Collagen IV NC1 domain-containing protein

Overview
NameCollagen IV NC1 domain-containing protein
Smed IDSMED30009776
Length (bp)5549
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Collagen IV NC1 domain-containing protein (SMED30009776) t-SNE clustered cells

Violin plots show distribution of expression levels for Collagen IV NC1 domain-containing protein (SMED30009776) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Collagen IV NC1 domain-containing protein (SMED30009776) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Collagen IV NC1 domain-containing protein (SMED30009776) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30009776

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 11

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
muscle cellSMED30009776SMESG000066546.1 dd_Smed_v4_3747_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30009776SMESG000066546.1 dd_Smed_v4_2500_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30009776SMESG000066546.1 dd_Smed_v4_2500_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
anterior region of the whole animalSMED30009776SMESG000066546.1 dd_Smed_v4_2500_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30009776SMESG000066546.1 dd_Smed_v6_3747_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
enteric muscle cellSMED30009776SMESG000066546.1 dd_Smed_v4_3747_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
enteric muscle cellSMED30009776SMESG000066546.1 dd_Smed_v4_2500_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
musculature systemSMED30009776SMESG000066546.1 dd_Smed_v6_2500_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pharynx musculatureSMED30009776SMESG000066546.1 dd_Smed_v6_2500_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30009776SMESG000066546.1 dd_Smed_v4_3747_0_1dd_Smed_v4PMID:30962434
Cote et al., 2019
whole organism asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30009776SMESG000066546.1 dd_Smed_v4_2500_0_1dd_Smed_v4PMID:30962434
Cote et al., 2019
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Collagen IV NC1 domain-containing protein vs. Ensembl Human
Match: COL4A6 (collagen type IV alpha 6 chain [Source:HGNC Symbol;Acc:HGNC:2208])

HSP 1 Score: 449.899 bits (1156), Expect = 5.070e-130
Identity = 613/1882 (32.57%), Postives = 796/1882 (42.30%), Query Frame = 3
Query:  186 KCQCFGNKGRQGFPGPRGYQGVSGDKGDVGQFGMPGPKGYKGFTGAIGPQGRKGERGIPGSPGYPGKMGEMGFPGIRGDIGEKGLTGCDGQQGDFGNPGMNGLVGRTGQPG---ERGDDGDRGLSIIPKYGLKGNKGSRGLLGRYGRKGEKGFKGIK--------------------------GYSGIFGIKGNKGYVGPMGRRGPKGDSLGTVIIQSEKGSKGDKGLKGQSGIP-CKGFQ-----------IEGRMYGRVGSDGPIGDKGIKG---EKGLMGEIGQSGIDGARGLNGEKGLPGEAGPR-----GERGDRGNPGFPGDPGASGADGTRGRQGERGPKGVHGISGADGPRGSRGDKGPSGSLLSCPGRKGEKGFFGIPGIKGDIGNKG----------------------------YQGHDGDIGEIGFKGEKGYEGPLGPSCSEVEQGFRGTKGESGF---------------------------PGLRGAKGQRGYSGNKGIKGKPNFGTGINNPGETGSYGN------LGVPGEKGN---KGFIGDTGEKGFSGTGKQGPEGPRGDKGDDGVNGQVGMIGMPGIKGDKGSTYPICPFCEKGYKGIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEGRMGLLGSKGRQGYKGGKGFSGSMGDAGEIGYVTISGTTIPGVKGEKGNQGPKGNKGEFGEAGSRGRKGYSGL------KGFKGLIGERGTSFSSGDPGDKGLRGENGKDGV------------SFAGIPGEKGLKGDKGNRGILGDVGS--LSNCATRPITSKGFKGPQGAKGTSGSPGSAGKTGIVGNKGENGYPGKRGIDGDNGIPGSKGEEGETGIKGHAGRPGNLGKSGLQGLRGEYGVKGDLGIQGIPGRKGVMGDPGPNGYAMIGSKGDKGIKGLPGIYGAKGDKGRPGYIGIPGFKGETGLIGRSGLKGDQGEIGEKGIKGFTF----ISNN--PGDRGLLGNKGLKGFPGELGNKGQVGVC-------------TVRGDQGLRGYSGLIGDMGMKGEQGSKGIVGDYGAASRSGIMGRTGKIGNQGLPGDQXXXXXXXXXXXXXXXXYIGIPGFEGDRGEKGNKGFPGFPGDIGQPGRLGNPGISTEGVXXXXXXXXXXXXXXXXXXXXXXXXXXKQGDSGISIPGRQGIKGEDGTIGLPGEMGEPGPRGDFGQKGNIGITGEFGLQGNRGDDGLKGDDGIPGLNGPRGFIGDIGFVGFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXELGLDGSMGGKGDNGPR--GFNGPTGIPGSKGFEGDKGIRGDIGVKGFQGQHGEIGFPGLKGVSGENGRQXXXXXXXXXXXXXXXXVCMQPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEVGESIRGLQGRKGSTGLRGNIGIPGERGDKGI---PGLQGKVGNKGVKGDIGDKGFSGNIGDKGYSGISGDKG----SFGVKGDKGFQGDVGMLGKSGLQGDRGQKGIIGFRGTRGIPGSMGLPGEIGEKGDVGPSGIGVKGLKGYQNAVGIKGRKGEKGLPGFPGRPGKVGDQGDKGPKGMKNMNTXXXXXXXXXXXXXXXXXXXXXXXXXLPGDMGEIGPNGPIGYADNGFLYATHSQSKDFPPCHGGGSPLYNGYSLLAIHGDIDSVTMDLGTPGSCLKNFSTIPFVNCFLERNTFYGGRCHVNMRNSRSYWLSTLQSYMSSPQPPSKMDDYISRCSVCQTKTTVMAFHSQKSDWQMTKCPYGWQKLWAGFSFPMAVQASRSGSNQPFSSPGSCLKHFRSLPFIECNNHNSNCNHWRDGVSYYMTAVDSENQFVKAQGKVLKSQTDIMNSISKCVVCQRDM 5348
             CQCF  KG +G PGP G QG +G +G  G  G+ G KG +GF G +GP G KG++G  G PG+ G  G  G PG  G  G  GL GC+G QG  G PG +G  G  G PG   ++G  GD  L+     G+KG+ G  GL G  G +G  GF G                            G+ G  G+KG+ G  GP G     G+       + +KGSKG+ G KG  GI    GF             E  + G  G  GP+G +G++G   ++G  G +G  G++G +G+ G+KG  G  GP            GNPG PG PG  G  G  G QG RGP GV G+                 +L   PG  G +GF   PG+KGD GN G                            ++       E GF G +G +GP G        G +G KG+SGF                           PGL+GA+G RG  G +G  G P     +   G  G  G        G+PG++G+   +GF G  GE G  G             G  G  G+ G+ G+PG KG  G                               NGL G  G +GLPGD+G+ GL    G+QG  G KG +      G  G     GT  PG  G KG++G  G  G+ G +GS+G  G  GL       GF G  GE+G     G PG  GL G  G  G+            +  G PGE+GL+G  G++G LGD G   L     +P    G  GP+G +G+ G+PG  G+ G  G+ G  G  GK G+ G  G PG  G  G+ G +G  G PG++ K GL GL+G  G  G +G++G PG  GV G P  +G    G KG  G  G PGI G  G  G  G  GIPG  G+ G  GR+G  G++G+ G  G  G       +SN    GD+G  G+ G  GFPG  G+KG+ G                ++G  G  G  G +G  G+ G +GS GI G  G    SG  G  G   + GLPG                    G+PG +GD G+       G PG  GQPG  G  G                                K  D  I   G  G KGEDG +G+ G++G PG     G  G  G+ GE GL G+ G  G  G  G PGL GP+GF G  G  G                                        GL G+ G  G  GP   G  GP G+PG KG +G  GI   IG  G  G  G+      KG  G  G QG +GL G  G      +  QP    +     +  +                       S +G  G  G  G+ G  G+PGE G KG+   PG  G  G  G  GD G  G  G  G +G SG+ GD G    +  V+   G  G  G+ G  GL GD G +G +G +G++G+P                    G+ G  G     G  G  G+ GLPG  G PG  G  G +GP GM  M                            PG    +           G+    HSQS+  PPC  G S L+ GYSLL + G   +   DLG  GSCL  FST+PF+ C +         CH   RN +SYWLST       P   +++  YISRCSVC+  +  +A HSQ  D  + +CP GW+ LW G+SF M   A   G  Q   SPGSCL+ FR+ PFIEC+     C+++ +  S+++T V+   QF +           +   +S+C VC + +
Sbjct:   38 SCQCFPEKGARGRPGPIGIQGPTGPQGFTGSTGLSGLKGERGFPGLLGPYGPKGDKGPMGVPGFLGINGIPGHPGQPGPRGPPGLDGCNGTQGAVGFPGPDGYPGLLGPPGLPGQKGSKGDPVLAPGSFKGMKGDPGLPGLDGITGPQGAPGFPGAVGPAGPPGLQGPPGPPGPLGPDGNMGLGFQGEKGVKGDVGLPGPAGPPPSTGELEFMGFPKGKKGSKGEPGPKGFPGISGPPGFPGLGTTGEKGEKGEKGIPGLPGPRGPMGSEGVQGPPGQQGKKGTLGFPGLNGFQGIEGQKGDIGLPGPDVFIDIDGAVISGNPGDPGVPGLPGLKGDEGIQGLRGPSGVPGLP----------------ALSGVPGALGPQGF---PGLKGDQGNPGRTTIGAAGLPGRDGLPGPPGPPGPPSPEFETETLHNKESGFPGLRGEQGPKG------NLGLKGIKGDSGFCACDGGVPNTGPPGEPGPPGPWGLIGLPGLKGARGDRGSGGAQGPAGAPGLVGPLGPSGPKGKKGEPILSTIQGMPGDRGDSGSQGFRGVIGEPGKDGVPGLPGLPGLPGDGGQGFPGEKGLPGLPGEKGHPGPPG-------------------------LPGNGLPGLPGPRGLPGDKGKDGL---PGQQGLPGSKGITLPCIIPGSYGPSGFPGT--PGFPGPKGSRGLPGTPGQPGSSGSKGEPGSPGLVHLPELPGFPGPRGEKGLPGFPGLPGKDGLPGMIGSPGLPGSKGATGDIFGAENGAPGEQGLQGLTGHKGFLGDSGLPGLKGVHGKP----GLLGPKGERGSPGTPGQVGQPGTPGSSGPYGIKGKSGLPGAPGFPGISGHPGKKGTRGKKGPPGSIVKKGLPGLKGLPGNPGLVGLKGSPGSPGVAGLPALSGPK--GEKGSVGFVGFPGIPGLPGIPGTRGLKGIPGSTGKMGPSGRAGTPGEKGDRGNPGPVGIPSPRRPMSNLWLKGDKGSQGSAGSNGFPGPRGDKGEAGRPGPPGLPGAPGLPGIIKGVSGKPGPPGFMGIRGLPGLKGSSGITGFPGMPGESGSQGIRG---SPGLPGAS------------------GLPGLKGDNGQTVE--ISGSPGPKGQPGESGFKGT-------------------------------KGRDGLIGNIGFPGNKGEDGKVGVSGDVGLPG---APGFPGVAGMRGEPGLPGSSGHQGAIGPLGSPGLIGPKGFPGFPGLHGLN--------------------------------------GLPGTKGTHGTPGPSITGVPGPAGLPGPKGEKGYPGI--GIGAPGKPGLRGQ------KGDRGFPGLQGPAGLPGAPGISLPSLIAGQPGDPGRPGLDGERGRPGPAGPPGP----------PGPSSNQGDTGDPGFPGIPGFSGLPGELGLKGMRGEPGFMGTPGKVGPPGDPGFPGMKGKAGPRGSSGLQGDPGQTPTAEAVQVPPGPLGLPGIDGIPGLTGDPGAQGPVGLQGSKGLP--------------------GIPGKDGPSGLPGPPGALGDPGLPGLQGPPGFEGAPGQQGPFGMPGM----------------------------PGQSMRV-----------GYTLVKHSQSEQVPPCPIGMSQLWVGYSLLFVEGQEKAHNQDLGFAGSCLPRFSTMPFIYCNINE------VCHYARRNDKSYWLSTTAPIPMMPVSQTQIPQYISRCSVCEAPSQAIAVHSQ--DITIPQCPLGWRSLWIGYSFLMHTAAGAEGGGQSLVSPGSCLEDFRATPFIECSGARGTCHYFANKYSFWLTTVEERQQFGELPVSETLKAGQLHTRVSRCQVCMKSL 1678          

