 2.072e-12
Identity = 77/292 (26.37%), Postives = 112/292 (38.36%), Query Frame = 2
Query:  914 YYSLRNIEIGGKC---ICNNHADKCDKVIENGISVAKC-NCKHNTCGSNCETCCP-LFNQRPWKPVAVCEECNCNRKSNECSYNQTVATLQLSVNKMGRMEGGGVCINCQENTEGINCEKCIKGFYR-----------------------------PWNVLATE-------------LYPCTPCQCHGLGTIGSCVSNGEDIGDQKPGDCICKKGYEGVNCDLCSIGYERYPNGECLPCPCSIDGSVRTSFY--RCKPPCNCKVHVNSDDLCKTCKNGYFNLDSANPEGCEP 1642
            Y  + N+   G+C    C NH++ CD +  NG    +C NC HNT G++CE C    +     K +  C++C C R      Y  T      S           VC  C  NT G++C++CI+G+Y                               +N + TE                C  C C  LG      S  E+  D+  G+C C+  +    CD C+ G     + +C+PC C I G + +  +       C C   VN D  C+ C  GYFN  +     C P
Sbjct:  392 YRRVNNVLYQGQCEACACYNHSNTCDSL--NG----ECQNCTHNTAGAHCEDCASGYYGDAKSKNLNFCKKCPCPR----LDYQMTELCSSYSSENY-------VCHKCLHNTSGVHCDRCIEGYYGNPKKKISCKRCKCNNNQESCDPVTGECRCSYNTMGTECQLCKHGFYGDALTKSCKKCDCDSLG------STSENC-DKLTGECDCRTNFVNRQCDSCTSGL-YLKDKKCIPCNCEIQGRISSEKFCNTTSGQCFCLESVNGDR-CEKCVEGYFNYPNCKKCLCSP 657          

HSP 3 Score: 63.5438 bits (153), Expect = 3.674e-9
Identity = 68/266 (25.56%), Postives = 96/266 (36.09%), Query Frame = 2
Query:  947 KCICNNHADKCDKVIENGISVAKCNCKHNTCGSNCETC-CPLFNQRPWKPVAVCE----------------ECNC-----NRKSNECS---YNQTVATLQLSVNKMGRMEGGGVCIN------CQENTEGINCEKCIKGFYRPWNVLATELYP-CTPCQCHGLGTIGSCVSNGEDIGDQKPGDCICKKGYEGVNCDLCSIGYERYPNGECLPCPCSIDGSVRTSFYRCKPPCNCKVHVNSDDLCKTCKNGYFNLDSANPEGCEPCY 1648
            +C CNN+ + CD V        +C C +NT G+ C+ C    +     K    C+                EC+C     NR+ + C+   Y +    +  +    GR+     C        C E+  G  CEKC++G++          YP C  C C        C        D   G C C        CD C   +      +C+PC C   GS+          C C  +V   D C  C  GYF LD    + C PCY
Sbjct:  511 RCKCNNNQESCDPV------TGECRCSYNTMGTECQLCKHGFYGDALTKSCKKCDCDSLGSTSENCDKLTGECDCRTNFVNRQCDSCTSGLYLKDKKCIPCNCEIQGRISSEKFCNTTSGQCFCLESVNGDRCEKCVEGYFN---------YPNCKKCLCSPHALSADC--------DLNNGKCKCGSNVINRICDKCENLHYWNNRTDCVPCNCG-RGSLNPKCDMETGNCKCAQNVARRD-CSKCDVGYFGLDVTGCKKCPPCY 751          
BLAST of Laminin subunit alpha-2 vs. Planmine SMEST
Match: SMESG000056013.1 (SMESG000056013.1)

HSP 1 Score: 5736.38 bits (14880), Expect = 0.000e+0
Identity = 2838/2858 (99.30%), Postives = 2841/2858 (99.41%), Query Frame = 2
Query: 1253 EKCIKGFYRPWNVLATELYPCTPCQCHGLGTIGSCVSNGEDIGDQKPGDCICKKGYEGVNCDLCSIGYERYPNGECLPCPCSIDGSVRTSFYRCKPPCNCKVHVNSDDLCKTCKNGYFNLDSANPEGCEPCYCFGITNQCSSLSAKNLKISDLKGWKLTTFTGEKIALPKFTSFQYLTSENSYIDERFNNPTVYYWTAPPPYLGNWITSYGTIFRYVVKIELQSTLKGSLIDSPDVIIKCGDFRLFHSVSIEDRRLQRQVFIYIKPTEWKIGKLTPDKAATKEEFISCLVKVDKLLIKAKYYSNQKSIELLNITLSRGEVHLALDEMPHIEKCNCPPGFNGLSCESCESGYRRVNNVLYQGQCEACACYNHSNTCDSLNGECQNCTHNTAGAHCEDCASGYYGDAKSKNLNSCKKCPCPRLDYQMTELCSSYSSENYVCHKCLHNTSGVHCDRCIEGYYGNPKKKISCKRCKCNNNQESCDPVTGECRCSYNTMGTECQLCKHGFYGDALTKSCKKCDCDSLGSTSENCDKLTGKCDCRTNFVNRQCDSCTSGLYLKDKKCIPCNCEIQGRISSEKFCNTTSGQCFCLENVNGDRCEKCVEGYFNYPNCKKCLCSPHALSADCDLNNGKCKCGSNVINRICDKCENLHYWNNRTDCVPCNCGRGSLNPKCDMETGNCKCAQNVARRDCSKCDVGYFGLDVTGCKKCPPCYNGQVCNNEGICVCPPNTIGNLCNKCSEDSWDFNETIGCKKCNCYINGSYSNICNKISGICACKTAFFGSKCDRCNEGYYGFPNCQPCSCAENGTKSNELTKCDKITGQCQCKQNVIGTKCKVCRKGTFPSDGTYEGGCFSCFCFGVSEKCHAILNHRIVENSIYEYHIFDEKNSLESGKDYSTIHLNANYPRRFGWPLTMFRPIYVNVMKLFNSHDLSLFYRSIFMNVSVDCLDNKCGREIPEQTEVFMESYNGLFGMRYXXXXXXXXXXXXXXDFNEHSKNGKWVISQYQNDILDKFIILEDSNVINSNLTRDIFMMALLNVTSLKVKLYTDKVNPPLIKIKIITYKVMETTQAIGKRVTAVEKCICNALTFGNHCQNPISGYYKEYFNLPNSTKSGSMRTGNRILINLKKCNCNGYSKVCDSVTGDCQNCMGNREGNKCQLCREGFYKNDKNYDQCEPCQCPSAHYNFAQNCTRIESSLELKCQCRIGYSGKSCENCQQGFYGNPIKGIPCKSCDCNQQGSQSLNCNEFGICQCSPGVLGIKCDQCAPNYVVEKKTCQSCYSGCTKDLLVRIDTLNETVINFKWKTLPSTLDLRLNKINISIQMSSELLNSINKFYKLKNEIKNFSIQFQKMKDDAKEKYGEIEKLKTRYNKVLEDLRSTFTDINETISGHEQLGISNELIKNATAYLETIKNIYKEMPNITLAASVLKDVLKYVDELNQIIKYTQSHIQSDQINNLKILKNKTIMADEINTNNKEYLNTMSTKKKEHELYIILINERMKDLQKIFRKMTKQRDNLRKKIQKLDAISKSFQDEKDLISINVREIEDLMKNLSSNHLVSKSLIIPDTLKKHVEQQLNKSSNLIKKLTKDFNFLHNAEQAKEAYSNITRDILAVDYAINQTKKELDFNRSNMNIDSLKKLLAEFNSNKSEIVENIKNIDKEHEKLLKQYKNCSYXXXXXXXXXXXXSSEIPTGFYDVEILKRNLSXXXXXXXXXXXXFILPINQTILNLGTPNVKSGLDTRNLEKLIKVVDNQYRDLVNESSFVENKIKDLRKSIKSLRERLQKARVMSELIHGAAARSVEPIRHVVRCVRHYVTYYLPTSNAFSLEFYMKPQILNDQSLVLFGYDDSGSIPHAFAFTLERNNQYKFWYDSGNSVESIELTGKFSNENYVGIMITWKLGKWHMVIRSISDGRTEQVETSSITNNILSNVRIGPQTNIFVGGFPSSKLLRSLKLEGRLISDLKENYDNYFYKGCLFGVKLMNTEFGLQDIEAIEEECRNTISIDNLLLGKFNCKFNPNSSIIFLDSNIESVNTFKRSVRRQKRDVQTNFDLHFTGNGFAMINTSRTKNGKCATSLNKVLTISTMALPKTHPDTFQLIAVFANKIMKYGFVLGQKNNSYHFGYWKKDVDYPLFPIQNASDSFTWFIFKSKIEKLSETLFGIDEICDHNSLFYLSSIPDNDSYLIEKLKKLKVPNYGFTGKMKFLINKKPLFQVLATRFINVIFLFTEQVRENKFHSLLISPNAINPIEITEHSPNDILQNGFGFTVNFMGQPIAKTLKLLTIELEAGSVNVEVSRALVFSVIVNDVKIDKELQKFNNDNLDWEAHYIVVFLEQKQSSIIVTFTVDNEDIKSQEIMINIGSVNRMTLNPSSTNNHSYYIYNLFIGQKLVNFNELNYLPPGVFLKMRPTNLQPVDIQNPRVDTDKSIPRVSYKHGQNLQRDAVALPYIKSIPLYTNSNINAPFPKHKVKTLNLYSFKSQSYPAHSAWLAGISSNVLKLDASILNQYQITENNEISLKILSGSKRPEILMSLNYGTDKILNILTFNGQLILNNPSTKWTAELPILLINEQWHTLRITSNPLNSSTGVRVYQDNHSFNFQSLGFTITFPSKVELGGFSQTNPVFSYKDKNYMLKPFTGCLDELQINNNTVSILNSGSSNSVKQCPRVLELLNSGGQILAPYAEVTSKPIQLIFEPNQKFETDYFIKFKFKYTGYESGIILTIGDGKRFCSISIKNQEIQLIYLNMINKEKAVEKVEIDKERWYKIIFVVYHQADVLTICRMSINDDKIVRLHTLADSQMFDSNYKMSNLYFGYHPGLLADTKLVSEWDKNFVGCISDVECFVGNVPVSCQFDNSEYFIRGRCSIDKNTYLLRKY 9826
             KCIKGFYRPWNVLATELYPCTPCQCHGLGTIGSCVSNGEDIGDQKPGDCICKKGYEGVNCDLCSIGYERYPNGECLPCPCSIDGSVRTSFYRCKPPCNCKVHVNSDDLCKTCKNGYFNLDSANPEGCEPCYCFGITNQCSSLSAKNLKISDLKGWKLTTFTGEKIALPKFTSFQYLTSENSYIDERFNNPTVYYWTAPPPYLGNWITSYGTIFRYVVKIELQSTLKGSLIDSPDVIIKCGDFRLFHSVSIEDRRLQRQVFIYIKPTEWKIGKLTPDKAATKEEFISCLVKVDKLLIKAKYYSNQKSIELLNITLSRGEVHLALDEMPHIEKCNCPPGFNGLSCESCESGYRRVNNVLYQGQCEACACYNHSNTCDSLNGECQNCTHNTAGAHCEDCASGYYGDAKSKNLN CKKCPCPRLDYQMTELCSSYSSENYVCHKCLHNTSGVHCDRCIEGYYGNPKKKISCKRCKCNNNQESCDPVTGECRCSYNTMGTECQLCKHGFYGDALTKSCKKCDCDSLGSTSENCDKLTG+CDCRTNFVNRQCDSCTSGLYLKDKKCIPCNCEIQGRISSEKFCNTTSGQCFCLE+VNGDRCEKCVEGYFNYPNCKKCLCSPHALSADCDLNNGKCKCGSNVINRICDKCENLHYWNNRTDCVPCNCGRGSLNPKCDMETGNCKCAQNVARRDCSKCDVGYFGLDVTGCKKCPPCYNGQVCNNEGICVCPPNTIGNLCNKCSEDSWDFNETIGCKKCNCYINGSYSNICNKISGICACKTAFFGSKCDRCNEGYYGFPNCQPCSCAENGTKSNELTKCDKITGQCQCKQNVIGTKCKVCRKGTFPSDGTYEGGCFSCFCFGVSEKCHAILNHRIVENSIYEYHIFDEKNSLESGKDYSTIHLNANYPRRFGWPLTMFRPIYVNVMKLFNSHDLSLFYRSIFMNVSVDCLDNKCGREIPEQTEVFMESYNGLFGMRYIVNHSVSNSNNIIVDFNEHSKNGKWVISQYQNDILDKFIILEDSNVINSNLTRDIFMMALLNVTSLKVKLYTDKVNPPLIKIKIITYKVMETTQAIGKRVTAVEKCICNALTFGNHCQNPISGYYKEYFNLPNSTKSGSMRTGNRILINLKKCNCNGYSKVCDSVTGDCQNCMGNREGNKCQLCREGFYKNDKNYDQCEPCQCPSAHYNFAQNCTRIESSLELKCQCRIGYSGKSCENCQQGFYGNPIKGIPCKSCDCNQQGSQSLNCNEFGICQCSPGVLGIKCDQCAPNYVVEKKTCQSCYSGCTKDLLVRIDTLNETVINFKWKTLPSTLDLRLNKINISIQMSSELLNSINKFYKLKNEIKNFSIQFQKMKDDAKEKYGEIEKLKTRYNK+LEDLRSTFTDINETISGHEQLGISNELIKNATAYLETIKNIYKEMPNITLAASVLKDVLKYVDELNQIIKYTQSHIQSDQINNLKILKNKTIMADEINTNNKEYLNTMSTKKKEHELYIILINERMKDLQKIFRKMTKQRDNLRKKIQKLDAISKSFQDEKDLISINVREIEDLMKNLSSNHLVSKSLIIPDTLKKHVEQQLNKSSNLIKKLTKDFNFLHNAEQAKEAYSNITRDILAVDYAINQTKKELDFNRSNMNIDSLKKLLAEFNSNKSEIVENIKNIDKEHEKLLKQYKNCSYNEKKLKNMNEKLSSEIPTGFYDVEILKRNLSEIQMEQNNIENN