Outer dense fiber protein 3

Overview
NameOuter dense fiber protein 3
Smed IDSMED30009782
Uniprot Best hitOuter dense fiber protein 3 OS=Xenopus tropicalis OX=8364 GN=odf3 PE=2 SV=1 (E=1.72193e-76)
Length (bp)1209
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Outer dense fiber protein 3 (SMED30009782) t-SNE clustered cells

Violin plots show distribution of expression levels for Outer dense fiber protein 3 (SMED30009782) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Outer dense fiber protein 3 (SMED30009782) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Outer dense fiber protein 3 (SMED30009782) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30009782

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30009782SMESG000038718.1 dd_Smed_v4_2658_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30009782SMESG000038718.1 dd_Smed_v4_2658_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30009782SMESG000038718.1 dd_Smed_v4_2658_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30009782SMESG000038718.1 dd_Smed_v4_2658_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
epidermal cellSMED30009782SMESG000038718.1 dd_Smed_v4_2658_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30009782SMESG000038718.1 dd_Smed_v6_2658_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30009782SMESG000038718.1 dd_Smed_v6_2658_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30009782SMESG000038718.1 dd_Smed_v4_2658_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30009782SMESG000038718.1 dd_Smed_v4_2658_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ciliated epithelial cellSMED30009782SMESG000038718.1 dd_Smed_v4_2658_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Outer dense fiber protein 3 vs. Ensembl Human
Match: ODF3 (outer dense fiber of sperm tails 3 [Source:HGNC Symbol;Acc:HGNC:19905])

HSP 1 Score: 184.111 bits (466), Expect = 3.997e-55
Identity = 109/257 (42.41%), Postives = 149/257 (57.98%), Query Frame = 3
Query:  138 TEQIEMAAVY-NIPRRPIGAMYSSPGPQYMLPGLVGTTFHDPRSVHYKSPGWSFGLRHGKYQDDSSPGPCYFPNSKLYRTGKDGSPQYSLYSRPKSLSLDYIPGPGAYKPENTIKKVYNKAPEYPFGIRHMERRTDDTPGPNVYAIDPMLCRTVRSQKPSAPMISMSSRSKIGGFHEDLQKTPGPGTYKVTDPGVFKSRYPMYSMTSRNPMPGDTTQKPGPGTYSAELVTFSRPAAPKFTFGIRHSQYKGEMIVNND 905
            TE++ M     + PR PI A+YSSPGP+Y++P   G   H P  +  ++P +SF        ++ SPGP Y  N K+ RTGKD  P YS+  R ++ ++   PGPG Y PE + K V++ AP +    R    R D TPGP  Y + PM+       K S P  S+  RSK+GGF +DL KTPGP  Y+ TD  V K + P Y+M +R   PGD T KPGPG +S E VT ++P AP  TFGI+HS Y   ++V+ +
Sbjct:    2 TEEVWMGTWRPHRPRGPIMALYSSPGPKYLIPPTTGFMKHTPTKL--RAPAYSFRGAPMLLAENCSPGPRYNVNPKILRTGKDLGPAYSILGRYQTKTM-LTPGPGDYFPEKSTKYVFDSAPSHSISARTKAFRVDSTPGPAAYML-PMVMGPNTVGKASQPSFSIKGRSKLGGFSDDLHKTPGPAAYRQTDVRVTKFKAPQYTMAARVEPPGDKTLKPGPGAHSPEKVTLTKPCAPVVTFGIKHSDYMTPLLVDVE 254          
BLAST of Outer dense fiber protein 3 vs. Ensembl Human
Match: ODF3B (outer dense fiber of sperm tails 3B [Source:HGNC Symbol;Acc:HGNC:34388])

HSP 1 Score: 156.762 bits (395), Expect = 1.164e-44
Identity = 93/245 (37.96%), Postives = 129/245 (52.65%), Query Frame = 3
Query:  174 PRRPIGAMYSSPGPQYMLPGLVGTTFHDPRSVHYKSPGWSFGLRHGKYQDDSSPGPCYFPNSKLYRTGKDGSPQYSLYSRPKSLSLDYIPGPGAYKPENTIKKVYNKAPEYPFGIRHMERRTDD-TPGPNVYAIDPMLCRTVRSQKPSAPMISMSSRSKIGGFHEDLQKTPGPGTYKVTDPGVFKSRYPMYSMTSRNPMPGDTTQKPGPGTYSAELVTFSRPAAPKFTFGIRHSQYKGEMIVNND 905
            PR PI A Y  PGP+Y LP   G   HDP     ++P ++FG R    Q    PGP +   +++   G DG+P YS+Y RP+  +    PGPG Y PE      Y  AP +    R+   + +  +PGP  Y +  +L   V   K SAP  S+  R   G F EDL KTPGP  Y+V  PGV+KSR P +++ +R  +P D T+KPGP  Y+ +     R     ++FGIRHS Y   ++ + D
Sbjct:   15 PRGPIAAHYGGPGPKYKLPPNTGYALHDPSRP--RAPAFTFGARFPTQQTTCGPGPGHLVPARMTVRGTDGAPAYSIYGRPRRSAPFLTPGPGRYFPERAGNATYPSAPRHTIAPRNWGVQAEQQSPGPAAYTVPSLLGPRVIG-KVSAPTCSIYGRRAAGSFFEDLSKTPGPCAYQVVSPGVYKSRAPQFTILARTSLPQDNTRKPGPAAYNVDQHRKPR----GWSFGIRHSDYLAPLVTDAD 252          
BLAST of Outer dense fiber protein 3 vs. Ensembl Human
Match: ODF3B (outer dense fiber of sperm tails 3B [Source:HGNC Symbol;Acc:HGNC:34388])

HSP 1 Score: 156.762 bits (395), Expect = 1.164e-44
Identity = 93/245 (37.96%), Postives = 129/245 (52.65%), Query Frame = 3
Query:  174 PRRPIGAMYSSPGPQYMLPGLVGTTFHDPRSVHYKSPGWSFGLRHGKYQDDSSPGPCYFPNSKLYRTGKDGSPQYSLYSRPKSLSLDYIPGPGAYKPENTIKKVYNKAPEYPFGIRHMERRTDD-TPGPNVYAIDPMLCRTVRSQKPSAPMISMSSRSKIGGFHEDLQKTPGPGTYKVTDPGVFKSRYPMYSMTSRNPMPGDTTQKPGPGTYSAELVTFSRPAAPKFTFGIRHSQYKGEMIVNND 905
            PR PI A Y  PGP+Y LP   G   HDP     ++P ++FG R    Q    PGP +   +++   G DG+P YS+Y RP+  +    PGPG Y PE      Y  AP +    R+   + +  +PGP  Y +  +L   V   K SAP  S+  R   G F EDL KTPGP  Y+V  PGV+KSR P +++ +R  +P D T+KPGP  Y+ +     R     ++FGIRHS Y   ++ + D
Sbjct:   15 PRGPIAAHYGGPGPKYKLPPNTGYALHDPSRP--RAPAFTFGARFPTQQTTCGPGPGHLVPARMTVRGTDGAPAYSIYGRPRRSAPFLTPGPGRYFPERAGNATYPSAPRHTIAPRNWGVQAEQQSPGPAAYTVPSLLGPRVIG-KVSAPTCSIYGRRAAGSFFEDLSKTPGPCAYQVVSPGVYKSRAPQFTILARTSLPQDNTRKPGPAAYNVDQHRKPR----GWSFGIRHSDYLAPLVTDAD 252          
BLAST of Outer dense fiber protein 3 vs. Ensembl Human
Match: ODF3L1 (outer dense fiber of sperm tails 3 like 1 [Source:HGNC Symbol;Acc:HGNC:28735])

HSP 1 Score: 125.946 bits (315), Expect = 6.953e-33
Identity = 82/241 (34.02%), Postives = 120/241 (49.79%), Query Frame = 3
Query:  186 IGAMYSSPGP-QYMLPGLVGTTFHDPRSVHYKSPGWSFGLRHGKYQ--DDSSPGPCYFPNSKLYRTGKDGSPQYSLYSRPKSLSLDYIPGPGAYKPENTIKKVYNKAPEYPFGIRHMERRTDDTPGPNVYAIDPMLCRTVRSQKPSAPMISMSSRSKIGGFHEDLQKTPGPGTYKVTDPGVFKSRYPMYSMTSRNPMPGDTTQKPGPGTYSAELVTFSRPAAPKFTFGIRHSQYKGEMIVN 899
            I A    PGP +Y+ P   G   HD     +K+P ++   RH + +    SSPGPCY  + K+ R G    PQ  +  R  +L L+       Y  E        +AP+Y FG R   R  D  P PN Y + P+L         +AP  S++SR K   + ED+   PGP TY   +P ++++R P YSM  R   P D T +PGPG++  + VT  +P  P FT GI+HS +   ++++
Sbjct:   34 IMAKIKGPGPAKYLRPSCTGYIDHD--ISMFKAPAYTLHSRHSEKRMVCHSSPGPCYLLDPKITRFGMSSCPQVPMEERISNLRLNPTLASCQYYFEKIHPPGERRAPQYTFGYRRPYRVMDLNPAPNQYQM-PLLLGPNTPVSRAAPCYSLASRDKNWFYKEDVAGGPGPTTYARPEPSIYQNRSPTYSMAKRFAYPLDLTPRPGPGSHEVQQVTVHKPHIPAFTMGIKHSLHLCPLVID 271          
BLAST of Outer dense fiber protein 3 vs. Ensembl Human
Match: ODF3 (outer dense fiber of sperm tails 3 [Source:HGNC Symbol;Acc:HGNC:19905])

HSP 1 Score: 120.939 bits (302), Expect = 1.193e-31
Identity = 85/257 (33.07%), Postives = 120/257 (46.69%), Query Frame = 3
Query:  138 TEQIEMAAVY-NIPRRPIGAMYSSPGPQYMLPGLVGTTFHDPRSVHYKSPGWSFGLRHGKYQDDSSPGPCYFPNSKLYRTGKDGSPQYSLYSRPKSLSLDYIPGPGAYKPENTIKKVYNKAPEYPFGIRHMERRTDDTPGPNVYAIDPMLCRTVRSQKPSAPMISMSSRSKIGGFHEDLQKTPGPGTYKVTDPGVFKSRYPMYSMTSRNPMPGDTTQKPGPGTYSAELVTFSRPAAPKFTFGIRHSQYKGEMIVNND 905
            TE++ M     + PR PI A+YSSPGP+Y++P   G   H P  +  ++P +SF        ++ SPGP Y  N K+ RTGKD  P YS+  R ++ ++   PGPG Y PE + K V++ AP +    R    R D TPGP  Y + PM+       K S P  S+  RSK+GGF +DL K                                               VT ++P AP  TFGI+HS Y   ++V+ +
Sbjct:    2 TEEVWMGTWRPHRPRGPIMALYSSPGPKYLIPPTTGFMKHTPTKL--RAPAYSFRGAPMLLAENCSPGPRYNVNPKILRTGKDLGPAYSILGRYQTKTM-LTPGPGDYFPEKSTKYVFDSAPSHSISARTKAFRVDSTPGPAAYML-PMVMGPNTVGKASQPSFSIKGRSKLGGFSDDLHK-----------------------------------------------VTLTKPCAPVVTFGIKHSDYMTPLLVDVE 207          
BLAST of Outer dense fiber protein 3 vs. Ensembl Fly
Match: CG8086 (gene:FBgn0032010 transcript:FBtr0332362)

HSP 1 Score: 107.457 bits (267), Expect = 1.799e-26
Identity = 83/240 (34.58%), Postives = 119/240 (49.58%), Query Frame = 3
Query:  186 IGAMYSSPGPQYM-LPGLVGTTFHDPRSVHYKSPGWSFGLRHGKYQDDSSPGPCYFPNSKLYRTGKDGSPQYSLYSRPKSLSLDYIPGPGAYKPENTIKKVYNKAPEYPFGIRHMERRTDDTPGPNVYAIDPMLCRTVRSQKPSAPMISMSSRSKIGGFHEDLQKTPGPGTYKVTDPGVFKSRYPMYSMTSRNPMPGDTTQKPGPGTYSAELVTFSRPAAPKFTFGIRHSQYKGEMIVNN 902
            I A  ++PGP  + LP L+G+    P S    +P +SFG + G   D S PGP  +  + +   G+D     +L SRPK L+    PGPG Y      K V +  P+Y FG R +  +T   P PNVY I  ++  +   +  SAP  +++ R K       +   PGPG Y   +  V K + P++SM  +  M G    KPGPG +  E V  S    P ++FGI+HSQY G +   N
Sbjct:   19 IAAETTNPGPATVQLPTLIGSKV--PDSKKKAAPSYSFGHKLGGKYDTSGPGPAQYNVTGMRAKGRDYPRAATLQSRPKELTRFSNPGPGEYDVVPAAKAVIDATPKYTFGQRPVALKTFQIPAPNVYKIPTVMGSSKEGKIRSAPAYTITGREKPPLI--PVMIFPGPGYYD-GEYTVVKPKPPVFSMRGKYKM-GSEDSKPGPGAHCPEKVNLSH--VPAYSFGIKHSQYLGRLNEKN 250          
BLAST of Outer dense fiber protein 3 vs. Ensembl Fly
Match: CG10252 (gene:FBgn0039104 transcript:FBtr0084475)

HSP 1 Score: 98.9821 bits (245), Expect = 9.797e-24
Identity = 87/247 (35.22%), Postives = 114/247 (46.15%), Query Frame = 3
Query:  180 RPIGAMYSSPGPQ-YMLPGLVGTTFHDPRSVHYKSPGWSFGLRHGKYQDDSSPGPCYFPNSKLYRTGKDGSPQYSLYSRPKSLSLDYIPGPGAYKPENTIKKVYNKAPEYPFGIRHMERRTDDTPGPNVYAIDPMLCRTVRSQKPSAPMISMSSRSKIGGFHEDLQKT--PGPGTYKVTDPGVFKSRYPMYSMTSRNPMPGDTTQKPGPGTYSAELVTFSRP--AAPKFTFGIRHSQYKGEMIVNND 905
            RP G     PGP  YMLP  VG   HD R    + P +SFG+R     +D  PGP  +   KL R G     ++S+  R   +     PGPGA+   N        AP Y  G+R       D PGPN Y  +      V + +P  P  SM  ++KI      L KT  PGP  Y   D  V  +R P+YSM  R  +PG+    PGP  Y    + + RP  + P ++FG+RH Q+   MIV  D
Sbjct:    4 RPFG-----PGPGVYMLPPTVGYDKHDNRK--QRLPQYSFGMRTRAPGEDLGPGPGAYKVDKLTRYGTSKGLEFSMAPRTNVIDKRSSPGPGAHDVHNRPFFKGVNAPSYSMGLRTDFNFKKDGPGPNAYKYE------VNAVRPGVPSYSMGLQTKI------LNKTNSPGPAAYGGGDINVKLTRAPIYSMQPRTTIPGENV-GPGPNYYD---LMYYRPGKSGPGYSFGVRHHQFAPPMIVRCD 227          
BLAST of Outer dense fiber protein 3 vs. Ensembl Fly
Match: CG8086 (gene:FBgn0032010 transcript:FBtr0079620)