HSP 2 Score: 192.586 bits (488), Expect = 2.443e-48
Identity = 288/873 (32.99%), Postives = 359/873 (41.12%), Query Frame = 3
Query:  177 TPDKCQCFGNKGRQGFPGPRGYQGVSGDKGDVGQFGMPGPKGYKGFTGAIGPQGRKGERGIPGSPGYPGKMGEMG--FPGIRGDIGEKGLTGCDGQQGDFGNPGMNGLVGRTGQPGERGDDGDRGLSIIP----KYGLKGNKGSRGLLGRYGRKGEKGFKGI---------------------KGYSGIFGIKGNKGYVGPMGRRGPKGDSLGTVIIQSEKGSKGDKGLKGQSGIPCKGFQIEGRMYGRVGSDGPIGDKGIKGEKGLMGEIGQSGIDGARGLNGEKGLPGEAGPRGERGDRGNPGFPGDPGASGADGTRGRQGERGPKG-------------------VHGISGADGPRGSRGDKGPSGSLLSCPGRKGEKGFFGIPGIKGDIGNKGYQGHDGDIGEIGFKGEKG-------YEGPLGPSCSEVEQGFRGTKGES------GFPGLRGAKGQRGYSGNKGIKGKPNFGTGINNPGETGSYGNLGVPGEKGNKGFIGDTGEKGFSGTGKQGPEGPRGDKGDDGVNGQVGMIGMPGIKGDKGSTYPIC-----------PFCEKGYKGIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEGRMGLLGSKGRQGYKGGKGFSGSMGDAGEIGYVTISGTTIPGVKGEKGNQGPKGNKGEFGEAGSRGRKGYSGLKGFKGLIGERGTSFSSGDPGDKGLRGENGKDGVSFAGIPGEKGLKGDKGNRGILGDVGSLSNCATRPITS-KGFKGPQGAKGTSGSPGSAGKTGIVG-NKGENGYPGKRGIDGDNGIPGSKGEEGETGIKGHAGRPGN------------LGKSGLQGLRGEYGVKGDLGIQGIPGRKGVMGDPGPNGYAMI 2543
            TP +    G+KG  G PG      +          G PGP+G KG  G  G  G+ G  G+ GSPG PG  G  G  F    G  GE+GL G  G +G  G+ G+ GL G  G+PG  G  G+RG    P    + G  G+ G  G+ G+ G  G  GF GI                     KG  G+ G+ GN G VG  G  G  G + G   +   KG KG  G  G  GIP              G  G  G +G+KG  G  G++G SG  G  G  G++G PG  G    R    N    GD G+ G+ G+ G  G RG KG                   + G+SG  GP G  G +G        PG KG  G  G PG+ G+ G++G +G  G  G  G  G KG         G  GP     E GF+GTKG        GFPG +G  G+ G SG+ G+ G P F      PG  G  G  G+PG  G++G IG  G  G  G            KG  G  G  G+ G+PG KG  G+  P             P  EKGY GI                                 +G  G  G +G KG +GF G  G AG  G   IS  ++  + G+ G+ G  G  GE G  G  G  G              G S + GD GD G  G  G     F+G+PGE GLKG +G  G +G  G +           KG  GP+G+ G  G PG       V    G  G PG  GI G  G PG++G  G  G KG  G PG             LG  GL GL+G  G +G  G QG  G  G+ G     GY ++
Sbjct:  685 TPGQPGSSGSKGEPGSPGLVHLPELP---------GFPGPRGEKGLPGFPGLPGKDGLPGMIGSPGLPGSKGATGDIFGAENGAPGEQGLQGLTGHKGFLGDSGLPGLKGVHGKPGLLGPKGERGSPGTPGQVGQPGTPGSSGPYGIKGKSGLPGAPGFPGISGHPGKKGTRGKKGPPGSIVKKGLPGLKGLPGNPGLVGLKGSPGSPGVA-GLPALSGPKGEKGSVGFVGFPGIP--------------GLPGIPGTRGLKGIPGSTGKMGPSGRAGTPGEKGDRGNPGPVGIPSPRRPMSNLWLKGDKGSQGSAGSNGFPGPRGDKGEAGRPGPPGLPGAPGLPGIIKGVSGKPGPPGFMGIRG-------LPGLKGSSGITGFPGMPGESGSQGIRGSPGLPGASGLPGLKGDNGQTVEISGSPGPKGQPGESGFKGTKGRDGLIGNIGFPGNKGEDGKVGVSGDVGLPGAPGF------PGVAGMRGEPGLPGSSGHQGAIGPLGSPGLIGP-----------KGFPGFPGLHGLNGLPGTKGTHGTPGPSITGVPGPAGLPGPKGEKGYPGIG--------------------------------IGAPGKPGLRGQKGDRGFPGLQGPAGLPGAPGISLPSL--IAGQPGDPGRPGLDGERGRPGPAGPPGPP------------GPSSNQGDTGDPGFPGIPG-----FSGLPGELGLKGMRGEPGFMGTPGKVGPPGDPGFPGMKGKAGPRGSSGLQGDPGQTPTAEAVQVPPGPLGLPGIDGIPGLTGDPGAQGPVGLQGSKGLPGIPGKDGPSGLPGPPGALGDPGLPGLQGPPGFEGAPGQQGPFGMPGMPGQSMRVGYTLV 1458          
BLAST of Collagen IV NC1 domain-containing protein vs. Ensembl Human
Match: COL24A1 (collagen type XXIV alpha 1 chain [Source:HGNC Symbol;Acc:HGNC:20821])