ILPINQTILNLGTPNVKSGLDTRNLEKLIKVVDNQYRDLVNESSFVENKIKDLRKSIKSLRERLQKARVMSELIHGAAARSVEPIRHVVRCVRHYVTYYLPTSNAFSLEFYMKPQILNDQSLVLFGYDDSGSIPHAFAFTLERNNQYKFWYDSGNSVESIELTGKFSNENYVGIMITWKLGKWHMVIRSISDGRTEQVETSSITNNILSNVRIGPQTNIFVGGFPSSKLLRSLKLEGRLISDLKENYDNYFYKGCLFGVKLMNTEFGLQDIEAIEEECRNTISIDNLLLGKFNCK            NIESVNTFKRSVRRQKRDVQTNFDLHFTGNGFAMINTSRTKNGKCATSLNKVLTISTMALPKTHPDTFQLIAVFANKIMKYGFVLGQKNNSYHFGYWKKDVDYPLFPIQN SDSFTWFIFKSKIEKLSETLFGIDEICDHNSLFYLSSIPDNDSYLIEKLKKLKVPNYGFTGKMKFLINKKPLFQVLATRFINVIFLFTEQVRENKFHSLLISPNAINPIEITEHSPNDILQNGFGFTVNFMGQPIAKTLKL TIELEAGSVNVEVSRALVFSVIVNDVKIDKELQKFNNDNLDWEAHYIVVFLEQKQSSIIVTFTVDNEDIKSQEIMINIGSVNRMTLNPSSTNNHSYYIYNLFIGQKLVNFNELNYLPPGVFLKMRPTNLQPVDIQNPRVDTDKSIPRVSYKHGQNLQRDAVALPYIKSIPLYTNSNINAPFPKHKVKTLNLYSFKSQSYPAHSAWLAGISSNVLKLDASILNQYQITENNEISLKILSGSKRPEILMSLNYGTDKILNILTFNGQLILNNPSTKWTAELPILLINEQWHTLRITSNPLNSSTGVRVYQDNHSFNFQSLGFTITFPSKVELGGFSQTNPVFSYKDKNYMLKPFTGCLDELQINNNTVSILNSGSSNSVKQCPRVLELLNSGGQILAPYAEVTSKPIQLIFEPNQKFETDYFIKFKFKYTGYESGIILTIGDGKRFCSISIKNQEIQLIYLNMINKEKAVEKVEIDKERWYKIIFVVYHQADVLTICRMSINDDKIVRLHTLADSQMFDSNYKMSNLYFGYHPGLLADTKLVSEWDKNFVGCISDVECFVGNVPVSCQFDNSEYFIRGRCSIDKNTYLLRKY
Sbjct:    3 RKCIKGFYRPWNVLATELYPCTPCQCHGLGTIGSCVSNGEDIGDQKPGDCICKKGYEGVNCDLCSIGYERYPNGECLPCPCSIDGSVRTSFYRCKPPCNCKVHVNSDDLCKTCKNGYFNLDSANPEGCEPCYCFGITNQCSSLSAKNLKISDLKGWKLTTFTGEKIALPKFTSFQYLTSENSYIDERFNNPTVYYWTAPPPYLGNWITSYGTIFRYVVKIELQSTLKGSLIDSPDVIIKCGDFRLFHSVSIEDRRLQRQVFIYIKPTEWKIGKLTPDKAATKEEFISCLVKVDKLLIKAKYYSNQKSIELLNITLSRGEVHLALDEMPHIEKCNCPPGFNGLSCESCESGYRRVNNVLYQGQCEACACYNHSNTCDSLNGECQNCTHNTAGAHCEDCASGYYGDAKSKNLNFCKKCPCPRLDYQMTELCSSYSSENYVCHKCLHNTSGVHCDRCIEGYYGNPKKKISCKRCKCNNNQESCDPVTGECRCSYNTMGTECQLCKHGFYGDALTKSCKKCDCDSLGSTSENCDKLTGECDCRTNFVNRQCDSCTSGLYLKDKKCIPCNCEIQGRISSEKFCNTTSGQCFCLESVNGDRCEKCVEGYFNYPNCKKCLCSPHALSADCDLNNGKCKCGSNVINRICDKCENLHYWNNRTDCVPCNCGRGSLNPKCDMETGNCKCAQNVARRDCSKCDVGYFGLDVTGCKKCPPCYNGQVCNNEGICVCPPNTIGNLCNKCSEDSWDFNETIGCKKCNCYINGSYSNICNKISGICACKTAFFGSKCDRCNEGYYGFPNCQPCSCAENGTKSNELTKCDKITGQCQCKQNVIGTKCKVCRKGTFPSDGTYEGGCFSCFCFGVSEKCHAILNHRIVENSIYEYHIFDEKNSLESGKDYSTIHLNANYPRRFGWPLTMFRPIYVNVMKLFNSHDLSLFYRSIFMNVSVDCLDNKCGREIPEQTEVFMESYNGLFGMRYIVNHSVSNSNNIIVDFNEHSKNGKWVISQYQNDILDKFIILEDSNVINSNLTRDIFMMALLNVTSLKVKLYTDKVNPPLIKIKIITYKVMETTQAIGKRVTAVEKCICNALTFGNHCQNPISGYYKEYFNLPNSTKSGSMRTGNRILINLKKCNCNGYSKVCDSVTGDCQNCMGNREGNKCQLCREGFYKNDKNYDQCEPCQCPSAHYNFAQNCTRIESSLELKCQCRIGYSGKSCENCQQGFYGNPIKGIPCKSCDCNQQGSQSLNCNEFGICQCSPGVLGIKCDQCAPNYVVEKKTCQSCYSGCTKDLLVRIDTLNETVINFKWKTLPSTLDLRLNKINISIQMSSELLNSINKFYKLKNEIKNFSIQFQKMKDDAKEKYGEIEKLKTRYNKILEDLRSTFTDINETISGHEQLGISNELIKNATAYLETIKNIYKEMPNITLAASVLKDVLKYVDELNQIIKYTQSHIQSDQINNLKILKNKTIMADEINTNNKEYLNTMSTKKKEHELYIILINERMKDLQKIFRKMTKQRDNLRKKIQKLDAISKSFQDEKDLISINVREIEDLMKNLSSNHLVSKSLIIPDTLKKHVEQQLNKSSNLIKKLTKDFNFLHNAEQAKEAYSNITRDILAVDYAINQTKKELDFNRSNMNIDSLKKLLAEFNSNKSEIVENIKNIDKEHEKLLKQYKNCSYNEKKLKNMNEKLSSEIPTGFYDVEILKRNLSEIQMEQNNIENNLILPINQTILNLGTPNVKSGLDTRNLEKLIKVVDNQYRDLVNESSFVENKIKDLRKSIKSLRERLQKARVMSELIHGAAARSVEPIRHVVRCVRHYVTYYLPTSNAFSLEFYMKPQILNDQSLVLFGYDDSGSIPHAFAFTLERNNQYKFWYDSGNSVESIELTGKFSNENYVGIMITWKLGKWHMVIRSISDGRTEQVETSSITNNILSNVRIGPQTNIFVGGFPSSKLLRSLKLEGRLISDLKENYDNYFYKGCLFGVKLMNTEFGLQDIEAIEEECRNTISIDNLLLGKFNCKL-----------NIESVNTFKRSVRRQKRDVQTNFDLHFTGNGFAMINTSRTKNGKCATSLNKVLTISTMALPKTHPDTFQLIAVFANKIMKYGFVLGQKNNSYHFGYWKKDVDYPLFPIQNTSDSFTWFIFKSKIEKLSETLFGIDEICDHNSLFYLSSIPDNDSYLIEKLKKLKVPNYGFTGKMKFLINKKPLFQVLATRFINVIFLFTEQVRENKFHSLLISPNAINPIEITEHSPNDILQNGFGFTVNFMGQPIAKTLKLFTIELEAGSVNVEVSRALVFSVIVNDVKIDKELQKFNNDNLDWEAHYIVVFLEQKQSSIIVTFTVDNEDIKSQEIMINIGSVNRMTLNPSSTNNHSYYIYNLFIGQKLVNFNELNYLPPGVFLKMRPTNLQPVDIQNPRVDTDKSIPRVSYKHGQNLQRDAVALPYIKSIPLYTNSNINAPFPKHKVKTLNLYSFKSQSYPAHSAWLAGISSNVLKLDASILNQYQITENNEISLKILSGSKRPEILMSLNYGTDKILNILTFNGQLILNNPSTKWTAELPILLINEQWHTLRITSNPLNSSTGVRVYQDNHSFNFQSLGFTITFPSKVELGGFSQTNPVFSYKDKNYMLKPFTGCLDELQINNNTVSILNSGSSNSVKQCPRVLELLNSGGQILAPYAEVTSKPIQLIFEPNQKFETDYFIKFKFKYTGYESGIILTIGDGKRFCSISIKNQEIQLIYLNMINKEKAVEKVEIDKERWYKIIFVVYHQADVLTICRMSINDDKIVRLHTLADSQMFDSNYKMSNLYFGYHPGLLADTKLVSEWDKNFVGCISDVECFVGNVPVSCQFDNSEYFIRGRCSIDKNTYLLRKY 2849          

HSP 2 Score: 74.3294 bits (181), Expect = 2.139e-12
Identity = 78/295 (26.44%), Postives = 114/295 (38.64%), Query Frame = 2
Query:  914 YYSLRNIEIGGKC---ICNNHADKCDKVIENGISVAKC-NCKHNTCGSNCETCCP-LFNQRPWKPVAVCEECNCNRKSNECSYNQTVATLQLSVNKMGRMEGGGVCINCQENTEGINCEKCIKGFYR-----------------------------PWNVLATE-------------LYPCTPCQCHGLGTIGSCVSNGEDIGDQKPGDCICKKGYEGVNCDLCSIGYERYPNGECLPCPCSIDGSVRTSFY--RCKPPCNCKVHVNSDDLCKTCKNGYFNLDSANPEGCEPCYC 1651
            Y  + N+   G+C    C NH++ CD +  NG    +C NC HNT G++CE C    +     K +  C++C C R      Y  T      S           VC  C  NT G++C++CI+G+Y                               +N + TE                C  C C  LG      S  E+  D+  G+C C+  +    CD C+ G     + +C+PC C I G + +  +       C C   VN D  C+ C  GYFN  +     C+ C C
Sbjct:  353 YRRVNNVLYQGQCEACACYNHSNTCDSL--NG----ECQNCTHNTAGAHCEDCASGYYGDAKSKNLNFCKKCPCPR----LDYQMTELCSSYSSENY-------VCHKCLHNTSGVHCDRCIEGYYGNPKKKISCKRCKCNNNQESCDPVTGECRCSYNTMGTECQLCKHGFYGDALTKSCKKCDCDSLG------STSENC-DKLTGECDCRTNFVNRQCDSCTSGL-YLKDKKCIPCNCEIQGRISSEKFCNTTSGQCFCLESVNGDR-CEKCVEGYFNYPN-----CKKCLC 616          

HSP 3 Score: 63.5438 bits (153), Expect = 3.825e-9
Identity = 68/266 (25.56%), Postives = 96/266 (36.09%), Query Frame = 2
Query:  947 KCICNNHADKCDKVIENGISVAKCNCKHNTCGSNCETC-CPLFNQRPWKPVAVCE----------------ECNC-----NRKSNECS---YNQTVATLQLSVNKMGRMEGGGVCIN------CQENTEGINCEKCIKGFYRPWNVLATELYP-CTPCQCHGLGTIGSCVSNGEDIGDQKPGDCICKKGYEGVNCDLCSIGYERYPNGECLPCPCSIDGSVRTSFYRCKPPCNCKVHVNSDDLCKTCKNGYFNLDSANPEGCEPCY 1648
            +C CNN+ + CD V        +C C +NT G+ C+ C    +     K    C+                EC+C     NR+ + C+   Y +    +  +    GR+     C        C E+  G  CEKC++G++          YP C  C C        C        D   G C C        CD C   +      +C+PC C   GS+          C C  +V   D C  C  GYF LD    + C PCY
Sbjct:  472 RCKCNNNQESCDPV------TGECRCSYNTMGTECQLCKHGFYGDALTKSCKKCDCDSLGSTSENCDKLTGECDCRTNFVNRQCDSCTSGLYLKDKKCIPCNCEIQGRISSEKFCNTTSGQCFCLESVNGDRCEKCVEGYFN---------YPNCKKCLCSPHALSADC--------DLNNGKCKCGSNVINRICDKCENLHYWNNRTDCVPCNCG-RGSLNPKCDMETGNCKCAQNVARRD-CSKCDVGYFGLDVTGCKKCPPCY 712          
BLAST of Laminin subunit alpha-2 vs. Planmine SMEST
Match: SMESG000056013.1 (SMESG000056013.1)

HSP 1 Score: 5734.84 bits (14876), Expect = 0.000e+0
Identity = 2838/2858 (99.30%), Postives = 2841/2858 (99.41%), Query Frame = 2