HSP 1 Score: 95.5153 bits (236), Expect = 4.965e-22
Identity = 79/232 (34.05%), Postives = 113/232 (48.71%), Query Frame = 3
Query:  186 IGAMYSSPGPQYM-LPGLVGTTFHDPRSVHYKSPGWSFGLRHGKYQDDSSPGPCYFPNSKLYRTGKDGSPQYSLYSRPKSLSLDYIPGPGAYKPENTIKKVYNKAPEYPFGIRHMERRTDDTPGPNVYAIDPMLCRTVRSQKPSAPMISMSSRSKIGGFHEDLQKTPGPGTYKVTDPGVFKSRYPMYSMTSRNPMPGDTTQKPGPGTYSAELVTFSRPAAPKFTFGIRHSQY 878
            I A  ++PGP  + LP L+G+   D  S    +P +SFG + G   D S PGP  +  + +   G+D     +L SRPK L+    PGPG Y      K V +  P+Y FG R +  +T   P PNVY I  ++  +   +  SAP  +++ R K       +   PGPG Y   +  V K + P++SM  +  M G    KPGPG +  E     R + P  +FGI HS Y
Sbjct:   19 IAAETTNPGPATVQLPTLIGSKVPD--SKKKAAPSYSFGHKLGGKYDTSGPGPAQYNVTGMRAKGRDYPRAATLQSRPKELTRFSNPGPGEYDVVPAAKAVIDATPKYTFGQRPVALKTFQIPAPNVYKIPTVMGSSKEGKIRSAPAYTITGREKPPLI--PVMIFPGPGYYD-GEYTVVKPKPPVFSMRGKYKM-GSEDSKPGPGAHCPEKYWEKR-SPPAISFGILHSPY 243          
BLAST of Outer dense fiber protein 3 vs. Ensembl Fly
Match: CG8086 (gene:FBgn0032010 transcript:FBtr0079621)

HSP 1 Score: 95.1301 bits (235), Expect = 8.685e-22
Identity = 79/232 (34.05%), Postives = 113/232 (48.71%), Query Frame = 3
Query:  186 IGAMYSSPGPQYM-LPGLVGTTFHDPRSVHYKSPGWSFGLRHGKYQDDSSPGPCYFPNSKLYRTGKDGSPQYSLYSRPKSLSLDYIPGPGAYKPENTIKKVYNKAPEYPFGIRHMERRTDDTPGPNVYAIDPMLCRTVRSQKPSAPMISMSSRSKIGGFHEDLQKTPGPGTYKVTDPGVFKSRYPMYSMTSRNPMPGDTTQKPGPGTYSAELVTFSRPAAPKFTFGIRHSQY 878
            I A  ++PGP  + LP L+G+   D  S    +P +SFG + G   D S PGP  +  + +   G+D     +L SRPK L+    PGPG Y      K V +  P+Y FG R +  +T   P PNVY I  ++  +   +  SAP  +++ R K       +   PGPG Y   +  V K + P++SM  +  M G    KPGPG +  E     R + P  +FGI HS Y
Sbjct:   45 IAAETTNPGPATVQLPTLIGSKVPD--SKKKAAPSYSFGHKLGGKYDTSGPGPAQYNVTGMRAKGRDYPRAATLQSRPKELTRFSNPGPGEYDVVPAAKAVIDATPKYTFGQRPVALKTFQIPAPNVYKIPTVMGSSKEGKIRSAPAYTITGREKPPLI--PVMIFPGPGYYD-GEYTVVKPKPPVFSMRGKYKM-GSEDSKPGPGAHCPEKYWEKR-SPPAISFGILHSPY 269          
BLAST of Outer dense fiber protein 3 vs. Ensembl Fly
Match: CG8086 (gene:FBgn0032010 transcript:FBtr0332360)

HSP 1 Score: 91.2781 bits (225), Expect = 2.064e-19
Identity = 83/268 (30.97%), Postives = 117/268 (43.66%), Query Frame = 3
Query:  168 NIPRRP---------IGAMYSSPGPQYM-LPGLVGTTFHDPRSVHYKSPGWSFGLRHGKYQDDSSPGPCYFPNSKLYRTGKDGSPQYSLYSRPKSLSLDYIPGPGAYKPENTIKKVYNKAPEYPFGIRHMERRTDDTPGPNVYAIDPMLCRTVRSQKPSAPMISMSSRSKIGGFHEDLQKTPGPGTYKVTDPGVFKSRYPMYSMTSRNPMPGDTTQKPGPGTYSAELVTFSRPAAPKFTFGIRHSQ-----------YKGEMIVNNDI 908
            N+ +RP         I A  ++PGP  + LP L+G+    P S    +P +SFG + G   D S PGP  +  + +   G+D     +L SRPK L+    PGPG Y      K V +  P+Y FG R +  +T   PGPN Y + P+     R     AP  S   R K+  +   L   P P +Y        K   P Y+   R  +  D    P PG Y  E V  ++   P+F+FGI+H +           YK E +V   I
Sbjct:   30 NVEQRPWTPTVRIGKIAAETTNPGPATVQLPTLIGSKV--PDSKKKAAPSYSFGHKLGGKYDTSGPGPAQYNVTGMRAKGRDYPRAATLQSRPKELTRFSNPGPGEYDVVPAAKAVIDATPKYTFGQRPVALKTFQIPGPNYYQVVPLDVVKRR-----APRYSF--RIKVNVY---LVNNPAPNSYCPEKVTQSKKNAPRYTFGRRTKIEHDQGT-PAPGAYCPEKVKLNK--TPEFSFGIKHHEQRPDYTPAPGTYKPEQVVLEHI 282          

HSP 2 Score: 70.4774 bits (171), Expect = 1.419e-12
Identity = 74/247 (29.96%), Postives = 108/247 (43.72%), Query Frame = 3
Query:  147 IEMAAVYNIPRRPIG-AMYSSPGPQY--MLPGLVGTTFHDPRSVHYKSPGWSFGLRHGKYQDDSSPGPCYFPNSKLYRTGKDGSPQYSLYSRPKSLSLDYIPGPGAYKPENTIKKVYNKAPEYPFGIRHMERRTDDTPGPNVYAIDPMLCRTVRSQKPSAPMISMSSRSKIGGFHEDLQKTPGPGTYKVTDPGVFKSRY---PMYSMTSRNPMPGDTTQ-KPGPGTYSAELVTFSRPAAPKFTFGIR 866
            I+    Y   +RP+    +  PGP Y  ++P  V         V  ++P +SF ++   Y  ++ P P  +   K+ ++ K+ +P+Y+   R K       P PGAY PE   K   NK PE+ FGI+H E+R D TP P  Y  + ++   +       P  S   ++K    H  +  TP PG Y        KSR    P YS+  +     D     P PG Y  E    SR   P F+FG R
Sbjct:  144 IDATPKYTFGQRPVALKTFQIPGPNYYQVVPLDV---------VKRRAPRYSFRIKVNVYLVNN-PAPNSYCPEKVTQSKKN-APRYTFGRRTKIEHDQGTPAPGAYCPE---KVKLNKTPEFSFGIKHHEQRPDYTPAPGTYKPEQVVLEHI-------PAYSFGLKTK----HIQVSDTPAPGAYSPE-----KSRLHSAPAYSIAGKASQ--DVVDCTPAPGAYEPEKCVLSR--TPAFSFGHR 356          

HSP 3 Score: 64.6994 bits (156), Expect = 8.959e-11
Identity = 60/208 (28.85%), Postives = 90/208 (43.27%), Query Frame = 3
Query:  261 RSVHYKSPGWSFGLRHGKYQDDSSPGPCYFPNSKLYRTGKDGSPQYSLYSRPKSLSLDYIPGPGAYKPENTIKKVYNKAPEYPFGIRHMERRTDDTPGPNVYAIDPMLCRTVRSQKPSAPMISMSSRSKIGGFHEDLQK---TPGPGTYKVTDPGVFKSRYPMYSMTSRNPMPGDTTQKPGPGTYSAELVTFSRPAAPKFTFGIRHSQ 875
            + V  ++P +SFG R    +   +P P  +   K+     D +P ++L  RP++ S+   P PG+Y PE   K   ++ P + FG +H +R    TP P  Y   P   R   +     P  S + R        DL K   TP PG Y      V +   P +S   R+ +    ++ P PG YS E V       P F+   +HSQ
Sbjct:  342 KCVLSRTPAFSFGHRAELAKSSDTPAPGTYNPEKVRL---DHTPAFTLSGRPETRSVSETPAPGSYAPE---KYRNDRTPAFTFGGKHEQRLESSTPAPGDYC--PEKVRHDHN-----PAFSFAGR-------HDLHKPSDTPAPGAYDTEK--VRQDHNPAFSFAGRHDL-HKPSETPAPGAYSPEKVRQDH--NPAFSMAGKHSQ 524          

HSP 4 Score: 53.9138 bits (128), Expect = 2.254e-7
Identity = 56/202 (27.72%), Postives = 81/202 (40.10%), Query Frame = 3
Query:  279 SPGWSFGLRHGKYQDDSSPGP-CYFPNSKLYRTGKDGSPQYSLYSRPKSLSLDYIPGPGAYKPENTIKKVYNKAPEYPFGIRHMERRTDDTPGPNVYAIDPMLCRTVRSQKPSAPMISMSSRSKIGGFHEDLQKTPGPGTYKVTDPGVFKSRYPMYSMTSRNPMPGDTTQKPGPGTYSAELVTFSRPAAPKFTFGIRHSQYK 881
            +P +SF  RH   + D++P P  YFP     +   D +P +S+  +  +   +  P PG Y PE   K   +  P Y F  RH   +  +TP P  Y+  P   R   +     P  +M+ +       + L  TP PG Y      +     P YS   +N  P      P PG Y  E V       P ++F  RH   K
Sbjct:  579 NPAYSFAGRHDLQKPDNTPAPGAYFPE----KVRLDHNPAFSMAGKYDAKVTNDTPAPGDYSPE---KVRQDTNPAYSFAGRHDLHKPSETPAPGAYS--PEKVRLDHN-----PAFTMAGKHD----QKILNGTPAPGDYSPEKCRL--DHTPAYSFGGKN-DPKVENNTPAPGDYHPEKVRLDH--NPAYSFAGRHDLQK 757          

HSP 5 Score: 51.2174 bits (121), Expect = 1.471e-6
Identity = 51/201 (25.37%), Postives = 85/201 (42.29%), Query Frame = 3
Query:  279 SPGWSFGLRHGKYQDDSSPGPCYFPNSKLYRTGKDGSPQYSLYSRPKSLSLDYIPGPGAYKPENTIKKVYNKAPEYPFGIRHMERRTDDTPGPNVYAIDPMLCRTVRSQKPSAPMISMSSRSKIGGFHEDLQKTPGPGTYKVTDPGVFKSRYPMYSMTSRNPMPGDTTQKPGPGTYSAELVTFSRPAAPKFTFGIRHSQYK 881
            +P +SF  RH  ++   +P P  +   K+    +D +P +S+  +      +  P PG Y PE   K   +  P + FG ++  +  ++TP P  Y  +       + ++   P  S + R  +   +E    TP PG Y      V +   P ++M  ++  P  T   P PG Y  E V       P F+F  RH  +K
Sbjct: 1041 NPAFSFAGRHDLHKPSDTPAPGAYSPEKVR---QDHNPAFSMAGKYIEKITNGTPAPGDYCPE---KVRLDHTPAFTFGGKNDPKVENNTPAPGDYHPE-------KVRQDHVPAFSFAGRHDLHKPNE----TPAPGAYSPEK--VRQDHNPAFTMAGKH-DPKVTHDTPAPGDYHPEKVRLDH--NPAFSFAGRHDLHK 1219          

HSP 6 Score: 50.8322 bits (120), Expect = 1.859e-6
Identity = 55/200 (27.50%), Postives = 87/200 (43.50%), Query Frame = 3
Query:  279 SPGWSFGLRHGKYQDDSSPGPCYFPNSKLYRTGKDGSPQYSLYSRPKSLSLDYIPGPGAYKPENTIKKVYNKAPEYPFGIRHMERRTDDTPGPNVYAIDPMLCRTVRSQKPSAPMISMSSRSKIGGFHEDLQK---TPGPGTYKVTDPGVFKSRYPMYSMTSRNPMPGDTTQKPGPGTYSAELVTFSRPAAPKFTFGIRH 869
            +P ++FG ++    ++++P P  +   K+    +D  P +S   R      +  P PGAY PE  +++ +N  P +    +H  + T DTP P  Y   P   R   +     P  S + R        DL K   TP PG Y      V +   P ++   ++  P   ++ P PG YS E V      AP F+FG +H
Sbjct: 1107 TPAFTFGGKNDPKVENNTPAPGDYHPEKVR---QDHVPAFSFAGRHDLHKPNETPAPGAYSPEK-VRQDHN--PAFTMAGKHDPKVTHDTPAPGDY--HPEKVRLDHN-----PAFSFAGR-------HDLHKPSETPAPGDYFPEK--VRQDFNPAFTFAGKH-DPRSLSESPAPGDYSPEKVRLDH--APAFSFGGKH 1281          

HSP 7 Score: 50.0618 bits (118), Expect = 3.785e-6
Identity = 57/204 (27.94%), Postives = 83/204 (40.69%), Query Frame = 3
Query:  279 SPGWSFGLRHGKYQDDSSPGPCYFPNSKLYRTGKDGSPQYSLYSRPKSLSLDYIPGPGAYKPENTIKKVYNKAPEYPFGIRHMERRTDDTPGPNVYAIDPMLCRTVRSQKPSAPMISMSSRSKIGGFHEDLQK---TPGPGTYKVTDPGVFKSRYPMYSMTSRNPMPGDTTQKPGPGTYSAELVTFSRPAAPKFTFGIRHSQYK 881
            +P +SF  RH  ++   +P P  +   K+    +D +P +S+  +         P PG Y PE   K   +  P Y FG++   +  ++TP P  Y   P   R   +     P  S + R        DLQK   TP PG Y      V     P +SM  +      T   P PG YS E V   +   P ++F  RH  +K
Sbjct:  480 NPAFSFAGRHDLHKPSETPAPGAYSPEKVR---QDHNPAFSMAGKHSQKVTSDSPAPGDYCPE---KVRLDHTPAYSFGVKSDPKVENNTPAPGDY--HPEKVRQDHN-----PAYSFAGR-------HDLQKPDNTPAPGAYFPEK--VRLDHNPAFSMAGKYDA-KVTNDTPAPGDYSPEKV--RQDTNPAYSFAGRHDLHK 658          

HSP 8 Score: 49.6766 bits (117), Expect = 4.022e-6
Identity = 55/198 (27.78%), Postives = 82/198 (41.41%), Query Frame = 3
Query:  279 SPGWSFGLRHGKYQDDSSPGP-CYFPNSKLYRTGKDGSPQYSLYSRPKSLSLDYIPGPGAYKPENTIKKVYNKAPEYPFGIRHMERRTDDTPGPNVYAIDPMLCRTVRSQKPSAPMISMSSRSKIGGFHEDLQK---TPGPGTYKVTDPGVFKSRYPMYSMTSRNPMPGDTTQKPGPGTYSAELVTFSRPAAPKFTFG 860
            +P +SF  RH  ++ + +P P  Y P     +  +D +P +S+  +      +  P PG Y PE   K   +  P Y FG ++  +   +TP P  Y   P   R   +     P  S + R        +LQK   TP PG Y      V +   P ++M  ++  P  +   P PG YS E V       P FTF 
Sbjct:  843 NPAFSFAGRHDLHKPNDTPAPGAYCPE----KVRQDHNPAFSMAGKYTQKVANDTPAPGDYSPE---KVRLDHTPAYTFGGKNDPKVESNTPAPGDY--HPEKVRQDHN-----PAFSFAGR-------HNLQKPSDTPAPGAYSPEK--VRQDHNPAFTMAGKH-DPKVSNDTPAPGDYSPEKVRLDY--TPSFTFA 1014          