HSP 1 Score: 279.641 bits (714), Expect = 3.672e-75
Identity = 372/1026 (36.26%), Postives = 487/1026 (47.47%), Query Frame = 3
Query:  198 FGNKGRQGFPGPRGYQGVSGDKGDVGQFGMPGPKGYKGFTGAIGPQGRKGERGIPGSPGYPGKMGEMGFPGIRGDIGEKGLTGCDGQQGDFGNPGMNGLVGRTGQPGERGDDGDRGLSIIPKYGLKGNKGSRGLLGRYGRKGEKGFKGIKGYSGIFGIKGN------KGYVGPMGRRGPKGDSLGTVIIQSEKGSKGDKGLKGQSGIPCKGFQIEGRMYGRVGSDGPIGDKGIKGEKGLMGEIGQSGIDGARGLNGEKGLPGEAGPRGERGD---------------RGNPGFPGDPGASGADGTRGRQGERGPKGVHGISGADGPRGSRGDKGPSGSLLSCPGRKGEKGFFGIPGIKGDIGNKGYQGHDGDIGEIGFKGEKGYEGPLGPSCSEVEQGFRGTKGESGFPGLRGAKGQRGYSGNKGIKGKPNFGTGINNPGETGSY---GNLGVPGEKGNKGFIGDTGEKGFSGT----GKQGPEGPRGDKGDDGVNGQVGMIGMPGIKGDKGSTYPICPFCEKGYKGIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEGRMGLLGSKGRQGYKGGKGFSGSMGDAGEIGYVTISGTTIPGVKGEKGNQGPKGNKGEFGEAGSRGRKGYSGLKGFKGLIGERGTSFSSGDPGDKGLRGENGKDGVS----FAGIPGEKGLKGDKGNRGILGDVGSLSNCATRPITSKGFKGPQGAKGTSGSPGSAGKTGIVGNKGENGYPGKRGIDGDNGIPGSKGEEG----ETGIKGHAGRPGNLGKSGLQGLRGEYGVKGDLGIQGIPGRKGVMGDPGPNGYAMIGSKGDKGIKGLPGIYGAKGDKGRPGYIGIPGFKGETGLIGRSGLK---------GDQGEIGEKGIKGFTFISNNPGDRGLLGNKGLKGFPGELGNKGQVGVCTVRGDQGLRGYSGLIGDMGMKGEQGSKGIVGDYGAASRSGIMGRTGKIGNQGLPGDQXXXXXXXXXXXXXXXXYIGIPGFEGDRGEKGNKGFPGFPGDIGQPGRLG 3140
             GN G  G PGP+G +G   D G      +PG KG +G +G +GP G +G++G+ G PG PG  GE G PG  G+IG  G  G  G  G  GNPG  G  G  G PGE G  G  G   IP  G++G KG +G  G  G  G++G  G+ G  G+ G  G       +G VGP+G  GP              G  G  GL G  G+P                 G  GDKG +G  G +GE G  G  GA GL G  G+ G++GP G+ GD                G+ G PG  G  G  G  G +G  GP G+ G  G +GP G+ G+ GP G     PG+KG  G  G  G+KG++G++G  G  G+ G +G  GE G  G +            G KGE G PG  G +G++G  G  G  G P     +  PG  G+    G+ G  G++G++G  G  GE+G  G     G QG  GP G  G  G  G+ G  G PG++G  GST       E G +G+Q                        G  G  G MG+ G  G +G  G +G  G+ GD G  G  ++ GT  PG++GE G           GE G +G+ G  G+ G +GL GE G     G PG  G  G +G+ G+       GIPG++G  G KG++G +G  G + +    P    G  GP+GA+GT G+ G  G  G  G  G  GY G +G  G +G+PG KGE+G    ++ + G  G  G  G  G QG RGE G +G  G  G+PG +G  G  GP G    G +G++G+KG  G  G KG KG PG  G PG  G  GL+G  G++         G+ G+IG  G +G   I   PG  GL G  G  G  G  G  G  G+   +G+QGL G  G+ G  G +G QG +G  GD G   + G  G  G  G QG PG +         G +G  G +GI G +G  G +GN G  G  G IG  GR G
Sbjct:  521 HGNPGLPGLPGPKGPKG---DPGFSPGQPVPGEKGDQGLSGLMGPPGMQGDKGLKGHPGLPGLPGEQGIPGFAGNIGSPGYPGRQGLAGPEGNPGPKGAQGFIGSPGEAGQLGPEGERGIP--GIRGKKGFKGRQGFPGDFGDRGPAGLDGSPGLVGGTGPPGFPGLRGSVGPVGPIGP-------------AGIPGPMGLSGNKGLP-----------------GIKGDKGEQGTAGELGEPGYPGDKGAVGLPGPPGMRGKSGPSGQTGDPGLQGPSGPPGPEGFPGDIGIPGQNGPEGPKGLLGNRGPPGPPGLKGTQGEEGPIGAFGELGPRGK----PGQKGYAGEPGPEGLKGEVGDQGNIGKIGETGPVGLPGEVGMTGSI------------GEKGERGSPGPLGPQGEKGVMGYPGPPGVPGPIGPLGLPGHVGARGPPGSQGPKGQRGSRGPDGLLGEQGIQGAKGEKGDQGKRGPHGLIGKTGNPGERGFQGKPGLQGLPGSTGDRGLPGEPGLRGLQ------------------------GDVGPPGEMGMEGPPGTEGESGLQGEPGAKGDVGTAG--SVGGTGEPGLRGEPGAP---------GEEGLQGKDGLKGVPGGRGLPGEDGEKGEMGLPGIIGPLGRSGQTGLPGPEGIVGIPGQRGRPGKKGDKGQIGPTGEVGSRG--PPGKIGKSGPKGARGTRGAVGHLGLMGPDGEPGIPGYRGHQGQPGPSGLPGPKGEKGYPGEDSTVLGPPGPRGEPGPVGDQGERGEPGAEGYKGHVGVPGLRGATGQQGPPGEP--GDQGEQGLKGERGSEGNKGKKGAPGPSGKPGIPGLQGLLGPKGIQGYHGADGISGNPGKIGPPGKQGLPGIRGGPGRTGLAGAPGPPGVKGSSGLPGSPGIQGPKGEQGLPGQPGIQGKRGHRGAQGDQGPCGDPGLKGQPGEYGVQGLTGFQGFPGPK---------GPEGDAGIVGISGPKGPIGHRGNTGPLGREGIIGPTGRTG 1447          

HSP 2 Score: 268.47 bits (685), Expect = 1.241e-71
Identity = 393/1090 (36.06%), Postives = 504/1090 (46.24%), Query Frame = 3
Query:  567 GLKGNKGSRGLLGRYGRKGEKGFKGIKGYSGIFGIKGNKGYVGPMGRRGPKGDSLGTVIIQSEKGSKGDKGLKGQSGIPCKGFQIEGRMY-GRVGSDGPIGDKGIKGEKGLMGEIGQSGIDGARGLNGEKGLPGEAGPRGERGDRGNPGFPGDPGASGADGTRGRQGERGPKGVHGISGADGPRGSRGDKGPSGSLLSCPGRKGEKGFFGIPGIKGDIGNKGYQGHDGDIGEIGFKGEKGYEGPLGPSCSEVEQGFRGTKGES------------------GFPGLRGAKGQRGYSGNKGIKGKPNFGTGINNPGETGSYGNLGVPGEKGNKGFIGDTGEKGFSG-TGKQGPEGPRGDKGDDGVNGQVGMIGMPGIKGDKGSTYPICPFCEKGYKGIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEGRMGLLGSKGRQGYKGGKGFSGSMGDAGEIGYVTISGTTIPGVKGEKGNQGPKGNKGEFGEAGSRGRKGYSGLKGFKGLIGERGTSFSSGDPGDKGLRGENGKDGVSFAGIPGEKGLKGDKGNRGILGDVGSLSNCATRPITSKGFKGPQGAKGTSGSPGSAGKTGIVGNKGENGYPGKRGI---DGDNGIPGSKGEEGETGIKGHAGRPG---NLGKSGLQGLRGEYGVKGDLGIQGIPGRKGVMGDPGPNGYAMIGSKGDKGIKGLPGIYGAKGDKGRPGYIG---------IPGFKGETGLIGRSGLKGDQGEIGEKGIKGFTFISNNPGDRGLLG-NKGLKGFPGELGNKGQVGVCTVRGDQGLRGYSGLIGDMGMKGEQGSKGIVGDYGAASRSGIMGRTGKIGNQGLPGDQXXXXXXXXXXXXXXXXYIGIPGFEGDRGEKGNKGFPGFPGDIGQPGRLGNPGISTEGVXXXXXXXXXXXXXXXXXXXXXXXXXXKQGDSGISIPGRQGIKGEDGTIGLPGEMGEPGPRGDFGQKGNIGITGEFGLQGNRGDDGLKGDDGIPGLNGPRGFIGDIGFVGFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXELGLDGSMGGKGDNGPRGFNGPTGIPGSKGFEGDKGIRGD 3728
            G+ G  G+ GL G  G KG KG  G      + G KG++G  G MG  G +GD       +  KG  G  GL G+ GIP     I    Y GR G  GP G+ G KG +G +G  G++G     G  GE+G+PG  G +G +G +G PG  GD G +G DG+ G  G  GP G  G+ G+ GP G  G  G        PG  G  G  G+PGIKGD   KG QG  G++GE G+ G+KG  G  GP     + G  G  G+                   G PG  G +G +G  GN+G  G P         G  G++G LG  G+ G KG+ G+ G +G  G  G QG  G  G+ G  G+ G+VGM G  G KG++GS  P+ P  EKG  G  G  G  G  G  G+                G +G  G  G QG KG +G  G  G  GE G        I G KGEKG+QG +G  G  G+ G+ G +G+ G  G +GL G  G     G+PG +GL+G+         G PGE G++G  G  G                   G +G  GAKG  G+ GS G TG  G +GE G PG+ G+   DG  G+PG +G  GE G KG  G PG    LG+SG  GL G  G+ G  G +G PG+KG  G  GP G   +GS+G  G  G  G  GA+G +G  G++G         IPG++G  G  G SGL G +GE G  G          P        ++G +G PG  G KG VGV       GLRG +G  G  G  G+QG +G+ G+ G+    G  G  G  G  G+PG Q                  G+ G +G +G  G  G  G PG IG PG+ G PGI               G  G  GL G  G PG +G SG+  PG  GI+G  G  GLPG+ G  G RG  G +G+ G  G+ GL+G  G+ G++G  G  G  GP+G  GD G VG                                        G  G +G +G+ GP G  G  G  G  G  G+KG RG+
Sbjct:  516 GIPGPHGNPGLPGLPGPKGPKGDPGFSPGQPVPGEKGDQGLSGLMGPPGMQGD-------KGLKGHPGLPGLPGEQGIPGFAGNIGSPGYPGRQGLAGPEGNPGPKGAQGFIGSPGEAG---QLGPEGERGIPGIRGKKGFKGRQGFPGDFGDRGPAGLDGSPGLVGGTGPPGFPGLRGSVGPVGPIGPAG-------IPGPMGLSGNKGLPGIKGD---KGEQGTAGELGEPGYPGDKGAVGLPGPPGMRGKSGPSGQTGDPGLQGPSGPPGPEGFPGDIGIPGQNGPEGPKGLLGNRGPPGPPGLKGTQGEEGPIGAFGELGPRGKPGQKGYAGEPGPEGLKGEVGDQGNIGKIGETGPVGLPGEVGMTGSIGEKGERGSPGPLGPQGEKGVMGYPGPPGVPGPIGPLGL---------------PGHVGARGPPGSQGPKGQRGSRGPDGLLGEQG--------IQGAKGEKGDQGKRGPHGLIGKTGNPGERGFQGKPGLQGLPGSTGDRGLPGEPGLRGLQGD--------VGPPGEMGMEGPPGTEG-----------------ESGLQGEPGAKGDVGTAGSVGGTGEPGLRGEPGAPGEEGLQGKDGLKGVPGGRGLPGEDGEKGEMGLPGIIGPLGRSGQTGLPGPEGIVGIPGQRGRPGKKGDKGQIGPTGE--VGSRGPPGKIGKSGPKGARGTRGAVGHLGLMGPDGEPGIPGYRGHQGQPGPSGLPGPKGEKGYPGEDSTVLGPPGPRGEPGPVGDQGERGEPGAEGYKGHVGV------PGLRGATGQQGPPGEPGDQGEQGLKGERGSEGNKGKKGAPGPSGKPGIPGLQ------------------GLLGPKGIQGYHGADGISGNPGKIGPPGKQGLPGIR--------------GGPGRTGLAGAPGPPGVKGSSGL--PGSPGIQGPKGEQGLPGQPGIQGKRGHRGAQGDQGPCGDPGLKGQPGEYGVQGLTGFQGFPGPKGPEGDAGIVGIS--------------------------------------GPKGPIGHRGNTGPLGREGIIGPTGRTGPRGEKGFRGE 1457          