Query: 1253 EKCIKGFYRPWNVLATELYPCTPCQCHGLGTIGSCVSNGEDIGDQKPGDCICKKGYEGVNCDLCSIGYERYPNGECLPCPCSIDGSVRTSFYRCKPPCNCKVHVNSDDLCKTCKNGYFNLDSANPEGCEPCYCFGITNQCSSLSAKNLKISDLKGWKLTTFTGEKIALPKFTSFQYLTSENSYIDERFNNPTVYYWTAPPPYLGNWITSYGTIFRYVVKIELQSTLKGSLIDSPDVIIKCGDFRLFHSVSIEDRRLQRQVFIYIKPTEWKIGKLTPDKAATKEEFISCLVKVDKLLIKAKYYSNQKSIELLNITLSRGEVHLALDEMPHIEKCNCPPGFNGLSCESCESGYRRVNNVLYQGQCEACACYNHSNTCDSLNGECQNCTHNTAGAHCEDCASGYYGDAKSKNLNSCKKCPCPRLDYQMTELCSSYSSENYVCHKCLHNTSGVHCDRCIEGYYGNPKKKISCKRCKCNNNQESCDPVTGECRCSYNTMGTECQLCKHGFYGDALTKSCKKCDCDSLGSTSENCDKLTGKCDCRTNFVNRQCDSCTSGLYLKDKKCIPCNCEIQGRISSEKFCNTTSGQCFCLENVNGDRCEKCVEGYFNYPNCKKCLCSPHALSADCDLNNGKCKCGSNVINRICDKCENLHYWNNRTDCVPCNCGRGSLNPKCDMETGNCKCAQNVARRDCSKCDVGYFGLDVTGCKKCPPCYNGQVCNNEGICVCPPNTIGNLCNKCSEDSWDFNETIGCKKCNCYINGSYSNICNKISGICACKTAFFGSKCDRCNEGYYGFPNCQPCSCAENGTKSNELTKCDKITGQCQCKQNVIGTKCKVCRKGTFPSDGTYEGGCFSCFCFGVSEKCHAILNHRIVENSIYEYHIFDEKNSLESGKDYSTIHLNANYPRRFGWPLTMFRPIYVNVMKLFNSHDLSLFYRSIFMNVSVDCLDNKCGREIPEQTEVFMESYNGLFGMRYXXXXXXXXXXXXXXDFNEHSKNGKWVISQYQNDILDKFIILEDSNVINSNLTRDIFMMALLNVTSLKVKLYTDKVNPPLIKIKIITYKVMETTQAIGKRVTAVEKCICNALTFGNHCQNPISGYYKEYFNLPNSTKSGSMRTGNRILINLKKCNCNGYSKVCDSVTGDCQNCMGNREGNKCQLCREGFYKNDKNYDQCEPCQCPSAHYNFAQNCTRIESSLELKCQCRIGYSGKSCENCQQGFYGNPIKGIPCKSCDCNQQGSQSLNCNEFGICQCSPGVLGIKCDQCAPNYVVEKKTCQSCYSGCTKDLLVRIDTLNETVINFKWKTLPSTLDLRLNKINISIQMSSELLNSINKFYKLKNEIKNFSIQFQKMKDDAKEKYGEIEKLKTRYNKVLEDLRSTFTDINETISGHEQLGISNELIKNATAYLETIKNIYKEMPNITLAASVLKDVLKYVDELNQIIKYTQSHIQSDQINNLKILKNKTIMADEINTNNKEYLNTMSTKKKEHELYIILINERMKDLQKIFRKMTKQRDNLRKKIQKLDAISKSFQDEKDLISINVREIEDLMKNLSSNHLVSKSLIIPDTLKKHVEQQLNKSSNLIKKLTKDFNFLHNAEQAKEAYSNITRDILAVDYAINQTKKELDFNRSNMNIDSLKKLLAEFNSNKSEIVENIKNIDKEHEKLLKQYKNCSYXXXXXXXXXXXXSSEIPTGFYDVEILKRNLSXXXXXXXXXXXXFILPINQTILNLGTPNVKSGLDTRNLEKLIKVVDNQYRDLVNESSFVENKIKDLRKSIKSLRERLQKARVMSELIHGAAARSVEPIRHVVRCVRHYVTYYLPTSNAFSLEFYMKPQILNDQSLVLFGYDDSGSIPHAFAFTLERNNQYKFWYDSGNSVESIELTGKFSNENYVGIMITWKLGKWHMVIRSISDGRTEQVETSSITNNILSNVRIGPQTNIFVGGFPSSKLLRSLKLEGRLISDLKENYDNYFYKGCLFGVKLMNTEFGLQDIEAIEEECRNTISIDNLLLGKFNCKFNPNSSIIFLDSNIESVNTFKRSVRRQKRDVQTNFDLHFTGNGFAMINTSRTKNGKCATSLNKVLTISTMALPKTHPDTFQLIAVFANKIMKYGFVLGQKNNSYHFGYWKKDVDYPLFPIQNASDSFTWFIFKSKIEKLSETLFGIDEICDHNSLFYLSSIPDNDSYLIEKLKKLKVPNYGFTGKMKFLINKKPLFQVLATRFINVIFLFTEQVRENKFHSLLISPNAINPIEITEHSPNDILQNGFGFTVNFMGQPIAKTLKLLTIELEAGSVNVEVSRALVFSVIVNDVKIDKELQKFNNDNLDWEAHYIVVFLEQKQSSIIVTFTVDNEDIKSQEIMINIGSVNRMTLNPSSTNNHSYYIYNLFIGQKLVNFNELNYLPPGVFLKMRPTNLQPVDIQNPRVDTDKSIPRVSYKHGQNLQRDAVALPYIKSIPLYTNSNINAPFPKHKVKTLNLYSFKSQSYPAHSAWLAGISSNVLKLDASILNQYQITENNEISLKILSGSKRPEILMSLNYGTDKILNILTFNGQLILNNPSTKWTAELPILLINEQWHTLRITSNPLNSSTGVRVYQDNHSFNFQSLGFTITFPSKVELGGFSQTNPVFSYKDKNYMLKPFTGCLDELQINNNTVSILNSGSSNSVKQCPRVLELLNSGGQILAPYAEVTSKPIQLIFEPNQKFETDYFIKFKFKYTGYESGIILTIGDGKRFCSISIKNQEIQLIYLNMINKEKAVEKVEIDKERWYKIIFVVYHQADVLTICRMSINDDKIVRLHTLADSQMFDSNYKMSNLYFGYHPGLLADTKLVSEWDKNFVGCISDVECFVGNVPVSCQFDNSEYFIRGRCSIDKNTYLLRKY 9826