HSP 9 Score: 49.6766 bits (117), Expect = 5.126e-6
Identity = 36/132 (27.27%), Postives = 52/132 (39.39%), Query Frame = 3
Query:  216 QYMLPGLVGTTFHDPRSVHYK---------------SPGWSFGLRHGKYQDDSSPGPCYFPNSKLYRTGKDGSPQYSLYSRPKSLSLDYIPGPGAYKPENTIKKVYNKAPEYPFGIRHMERRTDDTPGPNVY 566
            Q   P       HDPRS+                  +P +SFG +H    +   P PC +   K+     D +P Y++  RP +  +   P P  Y PE       +  P + FG+R    R  DTP P+ Y
Sbjct: 1236 QDFNPAFTFAGKHDPRSLSESPAPGDYSPEKVRLDHAPAFSFGGKHDPKTEHLHPAPCDYAPEKVRL---DHTPAYTIAGRPAADHVSQTPAPCDYHPEQC---QVDSTPAFTFGMRLGRERISDTPAPSAY 1361          
BLAST of Outer dense fiber protein 3 vs. Ensembl Zebrafish
Match: odf3b (outer dense fiber of sperm tails 3B [Source:NCBI gene;Acc:335524])

HSP 1 Score: 236.884 bits (603), Expect = 8.337e-76
Identity = 126/244 (51.64%), Postives = 153/244 (62.70%), Query Frame = 3
Query:  174 PRRPIGAMYSSPGPQYMLPGLVGTTFHDPRSVHYKSPGWSFGLRHGKYQDDSSPGPCYFPNSKLYRTGKDGSPQYSLYSRPKSLSLDYIPGPGAYKPENTIKKVYNKAPEYPFGIRHMERRTDDTPGPNVYAIDPMLCRTVRSQKPSAPMISMSSRSKIGGFHEDLQKTPGPGTYKVTDPGVFKSRYPMYSMTSRNPMPGDTTQKPGPGTYSAELVTFSRPAAPKFTFGIRHSQYKGEMIVNND 905
            PR PI AMY+SPGP Y LPG  G   HDPR    K P +SFG+RH  +  + SPGP Y   S + R G+DG+P YS+Y R K +     PGPG+Y PEN  K  Y   P +    R    R D TPGP  Y + P+L   V   K SAP +S S RS IG FHEDL+KTPGPGTY+V DP V+K + P YSMT RN MPGD T+KPGPG +  E+V F+R  AP F+FGIRHS+Y    IV+ +
Sbjct:   16 PRGPIAAMYNSPGPTYALPGATGMNNHDPRM--QKGPAFSFGIRHHNFHGNYSPGPGYLVPSNITRVGRDGTPAYSVYGRRKDIQPFQTPGPGSYSPENATKATYLSPPAFTLSARTKLFRNDQTPGPAAYMLPPVLGPKV-VNKTSAPNVSFSGRSAIGSFHEDLRKTPGPGTYQVVDPCVYKHKGPQYSMTGRNMMPGDMTKKPGPGAHYPEMVCFTRAKAPSFSFGIRHSEYVAPTIVDGE 256          
BLAST of Outer dense fiber protein 3 vs. Ensembl Zebrafish
Match: odf3b (tripartite motif containing 35-30 [Source:ZFIN;Acc:ZDB-GENE-060503-557])

HSP 1 Score: 236.884 bits (603), Expect = 8.337e-76
Identity = 126/244 (51.64%), Postives = 153/244 (62.70%), Query Frame = 3
Query:  174 PRRPIGAMYSSPGPQYMLPGLVGTTFHDPRSVHYKSPGWSFGLRHGKYQDDSSPGPCYFPNSKLYRTGKDGSPQYSLYSRPKSLSLDYIPGPGAYKPENTIKKVYNKAPEYPFGIRHMERRTDDTPGPNVYAIDPMLCRTVRSQKPSAPMISMSSRSKIGGFHEDLQKTPGPGTYKVTDPGVFKSRYPMYSMTSRNPMPGDTTQKPGPGTYSAELVTFSRPAAPKFTFGIRHSQYKGEMIVNND 905
            PR PI AMY+SPGP Y LPG  G   HDPR    K P +SFG+RH  +  + SPGP Y   S + R G+DG+P YS+Y R K +     PGPG+Y PEN  K  Y   P +    R    R D TPGP  Y + P+L   V   K SAP +S S RS IG FHEDL+KTPGPGTY+V DP V+K + P YSMT RN MPGD T+KPGPG +  E+V F+R  AP F+FGIRHS+Y    IV+ +
Sbjct:   16 PRGPIAAMYNSPGPTYALPGATGMNNHDPRM--QKGPAFSFGIRHHNFHGNYSPGPGYLVPSNITRVGRDGTPAYSVYGRRKDIQPFQTPGPGSYSPENATKATYLSPPAFTLSARTKLFRNDQTPGPAAYMLPPVLGPKV-VNKTSAPNVSFSGRSAIGSFHEDLRKTPGPGTYQVVDPCVYKHKGPQYSMTGRNMMPGDMTKKPGPGAHYPEMVCFTRAKAPSFSFGIRHSEYVAPTIVDGE 256          
BLAST of Outer dense fiber protein 3 vs. Ensembl Zebrafish
Match: odf3b (tripartite motif containing 35-30 [Source:ZFIN;Acc:ZDB-GENE-060503-557])

HSP 1 Score: 236.884 bits (603), Expect = 8.337e-76
Identity = 126/244 (51.64%), Postives = 153/244 (62.70%), Query Frame = 3
Query:  174 PRRPIGAMYSSPGPQYMLPGLVGTTFHDPRSVHYKSPGWSFGLRHGKYQDDSSPGPCYFPNSKLYRTGKDGSPQYSLYSRPKSLSLDYIPGPGAYKPENTIKKVYNKAPEYPFGIRHMERRTDDTPGPNVYAIDPMLCRTVRSQKPSAPMISMSSRSKIGGFHEDLQKTPGPGTYKVTDPGVFKSRYPMYSMTSRNPMPGDTTQKPGPGTYSAELVTFSRPAAPKFTFGIRHSQYKGEMIVNND 905
            PR PI AMY+SPGP Y LPG  G   HDPR    K P +SFG+RH  +  + SPGP Y   S + R G+DG+P YS+Y R K +     PGPG+Y PEN  K  Y   P +    R    R D TPGP  Y + P+L   V   K SAP +S S RS IG FHEDL+KTPGPGTY+V DP V+K + P YSMT RN MPGD T+KPGPG +  E+V F+R  AP F+FGIRHS+Y    IV+ +
Sbjct:   16 PRGPIAAMYNSPGPTYALPGATGMNNHDPRM--QKGPAFSFGIRHHNFHGNYSPGPGYLVPSNITRVGRDGTPAYSVYGRRKDIQPFQTPGPGSYSPENATKATYLSPPAFTLSARTKLFRNDQTPGPAAYMLPPVLGPKV-VNKTSAPNVSFSGRSAIGSFHEDLRKTPGPGTYQVVDPCVYKHKGPQYSMTGRNMMPGDMTKKPGPGAHYPEMVCFTRAKAPSFSFGIRHSEYVAPTIVDGE 256          
BLAST of Outer dense fiber protein 3 vs. Ensembl Zebrafish
Match: odf3b (outer dense fiber of sperm tails 3B [Source:NCBI gene;Acc:335524])

HSP 1 Score: 236.498 bits (602), Expect = 1.370e-75
Identity = 126/244 (51.64%), Postives = 153/244 (62.70%), Query Frame = 3
Query:  174 PRRPIGAMYSSPGPQYMLPGLVGTTFHDPRSVHYKSPGWSFGLRHGKYQDDSSPGPCYFPNSKLYRTGKDGSPQYSLYSRPKSLSLDYIPGPGAYKPENTIKKVYNKAPEYPFGIRHMERRTDDTPGPNVYAIDPMLCRTVRSQKPSAPMISMSSRSKIGGFHEDLQKTPGPGTYKVTDPGVFKSRYPMYSMTSRNPMPGDTTQKPGPGTYSAELVTFSRPAAPKFTFGIRHSQYKGEMIVNND 905
            PR PI AMY+SPGP Y LPG  G   HDPR    K P +SFG+RH  +  + SPGP Y   S + R G+DG+P YS+Y R K +     PGPG+Y PEN  K  Y   P +    R    R D TPGP  Y + P+L   V   K SAP +S S RS IG FHEDL+KTPGPGTY+V DP V+K + P YSMT RN MPGD T+KPGPG +  E+V F+R  AP F+FGIRHS+Y    IV+ +
Sbjct:   16 PRGPIAAMYNSPGPTYALPGATGMNNHDPRM--QKGPAFSFGIRHHNFHGNYSPGPGYLVPSNITRVGRDGTPAYSVYGRRKDIQPFQTPGPGSYSPENATKVTYLSPPAFTLSARTKLFRNDQTPGPAAYMLPPVLGPKV-VNKTSAPNVSFSGRSAIGSFHEDLRKTPGPGTYQVVDPCVYKHKGPQYSMTGRNMMPGDMTKKPGPGAHYPEMVCFTRAKAPSFSFGIRHSEYIAPTIVDGE 256          
BLAST of Outer dense fiber protein 3 vs. Ensembl Zebrafish
Match: odf3l2a (outer dense fiber of sperm tails 3-like 2a [Source:ZFIN;Acc:ZDB-GENE-050417-380])

HSP 1 Score: 161.384 bits (407), Expect = 1.108e-46
Identity = 108/254 (42.52%), Postives = 140/254 (55.12%), Query Frame = 3
Query:  153 MAAVYNIPRRPIGAMYSSPGP-QYMLPGLVGTTFHDPRSVHYKSPGWSFGLRHGK--YQDDSSPGPCYFPNSKLYRTGKDGSPQYSLYSRPKSLSLDY-IPGPGAYKPENTI-KKVYNKAPEYPFGIRHMERRTDDTPGPNVYAIDPMLCRTVRSQKPSAPMISMSSRSKIGGFHEDLQKTPGPGTYKVTDPGVFKSRYPMYSMTSRNPMPGDTTQKPGPGTYSAELVTFSRPAAPKFTFGIRHSQYKGEMIVN 899
            MA V    R  I      PGP +Y LP  +G   HD       SP +SF  R        DSSPGP Y  ++K+ R G+DG+P YS+  R K  +  +  PGPGAY PE      ++++ P Y    R   R  D  P PN Y + P L  T  S KPS+P  +MS+R K GG  EDL  TPGPG Y  TDP V+ +R P +SM SR+ +  D+T KPGPGTYS+E VT   P AP  + G+RHS++   +IV+
Sbjct:    1 MAEVERRRRPIIAGRERGPGPGRYALPPTIGYINHD--YTKPSSPAYSFHSRMSSNMVSVDSSPGPRYRVDAKMTRFGRDGTPSYSMLGRRKRTASTFQTPGPGAYSPEKAPPLNLHHRPPSYTMSSRTRYRSVDPVPAPNRYTL-PNLFGTTVSCKPSSPCFTMSARMKAGGPSEDLSMTPGPGRYNSTDPSVYLNRQPSFSMQSRHNILIDSTGKPGPGTYSSEKVTAHLPRAPSVSLGVRHSEFVTPLIVD 251          
BLAST of Outer dense fiber protein 3 vs. Ensembl Xenopus
Match: scml2 (Scm polycomb group protein like 2 [Source:Xenbase;Acc:XB-GENE-6043728])

HSP 1 Score: 240.736 bits (613), Expect = 3.250e-77
Identity = 130/242 (53.72%), Postives = 155/242 (64.05%), Query Frame = 3
Query:  174 PRRPIGAMYSSPGPQYMLPGLVGTTFHDPRSVHYKSPGWSFGLRHGKYQDDSSPGPCYFPNSKLYRTGKDGSPQYSLYSRPKSLSLDYIPGPGAYKPENTIKKVYNKAPEYPFGIRHMERRTDDTPGPNVYAIDPMLCRTVRSQKPSAPMISMSSRSKIGGFHEDLQKTPGPGTYKVTDPGVFKSRYPMYSMTSRNPMPGDTTQKPGPGTYSAELVTFSRPAAPKFTFGIRHSQYKGEMIVN 899
            PR PI A+YSSPGP+Y LPG  G   HDP    Y++P +S G R  K+ DD SPGP Y   S +   GKDG+P YS+Y RPK +S    PGPG+Y PE   K  Y  AP Y  G R      D TPGP  Y +  ++   +   + SAP  SM+ RSKIG FHEDLQ+TPGPGTY+V DPG +K R P YSMT+RN +PGDTT KPGPG YS E V  SRP AP F+FGIRHS Y   +IV+
Sbjct:   15 PRGPIAALYSSPGPKYSLPGNTGFVSHDPS--RYRAPAYSMGNRRFKFVDDCSPGPGYLVPSNITVKGKDGTPAYSIYGRPKDISSFRTPGPGSYSPERAGKSAYRSAPTYSLGERTKTFSNDQTPGPAAYVLPSVIGPRI-VNRISAPNYSMTGRSKIGSFHEDLQRTPGPGTYRVIDPGSYKHRPPQYSMTARNVLPGDTTIKPGPGAYSPEKVVMSRPQAPNFSFGIRHSDYVAPLIVD 253          
BLAST of Outer dense fiber protein 3 vs. Ensembl Xenopus
Match: ODF3L2 (outer dense fiber of sperm tails 3-like 1 [Source:NCBI gene;Acc:100487571])

HSP 1 Score: 143.665 bits (361), Expect = 1.014e-39
Identity = 93/245 (37.96%), Postives = 127/245 (51.84%), Query Frame = 3
Query:  186 IGAMYSSPGP-QYMLPGLVGTTFHDPRSVHYKSPGWSFGLR--HGKYQDDSSPGPCYFPNSKLYRTGKDGSPQYSLYSRPKSLSL-DYIPGPGAYKPENTIKKVYNKAPEYPFGIRHMERRTDDTPGPNVYAIDPMLCRTVRSQKPSAPMISMSSRSKIGGFHEDLQKTPGPGTYKVTDPGVFKSRYPMYSMTSRNPMPGDTTQKPGPGTYSAELVTFSRPAAPKFTFGIRHSQYKGEMIVNNDI 908
            I A  + PGP +Y LP  VG   HD     + SP +SF  R  +  +  DSSPGP Y+ ++ L R G+   P YS+ +R +S    + IPGPG Y PE        K P Y  G R   R  D  P PN Y++ P+L     + K  AP  ++S + + GG  EDL  TPGP  Y+ TDP  +  R P +SM  R+P      + PGPG+Y  E V   +  AP ++ GIRHS+Y   +I+   I
Sbjct:   12 IAAKVTGPGPGRYNLPPTVGFVSHD--YTKFSSPAYSFHGRPSNSAHVSDSSPGPRYYVDASLTRFGRSAGPSYSMLARGRSADKKNDIPGPGTYSPEKCTVPTQRKFPSYSMGSRTRYRSMDRVPAPNSYSLPPVLGPRA-TAKVCAPAFTLSGKYQHGGHSEDLSGTPGPAHYQQTDPSRYLKRGPAFSMQGRHPNSKAEQKTPGPGSYYPEKVNQHKRHAPAYSMGIRHSEYTAPLIIEVPI 253          
BLAST of Outer dense fiber protein 3 vs. Ensembl Mouse
Match: Odf3 (outer dense fiber of sperm tails 3 [Source:MGI Symbol;Acc:MGI:1916537])