HSP 3 Score: 245.358 bits (625), Expect = 1.574e-64
Identity = 339/956 (35.46%), Postives = 433/956 (45.29%), Query Frame = 3
Query:  201 GNKGRQGFPGPRGYQGVSGDKGDVGQFGMPGPKGYKGFTGAIGPQGRKGERGIPGSPGYPGKMGEMGFPGIRGDIGEKGLTGCDGQQGDFGNPGMNGL------------------------VGRTGQPGERGDDGDRGLSIIPKYGLKGNKGSRGLLGRYGRKGEKGFKGIKGYSGIFGIKGNKGYVGPMGRRG-----------PKGDSLGTVIIQSEKGSKGDKGLKGQ----SGIPCKGFQ-IEGRM--YGRVGSDGPIGDKGIKGE---KGLMGEIGQSGIDGARGLNGEKGLPGEAGPRG---ERGDRGNPG---------------------------FPGDPGA---SGADGTRGRQGERGPKGV---HGISGADGPRGSRGDKGPSGSLLSCPGRKGEKGFFGIPGIKGDIGNKGYQGHDGDIGEIGFKGEKGYEGPLGPSCSEVEQGFRGTKGESGFPGLRGAKGQRGYSGNKGIKGKPNFGTGINNPGETGSYGNLGVPGEKGNKGFIGDTGEKGFSGTGKQGPEGPRGDKGDDGVNGQVGMIGMPGI------KGDKGSTYPICPFCEKGYKGIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEGRMGLLGSKGRQGYKGGKGFSGSMGDAGEIGYVTISGTT-------IPGVKGEKGNQGPKG----------------NKGEFGEAGSRGRKGYSGLKGFKGLIGERGTSFSSGDPGDKGLRGENGKDGVSFAGIPGEKGLKGDKGNRGILGDVGSLSNCATRPITSKGFKGPQGAKGTSGSPGSAGKTGIVGNKGENGYPGKRGIDGDNGIPGSKGEEG---ETGIKGHAGRPGNLGKSGLQGLRGEYGVKGDLGIQGIPGRKGVMGDPGPNGYAMIGSKGDKGIKGLPGIYGAKGDKGRPGYIGIP---GFKGETGLIGRSGLKGDQGEIGEKGIKGF 2720
            G KG  G PG  G QG+ G  G++G  G PG +G  G  G  GP+G +G  G PG  G  G  GE G PGIRG  G KG  G  G  GD G  G++G                         +G  G PG  G  G++GL      G+KG+KG +G  G  G   E G+ G KG  G+ G  G +G  GP G+ G                 G + I  + G +G KGL G          KG Q  EG +  +G +G  G  G KG  GE   +GL GE+G  G  G  G  G  GLPGE G  G   E+G+RG+PG                            PG  GA    G+ G +G++G RGP G+    GI GA G +G +G +GP G L+   G  GE+GF G PG++G  G+ G +G  G+ G  G +G+ G  G +G       +G  GT+GESG  G  GAKG  G +G+ G  G+P        PGE G  G  G+ G  G +G  G+ GEKG  G    G  GP G  G  G+ G  G++G+PG       KGDKG    I P  E G +G                                G++G  G KG +G +G  G  G MG  GE G     G         +PG KGEKG  G                   ++GE GE G+ G KG+ G+ G +G  G++G     GD G++GL+GE G +G       G+KG  G  G  GI G  G L          KG +G  GA G SG+PG  G  G  G  G  G PG+ G+ G  G PG KG  G     GI+G  G  G  G+ G+QG RG  G +GD G  G PG KG  G+         G +G  G +G PG  G +GD G  G  G     G +G TG +GR G+ G  G  G +G KGF
Sbjct:  570 GLKGHPGLPGLPGEQGIPGFAGNIGSPGYPGRQGLAGPEGNPGPKGAQGFIGSPGEAGQLGPEGERGIPGIRGKKGFKGRQGFPGDFGDRGPAGLDGSPGLVGGTGPPGFPGLRGSVGPVGPIGPAGIPGPMGLSGNKGLP-----GIKGDKGEQGTAGELG---EPGYPGDKGAVGLPGPPGMRGKSGPSGQTGDPGLQGPSGPPGPEGFPGDIGIPGQNGPEGPKGLLGNRGPPGPPGLKGTQGEEGPIGAFGELGPRGKPGQKGYAGEPGPEGLKGEVGDQGNIGKIGETGPVGLPGEVGMTGSIGEKGERGSPGPLGPQGEKGVMGYPGPPGVPGPIGPLGLPGHVGARGPPGSQGPKGQRGSRGPDGLLGEQGIQGAKGEKGDQGKRGPHG-LIGKTGNPGERGFQGKPGLQGLPGSTGDRGLPGEPGLRGLQGDVGPPGEMG------MEGPPGTEGESGLQGEPGAKGDVGTAGSVGGTGEPGLRGEPGAPGEEGLQGKDGLKGVPGGRGLPGEDGEKGEMGL--PGIIGPLGRSGQTGLPGPEGIVGIPGQRGRPGKKGDKGQ---IGPTGEVGSRG------------------------------PPGKIGKSGPKGARGTRGAVGHLGLMGPDGEPGIPGYRGHQGQPGPSGLPGPKGEKGYPGEDSTVLGPPGPRGEPGPVGDQGERGEPGAEGYKGHVGVPGLRGATGQQGPPGEPGDQGEQGLKGERGSEGNK-----GKKGAPGPSGKPGIPGLQGLLG--------PKGIQGYHGADGISGNPGKIGPPGKQGLPGIRGGPGRTGLAGAPGPPGVKGSSGLPGSPGIQGPKGEQGLPGQPGIQGKRGHRGAQGDQGPCGDPGLKGQPGE--------YGVQGLTGFQGFPGPKGPEGDAGIVGISGPKGPIGHRGNTGPLGREGIIGPTGRTGPRGEKGF 1454          

HSP 4 Score: 204.142 bits (518), Expect = 5.952e-52
Identity = 343/1007 (34.06%), Postives = 444/1007 (44.09%), Query Frame = 3
Query: 1050 RGRQGERGPKGVHGISGADGPRGSRGDKGPSGSLLSCPGRKGEKGFFGIPGIKGDIGNKGYQGHDGDIGEIGFKGEKGYEGPLGPSCSEVEQGFRGTKGESGFPGLRGAKGQRGYSGNKGIKGKPNFGTGINNPGETGSYGNLGVPGEKGNKGFIGDTGEKGFSGTGKQGPEGPRGDKGDDGVNGQVGMIGMPGIKGD---KGSTYPICPFCEKGYKGIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEGRMGLLGSKGRQGYKGGKGFSGSMGDAGEIGYVTISGTT-IPGVKGEKGNQGPKGNKGEFGEAGSR------------GRKGYSGLKGFKGLIGERGTSFSSGDPGDKGLRGENGKDG-VSFAGIPGEKGLKGDKGNRGILGDVGSLSNCATRPITSKGFKGPQGAKGTSGSPGSAGKTGIVGNKGENGYPGKRGIDGDNGI---------------------------PGSKGEEGETGIKGHAGRPGNLGKSGLQGLRGEYGVKGDLGIQGI------PGRKGVMGDPGPNGYAMIGSKGDKGIKGLPGIYGAKGDKGRPGYIGI---PGFKGETGLIGRSGLKGD---QGEIGEKGIKGFTFISNNPGDRGLLGNKGLKG------FPGELGNKGQVGVCTV------RGDQGLRGYSGLIGDMGMKGEQGSKGIVGDYGAASRSGIMGRTGKIGNQGLPGDQXXXXXXXXXXXXXXXXYIGIPGFEGDRGEKGNKGFPGFPGDIGQPGRLGNPGISTEGVXXXXXXXXXXXXXXXXXXXXXXXXXXKQGDSGISIPGRQGIKGEDGTIGLPGEMGEPGPRGDFGQKGNIGITGEFGLQGNRGD---------------DGLKGDDGIPGLNGPRGFIGDIGFVGFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXELGLDGSMGGKGDNGPRGFNGPTGIPGSKGF---EGDKGIRGDIGVKGFQGQHGEIGFPGLKGVSGENGRQ 3812
            RG +G  GP G  G+ G  GP+G +GD G S      PG KG++G  G+ G  G  G+KG +GH G     G  GE+G  G            F G  G  G+PG +G  G  G  G KG +G       I +PGE G  G       +G +G  G  G+KGF G  +QG  G  GD+G  G++G  G++G  G  G    +GS  P+ P    G  G                                  MGL G+KG  G KG KG  G+ G+ GE GY    G   +PG  G +G  GP G  G+ G  G              G  G +G +G KGL+G RG     G  G +G  G  G  G +   G PG+KG  G+ G  G+ G+VG   N            G  G  G  G PG  G TG +G KGE G PG  G  G+ G+                           PGS+G +G+ G +G  G    LG+ G+QG +GE G +G  G  G+      PG +G  G PG  G  + GS GD+G+ G PG+ G +GD G PG +G+   PG +GE+GL G  G KGD    G +G  G  G       PG+ GL G  GLKG       PGE G KG++G+  +       G  GL G  G++G  G +G  G KG  G  G     G  G  GKIG  G  G +G  G+ G  G  G  G  GIPG+ G +G+ G  G PG  G+ G PG                        +G PG  G  G  G QG+ G   PG +G KG  G  GL G  G+ GP G+ G +G  G+ GE G +GN+G                 GL G  GI G +G  G  G+ G +G  G +G  G +G  G  G                      GL GS G +G  G +G  G  GI G +G    +GD+G  GD G+KG  G++G  G  G +G  G  G +
Sbjct:  512 RGPRGIPGPHGNPGLPGLPGPKGPKGDPGFSPGQ-PVPGEKGDQGLSGLMGPPGMQGDKGLKGHPG---LPGLPGEQGIPG------------FAGNIGSPGYPGRQGLAGPEGNPGPKGAQGF------IGSPGEAGQLG------PEGERGIPGIRGKKGFKG--RQGFPGDFGDRGPAGLDGSPGLVGGTGPPGFPGLRGSVGPVGPIGPAGIPG---------------------------------PMGLSGNKGLPGIKGDKGEQGTAGELGEPGYPGDKGAVGLPGPPGMRGKSGPSGQTGDPGLQGPSGPPGPEGFPGDIGIPGQNGPEGPKGLLGNRGPPGPPGLKGTQGEEGPIGAFGELGPRGKPGQKGYAGEPGPEGLKGEVGDQGNI-----------GKIGETGPVGLPGEVGMTGSIGEKGERGSPGPLGPQGEKGVMGYPGPPGVPGPIGPLGLPGHVGARGPPGSQGPKGQRGSRGPDGL---LGEQGIQGAKGEKGDQGKRGPHGLIGKTGNPGERGFQGKPGLQG--LPGSTGDRGLPGEPGLRGLQGDVGPPGEMGMEGPPGTEGESGLQGEPGAKGDVGTAGSVGGTGEPGLRGEPGAPGEEGLQGKDGLKGVPGGRGLPGEDGEKGEMGLPGIIGPLGRSGQTGLPGPEGIVGIPGQRGRPGKKGDKGQIGPTGEVGSRGPPGKIGKSGPKGARGTRGAVGHLGLMGPDGEPGIPGYRGHQGQPGPSGLPGPKGEKGYPGE-------------------DSTVLGPPGPRGEPGPVGDQGERGE--PGAEGYKGHVGVPGLRGATGQQGPPGEPGDQGEQGLKGERGSEGNKGKKGAPGPSGKPGIPGLQGLLGPKGIQGYHGADGISGNPGKIGPPGKQGLPGIRGGPGRTGLAGAPGPPGVKGSS--------GLPGSPGIQGPKGEQGLPGQPGIQGKRGHRGAQGDQGPCGDPGLKGQPGEYGVQGLTGFQGFPGPKGPE 1410          