             KCIKGFYRPWNVLATELYPCTPCQCHGLGTIGSCVSNGEDIGDQKPGDCICKKGYEGVNCDLCSIGYERYPNGECLPCPCSIDGSVRTSFYRCKPPCNCKVHVNSDDLCKTCKNGYFNLDSANPEGCEPCYCFGITNQCSSLSAKNLKISDLKGWKLTTFTGEKIALPKFTSFQYLTSENSYIDERFNNPTVYYWTAPPPYLGNWITSYGTIFRYVVKIELQSTLKGSLIDSPDVIIKCGDFRLFHSVSIEDRRLQRQVFIYIKPTEWKIGKLTPDKAATKEEFISCLVKVDKLLIKAKYYSNQKSIELLNITLSRGEVHLALDEMPHIEKCNCPPGFNGLSCESCESGYRRVNNVLYQGQCEACACYNHSNTCDSLNGECQNCTHNTAGAHCEDCASGYYGDAKSKNLN CKKCPCPRLDYQMTELCSSYSSENYVCHKCLHNTSGVHCDRCIEGYYGNPKKKISCKRCKCNNNQESCDPVTGECRCSYNTMGTECQLCKHGFYGDALTKSCKKCDCDSLGSTSENCDKLTG+CDCRTNFVNRQCDSCTSGLYLKDKKCIPCNCEIQGRISSEKFCNTTSGQCFCLE+VNGDRCEKCVEGYFNYPNCKKCLCSPHALSADCDLNNGKCKCGSNVINRICDKCENLHYWNNRTDCVPCNCGRGSLNPKCDMETGNCKCAQNVARRDCSKCDVGYFGLDVTGCKKCPPCYNGQVCNNEGICVCPPNTIGNLCNKCSEDSWDFNETIGCKKCNCYINGSYSNICNKISGICACKTAFFGSKCDRCNEGYYGFPNCQPCSCAENGTKSNELTKCDKITGQCQCKQNVIGTKCKVCRKGTFPSDGTYEGGCFSCFCFGVSEKCHAILNHRIVENSIYEYHIFDEKNSLESGKDYSTIHLNANYPRRFGWPLTMFRPIYVNVMKLFNSHDLSLFYRSIFMNVSVDCLDNKCGREIPEQTEVFMESYNGLFGMRYIVNHSVSNSNNIIVDFNEHSKNGKWVISQYQNDILDKFIILEDSNVINSNLTRDIFMMALLNVTSLKVKLYTDKVNPPLIKIKIITYKVMETTQAIGKRVTAVEKCICNALTFGNHCQNPISGYYKEYFNLPNSTKSGSMRTGNRILINLKKCNCNGYSKVCDSVTGDCQNCMGNREGNKCQLCREGFYKNDKNYDQCEPCQCPSAHYNFAQNCTRIESSLELKCQCRIGYSGKSCENCQQGFYGNPIKGIPCKSCDCNQQGSQSLNCNEFGICQCSPGVLGIKCDQCAPNYVVEKKTCQSCYSGCTKDLLVRIDTLNETVINFKWKTLPSTLDLRLNKINISIQMSSELLNSINKFYKLKNEIKNFSIQFQKMKDDAKEKYGEIEKLKTRYNK+LEDLRSTFTDINETISGHEQLGISNELIKNATAYLETIKNIYKEMPNITLAASVLKDVLKYVDELNQIIKYTQSHIQSDQINNLKILKNKTIMADEINTNNKEYLNTMSTKKKEHELYIILINERMKDLQKIFRKMTKQRDNLRKKIQKLDAISKSFQDEKDLISINVREIEDLMKNLSSNHLVSKSLIIPDTLKKHVEQQLNKSSNLIKKLTKDFNFLHNAEQAKEAYSNITRDILAVDYAINQTKKELDFNRSNMNIDSLKKLLAEFNSNKSEIVENIKNIDKEHEKLLKQYKNCSYNEKKLKNMNEKLSSEIPTGFYDVEILKRNLSEIQMEQNNIENN ILPINQTILNLGTPNVKSGLDTRNLEKLIKVVDNQYRDLVNESSFVENKIKDLRKSIKSLRERLQKARVMSELIHGAAARSVEPIRHVVRCVRHYVTYYLPTSNAFSLEFYMKPQILNDQSLVLFGYDDSGSIPHAFAFTLERNNQYKFWYDSGNSVESIELTGKFSNENYVGIMITWKLGKWHMVIRSISDGRTEQVETSSITNNILSNVRIGPQTNIFVGGFPSSKLLRSLKLEGRLISDLKENYDNYFYKGCLFGVKLMNTEFGLQDIEAIEEECRNTISIDNLLLGKFNCK            NIESVNTFKRSVRRQKRDVQTNFDLHFTGNGFAMINTSRTKNGKCATSLNKVLTISTMALPKTHPDTFQLIAVFANKIMKYGFVLGQKNNSYHFGYWKKDVDYPLFPIQN SDSFTWFIFKSKIEKLSETLFGIDEICDHNSLFYLSSIPDNDSYLIEKLKKLKVPNYGFTGKMKFLINKKPLFQVLATRFINVIFLFTEQVRENKFHSLLISPNAINPIEITEHSPNDILQNGFGFTVNFMGQPIAKTLKL TIELEAGSVNVEVSRALVFSVIVNDVKIDKELQKFNNDNLDWEAHYIVVFLEQKQSSIIVTFTVDNEDIKSQEIMINIGSVNRMTLNPSSTNNHSYYIYNLFIGQKLVNFNELNYLPPGVFLKMRPTNLQPVDIQNPRVDTDKSIPRVSYKHGQNLQRDAVALPYIKSIPLYTNSNINAPFPKHKVKTLNLYSFKSQSYPAHSAWLAGISSNVLKLDASILNQYQITENNEISLKILSGSKRPEILMSLNYGTDKILNILTFNGQLILNNPSTKWTAELPILLINEQWHTLRITSNPLNSSTGVRVYQDNHSFNFQSLGFTITFPSKVELGGFSQTNPVFSYKDKNYMLKPFTGCLDELQINNNTVSILNSGSSNSVKQCPRVLELLNSGGQILAPYAEVTSKPIQLIFEPNQKFETDYFIKFKFKYTGYESGIILTIGDGKRFCSISIKNQEIQLIYLNMINKEKAVEKVEIDKERWYKIIFVVYHQADVLTICRMSINDDKIVRLHTLADSQMFDSNYKMSNLYFGYHPGLLADTKLVSEWDKNFVGCISDVECFVGNVPVSCQFDNSEYFIRGRCSIDKNTYLLRKY
Sbjct:    9 RKCIKGFYRPWNVLATELYPCTPCQCHGLGTIGSCVSNGEDIGDQKPGDCICKKGYEGVNCDLCSIGYERYPNGECLPCPCSIDGSVRTSFYRCKPPCNCKVHVNSDDLCKTCKNGYFNLDSANPEGCEPCYCFGITNQCSSLSAKNLKISDLKGWKLTTFTGEKIALPKFTSFQYLTSENSYIDERFNNPTVYYWTAPPPYLGNWITSYGTIFRYVVKIELQSTLKGSLIDSPDVIIKCGDFRLFHSVSIEDRRLQRQVFIYIKPTEWKIGKLTPDKAATKEEFISCLVKVDKLLIKAKYYSNQKSIELLNITLSRGEVHLALDEMPHIEKCNCPPGFNGLSCESCESGYRRVNNVLYQGQCEACACYNHSNTCDSLNGECQNCTHNTAGAHCEDCASGYYGDAKSKNLNFCKKCPCPRLDYQMTELCSSYSSENYVCHKCLHNTSGVHCDRCIEGYYGNPKKKISCKRCKCNNNQESCDPVTGECRCSYNTMGTECQLCKHGFYGDALTKSCKKCDCDSLGSTSENCDKLTGECDCRTNFVNRQCDSCTSGLYLKDKKCIPCNCEIQGRISSEKFCNTTSGQCFCLESVNGDRCEKCVEGYFNYPNCKKCLCSPHALSADCDLNNGKCKCGSNVINRICDKCENLHYWNNRTDCVPCNCGRGSLNPKCDMETGNCKCAQNVARRDCSKCDVGYFGLDVTGCKKCPPCYNGQVCNNEGICVCPPNTIGNLCNKCSEDSWDFNETIGCKKCNCYINGSYSNICNKISGICACKTAFFGSKCDRCNEGYYGFPNCQPCSCAENGTKSNELTKCDKITGQCQCKQNVIGTKCKVCRKGTFPSDGTYEGGCFSCFCFGVSEKCHAILNHRIVENSIYEYHIFDEKNSLESGKDYSTIHLNANYPRRFGWPLTMFRPIYVNVMKLFNSHDLSLFYRSIFMNVSVDCLDNKCGREIPEQTEVFMESYNGLFGMRYIVNHSVSNSNNIIVDFNEHSKNGKWVISQYQNDILDKFIILEDSNVINSNLTRDIFMMALLNVTSLKVKLYTDKVNPPLIKIKIITYKVMETTQAIGKRVTAVEKCICNALTFGNHCQNPISGYYKEYFNLPNSTKSGSMRTGNRILINLKKCNCNGYSKVCDSVTGDCQNCMGNREGNKCQLCREGFYKNDKNYDQCEPCQCPSAHYNFAQNCTRIESSLELKCQCRIGYSGKSCENCQQGFYGNPIKGIPCKSCDCNQQGSQSLNCNEFGICQCSPGVLGIKCDQCAPNYVVEKKTCQSCYSGCTKDLLVRIDTLNETVINFKWKTLPSTLDLRLNKINISIQMSSELLNSINKFYKLKNEIKNFSIQFQKMKDDAKEKYGEIEKLKTRYNKILEDLRSTFTDINETISGHEQLGISNELIKNATAYLETIKNIYKEMPNITLAASVLKDVLKYVDELNQIIKYTQSHIQSDQINNLKILKNKTIMADEINTNNKEYLNTMSTKKKEHELYIILINERMKDLQKIFRKMTKQRDNLRKKIQKLDAISKSFQDEKDLISINVREIEDLMKNLSSNHLVSKSLIIPDTLKKHVEQQLNKSSNLIKKLTKDFNFLHNAEQAKEAYSNITRDILAVDYAINQTKKELDFNRSNMNIDSLKKLLAEFNSNKSEIVENIKNIDKEHEKLLKQYKNCSYNEKKLKNMNEKLSSEIPTGFYDVEILKRNLSEIQMEQNNIENNLILPINQTILNLGTPNVKSGLDTRNLEKLIKVVDNQYRDLVNESSFVENKIKDLRKSIKSLRERLQKARVMSELIHGAAARSVEPIRHVVRCVRHYVTYYLPTSNAFSLEFYMKPQILNDQSLVLFGYDDSGSIPHAFAFTLERNNQYKFWYDSGNSVESIELTGKFSNENYVGIMITWKLGKWHMVIRSISDGRTEQVETSSITNNILSNVRIGPQTNIFVGGFPSSKLLRSLKLEGRLISDLKENYDNYFYKGCLFGVKLMNTEFGLQDIEAIEEECRNTISIDNLLLGKFNCKL-----------NIESVNTFKRSVRRQKRDVQTNFDLHFTGNGFAMINTSRTKNGKCATSLNKVLTISTMALPKTHPDTFQLIAVFANKIMKYGFVLGQKNNSYHFGYWKKDVDYPLFPIQNTSDSFTWFIFKSKIEKLSETLFGIDEICDHNSLFYLSSIPDNDSYLIEKLKKLKVPNYGFTGKMKFLINKKPLFQVLATRFINVIFLFTEQVRENKFHSLLISPNAINPIEITEHSPNDILQNGFGFTVNFMGQPIAKTLKLFTIELEAGSVNVEVSRALVFSVIVNDVKIDKELQKFNNDNLDWEAHYIVVFLEQKQSSIIVTFTVDNEDIKSQEIMINIGSVNRMTLNPSSTNNHSYYIYNLFIGQKLVNFNELNYLPPGVFLKMRPTNLQPVDIQNPRVDTDKSIPRVSYKHGQNLQRDAVALPYIKSIPLYTNSNINAPFPKHKVKTLNLYSFKSQSYPAHSAWLAGISSNVLKLDASILNQYQITENNEISLKILSGSKRPEILMSLNYGTDKILNILTFNGQLILNNPSTKWTAELPILLINEQWHTLRITSNPLNSSTGVRVYQDNHSFNFQSLGFTITFPSKVELGGFSQTNPVFSYKDKNYMLKPFTGCLDELQINNNTVSILNSGSSNSVKQCPRVLELLNSGGQILAPYAEVTSKPIQLIFEPNQKFETDYFIKFKFKYTGYESGIILTIGDGKRFCSISIKNQEIQLIYLNMINKEKAVEKVEIDKERWYKIIFVVYHQADVLTICRMSINDDKIVRLHTLADSQMFDSNYKMSNLYFGYHPGLLADTKLVSEWDKNFVGCISDVECFVGNVPVSCQFDNSEYFIRGRCSIDKNTYLLRKY 2855          

HSP 2 Score: 74.3294 bits (181), Expect = 2.104e-12
Identity = 78/295 (26.44%), Postives = 114/295 (38.64%), Query Frame = 2
Query:  914 YYSLRNIEIGGKC---ICNNHADKCDKVIENGISVAKC-NCKHNTCGSNCETCCP-LFNQRPWKPVAVCEECNCNRKSNECSYNQTVATLQLSVNKMGRMEGGGVCINCQENTEGINCEKCIKGFYR-----------------------------PWNVLATE-------------LYPCTPCQCHGLGTIGSCVSNGEDIGDQKPGDCICKKGYEGVNCDLCSIGYERYPNGECLPCPCSIDGSVRTSFY--RCKPPCNCKVHVNSDDLCKTCKNGYFNLDSANPEGCEPCYC 1651
            Y  + N+   G+C    C NH++ CD +  NG    +C NC HNT G++CE C    +     K +  C++C C R      Y  T      S           VC  C  NT G++C++CI+G+Y                               +N + TE                C  C C  LG      S  E+  D+  G+C C+  +    CD C+ G     + +C+PC C I G + +  +       C C   VN D  C+ C  GYFN  +     C+ C C
Sbjct:  359 YRRVNNVLYQGQCEACACYNHSNTCDSL--NG----ECQNCTHNTAGAHCEDCASGYYGDAKSKNLNFCKKCPCPR----LDYQMTELCSSYSSENY-------VCHKCLHNTSGVHCDRCIEGYYGNPKKKISCKRCKCNNNQESCDPVTGECRCSYNTMGTECQLCKHGFYGDALTKSCKKCDCDSLG------STSENC-DKLTGECDCRTNFVNRQCDSCTSGL-YLKDKKCIPCNCEIQGRISSEKFCNTTSGQCFCLESVNGDR-CEKCVEGYFNYPN-----CKKCLC 622          

HSP 3 Score: 63.5438 bits (153), Expect = 3.956e-9
Identity = 68/266 (25.56%), Postives = 96/266 (36.09%), Query Frame = 2