HSP 1 Score: 176.792 bits (447), Expect = 1.439e-52
Identity = 103/244 (42.21%), Postives = 141/244 (57.79%), Query Frame = 3
Query:  174 PRRPIGAMYSSPGPQYMLPGLVGTTFHDPRSVHYKSPGWSFGLRHGKYQDDSSPGPCYFPNSKLYRTGKDGSPQYSLYSRPKSLSLDYIPGPGAYKPENTIKKVYNKAPEYPFGIRHMERRTDDTPGPNVYAIDPMLCRTVRSQKPSAPMISMSSRSKIGGFHEDLQKTPGPGTYKVTDPGVFKSRYPMYSMTSRNPMPGDTTQKPGPGTYSAELVTFSRPAAPKFTFGIRHSQYKGEMIVNND 905
            PR PI A+YSSPGP+Y++P   G   H P  +  ++P +SF        ++ SPGP Y  N K+ +TGKD  P YS+  R  + +L   PGPG Y PE + K V++ AP +    R    R D TPGP  Y + P++       K S P  S+  RSK+G F +DL KTPGP  Y+ T+  V K + P Y+M +R   PGD T KPGPG +S E VT ++P AP  TFGI+HS Y   ++V+ +
Sbjct:   15 PRGPIMALYSSPGPKYLIPPTTGFVKHTPTKL--RAPAYSFRGAPMLLAENCSPGPRYSVNPKILKTGKDLGPAYSILGRYHTKTL-LTPGPGDYFPEKSTKYVFDSAPSHSISARTKTFRVDSTPGPAAYML-PVVMGPHTVGKVSQPSFSIKGRSKLGSFSDDLHKTPGPAAYRQTEVQVTKFKAPQYTMAARVEPPGDKTLKPGPGAHSPEKVTLNKPCAPTVTFGIKHSDYMTPLVVDVE 254          
BLAST of Outer dense fiber protein 3 vs. Ensembl Mouse
Match: Odf3 (outer dense fiber of sperm tails 3 [Source:MGI Symbol;Acc:MGI:1916537])

HSP 1 Score: 176.792 bits (447), Expect = 2.996e-52
Identity = 103/244 (42.21%), Postives = 141/244 (57.79%), Query Frame = 3
Query:  174 PRRPIGAMYSSPGPQYMLPGLVGTTFHDPRSVHYKSPGWSFGLRHGKYQDDSSPGPCYFPNSKLYRTGKDGSPQYSLYSRPKSLSLDYIPGPGAYKPENTIKKVYNKAPEYPFGIRHMERRTDDTPGPNVYAIDPMLCRTVRSQKPSAPMISMSSRSKIGGFHEDLQKTPGPGTYKVTDPGVFKSRYPMYSMTSRNPMPGDTTQKPGPGTYSAELVTFSRPAAPKFTFGIRHSQYKGEMIVNND 905
            PR PI A+YSSPGP+Y++P   G   H P  +  ++P +SF        ++ SPGP Y  N K+ +TGKD  P YS+  R  + +L   PGPG Y PE + K V++ AP +    R    R D TPGP  Y + P++       K S P  S+  RSK+G F +DL KTPGP  Y+ T+  V K + P Y+M +R   PGD T KPGPG +S E VT ++P AP  TFGI+HS Y   ++V+ +
Sbjct:   41 PRGPIMALYSSPGPKYLIPPTTGFVKHTPTKL--RAPAYSFRGAPMLLAENCSPGPRYSVNPKILKTGKDLGPAYSILGRYHTKTL-LTPGPGDYFPEKSTKYVFDSAPSHSISARTKTFRVDSTPGPAAYML-PVVMGPHTVGKVSQPSFSIKGRSKLGSFSDDLHKTPGPAAYRQTEVQVTKFKAPQYTMAARVEPPGDKTLKPGPGAHSPEKVTLNKPCAPTVTFGIKHSDYMTPLVVDVE 280          
BLAST of Outer dense fiber protein 3 vs. Ensembl Mouse
Match: Odf3b (outer dense fiber of sperm tails 3B [Source:MGI Symbol;Acc:MGI:1917363])

HSP 1 Score: 144.821 bits (364), Expect = 2.540e-40
Identity = 94/241 (39.00%), Postives = 125/241 (51.87%), Query Frame = 3
Query:  174 PRRPIGAMYSSPGPQYMLPGLVGTTFHDPRSVHYKSPGWSFGLRHGKYQDDSSPGPCYFPNSKLYRTGKDGSPQYSLYSRPKSLSLDYIPGPGAYKPENTIKKVYNKAPEYPFGIRHME-RRTDDTPGPNVYAIDPMLCRTVRSQKPSAPMISMSSRSKIGGFHEDLQKTPGPGTYKVTDPGVFKSRYPMYSMTSRNPMPGDTTQKPGPGTYSAELVTFSRPAAPKFTFGIRHSQYKGEMI 893
            PR PI A+Y  PGP+Y LP   G   HDP     ++P +SFG R         PGP Y   +++   G  GSP +S+Y R    +    PGPG Y PE      Y  AP +    R+       +TPGP  Y +  +L   V S K SAP  S+ SRS +G   EDL KTPGP  Y V +P ++K+R P ++M  R   P + T+KPGP +YS +     +P    ++FGIRHS Y   MI
Sbjct:   15 PRGPIAALYRGPGPKYKLPTNTGYKLHDPSRP--RAPAFSFGSRPPLRHATCGPGPSYLVPARMTVRGTVGSPAFSIYGRLSHTAPVLTPGPGRYYPERARNVTYPSAPRHTIAPRNWGILAKQETPGPGSYTVPSLLGSRVIS-KVSAPTYSIYSRSPVGSCFEDLSKTPGPCAYHVVNPMIYKTRAPQFTMLGRTLPPRENTKKPGPASYSVD--KHRKPCG--WSFGIRHSDYLAPMI 248          
BLAST of Outer dense fiber protein 3 vs. Ensembl Mouse
Match: Odf3b (outer dense fiber of sperm tails 3B [Source:MGI Symbol;Acc:MGI:1917363])

HSP 1 Score: 138.272 bits (347), Expect = 5.014e-38
Identity = 87/221 (39.37%), Postives = 116/221 (52.49%), Query Frame = 3
Query:  174 PRRPIGAMYSSPGPQYMLPGLVGTTFHDPRSVHYKSPGWSFGLRHGKYQDDSSPGPCYFPNSKLYRTGKDGSPQYSLYSRPKSLSLDYIPGPGAYKPENTIKKVYNKAPEYPFGIRHME-RRTDDTPGPNVYAIDPMLCRTVRSQKPSAPMISMSSRSKIGGFHEDLQKTPGPGTYKVTDPGVFKSRYPMYSMTSRNPMPGDTTQKPGPGTYSAELVTFSR 833
            PR PI A+Y  PGP+Y LP   G   HDP     ++P +SFG R         PGP Y   +++   G  GSP +S+Y R    +    PGPG Y PE      Y  AP +    R+       +TPGP  Y +  +L   V S K SAP  S+ SRS +G   EDL KTPGP  Y V +P ++K+R P ++M  R   P + T+KPGP +YS + V +SR
Sbjct:   15 PRGPIAALYRGPGPKYKLPTNTGYKLHDPS--RPRAPAFSFGSRPPLRHATCGPGPSYLVPARMTVRGTVGSPAFSIYGRLSHTAPVLTPGPGRYYPERARNVTYPSAPRHTIAPRNWGILAKQETPGPGSYTVPSLLGSRVIS-KVSAPTYSIYSRSPVGSCFEDLSKTPGPCAYHVVNPMIYKTRAPQFTMLGRTLPPRENTKKPGPASYSVDKVVWSR 232          
BLAST of Outer dense fiber protein 3 vs. Ensembl Mouse
Match: Odf3l2 (outer dense fiber of sperm tails 3-like 2 [Source:MGI Symbol;Acc:MGI:2686003])

HSP 1 Score: 129.028 bits (323), Expect = 3.430e-34
Identity = 85/239 (35.56%), Postives = 119/239 (49.79%), Query Frame = 3
Query:  186 IGAMYSSPGP-QYMLPGLVGTTFHDPRSVHYKSPGWSFGLRHGKY-QDDSSPGPCYFPNSKLYRTGKDGSPQYSLYSRPKSLSLDYIPGPGAYKPENTIKKVYNKAPEYPFGIRHMERRTDDT-PGPNVYAIDPMLCRTVRSQKPSAPMISMSSRSKIGGFHEDLQKTPGPGTYKVTDPGVFKSRYPMYSMTSRNPMPGDTTQKPGPGTYSAELVTFSRPAAPKFTFGIRHSQYKGEMI 893
            I  + +  GP  Y+LP  VG   HD       SP +S   R  +    DSSPGP YF + K+ R G+   P YS+  R K   L+  PGPGAY PE         AP +  G R  ++  D + P PN Y + P+    +   KPS+P  ++  R+      +D  + PGPG Y+  DP  ++ R P +S+  R   P      PGPGT++ E VT +R  AP +T GIRHS+    M+
Sbjct:   37 IATLENGSGPGLYVLPSTVGYVNHD--CTKAASPAYSLARRPSEAPLQDSSPGPVYFLDPKVTRFGRSCPPAYSMQGRAKVRGLEVTPGPGAYSPEKAPPVRQRNAPAFTLGSRLRQKPPDTSVPAPNAYTMPPLWGSQI-FIKPSSPSYTVVGRTPPARPPQDPSEIPGPGQYESPDPNTYRQRRPAFSILGRPRTPRPLEDTPGPGTHNPEQVTVNRARAPAYTMGIRHSKRASTMV 272          
BLAST of Outer dense fiber protein 3 vs. UniProt
Match: sp|Q5EB30|ODF3A_XENTR (Outer dense fiber protein 3 OS=Xenopus tropicalis OX=8364 GN=odf3 PE=2 SV=1)

HSP 1 Score: 240.736 bits (613), Expect = 1.722e-76
Identity = 130/242 (53.72%), Postives = 155/242 (64.05%), Query Frame = 3
Query:  174 PRRPIGAMYSSPGPQYMLPGLVGTTFHDPRSVHYKSPGWSFGLRHGKYQDDSSPGPCYFPNSKLYRTGKDGSPQYSLYSRPKSLSLDYIPGPGAYKPENTIKKVYNKAPEYPFGIRHMERRTDDTPGPNVYAIDPMLCRTVRSQKPSAPMISMSSRSKIGGFHEDLQKTPGPGTYKVTDPGVFKSRYPMYSMTSRNPMPGDTTQKPGPGTYSAELVTFSRPAAPKFTFGIRHSQYKGEMIVN 899
            PR PI A+YSSPGP+Y LPG  G   HDP    Y++P +S G R  K+ DD SPGP Y   S +   GKDG+P YS+Y RPK +S    PGPG+Y PE   K  Y  AP Y  G R      D TPGP  Y +  ++   +   + SAP  SM+ RSKIG FHEDLQ+TPGPGTY+V DPG +K R P YSMT+RN +PGDTT KPGPG YS E V  SRP AP F+FGIRHS Y   +IV+
Sbjct:   15 PRGPIAALYSSPGPKYSLPGNTGFVSHDPS--RYRAPAYSMGNRRFKFVDDCSPGPGYLVPSNITVKGKDGTPAYSIYGRPKDISSFRTPGPGSYSPERAGKSAYRSAPTYSLGERTKTFSNDQTPGPAAYVLPSVIGPRI-VNRISAPNYSMTGRSKIGSFHEDLQRTPGPGTYRVIDPGSYKHRPPQYSMTARNVLPGDTTIKPGPGAYSPEKVVMSRPQAPNFSFGIRHSDYVAPLIVD 253          
BLAST of Outer dense fiber protein 3 vs. UniProt
Match: sp|A3KQA5|ODF3B_DANRE (Outer dense fiber protein 3-B OS=Danio rerio OX=7955 GN=odf3b PE=2 SV=2)

HSP 1 Score: 236.884 bits (603), Expect = 6.294e-75
Identity = 126/244 (51.64%), Postives = 153/244 (62.70%), Query Frame = 3
Query:  174 PRRPIGAMYSSPGPQYMLPGLVGTTFHDPRSVHYKSPGWSFGLRHGKYQDDSSPGPCYFPNSKLYRTGKDGSPQYSLYSRPKSLSLDYIPGPGAYKPENTIKKVYNKAPEYPFGIRHMERRTDDTPGPNVYAIDPMLCRTVRSQKPSAPMISMSSRSKIGGFHEDLQKTPGPGTYKVTDPGVFKSRYPMYSMTSRNPMPGDTTQKPGPGTYSAELVTFSRPAAPKFTFGIRHSQYKGEMIVNND 905
            PR PI AMY+SPGP Y LPG  G   HDPR    K P +SFG+RH  +  + SPGP Y   S + R G+DG+P YS+Y R K +     PGPG+Y PEN  K  Y   P +    R    R D TPGP  Y + P+L   V   K SAP +S S RS IG FHEDL+KTPGPGTY+V DP V+K + P YSMT RN MPGD T+KPGPG +  E+V F+R  AP F+FGIRHS+Y    IV+ +
Sbjct:   16 PRGPIAAMYNSPGPTYALPGATGMNNHDPRM--QKGPAFSFGIRHHNFHGNYSPGPGYLVPSNITRVGRDGTPAYSVYGRRKDIQPFQTPGPGSYSPENATKATYLSPPAFTLSARTKLFRNDQTPGPAAYMLPPVLGPKV-VNKTSAPNVSFSGRSAIGSFHEDLRKTPGPGTYQVVDPCVYKHKGPQYSMTGRNMMPGDMTKKPGPGAHYPEMVCFTRAKAPSFSFGIRHSEYVAPTIVDGE 256          
BLAST of Outer dense fiber protein 3 vs. UniProt
Match: sp|Q8AVY1|ODF3A_XENLA (Outer dense fiber protein 3 OS=Xenopus laevis OX=8355 GN=odf3 PE=2 SV=1)