HSP 5 Score: 203.756 bits (517), Expect = 1.007e-51
Identity = 291/850 (34.24%), Postives = 394/850 (46.35%), Query Frame = 3
Query:  201 GNKGRQGFPGPRGYQGVSGDKGDVGQFGMPGP------------KGYKGFTGAIGPQGRKGERGIPGSPGYPGKMGEMGFPGIRGDIGEKGLTGCDGQQGDFGNPGMNGLVGRTGQ------------------------PGERGDDGDRGL----SIIPKYGLKGNKGSRGLLGRYGRKGEKGFKGIKGYSGIFGIKGNKGYVGPMGRRGPKGDS-----------LGTVIIQSEKGSKGDKGLKGQSGI-------PCKGFQIEGRMYGRVGSDGPIGDKGIKGEKGLMGEIGQSGIDGARGLNGEKGLPGEAGPRGERGDRGNPG---FPGDPGASGADGTRGRQGERGPKGVHGISGADGPRGSRGDKGPSGSLLSCPGRKGEKGFFGIPGIKGDIGNKGYQGHDGDIG---EIGFKGEKGYEGPLGPSCSEVEQGFRGTKGESGFPGLRGAKGQRGYSGNKGIKGKPNFGTGINNP-GETGSYGNLGVPGEKGNKGFIGDTGEKGFSGT-GKQGPEGPRGDKGDDGVNGQVGMIG------MPGIKGDKGSTYPIC---PFCEKGYKGIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEGRMGLLGSKGRQGYKGGKGFSGSMGDAGEIGYVTISGTTIPGVKGEKGNQGPKGNKGEFGEAGSRGRKGYSGLKGFKGLIGERGTSFSSGDPGD---------KGLRGENGKDGVSFA-------------------------GIPGEKGLKGDKGNRGILGDVGSLSNCATR----------PITSKGFKGPQGAKGTSGSPGSAGKTGIVGNKGENGYPGKRGIDGDNGIPGSKGE---EGET 2384
            G +G++GF G +G+ G  GD+G  G  G PG             +G  G  G IGP G  G  G+ G+ G PG  G+ G  G  G++GE G  G  G  G  G PGM G  G +GQ                        PG+ G +G +GL          GLKG +G  G +G +G  G +G  G KGY+G  G +G KG VG  G  G  G++            G++  + E+GS G  G +G+ G+          G      + G VG+ GP G +G KG++G  G  G  G  G +G  GEKG  G+ GP G  G  GNPG   F G PG  G  G+ G +G  G  G+ G+ G  GP G  G +GP       PG +GE G  G PG KGD+G  G  G  G+ G   E G  GE+G +G         + G +G  G  G PG  G KG+ G  G  G  G+ +  TG+  P G  G  G  G PG+KG+KG IG TGE G  G  GK G  GP+G +G  G  G +G++G      +PG +G +G   P     P  EKGY G            ++ + G  G +G  G  GD+G  G  G++G +G+ G  G  G+ G  G  G     G    G+KGE+G++G KG KG  G +G  G  G  GL G KG+ G  G    SG+PG           G+RG  G+ G++ A                         G+PG+ G++G +G+RG  GD G   +   +              +GF GP+G +G +G  G +G  G +G++G  G  G+ GI G  G  G +GE    GET
Sbjct:  639 GIRGKKGFKGRQGFPGDFGDRGPAGLDGSPGLVGGTGPPGFPGLRGSVGPVGPIGPAGIPGPMGLSGNKGLPGIKGDKGEQGTAGELGEPGYPGDKGAVGLPGPPGMRGKSGPSGQTGDPGLQGPSGPPGPEGFPGDIGIPGQNGPEGPKGLLGNRGPPGPPGLKGTQGEEGPIGAFGELGPRGKPGQKGYAGEPGPEGLKGEVGDQGNIGKIGETGPVGLPGEVGMTGSIGEKGERGSPGPLGPQGEKGVMGYPGPPGVPGPIGPLGLPGHVGARGPPGSQGPKGQRGSRGPDGLLGEQGIQGAKGEKGDQGKRGPHGLIGKTGNPGERGFQGKPGLQGLPGSTGDRGLPGEPGLRGLQGDVGPPGEMGMEGP-------PGTEGESGLQGEPGAKGDVGTAGSVGGTGEPGLRGEPGAPGEEGLQG---------KDGLKGVPGGRGLPGEDGEKGEMGLPGIIGPLGR-SGQTGLPGPEGIVGIPGQRGRPGKKGDKGQIGPTGEVGSRGPPGKIGKSGPKGARGTRGAVGHLGLMGPDGEPGIPGYRGHQGQPGPSGLPGPKGEKGYPG-----------EDSTVLGPPGPRGEPGPVGDQGERGEPGAEGYKGHVGVPGLRGATGQQGPPGEPGDQGEQ--GLKGERGSEGNKGKKGAPGPSGKPGIPGLQGLLGPKGIQGYHGADGISGNPGKIGPPGKQGLPGIRGGPGRTGLAGAPGPPGVKGSSGLPGSPGIQGPKGEQGLPGQPGIQGKRGHRGAQGDQGPCGDPGLKGQPGEYGVQGLTGFQGFPGPKGPEGDAGIVGISGPKGPIGHRGNTGPLGREGIIGPTGRTGPRGEKGFRGET 1458          

HSP 6 Score: 88.5817 bits (218), Expect = 1.055e-16
Identity = 78/184 (42.39%), Postives = 98/184 (53.26%), Query Frame = 3
Query: 3993 RGLQGRKGSTGLRGNIGIPGERGDKGIPGLQGKVGNKGVKGDIGDKGFSGNIGD---------------KGYSGISGDKGSFGVKGDKGFQGDVGMLGKSGLQGDRGQKGIIGFRGTRGIPGSMGLPGEIGEKGDVGPSGIGVKGLKGYQNAVGIKGRKGEKGLPGFPGRPGKVGDQGDKGPKG 4499
            +GL+G +GS G +G  G PG  G  GIPGLQG +G KG++G  G  G SGN G                 G +G++G  G  GVKG  G  G  G+ G  G QG  GQ GI G RG RG  G  G  G+ G KG   P   GV+GL G+Q   G KG +G+ G+ G  G  G +G +G+ GP G
Sbjct: 1254 QGLKGERGSEGNKGKKGAPGPSGKPGIPGLQGLLGPKGIQGYHGADGISGNPGKIGPPGKQGLPGIRGGPGRTGLAGAPGPPGVKGSSGLPGSPGIQGPKGEQGLPGQPGIQGKRGHRGAQGDQGPCGDPGLKGQ--PGEYGVQGLTGFQGFPGPKGPEGDAGIVGISGPKGPIGHRGNTGPLG 1435          

HSP 7 Score: 86.2705 bits (212), Expect = 5.742e-16
Identity = 76/166 (45.78%), Postives = 92/166 (55.42%), Query Frame = 3
Query: 4023 GLRGNIGIPGERGDKGIPGLQGKVGNKGVKGDIGDKGFSGNIGDKGYSGISGDKGSFGVKGDKGFQGDVGMLGKSGLQGDRGQKGIIGFRGTRGIPGSMGLPGEIGEKGDVGPSGI----GVKGLKGYQNAVGIKGRKGEKGLPGFPGRPGKVGD---QGDKGPKG 4499
            G RG  G  G +G  G+PGL+G  G +G  G+ GD+G  G  G++G  G  G KG+ G  G  G  G  G+LG  G+QG  G  GI G  G  G PG  GLPG  G  G  G +G     GVKG  G   + GI+G KGE+GLPG PG  GK G    QGD+GP G
Sbjct: 1216 GERGEPGAEGYKGHVGVPGLRGATGQQGPPGEPGDQGEQGLKGERGSEGNKGKKGAPGPSGKPGIPGLQGLLGPKGIQGYHGADGISGNPGKIGPPGKQGLPGIRGGPGRTGLAGAPGPPGVKGSSGLPGSPGIQGPKGEQGLPGQPGIQGKRGHRGAQGDQGPCG 1381          

HSP 8 Score: 85.5001 bits (210), Expect = 1.136e-15
Identity = 78/193 (40.41%), Postives = 93/193 (48.19%), Query Frame = 3
Query: 3981 GESIRGLQGRKGSTGLRGNIGIPGERGDKGIPGLQGKVGNKGVKGDIGDKGFSGNIGDKGYSGISGDKGSFGVKGDKGFQGDVGMLGKSGLQGDRGQKGIIGFRGTRGIPGSMGLPGEIGEKGDVGPSGI--------------------GVKGLKGYQNAVGIKGRKGEKGLPGFPGRPGKVGDQGDKGPKG 4499
            G  + G  G KG  GL G IG  G  G  G+PG +G VG  G +G  G KG  G IG  G  G  G  G  G  G KG +G  G +G  GL G  G+ GI G+RG +G PG  GLPG  GEKG  G                        G  G +GY+  VG+ G +G  G  G PG PG  G+QG KG +G
Sbjct: 1069 GRGLPGEDGEKGEMGLPGIIGPLGRSGQTGLPGPEGIVGIPGQRGRPGKKGDKGQIGPTGEVGSRGPPGKIGKSGPKGARGTRGAVGHLGLMGPDGEPGIPGYRGHQGQPGPSGLPGPKGEKGYPGEDSTVLGPPGPRGEPGPVGDQGERGEPGAEGYKGHVGVPGLRGATGQQGPPGEPGDQGEQGLKGERG 1261          