Query:  947 KCICNNHADKCDKVIENGISVAKCNCKHNTCGSNCETC-CPLFNQRPWKPVAVCE----------------ECNC-----NRKSNECS---YNQTVATLQLSVNKMGRMEGGGVCIN------CQENTEGINCEKCIKGFYRPWNVLATELYP-CTPCQCHGLGTIGSCVSNGEDIGDQKPGDCICKKGYEGVNCDLCSIGYERYPNGECLPCPCSIDGSVRTSFYRCKPPCNCKVHVNSDDLCKTCKNGYFNLDSANPEGCEPCY 1648
            +C CNN+ + CD V        +C C +NT G+ C+ C    +     K    C+                EC+C     NR+ + C+   Y +    +  +    GR+     C        C E+  G  CEKC++G++          YP C  C C        C        D   G C C        CD C   +      +C+PC C   GS+          C C  +V   D C  C  GYF LD    + C PCY
Sbjct:  478 RCKCNNNQESCDPV------TGECRCSYNTMGTECQLCKHGFYGDALTKSCKKCDCDSLGSTSENCDKLTGECDCRTNFVNRQCDSCTSGLYLKDKKCIPCNCEIQGRISSEKFCNTTSGQCFCLESVNGDRCEKCVEGYFN---------YPNCKKCLCSPHALSADC--------DLNNGKCKCGSNVINRICDKCENLHYWNNRTDCVPCNCG-RGSLNPKCDMETGNCKCAQNVARRD-CSKCDVGYFGLDVTGCKKCPPCY 718          
The following BLAST results are available for this feature:
BLAST of Laminin subunit alpha-2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
LAMA16.053e-11037.90laminin subunit alpha 1 [Source:HGNC Symbol;Acc:HG... [more]
LAMA21.979e-6036.82laminin subunit alpha 2 [Source:HGNC Symbol;Acc:HG... [more]
LAMA22.118e-6036.82laminin subunit alpha 2 [Source:HGNC Symbol;Acc:HG... [more]
LAMA22.190e-6036.82laminin subunit alpha 2 [Source:HGNC Symbol;Acc:HG... [more]
LAMC11.877e-12229.75laminin subunit gamma 1 [Source:HGNC Symbol;Acc:HG... [more]
back to top
BLAST of Laminin subunit alpha-2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lam-30.000e+031.41LAMinin related. See also lmb; Laminin alpha chain... [more]
lam-21.082e-12330.78Laminin-like protein lam-2 [Source:UniProtKB/Swis... [more]
epi-16.082e-7932.80Laminin-like protein epi-1 [Source:UniProtKB/Swis... [more]
epi-16.603e-7932.80Laminin-like protein epi-1 [Source:UniProtKB/Swis... [more]
epi-16.934e-7932.80Laminin-like protein epi-1 [Source:UniProtKB/Swis... [more]
back to top
BLAST of Laminin subunit alpha-2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
wb0.000e+029.48gene:FBgn0261563 transcript:FBtr0305063[more]
wb0.000e+029.48gene:FBgn0261563 transcript:FBtr0302731[more]
LanB21.187e-11029.55gene:FBgn0267348 transcript:FBtr0345031[more]
LanB21.187e-11029.55gene:FBgn0267348 transcript:FBtr0076382[more]
LanA9.129e-8536.41gene:FBgn0002526 transcript:FBtr0077014[more]
back to top
BLAST of Laminin subunit alpha-2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lama17.408e-9834.78laminin, alpha 1 [Source:ZFIN;Acc:ZDB-GENE-060118-... [more]
CABZ01065423.12.314e-14043.67pep chromosome:GRCz11:20:1834262:1891596:1 gene:EN... [more]
lamc16.914e-12229.94laminin, gamma 1 [Source:NCBI gene;Acc:286832][more]
lamc32.238e-10229.11laminin, gamma 3 [Source:ZFIN;Acc:ZDB-GENE-060531-... [more]
lamc33.786e-10229.11laminin, gamma 3 [Source:ZFIN;Acc:ZDB-GENE-060531-... [more]
back to top
BLAST of Laminin subunit alpha-2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
LAMA10.000e+033.08laminin subunit alpha 1 [Source:NCBI gene;Acc:1004... [more]
wdcp6.737e-6338.68WD repeat and coiled coil containing [Source:Xenba... [more]
wdcp7.636e-6338.68WD repeat and coiled coil containing [Source:Xenba... [more]
wdcp4.294e-6338.59WD repeat and coiled coil containing [Source:Xenba... [more]
wdcp4.573e-9238.73WD repeat and coiled coil containing [Source:Xenba... [more]
back to top
BLAST of Laminin subunit alpha-2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5