HSP 1 Score: 233.032 bits (593), Expect = 2.107e-73
Identity = 126/242 (52.07%), Postives = 154/242 (63.64%), Query Frame = 3
Query:  174 PRRPIGAMYSSPGPQYMLPGLVGTTFHDPRSVHYKSPGWSFGLRHGKYQDDSSPGPCYFPNSKLYRTGKDGSPQYSLYSRPKSLSLDYIPGPGAYKPENTIKKVYNKAPEYPFGIRHMERRTDDTPGPNVYAIDPMLCRTVRSQKPSAPMISMSSRSKIGGFHEDLQKTPGPGTYKVTDPGVFKSRYPMYSMTSRNPMPGDTTQKPGPGTYSAELVTFSRPAAPKFTFGIRHSQYKGEMIVN 899
            PR PI A YSSPGP+Y LPG  G   HDP    +++P +S G R  K  DD SPGP Y   S +   GKDG+P YS+Y RP+ +S    PGPG+Y PE   K  Y  AP Y  G R      D TPGP  Y +  ++   + ++  SAP  SM+ RSKIG FHEDLQKTPGPGTY+V DPG +K + P YSMT+RN +PGDTT KPGPG YS E V  S+  AP F+FGIRHS+Y   +IV+
Sbjct:   15 PRGPIAAFYSSPGPKYSLPGNTGFVSHDPS--RHRAPAYSMGNRRFKLVDDCSPGPGYLVPSNITVKGKDGTPAYSIYGRPRDISSFRTPGPGSYSPERAGKSAYRSAPTYSLGERTKTFGNDQTPGPAAYMLPSVIGPRIVNRS-SAPNYSMTGRSKIGSFHEDLQKTPGPGTYRVIDPGTYKHKPPQYSMTARNVLPGDTTIKPGPGAYSPEKVVMSKAQAPNFSFGIRHSEYVAPLIVD 253          
BLAST of Outer dense fiber protein 3 vs. UniProt
Match: sp|Q96PU9|ODF3A_HUMAN (Outer dense fiber protein 3 OS=Homo sapiens OX=9606 GN=ODF3 PE=1 SV=1)

HSP 1 Score: 184.111 bits (466), Expect = 1.919e-54
Identity = 109/257 (42.41%), Postives = 149/257 (57.98%), Query Frame = 3
Query:  138 TEQIEMAAVY-NIPRRPIGAMYSSPGPQYMLPGLVGTTFHDPRSVHYKSPGWSFGLRHGKYQDDSSPGPCYFPNSKLYRTGKDGSPQYSLYSRPKSLSLDYIPGPGAYKPENTIKKVYNKAPEYPFGIRHMERRTDDTPGPNVYAIDPMLCRTVRSQKPSAPMISMSSRSKIGGFHEDLQKTPGPGTYKVTDPGVFKSRYPMYSMTSRNPMPGDTTQKPGPGTYSAELVTFSRPAAPKFTFGIRHSQYKGEMIVNND 905
            TE++ M     + PR PI A+YSSPGP+Y++P   G   H P  +  ++P +SF        ++ SPGP Y  N K+ RTGKD  P YS+  R ++ ++   PGPG Y PE + K V++ AP +    R    R D TPGP  Y + PM+       K S P  S+  RSK+GGF +DL KTPGP  Y+ TD  V K + P Y+M +R   PGD T KPGPG +S E VT ++P AP  TFGI+HS Y   ++V+ +
Sbjct:    2 TEEVWMGTWRPHRPRGPIMALYSSPGPKYLIPPTTGFMKHTPTKL--RAPAYSFRGAPMLLAENCSPGPRYNVNPKILRTGKDLGPAYSILGRYQTKTM-LTPGPGDYFPEKSTKYVFDSAPSHSISARTKAFRVDSTPGPAAYML-PMVMGPNTVGKASQPSFSIKGRSKLGGFSDDLHKTPGPAAYRQTDVRVTKFKAPQYTMAARVEPPGDKTLKPGPGAHSPEKVTLTKPCAPVVTFGIKHSDYMTPLLVDVE 254          
BLAST of Outer dense fiber protein 3 vs. UniProt
Match: sp|Q2TBH0|ODF3A_BOVIN (Outer dense fiber protein 3 OS=Bos taurus OX=9913 GN=ODF3 PE=2 SV=1)

HSP 1 Score: 178.333 bits (451), Expect = 2.743e-52
Identity = 105/244 (43.03%), Postives = 139/244 (56.97%), Query Frame = 3
Query:  174 PRRPIGAMYSSPGPQYMLPGLVGTTFHDPRSVHYKSPGWSFGLRHGKYQDDSSPGPCYFPNSKLYRTGKDGSPQYSLYSRPKSLSLDYIPGPGAYKPENTIKKVYNKAPEYPFGIRHMERRTDDTPGPNVYAIDPMLCRTVRSQKPSAPMISMSSRSKIGGFHEDLQKTPGPGTYKVTDPGVFKSRYPMYSMTSRNPMPGDTTQKPGPGTYSAELVTFSRPAAPKFTFGIRHSQYKGEMIVNND 905
            PR PI A+YSSPGP+Y++P   G     P  +  ++P +SF        ++ SPGP Y  N K+ RTGKD  P YS+  R  + +    PGPG Y PE + K V++ AP +    R    R D TPGP  Y + PM+       K S P  S+  RSK+G F +DL KTPGP  Y+ TD  V K + P Y+M +R   PGD T KPGPG +S E VT +RP AP  +FGI+HS Y   ++V+ D
Sbjct:   15 PRGPIMALYSSPGPKYLIPPTTGFVKQTPTKL--RAPAYSFRGAPMLLAENCSPGPRYSVNPKILRTGKDLGPAYSILGRYHTKT-TLTPGPGDYFPEKSTKHVFDSAPSHSISARTKTFRVDSTPGPAAYML-PMVMGPHTIGKVSQPSFSIKGRSKLGSFSDDLHKTPGPAAYRQTDVQVTKFKAPQYTMAARVEPPGDKTLKPGPGAHSPEKVTMTRPCAPVVSFGIKHSDYMTPLVVDVD 254          
BLAST of Outer dense fiber protein 3 vs. TrEMBL
Match: gnl|BL_ORD_ID|15788274 (tr|A0A267GHA7|A0A267GHA7_9PLAT Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig006571g1 PE=4 SV=1)

HSP 1 Score: 330.487 bits (846), Expect = 3.272e-109
Identity = 162/255 (63.53%), Postives = 197/255 (77.25%), Query Frame = 3
Query:  156 AAVYNI--PRRPIGAMYSSPGPQYMLPGLVGTTFHDPRSVHYKSPGWSFGLRHGKYQDDSSPGPCYFPNSKLYRTGKDGSPQYSLYSRPKSLSLDYIPGPGAYKPENTIKKVYNKAPEYPFGIRHMERRTDDTPGPNVYAIDPMLCRTVRSQKPSAPMISMSSRSKIGGFHEDLQKTPGPGTYKVTDPGVFKSRYPMYSMTSRNPMPGDTTQKPGPGTYSAE-LVTFSRPAAPKFTFGIRHSQYKGEMIVNNDID 911
            A VYN   PR P+ AMYSSPGP+Y LPGLVG   HDPRSVH + P + FG+RHGK+ DDSSPGPCY P ++++R GKDG+PQYSLY RPK  ++   PGPGAYK +NT K++Y+KAP Y FG+RHME RTD+TPGPN Y  DPM+ +T+RS+K SAP  S++ RSKIGGFHEDLQKTPGPG Y VT PG +K+  P YSMTSRN MPGD+T KPGPG +S E    F+R +AP  +FGIRHSQYKGE I + D++
Sbjct:    1 AMVYNYTKPRGPVAAMYSSPGPKYGLPGLVGQPHHDPRSVHNRGPAYQFGMRHGKFSDDSSPGPCYLPGARIFRDGKDGTPQYSLYGRPKDGTMFSAPGPGAYKTDNTNKEIYSKAPAYSFGVRHMEFRTDNTPGPNAYTPDPMMGKTLRSEKKSAPAASLTGRSKIGGFHEDLQKTPGPGAYSVTSPGKYKNSPPAYSMTSRNAMPGDSTTKPGPGAHSPEPGYNFTRKSAPSCSFGIRHSQYKGESITDADLE 255          
BLAST of Outer dense fiber protein 3 vs. TrEMBL
Match: gnl|BL_ORD_ID|15801871 (tr|A0A1I8IAV2|A0A1I8IAV2_9PLAT Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig006551g1 PE=4 SV=1)

HSP 1 Score: 329.331 bits (843), Expect = 1.194e-108
Identity = 159/254 (62.60%), Postives = 195/254 (76.77%), Query Frame = 3
Query:  153 MAAVYNIPRRPIGAMYSSPGPQYMLPGLVGTTFHDPRSVHYKSPGWSFGLRHGKYQDDSSPGPCYFPNSKLYRTGKDGSPQYSLYSRPKSLSLDYIPGPGAYKPENTIKKVYNKAPEYPFGIRHMERRTDDTPGPNVYAIDPMLCRTVRSQKPSAPMISMSSRSKIGGFHEDLQKTPGPGTYKVTDPGVFKSRYPMYSMTSRNPMPGDTTQKPGPGTYSAE-LVTFSRPAAPKFTFGIRHSQYKGEMIVNNDID 911
            M   Y  PR P+ AMYSSPGP+Y LPGLVG   HDPRSVH + P + FG+RHGK+ DDSSPGPCY P ++++R GKDG+PQYSLY RPK  ++   PGPGAYK +NT K++Y+KAP Y FG+RHME RTD+TPGPN Y  DPM+ +T+RS+K SAP  S++ RSKIGGFHEDLQKTPGPG Y VT PG +K+  P +SMTSRN MPGD+T KPGPG +S E    F+R +AP  +FGIRHSQYKGE I + D++
Sbjct:    1 MVYNYTKPRGPVAAMYSSPGPKYGLPGLVGQPHHDPRSVHNRGPAYQFGMRHGKFSDDSSPGPCYLPGARIFRDGKDGTPQYSLYGRPKDGTMFSAPGPGAYKTDNTNKEIYSKAPAYSFGVRHMEFRTDNTPGPNAYTPDPMMGKTLRSEKKSAPAASLTGRSKIGGFHEDLQKTPGPGAYSVTSPGKYKNSPPAFSMTSRNAMPGDSTTKPGPGAHSPEPGYNFTRKSAPSCSFGIRHSQYKGESITDADLE 254          
BLAST of Outer dense fiber protein 3 vs. TrEMBL
Match: gnl|BL_ORD_ID|18309809 (tr|A0A267EQJ8|A0A267EQJ8_9PLAT Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig023580g1 PE=4 SV=1)

HSP 1 Score: 324.709 bits (831), Expect = 5.840e-107
Identity = 157/253 (62.06%), Postives = 194/253 (76.68%), Query Frame = 3
Query:  153 MAAVYNIPRRPIGAMYSSPGPQYMLPGLVGTTFHDPRSVHYKSPGWSFGLRHGKYQDDSSPGPCYFPNSKLYRTGKDGSPQYSLYSRPKSLSLDYIPGPGAYKPENTIKKVYNKAPEYPFGIRHMERRTDDTPGPNVYAIDPMLCRTVRSQKPSAPMISMSSRSKIGGFHEDLQKTPGPGTYKVTDPGVFKSRYPMYSMTSRNPMPGDTTQKPGPGTYSAELVTF-SRPAAPKFTFGIRHSQYKGEMIVNNDI 908
            M   Y  PR P+ AMYSSPGP+Y LPGLVG   HDPRSVH + P + FG+RHGK++DDSSPGPCY P ++++R GKDG+PQYSLY RPK  ++   PGPGAYK +NT K++Y+KAP Y FG+RHME RTD+TPGPN Y  DPML +T+RS+K +AP  ++  RSK+GGFHEDLQ+TPGPG Y VT PG +KS  P YSMTSRNPMPGD+T KPGPG +S E   + ++   P F+FGIRHSQYKGE I + D+
Sbjct:    1 MVYNYTKPRGPVAAMYSSPGPKYGLPGLVGQPHHDPRSVHTRGPAYPFGIRHGKFRDDSSPGPCYLPGARIFRDGKDGTPQYSLYGRPKDGTMFSAPGPGAYKTDNTNKEIYSKAPAYSFGVRHMEFRTDNTPGPNAYTPDPMLGKTLRSEKKAAPSYTLVGRSKVGGFHEDLQRTPGPGAYSVTSPGKYKSTPPAYSMTSRNPMPGDSTTKPGPGAHSPETGYYKTKRGTPAFSFGIRHSQYKGESITDADL 253          
BLAST of Outer dense fiber protein 3 vs. TrEMBL
Match: gnl|BL_ORD_ID|18222849 (tr|A0A1I8H174|A0A1I8H174_9PLAT Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 323.939 bits (829), Expect = 1.528e-106
Identity = 159/256 (62.11%), Postives = 193/256 (75.39%), Query Frame = 3
Query:  147 IEMAAVYNI--PRRPIGAMYSSPGPQYMLPGLVGTTFHDPRSVHYKSPGWSFGLRHGKYQDDSSPGPCYFPNSKLYRTGKDGSPQYSLYSRPKSLSLDYIPGPGAYKPENTIKKVYNKAPEYPFGIRHMERRTDDTPGPNVYAIDPMLCRTVRSQKPSAPMISMSSRSKIGGFHEDLQKTPGPGTYKVTDPGVFKSRYPMYSMTSRNPMPGDTTQKPGPGTYSAELVTFSRPAAPKFTFGIRHSQYKGEMIVNNDI 908
               A VYN   PR P+ AMYSSPGP+Y LPGLVG   HDPRSVH + P + FG+RHGK++DDSSPGPCY P ++++R GKDG+PQYSLY RPK  ++   PGPGAYK +NT K++Y+KAP Y FG+RHME RTD+TPGPN Y  DPML +T+RS+K +AP  ++  RSK+GGFHEDLQ+TPGPG Y VT PG +KS  P YSMTSRN MPGD+T KPGPG +S E      PA   F+FGIRHSQYKGE I + D+
Sbjct:    3 TNAAMVYNYTKPRGPVAAMYSSPGPKYGLPGLVGQPHHDPRSVHTRGPAYPFGIRHGKFRDDSSPGPCYLPGARIFRDGKDGTPQYSLYGRPKDGTMFSAPGPGAYKTDNTNKEIYSKAPAYSFGVRHMEFRTDNTPGPNAYTPDPMLGKTLRSEKKAAPSYTLVGRSKVGGFHEDLQRTPGPGAYSVTSPGKYKSTPPAYSMTSRNSMPGDSTTKPGPGAHSPETTKRGTPA---FSFGIRHSQYKGESITDADL 255          
BLAST of Outer dense fiber protein 3 vs. TrEMBL
Match: gnl|BL_ORD_ID|18338999 (tr|A0A267F4K0|A0A267F4K0_9PLAT Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig024012g1 PE=4 SV=1)