HSP 9 Score: 84.3445 bits (207), Expect = 2.346e-15
Identity = 76/205 (37.07%), Postives = 103/205 (50.24%), Query Frame = 3
Query: 3993 RGLQGRKGSTGLRGNIGIPGERGDKGIPGLQGKVGNKGVKGDIGDKGFSGNIGDKGYSGISGDKGSFGV------------------------KGDKGFQGDVGMLGKSGLQGDRGQKGIIGFRGTRGIPGSMGLPGEIGEKGDVGPSGI----------GVKGLKGYQNAVGIKGRKGEKGLPGFPGRPGKVGDQGDKGPKGMK 4505
            RGL G  G  GL+G++G PGE G +G PG +G+ G +G  G  GD G +G++G  G  G+ G+ G+ G                         KG+ G  G +G LG+SG  G  G +GI+G  G RG PG  G  G+IG  G+VG  G           G +G +G    +G+ G  GE G+PG+ G  G+ G  G  GPKG K
Sbjct:  986 RGLPGEPGLRGLQGDVGPPGEMGMEGPPGTEGESGLQGEPGAKGDVGTAGSVGGTGEPGLRGEPGAPGEEGLQGKDGLKGVPGGRGLPGEDGEKGEMGLPGIIGPLGRSGQTGLPGPEGIVGIPGQRGRPGKKGDKGQIGPTGEVGSRGPPGKIGKSGPKGARGTRGAVGHLGLMGPDGEPGIPGYRGHQGQPGPSGLPGPKGEK 1190          

HSP 10 Score: 82.8037 bits (203), Expect = 7.256e-15
Identity = 76/188 (40.43%), Postives = 97/188 (51.60%), Query Frame = 3
Query: 3993 RGLQGRKGSTGLRGNIGIPGERGDKGIPGLQGKVGNKGVKGDIGDKGFSGNIGDKGYSGISGDKGSFGVKGDKGFQGDVGMLGKSGLQGDRGQKGIIGFRGTRGIPGSMGLPGEIGEKGDVGPSGI----------GVKGLKGYQNAVGIKGRKGEKGLP------GFP---GRPGKVGDQGDKGPKG 4499
            +G QG++G  GL G  G PGERG +G PGLQG      + G  GD+G  G  G +G  G  G  G  G++G  G +G+ G+ G+ G +GD G  G +G  G  G+ G  G PGE G +G  G  G+          G KG  G    +G  GR G+ GLP      G P   GRPGK GD+G  GP G
Sbjct:  947 KGDQGKRGPHGLIGKTGNPGERGFQGKPGLQG------LPGSTGDRGLPGEPGLRGLQGDVGPPGEMGMEGPPGTEGESGLQGEPGAKGDVGTAGSVGGTGEPGLRGEPGAPGEEGLQGKDGLKGVPGGRGLPGEDGEKGEMGLPGIIGPLGRSGQTGLPGPEGIVGIPGQRGRPGKKGDKGQIGPTG 1128          

HSP 11 Score: 80.4925 bits (197), Expect = 3.597e-14
Identity = 73/174 (41.95%), Postives = 99/174 (56.90%), Query Frame = 3
Query: 3993 RGLQGRKGSTGLRGNIGIPGERGDKGIPGLQGKVGNKGVKGDIGDKGFSGNIGDKGYSGISGDKGSFGVKGDKGFQGDVGMLGKSGLQGDRGQKGIIGFRGTRGIPGSMGLPGEIGEKGDVGPS----GIGVKGLKGYQNAVGIKGRKGEKGLPGFPGRPGKVGDQGDKGPKGM 4502
            RG  G +G  G RG+ G  G  G++GI G +G+ G++G +G  G  G +GN G++G+ G  G +G  G  GD+G  G+ G+    GLQGD G  G +G  G  G  G  GL GE G KGDVG +    G G  GL+G   A G +G +G+ GL G PG  G  G+ G+KG  G+
Sbjct:  914 RGPPGSQGPKGQRGSRGPDGLLGEQGIQGAKGEKGDQGKRGPHGLIGKTGNPGERGFQGKPGLQGLPGSTGDRGLPGEPGL---RGLQGDVGPPGEMGMEGPPGTEGESGLQGEPGAKGDVGTAGSVGGTGEPGLRGEPGAPGEEGLQGKDGLKGVPGGRGLPGEDGEKGEMGL 1084          

HSP 12 Score: 76.2554 bits (186), Expect = 7.040e-13
Identity = 78/178 (43.82%), Postives = 99/178 (55.62%), Query Frame = 3
Query: 3993 RGLQGRKGSTGLRGNIGIPGERGDKGIPGLQGKVGNKGVKGDIGDKG---FSGNIGDKGYSGISGDKGSFGVKGDKGFQGDVGMLGKSGLQGDRGQKGIIGFRGTRGIPGSMGLPGEIGEKGDVGPSGI-GVKGLKGYQNAVGIKGRKGEKGLPGFPGRPGKVGDQGD---KGPKGMK 4505
            +GL+G  G  GL G  GIPG  G+ G PG  G+ G  G +G+ G KG   F G+ G+ G  G  G++G  G++G KGF+G  G  G  G +G  G  G  G  G  G PG  GL G +G  G +GP+GI G  GL G +   GIKG KGE+G  G  G PG  GD+G     GP GM+
Sbjct:  569 KGLKGHPGLPGLPGEQGIPGFAGNIGSPGYPGRQGLAGPEGNPGPKGAQGFIGSPGEAGQLGPEGERGIPGIRGKKGFKGRQGFPGDFGDRGPAGLDGSPGLVGGTGPPGFPGLRGSVGPVGPIGPAGIPGPMGLSGNKGLPGIKGDKGEQGTAGELGEPGYPGDKGAVGLPGPPGMR 746          

HSP 13 Score: 72.4034 bits (176), Expect = 1.034e-11
Identity = 72/194 (37.11%), Postives = 91/194 (46.91%), Query Frame = 3
Query: 3996 GLQGRKGSTGLRGNIGIPGERGDKGIPGLQGKVGNKGVKGDIGDKGFSGNIGDK---------------------GYSGISGDKGSFGVKGDKGFQGDVGMLGKSGLQGDRGQKGIIGFRGTRGIPGSMGLPGEIGEKGDVGPSGIGVKGLKGYQNAVGIKGRKGEKGLPGFPGRPGKVGDQGDKGPKGMKNMN 4514
            G +G KG  G +GNIG  GE G  G+PG  G  G+ G KG+ G  G  G  G+K                     G+ G  G  GS G KG +G +G  G+LG+ G+QG +G+KG  G RG  G+ G  G PGE                 +G+Q   G++G  G  G  G PG PG  G QGD GP G   M 
Sbjct:  834 GPEGLKGEVGDQGNIGKIGETGPVGLPGEVGMTGSIGEKGERGSPGPLGPQGEKGVMGYPGPPGVPGPIGPLGLPGHVGARGPPGSQGPKGQRGSRGPDGLLGEQGIQGAKGEKGDQGKRGPHGLIGKTGNPGE-----------------RGFQGKPGLQGLPGSTGDRGLPGEPGLRGLQGDVGPPGEMGME 1010          

HSP 14 Score: 71.2478 bits (173), Expect = 1.897e-11
Identity = 65/156 (41.67%), Postives = 82/156 (52.56%), Query Frame = 3
Query: 4053 ERGDKGIPGLQGKVGNKGVKGDIGDKGFSGNIGDKGYSGISGDKGSFGVKGDKGFQGDVGMLGKSGLQGDRGQKGIIGFRGTRGIPGSMGLPGEIGEKGDVGPSGIGVKGLKGYQNAVGIKGRKGEKGLP------GFPGRPGKVGDQGDKGPKGM 4502
            +RG +GIPG  G  G  G+ G  G KG  G    +   G  GD+G  G+ G  G QGD G+ G  GL G  G++GI GF G  G PG  G  G  G +G+ GP   G +G  G     G  G +GE+G+P      GF GR G  GD GD+GP G+
Sbjct:  511 KRGPRGIPGPHGNPGLPGLPGPKGPKGDPGFSPGQPVPGEKGDQGLSGLMGPPGMQGDKGLKGHPGLPGLPGEQGIPGFAGNIGSPGYPGRQGLAGPEGNPGPK--GAQGFIGSPGEAGQLGPEGERGIPGIRGKKGFKGRQGFPGDFGDRGPAGL 664          

HSP 15 Score: 65.855 bits (159), Expect = 1.002e-9
Identity = 66/165 (40.00%), Postives = 83/165 (50.30%), Query Frame = 3
Query: 3993 RGLQGRKGSTGLRGNIG---------IPGERGDKGIPGLQGKVGNKGVKGDIGDKGFSGNIGDKGYSGISGDKGSFGVKGDKGFQGDVGMLGKSGLQGDRGQKGIIGFRGTRGIPGSMGLPGEIGEKGDVGPSG-IGVKGLK---GYQNAVGIKGRKGEKGLPGF 4448
            +G+QG  G+ G+ GN G         +PG RG  G  GL G  G  GVKG  G  G  G  G KG  G+ G  G  G +G +G QGD G  G  GL+G  G+ G+ G  G +G PG  G  G+ G  G  GP G IG +G     G +  +G  GR G +G  GF
Sbjct: 1290 KGIQGYHGADGISGNPGKIGPPGKQGLPGIRGGPGRTGLAGAPGPPGVKGSSGLPGSPGIQGPKGEQGLPGQPGIQGKRGHRGAQGDQGPCGDPGLKGQPGEYGVQGLTGFQGFPGPKGPEGDAGIVGISGPKGPIGHRGNTGPLGREGIIGPTGRTGPRGEKGF 1454          

HSP 16 Score: 65.4698 bits (158), Expect = 1.128e-9
Identity = 77/208 (37.02%), Postives = 102/208 (49.04%), Query Frame = 3
Query: 3984 ESIRGLQGRKGSTGLRGNIGIPGERGDKGIPGLQGKVG---------NKGVKGDIGDKGFSGNIGDKGYSGISGDKGSFGVKGDKGFQGDVGMLGKSGLQGDRGQKGIIGFRGTRGIPGSMGLPG------------------EIGEKGDVGPSGI-GVKGLKGYQNAVGIKGRKGEKGLPGF------PGRPGKVGDQGDKGPKGMK 4505
            E  RG+ G +G  G +G  G PG+ GD+G  GL G  G           G++G +G  G  G  G  G  G+SG+KG  G+KGDKG QG  G LG+ G  GD+G  G+ G  G RG  G  G  G                  +IG  G  GP G  G+ G +G     G+KG +GE+G  G        G+PG+ G  G+ GP+G+K
Sbjct:  632 EGERGIPGIRGKKGFKGRQGFPGDFGDRGPAGLDGSPGLVGGTGPPGFPGLRGSVGPVGPIGPAGIPGPMGLSGNKGLPGIKGDKGEQGTAGELGEPGYPGDKGAVGLPGPPGMRGKSGPSGQTGDPGLQGPSGPPGPEGFPGDIGIPGQNGPEGPKGLLGNRGPPGPPGLKGTQGEEGPIGAFGELGPRGKPGQKGYAGEPGPEGLK 839          