HSP 1 Score: 322.398 bits (825), Expect = 6.009e-106
Identity = 156/253 (61.66%), Postives = 193/253 (76.28%), Query Frame = 3
Query:  153 MAAVYNIPRRPIGAMYSSPGPQYMLPGLVGTTFHDPRSVHYKSPGWSFGLRHGKYQDDSSPGPCYFPNSKLYRTGKDGSPQYSLYSRPKSLSLDYIPGPGAYKPENTIKKVYNKAPEYPFGIRHMERRTDDTPGPNVYAIDPMLCRTVRSQKPSAPMISMSSRSKIGGFHEDLQKTPGPGTYKVTDPGVFKSRYPMYSMTSRNPMPGDTTQKPGPGTYSAELVTF-SRPAAPKFTFGIRHSQYKGEMIVNNDI 908
            M   Y  PR P+ AMYSSPGP+Y LPGLVG   HDPRSVH + P + FG+RHGK++DDSSPGPCY P ++++R GKDG+PQYSLY RPK  ++   PGPGAYK +NT K++Y+KAP Y FG+RHME RTD+TPGPN Y  DPML +T+RS+K +AP  ++  RSK+GGFHEDLQ+TPGPG Y VT PG +KS  P YSMTSRN MPGD+T KPGPG +S E   + ++   P F+FGIRHSQYKGE I + D+
Sbjct:    1 MVYNYTKPRGPVAAMYSSPGPKYGLPGLVGQPHHDPRSVHTRGPAYPFGIRHGKFRDDSSPGPCYLPGARIFRDGKDGTPQYSLYGRPKDGTMFSAPGPGAYKTDNTNKEIYSKAPAYSFGVRHMEFRTDNTPGPNAYTPDPMLGKTLRSEKKAAPSYTLVGRSKVGGFHEDLQRTPGPGAYSVTSPGKYKSTPPAYSMTSRNSMPGDSTTKPGPGAHSPETGYYKTKRGTPAFSFGIRHSQYKGESITDADL 253          
BLAST of Outer dense fiber protein 3 vs. Ensembl Cavefish
Match: odf3b (outer dense fiber of sperm tails 3B [Source:NCBI gene;Acc:103032435])

HSP 1 Score: 225.328 bits (573), Expect = 1.988e-71
Identity = 121/243 (49.79%), Postives = 152/243 (62.55%), Query Frame = 3
Query:  174 PRRPIGAMYSSPGPQYMLPGLVGTTFHDPRSVHYKSPGWSFGLRHGKYQDDSSPGPCYFPNSKLYRTGKDGSPQYSLYSRPKSLSLDYIPGPGAYKPENTIKKVYNKAPEYPFGIRHMERRTDDTPGPNVYAIDPMLCRTVRSQKPSAPMISMSSRSKIGGFHEDLQKTPGPGTYKVTDPGVFKSRYPMYSMTSRNPMPGDTTQKPGPGTYSAELVTFSRPAAPKFTFGIRHSQYKGEMIVNN 902
            PR PI A+Y SPGP+Y LP + G   HDPR    K+P +SFG RH ++    SPGP +   S + + G+DG+P YSLYSRP+       PGPG Y PE + K  +  AP Y    R    R D +PGP  Y +  ++     S++ SAP  S S R K+G FHEDLQKTP PGTY V DP ++  R P YSMT RN MPGDTT+KPGPGTY  E VTF+R  AP F+FGIRHS+Y    I+++
Sbjct:   16 PRGPIAALYRSPGPKYGLPAVTGINDHDPRK--RKAPAFSFGTRHKQFSLSCSPGPGHLVPSNITKVGRDGTPAYSLYSRPRDPKPFQTPGPGKYSPEISGKTTFYSAPAYSLSGRSNGYRRDQSPGPAAYMLPNVMGSNTVSKR-SAPNFSFSGRLKVGSFHEDLQKTPAPGTYSVVDPNIYTPRSPHYSMTGRNMMPGDTTKKPGPGTYCPEQVTFTRLKAPSFSFGIRHSEYTAPPIIDD 255          
BLAST of Outer dense fiber protein 3 vs. Ensembl Cavefish
Match: odf3l2b (outer dense fiber protein 3-like protein 2 [Source:NCBI gene;Acc:103025199])

HSP 1 Score: 149.058 bits (375), Expect = 5.264e-42
Identity = 102/251 (40.64%), Postives = 137/251 (54.58%), Query Frame = 3
Query:  177 RRPIGA-MYSSPGP-QYMLPGLVGTTFHDPRSVHYKSPGWSFGLRHGK-----YQDDSSPGPCYFPNSKLYRTGKDGSPQYSLYSR-PKSLSLDYIPGPGAYKPENT-IKKVYNKAPEYPFGIRHMERRTDDTPGPNVYAIDPMLCRTVRSQKPSAPMISMSSRSKIGGFHEDLQKTPGPGTYKVTDPGVFKSRYPMYSMTSRNP-MPGDTTQKPGPGTYSAELVTFSRPAAPKFTFGIRHSQYKGEMIVN 899
            +RPI A     PGP +Y LP  +G   HD       SP ++F   HGK     Y  DSSPGP Y  ++K+ R G+DGSP YS+Y R P    +   PGPGAY PE   +     K P Y  G R   R  D  P PN Y +  ++  +V + KP++   ++S R K G + EDL  TPGPG Y   DP V+  R P +SM  R+   P +T  +PGPG+++ E VT  +P AP FT GIRHS +   ++V+
Sbjct:    7 KRPIIAGREKGPGPGRYALPSTIGFVGHD--FTKATSPAYTF---HGKMSENMYNIDSSPGPRYNIDAKVTRFGRDGSPAYSIYGRTPGPKEMFQTPGPGAYNPEIAPVCSTQRKPPSYTMGYRTPYRSADTVPAPNKYTLPALMGSSVLT-KPASASYTISGRFKFGSYAEDLSNTPGPGRYNRPDPNVYLPRQPAFSMLGRHDGKPSETMPRPGPGSHNPENVTTHKPRAPAFTLGIRHSDFVTPLVVH 251          
BLAST of Outer dense fiber protein 3 vs. Ensembl Cavefish
Match: odf3l2a (outer dense fiber protein 3-like protein 2 [Source:NCBI gene;Acc:103039917])

HSP 1 Score: 139.043 bits (349), Expect = 3.355e-38
Identity = 99/249 (39.76%), Postives = 132/249 (53.01%), Query Frame = 3
Query:  171 IPRRP-IGAMYSSPGP-QYMLPGLVGTTFHDPRSVHYKSPGWSFG--LRHGKYQDDSSPGPCYFPNSKLYRTGKDGSPQYSLYSRPK-SLSLDYIPGPGAYKPENTI-KKVYNKAPEYPFGIRHMERRTDDTPGPNVYAIDPMLCRTVRSQKPSAPMISMSSRSKIGGFHEDLQKTPGPGTYKVTDPGVFKSRYPMYSMTSRNPMPGDTTQKPGPGTYSAELVTFSRPAAPKFTFGIRHSQYKGEMIVN 899
            + RRP I      PGP +Y LP  +G   HD       SP +SF   L       DSSPGP Y   +K+ R G+DG+P YS+  R K S      PGPGAY PE       + + P Y    R   R  D  P PN Y +  +L   +   K S+   SMSSR K GG  EDL  TPGPG Y  T+P ++ +R P +S+ SR+ +P D T+KPGPGT+S E V    P  P F+ G+RHS++   ++++
Sbjct:    5 VRRRPLIAGREKGPGPGRYALPPTIGYVNHD--YTKPSSPAYSFHSRLSSNMVSVDSSPGPQYHVEAKITRFGRDGTPSYSMLGRKKLSAGTFQTPGPGAYSPEKAPPLNGHRQPPSYTMAYRTRYRSVDAIPAPNSYTLPNLLGSQI-PNKSSSASFSMSSRRKSGGPSEDLAMTPGPGHYNSTEPSIYLNRQPSFSIQSRHSIPSDATRKPGPGTHSPERVIAHLPRPPSFSLGVRHSEFVTPLVID 250          
BLAST of Outer dense fiber protein 3 vs. Ensembl Sea Lamprey
Match: odf3b (tripartite motif containing 35-30 [Source:ZFIN;Acc:ZDB-GENE-060503-557])

HSP 1 Score: 234.187 bits (596), Expect = 1.852e-75
Identity = 120/244 (49.18%), Postives = 158/244 (64.75%), Query Frame = 3
Query:  177 RRPIGAMYSSPGPQYMLPGLVGTTFHDPRSVHYKSPGWSFGLRHGKYQDDSSPGPCYFPNSKLYRTGKDGSPQYSLYSRPKSLSLDYIPGPGAYKPENTIKKVYNKAPEYPFGIRHMERRTDDTPGPNVYAIDPMLCRTVRSQKPSAPMISMSSRSKIGGFHEDLQKTPGPGTYKVTDPGVFKSRYPMYSMTSRNPMPGDTTQKPGPGTYSAE-LVTFSRPAAPKFTFGIRHSQYKGEMIVNND 905
            R PI A+YS PGP+Y LPG+ G + HDP    +K+P +SFG RH  +++D+SPGPCY   S L RTG+ G+P YSLY RP+   L   PGPG+Y PE      +  AP Y    R      D TPGP  Y +  ML   V   K SAP  S+SSR KIG FHEDLQKTPGPGTY + +   ++++ P YS+T+RN +PGDTT+KPGPG YS E +VT +   AP ++FG+RHS+Y   +I++ +
Sbjct:   18 RGPIAALYSGPGPKYALPGVTGHSLHDP--TKFKNPAYSFGARHAHFKEDTSPGPCYLVPSALTRTGRAGTPHYSLYGRPREPGLFKTPGPGSYSPERAGTAAFRSAPSYSLTARTDSFHRDQTPGPAKYMLPAMLGPHV-INKSSAPTYSLSSRGKIGSFHEDLQKTPGPGTYHMVESNTYRNKPPQYSLTARNSLPGDTTRKPGPGAYSPEKVVTLTHLQAPGYSFGLRHSEYVAPLIIHTE 258          
BLAST of Outer dense fiber protein 3 vs. Ensembl Sea Lamprey
Match: odf3l2b (outer dense fiber of sperm tails 3-like 2b [Source:ZFIN;Acc:ZDB-GENE-080723-64])

HSP 1 Score: 119.013 bits (297), Expect = 6.554e-32
Identity = 74/192 (38.54%), Postives = 102/192 (53.12%), Query Frame = 3
Query:  330 SPGPCYFPNSKLYRTGKDGSPQYSLYSRPKSLSLDY-IPGPGAYKPENTIKKVYNKAPEYPFGIRHMERRTDDTPGPNVYAIDPMLCRTVRSQKPSAPMISMSSRSKIGGFHEDLQKTPGPGTYKVTDPGVFK-SRYPMYSMTSRNPMPGDTTQKPGPGTYSAE-LVTFSRPAAPKFTFGIRHSQYKGEMIV 896
            +PGP Y+ +  L R G +GSP YS+  R +  +L +  PGPGAY  E        +AP Y    R   R  D  P PN Y++   L   +  ++ SAP  S+S+R  +GG  EDL +TPGP  Y        +  R P +S+ SR+ +PGD TQKPGPG +  E  V+ +   AP F  G+RHS Y   +I 
Sbjct:   20 TPGPKYY-SPSLTRHGLEGSPVYSIQGRHRERTLAFRTPGPGAYASERLFPPSEARAPAYSLAERTASRSVDLVPAPNAYSLPSTLGSHLPHRR-SAPSFSVSARRPVGGHAEDLARTPGPARYDAAHASDLRPHRAPAWSLQSRSRLPGDNTQKPGPGAHRPETCVSVTTRRAPTFRMGVRHSDYVMPLIC 209          
BLAST of Outer dense fiber protein 3 vs. Ensembl Nematostella
Match: EDO35554 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SL54])

HSP 1 Score: 202.216 bits (513), Expect = 7.070e-63
Identity = 118/244 (48.36%), Postives = 146/244 (59.84%), Query Frame = 3
Query:  186 IGAMYSSPGP-QYMLPGLVGTTFHDPRSVHYKSPGWSFGLRHGKYQDDSSPGPCYFPNSKLYRTGKDGSPQYSLYSRPKSLSLDYIPGPGAYKPENTIKKVYNKAPEYPFGIRHMERRTDDTPGPNVYAIDPMLCRTVRSQKPSAPMISMSSRSKIGGFHEDLQKTPGPGTYKVTDPGVFKSRYPMYSMTSRNPMPGDTTQKPGPGTYSAELVTFSRPAAPKFTFGIRHSQYKGEMIVNN-DID 911
            I A    PGP +Y+LPG VG   HD R     +P +SFG RH  +    SPGP Y   S L + GKDG+P +SLYSR K  +L ++PGPG Y PE        KAP Y FG R    +   TP PN Y++ P L       K SA   S++ RS  GGF EDLQKTPGPGTYKVT P  ++ R   YSM  RN MPGD+TQKPGPG +S E V   + AAPK +FGI+HS+Y   ++V+  D+D
Sbjct:   14 IAAKCRGPGPAKYLLPGTVGKKNHDVRKT--TNPAFSFGQRHRDFFTQISPGPKYMVPSGLTQCGKDGTPAFSLYSRAKEKNLSHVPGPGEYSPEKHSIPHERKAPSYSFGSRTKYAQKQITPSPNSYSL-PALTGPKVVNKTSAAAYSLTGRSNNGGFSEDLQKTPGPGTYKVTSPDKYRKRMAAYSMNGRNFMPGDSTQKPGPGQHSPEKVVMHQKAAPKVSFGIKHSEYSLPLVVDVLDVD 254          
BLAST of Outer dense fiber protein 3 vs. Ensembl Nematostella
Match: EDO37545 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFE9])

HSP 1 Score: 196.823 bits (499), Expect = 6.612e-61
Identity = 115/243 (47.33%), Postives = 142/243 (58.44%), Query Frame = 3
Query:  177 RRP-IGAMYSSPGP-QYMLPGLVGTTFHDPRSVHYKSPGWSFGLRHGKYQDDSSPGPCYFPNSKLYRTGKDGSPQYSLYSRPKSLSLDYIPGPGAYKPENTIKKVYNKAPEYPFGIRHMERRTDDTPGPNVYAIDPMLCRTVRSQKPSAPMISMSSRSKIGGFHEDLQKTPGPGTYKVTDPGVFKSRYPMYSMTSRNPMPGDTTQKPGPGTYSAELVTFSRPAAPKFTFGIRHSQYKGEMIVN 899
            +RP I AM+  PGP +Y LPG  G   HDPR   +K P WSFGL+ G    +  PGP Y   +++ RTG DG+P Y+L+ R +       P PGAY PE         AP Y FG R    + D TP  N Y++ P +       K + P  SMS+R KIG FHEDLQKTPGPGTYKV +P   K R P YSM  RN M GD T KPGPG +S E V   +  AP+F+FGIRHS+Y   +IV+
Sbjct:    6 KRPQIAAMFRGPGPAKYRLPGGCGYNDHDPRK--HKKPAWSFGLKLGLKSQNVGPGPAYLIPARITRTGTDGTPAYTLHDRTQLNKAFSTPAPGAYAPEKQRVPHQRWAPSYSFGSRTPYAKRDATPAANAYSL-PNVVGPKAVGKTALPAYSMSARLKIGAFHEDLQKTPGPGTYKVHNPDYNKKRMPAYSMNGRNYMTGDNTLKPGPGAHSPEKVYVHKRNAPRFSFGIRHSEYIAPLIVD 245          
BLAST of Outer dense fiber protein 3 vs. Ensembl Nematostella
Match: EDO39533 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S9T2])

HSP 1 Score: 159.073 bits (401), Expect = 2.496e-46
Identity = 97/241 (40.25%), Postives = 134/241 (55.60%), Query Frame = 3
Query:  186 IGAMYSSPGP-QYMLPGLVGTTFHDPRSVHYKSPGWSFG--LRHGKYQDDSSPGPCYFPNSKLYRTGKDGSPQYSLYSRPKSLSLDYIPGPGAYKPENTIKKVYNKAPEYPFGIRHMERRTDDTPGPNVYAIDPMLCRTVRSQKPSAPMISMSSRSKIGGFHEDLQKTPGPGTYKVTDPGVFKSRYPMYSMTSRNPMPGDTTQKPGPGTYSAELVTFSRPAAPKFTFGIRHSQYKGEMIVN 899
            I A    PGP +Y LP   G   HD      ++P +SFG  L +  ++ D SPGP Y  +  + + GKDG+P YS+  R +  +    P PGAY PE    +    AP Y  G R   R+ D +P PN Y +  +L   V ++  SA   SM+ R+  G F EDL K PGPG Y  T P  +K+R P YSM  R+ MPGD+T+KPGPG +S E V  ++  APK + GIRHS++   +I++
Sbjct:   15 IAARERGPGPGRYGLPSTCGFPEHD--FTKNRAPAYSFGTRLENSMFKKDCSPGPGYRIDPSITKHGKDGTPSYSVLGRQRDPNTFKTPAPGAYSPEKVHPQGERHAPAYSMGGRTRYRKRDASPSPNAYNLPQLLGPKVPNKYSSA-SYSMTGRATTGSFSEDLAKAPGPGKYNTTIPNTYKNRQPQYSMLGRSYMPGDSTKKPGPGAHSPEKVYINKHQAPKISLGIRHSEFITPLIID 252          
BLAST of Outer dense fiber protein 3 vs. Ensembl Nematostella
Match: EDO35555 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SL55])

HSP 1 Score: 62.003 bits (149), Expect = 4.396e-12
Identity = 36/94 (38.30%), Postives = 53/94 (56.38%), Query Frame = 3
Query:  129 AMTTEQIEMAAVYNIPRRPIGAMYSSPGP-QYMLPGLVGTTFHDPRSVHYKSPGWSFGLRH-GKYQDDSSPGPCYFPNSKLYRTGKDGSPQYSL 404
            A T +Q+++         PIGA++  PGP +YMLP       HD      + P +SFG +H     +D SPGP Y P+S++ R G +G+P+YSL
Sbjct:    4 ARTGDQVKLP--------PIGAIFRGPGPGRYMLPTTCNYNMHD--VTRNRRPAFSFGNKHMHALTNDCSPGPMYLPDSRITRVGAEGNPKYSL 87          
BLAST of Outer dense fiber protein 3 vs. Ensembl Medaka
Match: odf3b (outer dense fiber protein 3-B [Source:NCBI gene;Acc:101159189])

HSP 1 Score: 209.149 bits (531), Expect = 3.729e-65
Identity = 111/244 (45.49%), Postives = 148/244 (60.66%), Query Frame = 3
Query:  174 PRRPIGAMYSSPGPQYMLPGLVGTTFHDPRSVHYKSPGWSFGLRHGKYQDDSSPGPCYFPNSKLYRTGKDGSPQYSLYSRPKSLSLDYIPGPGAYKPENTIKKVYNKAPEYPFGIRHMERRTDDTPGPNVYAIDPMLCRTVRSQKPSAPMISMSSRSKIGGFHEDLQKTPGPGTYKVTDPGVFKSRYPMYSMTSRNPMPGDTTQKPGPGTYSAELVTFSRPAAPKFTFGIRHSQYKGEMIVNND 905
            PR P+ A+Y SPGP+Y LPGL+G+   DP     K+P +SFG+R  K   +SSPGP Y   S + R G++G+P +S+ SR K   L   PGPG Y PEN+ K +++  P Y    R     T   PGP  Y + PML     +   S+P  ++  RSK G FHED+ K+PGP  YK  DP ++K + P +SMT RN +PG+  QKPGPG Y  E VTF+R  AP FTFG+RHSQY    I++ +
Sbjct:   16 PRGPVAALYGSPGPKYALPGLIGSAQRDPTKC--KAPVFSFGIRCEKANSNSSPGPTYLIPSNITRRGRNGTPAFSISSRSKQPLLFRAPGPGQYSPENSEKLIFHSPPAYSLSGRSKAGSTKQLPGPATYTLPPMLGPK-SAVTTSSPTYTLCGRSKSGSFHEDMAKSPGPAAYKAVDPYIYKQKPPHFSMTGRNFIPGEAAQKPGPGAYCPERVTFTRAKAPSFTFGLRHSQYVSPFIMDVE 256          
BLAST of Outer dense fiber protein 3 vs. Ensembl Medaka
Match: odf3b (outer dense fiber protein 3-B [Source:NCBI gene;Acc:101159189])

HSP 1 Score: 183.341 bits (464), Expect = 3.119e-55
Identity = 98/234 (41.88%), Postives = 136/234 (58.12%), Query Frame = 3
Query:  216 QYMLPGLVGTTFHDPRS----VHYKSPGWSFGLRHGKYQDDSSPGPCYFPNSKLYRTGKDGSPQYSLYSRPKSLSLDYIPGPGAYKPENTIKKVYNKAPEYPFGIRHMERRTDDTPGPNVYAIDPMLCRTVRSQKPSAPMISMSSRSKIGGFHEDLQKTPGPGTYKVTDPGVFKSRYPMYSMTSRNPMPGDTTQKPGPGTYSAELVTFSRPAAPKFTFGIRHSQYKGEMIVNND 905
            QY+ P + G+  ++  +       K+P +SFG+R  K   +SSPGP Y   S + R G++G+P +S+ SR K   L   PGPG Y PEN+ K +++  P Y    R     T   PGP  Y + PML     +   S+P  ++  RSK G FHED+ K+PGP  YK  DP ++K + P +SMT RN +PG+  QKPGPG Y  E VTF+R  AP FTFG+RHSQY    I++ +
Sbjct:   11 QYLAPNVCGSCVYEGSAQRDPTKCKAPVFSFGIRCEKANSNSSPGPTYLIPSNITRRGRNGTPAFSISSRSKQPLLFRAPGPGQYSPENSEKLIFHSPPAYSLSGRSKAGSTKQLPGPATYTLPPML-GPKSAVTTSSPTYTLCGRSKSGSFHEDMAKSPGPAAYKAVDPYIYKQKPPHFSMTGRNFIPGEAAQKPGPGAYCPERVTFTRAKAPSFTFGLRHSQYVSPFIMDVE 243          
BLAST of Outer dense fiber protein 3 vs. Ensembl Medaka
Match: odf3l2b (outer dense fiber protein 3-like protein 2 [Source:NCBI gene;Acc:101156004])

HSP 1 Score: 145.976 bits (367), Expect = 8.391e-41
Identity = 96/246 (39.02%), Postives = 128/246 (52.03%), Query Frame = 3
Query:  183 PIGAMYSSPGP-QYMLPGLVGTTFHDPRSVHYKSPGWSF--GLRHGKYQDDSSPGPCYFPNSKLYRTGKDGSPQYSLYSRPK-SLSLDYIPGPGAYKPENTIKKVYNKAP-EYPFGIRHMERRTDDTPGPNVYAIDPMLCRTVRSQKPSAPMISMSSRSKIGGFHEDLQKTPGPGTYKVTDPGVFKSRYPMYSMTSRNPMPGDTTQKPGPGTYSAELVTFSRPAAPKFTFGIRHSQYKGEMIVNND 905
            PI      PGP +Y LP  +G   HD       SP +SF   +    Y  DSSPGP Y  ++K  R GKDG+P YS+  R K    L + PGPGAY PE        + P  Y  G R   R  D  P PN Y++ P+L   +   KP++   +MS     GG   DL KTPGP  Y  T P V+ SR P +S+  R  +P D T++PGPG Y+ E VT  +  AP F+ GIRHS +   +++++ 
Sbjct:    7 PIAGKEKGPGPGRYGLPPTIGFIGHD--FTKAASPAYSFHGSMSTKMYHVDSSPGPQYHVSAKFTRFGKDGTPSYSMLGRRKLQKELCHTPGPGAYSPEKAPPCGLQRTPPSYTMGARTHYRSVDQVPAPNKYSLPPLLGPHI-PNKPASANYTMSGSYSTGGASVDLAKTPGPCGYNCTAPSVYLSRQPAFSILGRPGLPRDGTERPGPGAYNPEKVTVHKARAPAFSMGIRHSDFVTPLVLDHS 249          
BLAST of Outer dense fiber protein 3 vs. Ensembl Medaka
Match: odf3l2b (outer dense fiber protein 3-like protein 2 [Source:NCBI gene;Acc:101156004])

HSP 1 Score: 144.436 bits (363), Expect = 5.346e-40
Identity = 96/242 (39.67%), Postives = 125/242 (51.65%), Query Frame = 3
Query:  183 PIGAMYSSPGP-QYMLPGLVGTTFHDPRSVHYKSPGWSF--GLRHGKYQDDSSPGPCYFPNSKLYRTGKDGSPQYSLYSRPK-SLSLDYIPGPGAYKPENTIKKVYNKAP-EYPFGIRHMERRTDDTPGPNVYAIDPMLCRTVRSQKPSAPMISMSSRSKIGGFHEDLQKTPGPGTYKVTDPGVFKSRYPMYSMTSRNPMPGDTTQKPGPGTYSAELVTFSRPAAPKFTFGIRHSQYKGEMI 893
            PI      PGP +Y LP  +G   HD       SP +SF   +    Y  DSSPGP Y  ++K  R GKDG+P YS+  R K    L + PGPGAY PE        + P  Y  G R   R  D  P PN Y++ P+L   +   KP++   +MS     GG   DL KTPGP  Y  T P V+ SR P +S+  R  +P D T++PGPG Y+ E VT  +  AP F+ GIRHS +   ++
Sbjct:    7 PIAGKEKGPGPGRYGLPPTIGFIGHD--FTKAASPAYSFHGSMSTKMYHVDSSPGPQYHVSAKFTRFGKDGTPSYSMLGRRKLQKELCHTPGPGAYSPEKAPPCGLQRTPPSYTMGARTHYRSVDQVPAPNKYSLPPLLGPHI-PNKPASANYTMSGSYSTGGASVDLAKTPGPCGYNCTAPSVYLSRQPAFSILGRPGLPRDGTERPGPGAYNPEKVTVHKARAPAFSMGIRHSDFVTPLV 245          
BLAST of Outer dense fiber protein 3 vs. Ensembl Medaka
Match: odf3l2a (outer dense fiber protein 3-like protein 2 [Source:NCBI gene;Acc:101159872])

HSP 1 Score: 134.806 bits (338), Expect = 1.358e-36
Identity = 96/246 (39.02%), Postives = 123/246 (50.00%), Query Frame = 3
Query:  186 IGAMYSSPGP-QYMLPGLVGTTFHDPRSVHYKSPGWSFGLR--HGKYQDDSSPGPCYFPNSKLYRTGKDGSPQYSLYSRPKSLS----LDYIPGPGAYKPENTI-KKVYNKAPEYPFGIRHMERRTDDTPGPNVYAIDPMLCRTVRSQKPSAPMISMSSRSKIGGFHEDLQKTPGPGTYKVTDPGVFKSRYPMYSMTSRNPMPGDTTQKPGPGTYSAELVTFSRPAAPKFTFGIRHSQYKGEMIVN 899
            I A    PGP +Y LP  VG   HD       SP +SF  R        DSSPGP Y  ++KL R G+  +P YS   R   +     L   PGPGAY PE         + P Y  G R   R  D  P PN Y++  +L   V   K S+   S S R K+G   EDL KTPGPG Y  T+P +++ R P ++M SR   P  ++  PGPGTYS E +    P  P F+ GIRHS+Y   +++N
Sbjct:   11 ISARERGPGPGRYALPPTVGFINHD--FTKPSSPAYSFRCRTSSAMVSVDSSPGPRYHVHAKLTRFGQMETPSYSFSGRGSQIGNKDVLFQTPGPGAYSPERVPPVNGQRRPPSYTIGPRTRYRSVDPVPAPNSYSLPNLLGCQV-PHKTSSASYSFSCRRKVGAPTEDLAKTPGPGQYSSTNPDIYRQRQPSFTMQSRTKRPLYSSAIPGPGTYSPEKIHTHLPKPPSFSMGIRHSEYITPLVIN 253          
BLAST of Outer dense fiber protein 3 vs. Planmine SMEST
Match: SMESG000038718.1 (SMESG000038718.1)

HSP 1 Score: 516.153 bits (1328), Expect = 0.000e+0
Identity = 253/253 (100.00%), Postives = 253/253 (100.00%), Query Frame = 3
Query:  153 MAAVYNIPRRPIGAMYSSPGPQYMLPGLVGTTFHDPRSVHYKSPGWSFGLRHGKYQDDSSPGPCYFPNSKLYRTGKDGSPQYSLYSRPKSLSLDYIPGPGAYKPENTIKKVYNKAPEYPFGIRHMERRTDDTPGPNVYAIDPMLCRTVRSQKPSAPMISMSSRSKIGGFHEDLQKTPGPGTYKVTDPGVFKSRYPMYSMTSRNPMPGDTTQKPGPGTYSAELVTFSRPAAPKFTFGIRHSQYKGEMIVNNDID 911
            MAAVYNIPRRPIGAMYSSPGPQYMLPGLVGTTFHDPRSVHYKSPGWSFGLRHGKYQDDSSPGPCYFPNSKLYRTGKDGSPQYSLYSRPKSLSLDYIPGPGAYKPENTIKKVYNKAPEYPFGIRHMERRTDDTPGPNVYAIDPMLCRTVRSQKPSAPMISMSSRSKIGGFHEDLQKTPGPGTYKVTDPGVFKSRYPMYSMTSRNPMPGDTTQKPGPGTYSAELVTFSRPAAPKFTFGIRHSQYKGEMIVNNDID
Sbjct:    1 MAAVYNIPRRPIGAMYSSPGPQYMLPGLVGTTFHDPRSVHYKSPGWSFGLRHGKYQDDSSPGPCYFPNSKLYRTGKDGSPQYSLYSRPKSLSLDYIPGPGAYKPENTIKKVYNKAPEYPFGIRHMERRTDDTPGPNVYAIDPMLCRTVRSQKPSAPMISMSSRSKIGGFHEDLQKTPGPGTYKVTDPGVFKSRYPMYSMTSRNPMPGDTTQKPGPGTYSAELVTFSRPAAPKFTFGIRHSQYKGEMIVNNDID 253          
BLAST of Outer dense fiber protein 3 vs. Planmine SMEST
Match: SMESG000019620.1 (SMESG000019620.1)