HSP 17 Score: 63.1586 bits (152), Expect = 5.585e-9
Identity = 74/201 (36.82%), Postives = 95/201 (47.26%), Query Frame = 3
Query: 3996 GLQGRKGSTGLRGNIGIPGERGDKGIPGLQGKVGNKGVKGDIGDKGFSGNIGDKGYSGISGDKG------------------SFGVKGDKGFQGDVGMLGK------SGLQGDRGQKGIIGF------------RGTRGIPGSMGLPGEIGEKGDVGPSGIGVKGLKGYQNAVGIKGRKGEKGLPGFPGRPGKVGDQGDKG 4490
            G  G  G  GL GN G+PG +GDKG  G  G++G  G  GD G  G  G  G +G SG SG  G                    G+ G  G +G  G+LG        GL+G +G++G IG             +G  G PG  GL GE+G++G++G   IG  G  G    VG+ G  GEK   G  G PG +G QG+KG
Sbjct:  693 GPAGIPGPMGLSGNKGLPGIKGDKGEQGTAGELGEPGYPGDKGAVGLPGPPGMRGKSGPSGQTGDPGLQGPSGPPGPEGFPGDIGIPGQNGPEGPKGLLGNRGPPGPPGLKGTQGEEGPIGAFGELGPRGKPGQKGYAGEPGPEGLKGEVGDQGNIG--KIGETGPVGLPGEVGMTGSIGEK---GERGSPGPLGPQGEKG 888          

HSP 18 Score: 62.7734 bits (151), Expect = 7.692e-9
Identity = 55/140 (39.29%), Postives = 77/140 (55.00%), Query Frame = 3
Query: 3990 IRGLQGRKGSTGLRGNIGIPGERGDKGIPG---LQGKVGNKGVKGDIGDKGFSGNIGDKGYSGISGDKGSFGVKGDKGFQGDVGMLGKSGLQGDRGQKGIIGFRGTRGIPGSMGLPGEIGEKGDVGPSG-IGVKGLKGYQ 4397
            + G++G  G TGL G  G PG +G  G+PG   +QG  G +G+ G  G +G  G+ G +G  G  GD G  G  G+ G QG  G  G  G +G  G  GI+G  G +G  G  G  G +G +G +GP+G  G +G KG++
Sbjct: 1316 LPGIRGGPGRTGLAGAPGPPGVKGSSGLPGSPGIQGPKGEQGLPGQPGIQGKRGHRGAQGDQGPCGDPGLKGQPGEYGVQGLTGFQGFPGPKGPEGDAGIVGISGPKGPIGHRGNTGPLGREGIIGPTGRTGPRGEKGFR 1455          

HSP 19 Score: 60.077 bits (144), Expect = 5.073e-8
Identity = 71/182 (39.01%), Postives = 89/182 (48.90%), Query Frame = 3
Query: 4005 GRKGSTGLRGNIGIPGERGDKGIPGLQGKVGNKGVKGDIGDKGFSGNIGDKGYSGISGDKGSFGVKGDKGFQGDVGMLGKSGLQGDRGQKGIIGFRGTRGIPGSMGLPGEIGEKGDVG-------------PSGIGVKGLKGYQNAVGIKGRKGEKGL---PGFPGRPGKVGDQGDKGPKGM 4502
            G  G  G  G  G+ G RG  G PGL+G  G +G  G  G+ G  G  G KGY+G  G +G  G  GD+G  G +G  G  GL G+ G  G IG +G RG PG +G  GE G  G  G             P  +G +G  G Q   G +G +G  GL    G  G  G+ GDQG +GP G+
Sbjct:  777 GIPGQNGPEGPKGLLGNRGPPGPPGLKGTQGEEGPIGAFGELGPRGKPGQKGYAGEPGPEGLKGEVGDQGNIGKIGETGPVGLPGEVGMTGSIGEKGERGSPGPLGPQGEKGVMGYPGPPGVPGPIGPLGLPGHVGARGPPGSQGPKGQRGSRGPDGLLGEQGIQGAKGEKGDQGKRGPHGL 958          

HSP 20 Score: 58.5362 bits (140), Expect = 1.677e-7
Identity = 50/112 (44.64%), Postives = 63/112 (56.25%), Query Frame = 3
Query: 3996 GLQGRKGSTGLRGNIGIPGERGDKGI---------PGLQGKVGNKGVKGDIGDKGF---SGNIGDKGYSGISGDKGSFGVKGDKGFQGDVGMLGKSGLQGDRGQKGIIGFRG 4295
            G+QG KG  GL G  GI G+RG +G          PGL+G+ G  GV+G  G +GF    G  GD G  GISG KG  G +G+ G  G  G++G +G  G RG+K   GFRG
Sbjct: 1348 GIQGPKGEQGLPGQPGIQGKRGHRGAQGDQGPCGDPGLKGQPGEYGVQGLTGFQGFPGPKGPEGDAGIVGISGPKGPIGHRGNTGPLGREGIIGPTGRTGPRGEK---GFRG 1456          

HSP 21 Score: 56.9954 bits (136), Expect = 4.306e-7
Identity = 95/295 (32.20%), Postives = 124/295 (42.03%), Query Frame = 3
Query: 2961 KIGNQGLPGDQXXXXXXXXXXXXXXXXYIGIPGFEGDRGEKGNKGF------PGFPGDIGQPGRLGNPGISTEGVXXXXXXXXXXXXXXXXXXXXXXXXXXKQGDSGIS-------IPGRQGIKGEDGTIGLPGEMGEPGPRGDFGQKGNIGITGEFGLQGNRGDDGLKGDDGIPGLNGPRGFIGDIGFVGFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXELGLDGSMGGKGDNGPRGFNGPTGIPGSKGFEGDKGIRGDIGVKGFQGQHGEIGFPGLKGVSGENG 3806
            K G +G+PG  G P               G+PG  G +G KG+ GF      PG  GD G  G +G PG+                                QGD G+        +PG QGI G  G IG PG  G  G  G  G  G  G  G  G  G  G  G +G+ GIPG+ G +GF G  GF G                      G+ G  G  G  G +G +G  G +G  G  GP G +G  G+PG KG +G++G  G++G  G+ G  G +G PG  G+ G++G
Sbjct:  511 KRGPRGIPGPHGNP---------------GLPGLPGPKGPKGDPGFSPGQPVPGEKGDQGLSGLMGPPGM--------------------------------QGDKGLKGHPGLPGLPGEQGIPGFAGNIGSPGYPGRQGLAGPEGNPGPKGAQGFIGSPGEAGQLGPEGERGIPGIRGKKGFKGRQGFPG--------DFGDRGPAGLDGSPGLVGGTGPPGFPGLRGSVGPVGPIGPAGIPGPMGLSGNKGLPGIKGDKGEQGTAGELGEPGYPGDKGAVGLPGPPGMRGKSG 750          

HSP 22 Score: 56.9954 bits (136), Expect = 4.491e-7
Identity = 65/167 (38.92%), Postives = 81/167 (48.50%), Query Frame = 3
Query: 3990 IRGLQGRKGSTGLRGNIGIPGERGDKGIPGLQGKVGNKGVKGDIGDKGFSGNIGDKGYSGISGDKGSFGVKGDKGFQGDVGMLGKSGLQGDRGQKGIIGFRGTRGIPGSMGLPGEIGEKGDVGPSGIGVKGLKGYQNAVGIKGRKGEKGLPGFPGRPGKVGDQGDKG 4490
            + G +G  G  G +G IG PGE G  G  G +G  G +G KG  G +GF G+ GD+G +G+ G  G  G  G  GF G  G +G  G  G  G  G +G  G +G+PG  G  GE G  G++G                G  G KG  GLPG PG  GK G  G  G
Sbjct:  604 LAGPEGNPGPKGAQGFIGSPGEAGQLGPEGERGIPGIRGKKGFKGRQGFPGDFGDRGPAGLDGSPGLVGGTGPPGFPGLRGSVGPVGPIGPAGIPGPMGLSGNKGLPGIKGDKGEQGTAGELG--------------EPGYPGDKGAVGLPGPPGMRGKSGPSGQTG 756          
BLAST of Collagen IV NC1 domain-containing protein vs. Ensembl Human
Match: COL4A6 (collagen type IV alpha 6 chain [Source:HGNC Symbol;Acc:HGNC:2208])