HSP 1 Score: 205.297 bits (521), Expect = 5.056e-64
Identity = 115/245 (46.94%), Postives = 151/245 (61.63%), Query Frame = 3
Query:  177 RRPIGAMYSSPGPQYMLPGLVGTTFHDPRSVHYKSPGWSFGLRHGKYQDDSSPGPCYFPNSKLYRTGKDGSPQYSLYSRPKSLSLDYIPGPGAYKPENTIKKVYNKAPEYPFGIRHMERRTDDTPGPNVYAIDPMLCRTVRSQKPSAPMISMSSRSKIGGFHEDLQKTPGPGTYKVTDPGVFKSRYPMYSMTSRNPMPGDTTQKPGPGTYSAELVTFSRPAAPKFTFGIRHSQYKGEMIVNNDID 911
            R PIGA Y+SPGP Y LP L+G   HDPRS  +K P      +HG    D            +   G   +  +SL+SRP  L  D+ P PG Y  E++I ++Y  +P Y FG++   + TD TPGPNVY +DPML +T RS+KPSAP  S+ SR+KIGGF EDL KTPGPG Y V D   +K + P  +++SRNP+PGD + KPGPGTY       +R   P F+FG  HSQY+G +IVN+D++
Sbjct:    5 RGPIGAEYTSPGPIYPLPSLLGRQNHDPRS-SFKRP------QHGHLVTDMENF------GTIVVLGLHINFSFSLHSRPNYLENDFTPDPGRYNYESSINRIYKSSPAYSFGLKRSGKTTDVTPGPNVYLLDPMLSKTFRSEKPSAPSYSLLSRNKIGGFSEDLTKTPGPGAYSVPDFSTYKRKLPAITISSRNPLPGDNSVKPGPGTYYPP----NRDNGPAFSFGSHHSQYRGHLIVNDDVE 232          
BLAST of Outer dense fiber protein 3 vs. Planmine SMEST
Match: SMESG000072745.1 (SMESG000072745.1)

HSP 1 Score: 164.851 bits (416), Expect = 3.269e-48
Identity = 97/256 (37.89%), Postives = 133/256 (51.95%), Query Frame = 3
Query:  153 MAAVYNIPRRPIGAMYSSPGPQYMLPGLVGTTFHDPRSVHYKSPGWSFG--LRHGKYQDDSSPGPCYFPNSKLYRTGKDGSPQYSLYSRPKSLSLDYIPGPGAYKPENTIKKVYNK--APEYPFGIRHMERRTDDTPGPNVYAIDPMLCRTVRSQKPSAPMISMSSRSKIGGFHEDLQKTPGPGTYKVTDPGVFKSRYPMYSMTSRNPMPGDTTQKPGPGTYSAELVTFSRPAAPKFTFGIRHSQYKGEMIVNNDI 908
            M   Y IPRR +GAM SSPGP Y LP +         S +  SP W  G  +   ++  D  PGPCY  +SKL R G   S ++S+  R    +    PGP  Y  E +  K+ ++   P Y    R  + + D  P PN Y I P L R+  S+K SAP  S+  R  IG F+EDL+ TPGP  Y +     +KS+ P YS+  R  +P D+  KPGPGTY  E V  +  +AP  +FGI+HS +    ++  D+
Sbjct:    1 MVYQYTIPRRSVGAMQSSPGPIYALPSIFDKNKVHHNSNYNNSPCWKIGSLINRNRFVTDG-PGPCYNVDSKLLRNGFSRSEKFSIRGRSSEPANTITPGPDLYFTEKSTNKISHQKSVPSYSISGRPNQMKIDKNPAPNSYDIKPTLGRSYESRKVSAPAYSLYGRKVIGSFNEDLRDTPGPNKYALPSSNTYKSKLPAYSLYGRTQLPCDSVLKPGPGTYKPEKVAITTKSAPASSFGIKHSPFASGFVLPPDL 255          
BLAST of Outer dense fiber protein 3 vs. Planmine SMEST
Match: SMESG000061272.1 (SMESG000061272.1)

HSP 1 Score: 142.124 bits (357), Expect = 1.424e-39
Identity = 95/243 (39.09%), Postives = 122/243 (50.21%), Query Frame = 3
Query:  165 YNIPRRPIGAMYSSPGPQYMLPGLVGTTFHDPRSVHYKSPGWSFGLRHGKYQDDSSPGP-CYFPNSKLYRTGKDGSPQYSLYSRPKSLSLDYIPGPGAYKPENTIKKVYNKAPEYPFGIRHMERRTDDTPGPNVYAIDPMLCRTVRSQKPSAPMISMSSRSKIGGFHEDLQKT-PGPGTYKVTDPGVFKSRYPMYSMTSRNPMPGDTTQKPGPGTYSAELVTFSRPAAPKFTFGIRHSQYKGE 887
            Y  PR PI A +++PGP Y  P LVG   HD RSVH K+P +SFGL+   +  D SPGP  Y P++KL   G D  P+YS+       + +  PGP  Y        V+ KAPE+  G    E   + TP PN Y + P     + S KPS P  S+         H D  +  PGP  YKV  P ++ +  P Y+M S    P      P P  Y  E+VT   P++P FT GI HS YKGE
Sbjct:   11 YTRPRMPIAAQFANPGPIYGAPTLVGEKGHDIRSVHVKAPAYSFGLKTFPHSQDQSPGPAAYGPDTKLTHHGYDSIPKYSIGQLLHPYAKEVTPGPSDYDITKANNVVWPKAPEHVMGKYLTESTANVTPAPNEYKLPP---PDITSDKPSGPKYSVGQY-----LHYDKSRDGPGPADYKVGSPDLYLTASPKYTMGSGAQCPDSRLLTPSPAHYKHEMVTSHLPSSPAFTMGIIHSPYKGE 245          
The following BLAST results are available for this feature:
BLAST of Outer dense fiber protein 3 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ODF33.997e-5542.41outer dense fiber of sperm tails 3 [Source:HGNC Sy... [more]
ODF3B1.164e-4437.96outer dense fiber of sperm tails 3B [Source:HGNC S... [more]
ODF3B1.164e-4437.96outer dense fiber of sperm tails 3B [Source:HGNC S... [more]
ODF3L16.953e-3334.02outer dense fiber of sperm tails 3 like 1 [Source:... [more]
ODF31.193e-3133.07outer dense fiber of sperm tails 3 [Source:HGNC Sy... [more]
back to top
BLAST of Outer dense fiber protein 3 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Outer dense fiber protein 3 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG80861.799e-2634.58gene:FBgn0032010 transcript:FBtr0332362[more]
CG102529.797e-2435.22gene:FBgn0039104 transcript:FBtr0084475[more]
CG80864.965e-2234.05gene:FBgn0032010 transcript:FBtr0079620[more]
CG80868.685e-2234.05gene:FBgn0032010 transcript:FBtr0079621[more]
CG80862.064e-1930.97gene:FBgn0032010 transcript:FBtr0332360[more]
back to top
BLAST of Outer dense fiber protein 3 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
odf3b8.337e-7651.64outer dense fiber of sperm tails 3B [Source:NCBI g... [more]
odf3b8.337e-7651.64tripartite motif containing 35-30 [Source:ZFIN;Acc... [more]
odf3b8.337e-7651.64tripartite motif containing 35-30 [Source:ZFIN;Acc... [more]
odf3b1.370e-7551.64outer dense fiber of sperm tails 3B [Source:NCBI g... [more]
odf3l2a1.108e-4642.52outer dense fiber of sperm tails 3-like 2a [Source... [more]
back to top
BLAST of Outer dense fiber protein 3 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
scml23.250e-7753.72Scm polycomb group protein like 2 [Source:Xenbase... [more]
ODF3L21.014e-3937.96outer dense fiber of sperm tails 3-like 1 [Source:... [more]
back to top
BLAST of Outer dense fiber protein 3 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Odf31.439e-5242.21outer dense fiber of sperm tails 3 [Source:MGI Sym... [more]
Odf32.996e-5242.21outer dense fiber of sperm tails 3 [Source:MGI Sym... [more]
Odf3b2.540e-4039.00outer dense fiber of sperm tails 3B [Source:MGI Sy... [more]
Odf3b5.014e-3839.37outer dense fiber of sperm tails 3B [Source:MGI Sy... [more]
Odf3l23.430e-3435.56outer dense fiber of sperm tails 3-like 2 [Source:... [more]
back to top
BLAST of Outer dense fiber protein 3 vs. UniProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5EB30|ODF3A_XENTR1.722e-7653.72Outer dense fiber protein 3 OS=Xenopus tropicalis ... [more]
sp|A3KQA5|ODF3B_DANRE6.294e-7551.64Outer dense fiber protein 3-B OS=Danio rerio OX=79... [more]
sp|Q8AVY1|ODF3A_XENLA2.107e-7352.07Outer dense fiber protein 3 OS=Xenopus laevis OX=8... [more]
sp|Q96PU9|ODF3A_HUMAN1.919e-5442.41Outer dense fiber protein 3 OS=Homo sapiens OX=960... [more]
sp|Q2TBH0|ODF3A_BOVIN2.743e-5243.03Outer dense fiber protein 3 OS=Bos taurus OX=9913 ... [more]
back to top
BLAST of Outer dense fiber protein 3 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
gnl|BL_ORD_ID|157882743.272e-10963.53tr|A0A267GHA7|A0A267GHA7_9PLAT Uncharacterized pro... [more]
gnl|BL_ORD_ID|158018711.194e-10862.60tr|A0A1I8IAV2|A0A1I8IAV2_9PLAT Uncharacterized pro... [more]
gnl|BL_ORD_ID|183098095.840e-10762.06tr|A0A267EQJ8|A0A267EQJ8_9PLAT Uncharacterized pro... [more]
gnl|BL_ORD_ID|182228491.528e-10662.11tr|A0A1I8H174|A0A1I8H174_9PLAT Uncharacterized pro... [more]
gnl|BL_ORD_ID|183389996.009e-10661.66tr|A0A267F4K0|A0A267F4K0_9PLAT Uncharacterized pro... [more]
back to top
BLAST of Outer dense fiber protein 3 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
odf3b1.988e-7149.79outer dense fiber of sperm tails 3B [Source:NCBI g... [more]
odf3l2b5.264e-4240.64outer dense fiber protein 3-like protein 2 [Source... [more]
odf3l2a3.355e-3839.76outer dense fiber protein 3-like protein 2 [Source... [more]
back to top
BLAST of Outer dense fiber protein 3 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
odf3b1.852e-7549.18tripartite motif containing 35-30 [Source:ZFIN;Acc... [more]
odf3l2b6.554e-3238.54outer dense fiber of sperm tails 3-like 2b [Source... [more]
back to top
BLAST of Outer dense fiber protein 3 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Outer dense fiber protein 3 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO355547.070e-6348.36Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO375456.612e-6147.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO395332.496e-4640.25Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO355554.396e-1238.30Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Outer dense fiber protein 3 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
odf3b3.729e-6545.49outer dense fiber protein 3-B [Source:NCBI gene;Ac... [more]
odf3b3.119e-5541.88outer dense fiber protein 3-B [Source:NCBI gene;Ac... [more]
odf3l2b8.391e-4139.02outer dense fiber protein 3-like protein 2 [Source... [more]
odf3l2b5.346e-4039.67outer dense fiber protein 3-like protein 2 [Source... [more]
odf3l2a1.358e-3639.02outer dense fiber protein 3-like protein 2 [Source... [more]
back to top
BLAST of Outer dense fiber protein 3 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000038718.10.000e+0100.00SMESG000038718.1[more]
SMESG000019620.15.056e-6446.94SMESG000019620.1[more]
SMESG000072745.13.269e-4837.89SMESG000072745.1[more]
SMESG000061272.11.424e-3939.09SMESG000061272.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30009782 ID=SMED30009782|Name=Outer dense fiber protein 3|organism=Schmidtea mediterranea sexual|type=transcript|length=1209bp
AAAAGATACTTAATCTTTTATTACATGTTTAAAATTACAAATCCGTACAC
GAAAATAGATTAAAAACTGATTTGCGAATTCTAATACAATCATAGTTCAT
TTGTTTTAATAATTATCACCAAGCAATAGCTATGACAACAGAACAAATAG
AAATGGCTGCAGTATATAATATCCCAAGACGGCCTATTGGTGCAATGTAC
AGTAGTCCTGGTCCACAATATATGCTTCCTGGGTTAGTAGGAACAACCTT
TCATGATCCTCGCTCAGTTCATTATAAATCTCCTGGTTGGAGTTTTGGTT
TAAGGCATGGTAAATATCAAGATGACAGCAGTCCAGGTCCATGCTATTTT
CCCAATTCAAAATTGTACAGAACTGGAAAAGACGGATCACCACAATACTC
TTTATACTCTAGACCGAAATCTCTTTCATTAGACTATATTCCTGGTCCCG
GAGCTTATAAACCGGAAAATACCATCAAGAAAGTGTACAATAAAGCACCA
GAATATCCGTTTGGAATCCGACATATGGAACGTAGAACAGATGATACACC
TGGTCCCAACGTTTATGCAATCGATCCAATGCTGTGCCGAACTGTTCGAA
GTCAAAAGCCGTCAGCTCCCATGATTAGTATGTCATCTAGAAGCAAAATT
GGTGGTTTTCATGAAGATCTGCAAAAAACTCCCGGTCCAGGGACTTATAA
AGTTACAGATCCAGGAGTTTTCAAATCTCGCTACCCAATGTACAGCATGA
CAAGTAGAAATCCTATGCCAGGCGACACAACGCAGAAACCCGGTCCAGGA
ACTTACAGTGCTGAATTAGTAACTTTTTCAAGACCTGCTGCCCCGAAATT
CACATTTGGCATTCGTCATAGTCAATACAAGGGCGAAATGATAGTGAACA
ATGACATTGATTGACAGATTTCATTGGCTGTTTCTAATATCGGTGTGTGT
ATGCATGCGTTTGTGTGTGTGTTTTGTGTTGTGTGCTGAATGGCATTAAA
TTATCTATAACTCTGTCTGCTAGCTGCTCATAGTTTTCTGCATGTTTGAC
GCGCGCGATTTATTTTTTAATGTTATTTTTATAATATTTATTCGTTTTTA
ACGCATTCTTTCATTGTTTGACGTGAGACAATCAAGATTTATTAGATTAT
AAAATTGCTTTTATAAACATTTATATTTGTTGTAAAATAGCTTTCGTTTT
TGAATTTTC
back to top

protein sequence of SMED30009782-orf-1

>SMED30009782-orf-1 ID=SMED30009782-orf-1|Name=SMED30009782-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=261bp
MTTEQIEMAAVYNIPRRPIGAMYSSPGPQYMLPGLVGTTFHDPRSVHYKS
PGWSFGLRHGKYQDDSSPGPCYFPNSKLYRTGKDGSPQYSLYSRPKSLSL
DYIPGPGAYKPENTIKKVYNKAPEYPFGIRHMERRTDDTPGPNVYAIDPM
LCRTVRSQKPSAPMISMSSRSKIGGFHEDLQKTPGPGTYKVTDPGVFKSR
YPMYSMTSRNPMPGDTTQKPGPGTYSAELVTFSRPAAPKFTFGIRHSQYK
GEMIVNNDID*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000096ventral epidermis
PLANA:0000099neuron
PLANA:0000106ciliated epithelial cell
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR010736SHIPPO-rpt
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR010736Sperm-tail PG-rich repeatPFAMPF07004SHIPPO-rptcoord: 220..247
e-value: 8.1E-5
score: 23.3
coord: 183..211
e-value: 0.016
score: 16.1
coord: 139..172
e-value: 0.032
score: 15.2
coord: 104..132
e-value: 2.5E-5
score: 24.9
NoneNo IPR availablePANTHERPTHR21580:SF23OUTER DENSE FIBER PROTEIN 3coord: 14..253
NoneNo IPR availablePANTHERPTHR21580SHIPPO-1-RELATEDcoord: 14..253