HSP 1 Score: 276.944 bits (707), Expect = 2.575e-74
Identity = 439/1198 (36.64%), Postives = 547/1198 (45.66%), Query Frame = 3
Query:  201 GNKGRQGFPGPRGYQGVSGDKGDVGQFGMPGPKGYKGFTGAIGPQGRKGERGIPGSPGYPGKMGEMGFPGIRGDIGEKGLTGCDGQQGDFGNPGMNGLVGRTGQPGERGDDGDRGLSIIPKYGLKG--------------------------NKGSRGLLGRYGRKGEKGFKGIKGYSGIFGIKGNKGYVGPMGRRGPKGDSLGTVI--IQSEKGSKGDKGLKGQSGIPCKGFQIEGRMYGRVGSDGPIGDKGIKGE------KGLMGEIGQSGIDGARGLNGEKG-----------LPGEAGPRGERGDRGNPGFPGD--PGASGADGTRGRQGERGPKGVHGISGADGPRGSRGDKGPSGSLLSC--PGRKGEKGFFGIPGIKGDIGNKGYQGHDGDIGEIGFKGEKGYEGPLGPSCSEVEQGFRGTKGESGFPGLRGAKGQRGYSGNKGIKGKPNFGTGINNPGETGSYGNLGVPGEKGNKGFIGDTGEKGFSGT-GKQGPEGPRGDKGDDGVNGQVGMIGMPGIKGDKG----STYPICPFCEKGYKGIQXXXXXXXXXXXXXXXXXXXXXXXXXX---XXDEGRMGLLGSKGRQGYKGGKGFSGSMGDAGEIGYVTISGTTIPGVKGEKGNQGPKGNKGEFGEAGSRGRKGYSGLKGFKGLIGERGTSFSSGDPGDKGLRGENGKDGVSFA-GIPGEKGLKGDKGN----------------RGILGDVGSLSNCATRPITSKGFKGPQGAKGTSGSPGSAGKTGIVGNKGENGYPGKRGIDGDNG-------IPGSKGEEGETGIKGHAGRPGNLGKSGLQGLRGE---YGVKGDLGIQGIPGRKGVMGDPGPNGYAMIGSKGDKGIKGLPGIYGAKGDKGRPGYIGIPGFKGETGLIGRSGLKGDQGEIGEKGIKGFTFISNNPGDRGLLGNKGLKGFPGE-LGNKGQVGVCTVRGDQGLRGYSGLIGDMGMKGEQGSKGIVGDYGAASRSGIMGRTGKIGNQGLPGDQXXXXXXXXXXXXXXXX---------YIGIPGFEGDRGEKGNKGFPGFPGDIGQPGRLGNPGISTEGVXXXXXXXXXXXXXXXXXXXXXXXXXXKQGDSGISIPGRQGIKGEDGTIGLPGEMGEPGPRGDFGQKGNIGITGEFGLQGNRGDDG---------LKGDDGIPGLNGPRGFIGDIG 3485
            G KG  GFPG  G+QG+ G KGD+G   +PGP  +    GA+         G PG PG PG       PG++GD G +GL G  G  G     G+ G +G  G PG +GD G+ G + I   GL G                            G  GL G  G KG  G KGIKG SG     G     GP G  GP G      +  ++  +G +G  G +G +G P           G VG  GP G KG KGE      +G+ G+ G SG  G RG+ GE G                G +G  G++G PG PG+            G  G  GP+G+ G  G DG  G +G  G  G  L C  PG  G  GF G PG  G  G++G  G  G  G  G KGE G  G +         G RG KG  GFPGL G  G  G  G+ G+ G     TG     E G+ G  G+ G  G+KGF+GD+G  G  G  GK G  GP+G++G  G  GQVG  G PG  G  G    S  P  P    G+ GI G  G++G  G  G  G    KG  GL   PG+ G +GL GS G  G  G    SG  G+ G +G+V   G  IPG+ G  G +G KG  G  G+ G  GR G  G KG +G  G  G         +  L+G+ G  G + + G PG +G KG+ G                 +G+ G  G       R +   G KG  G  G  G PG +G  GI G+ G  G  G  G+ GDNG        PG KG+ GE+G KG  GR G +G  G  G +GE    GV GD+G+ G PG  GV G            +G+ G+ G  G  GA G  G PG IG  GF G  GL G +GL G +G  G  G      I+  PG  GL G KG KG+PG  +G  G+ G+   RG +G RG+ GL         QG  G+ G  G +  S I G+ G  G  GL G++G PG  G  G  G            + GIPG +G +G++G  GF G PG++G  G  G PG    G  G  G  G PG  G  G  G  G  G QGD G   P  + ++   G +GLPG  G PG  GD G +G +G+ G  GL G  G DG           GD G+PGL GP GF G  G
Sbjct:  317 GKKGTLGFPGLNGFQGIEGQKGDIG---LPGPDVFIDIDGAV-------ISGNPGDPGVPG------LPGLKGDEGIQGLRGPSGVPGLPALSGVPGALGPQGFPGLKGDQGNPGRTTIGAAGLPGRDGLPGPPGPPGPPSPEFETETLHNKESGFPGLRGEQGPKGNLGLKGIKGDSGFCACDGGVPNTGPPGEPGPPGPWGLIGLPGLKGARGDRGSGGAQGPAGAP-----------GLVGPLGPSGPKGKKGEPILSTIQGMPGDRGDSGSQGFRGVIGEPGKDGVPGLPGLPGLPGDGGQGFPGEKGLPGLPGEKGHPGPPGLPGNGLPGLPGPRGLPGDKGKDGLPGQQGLPGSKGITLPCIIPGSYGPSGFPGTPGFPGPKGSRGLPGTPGQPGSSGSKGEPGSPGLVHLPELPGFPGPRGEKGLPGFPGLPGKDGLPGMIGSPGLPGS-KGATGDIFGAENGAPGEQGLQGLTGHKGFLGDSGLPGLKGVHGKPGLLGPKGERGSPGTPGQVGQPGTPGSSGPYGIKGKSGLPGAP----GFPGISGHPGKKGTRGKKGPPGSIVKKGLPGLKGLPGNPGLVGLKGSPGSPGVAGLPALSGPKGEKGSVGFVGFPG--IPGLPGIPGTRGLKGIPGSTGKMGPSGRAGTPGEKGDRGNPGPVGIPSPRRPMSNLWLKGDKGSQGSAGSNGFPGPRGDKGEAGRPGPPGLPGAPGLPGIIKGVSGKPGPPGFMGIRGL--PGLKGSSGITGFPGMPGESGSQGIRGSPGLPGASGLPGLKGDNGQTVEISGSPGPKGQPGESGFKGTKGRDGLIGNIGFPGNKGEDGKVGVSGDVGLPGAPGFPGVAG-----------MRGEPGLPGSSGHQGAIGPLGSPGLIGPKGFPGFPGLHGLNGLPGTKGTHGTPGPS----ITGVPGPAGLPGPKGEKGYPGIGIGAPGKPGL---RGQKGDRGFPGL---------QGPAGLPGAPGISLPSLIAGQPGDPGRPGLDGERGRPGPAGPPGPPGPSSNQGDTGDPGFPGIPGPKGPKGDQGIPGFSGLPGELGLKGMRGEPGFM--GTPGKVGPPGDPGFPGMKGKAGPRGSSGLQGDPG-QTPTAEAVQVPPGPLGLPGIDGIPGLTGDPGAQGPVGLQGSKGLPGIPGKDGPSGLPGPPGALGDPGLPGLQGPPGFEGAPG 1448          

HSP 2 Score: 259.996 bits (663), Expect = 4.927e-69
Identity = 488/1353 (36.07%), Postives = 623/1353 (46.05%), Query Frame = 3
Query:  186 KCQCFGNKGRQGFPGPRGYQGVSGDKGDVGQFGMPGPKGYKGFTGAIGPQGRKGERGIPGSPGYPGKMGEMGFPGIRGDIGEKGLTGCDGQQGDFGNPGMNGL---VGRTGQPGERGDDGDRGLSIIPKYGLKGNKGSRGLLGRYGRKGEKGFKGIK--------------------------GYSGIFGIKGNKGYVGPMGRRGPKGDSLGTVIIQSEKGSKGDKGLKGQSGIP-CKGFQ-----------IEGRMYGRVGSDGPIGDKGIK---GEKGLMGEIGQSGIDGARGLNGEKGLPGEAGPR-----GERGDRGNPGFPGDPGASGADGTRGRQGERGPKGVHGISGADGPRGSRGDKGPSGSLLSCPGRKGEKGFFGIPGIKGDIGNKGYQGHDGDIGEIGFKGEKGYEGPLGPSCSEVEQGFRGTKGESGFPGLRGAKGQRGYSGNKGIKGKPNFGT---GINNP------GETGSYGNLGVPGEKGNKGFIGDTGEKGFSGT-GKQGPEGPRGDKGDDGVNGQVGMIGMPGIKGDKGSTYPICPFCEKGYKGIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEGRMGLLGSK--------------------GRQGYKGGKGFSGSMGDAGEIGYV---TISGTTIP-------GVKGEKGNQGPKGNKGEFGEAGSRGRKGYSG------LKGFKGLIGERGTSFSSGDPGDKGLRGENGKDGV------------SFAGIPGEKGLKGDKGNRGILGDVG--SLSNCATRPITSKGFKGPQGAKGTSGSPGSAGKTGIVGNKGENGYPGKRGIDGDNGIPGSKGEEGETGIKGHAGRPGNLGKSGLQGLRGEYGVKGDLGIQGIPGRKGVMGDPGPNGYAMIGSKGDKGIKGLPGIYGAKGDKGRPGYIGIPGFKGETGLIGRSGLKGDQGEIGEKGIKGFTF----ISN--NPGDRGLLGNKGLKGFPGELGNKGQV----------------------------GVCTVRGDQGLRGYSGLIGDMGMKGEQGSKGIVGDYGAASRSGIMGRTGKIGN----QGLPGDQXXXXXXXXXXXXXXXXYIGIPGFEGDRGEKGNKGFPGFPGDIGQPGRLGNPGIS----TEGVXXXXXXXXXXXXXXXXXXXXXXXXXXKQGDSGIS-IPGRQGIKGEDG--TIGLPGEMGEPGPRGDFGQKG-NIGITGEFGLQGNRGDDGLKGDDGIPGLNGPRGFIGDIGFVGFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXELGLDGSMGGKGDNGPRGFNGPTGIPGSKGFEGDKGIRGDIGVKGFQGQHGEIGFPG 3779
             CQCF  KG +G PGP G QG +G +G  G  G+ G KG +GF G +GP G KG++G  G PG+ G  G  G PG  G  G  GL GC+G QG  G PG +G    +G  G PG++G  GD  L+     G+KG+ G  GL G  G +G  GF G                            G+ G  G+KG+ G  GP G     G+       + +KGSKG+ G KG  GI    GF             E  + G  G  GP+G +G++   G++G  G +G  G++G +G+ G+KG  G  GP            GNPG PG PG  G  G  G QG RGP GV G+                 +L   PG  G +GF   PG+KGD GN G     G  G  G  G  G  GP GP   E E      K ESGFPGLRG +G +G  G KGIKG   F     G+ N       G  G +G +G+PG KG +G  G  G +G +G  G  GP GP G KG  G      + GMPG +GD GS         +G++G+      +               G +G PG++G  GL G K                    G  G KG  G  G  G  G  G      I G+  P       G  G KG++G  G  G+ G +GS+G  G  G      L GF G  GE+G     G PG  GL G  G  G+            +  G PGE+GL+G  G++G LGD G   L     +P    G  GP+G +G+ G+PG  G+ G  G+ G  G  GK G+ G  G PG  G  G+ G +G  G PG++ K GL GL+G  G  G +G++G PG  GV G P  +G    G KG  G  G PGI G  G  G  G  GIPG  G+ G  GR+G  G++G+ G  G  G       +SN    GD+G  G+ G  GFPG  G+KG+                             G   +RG  GL+G SG+ G  GM GE GS+GI G  G    SG+ G  G  G      G PG +G PG  GFKG KG  G IG  GF G++GE G     G  GD+G PG  G PG++      G+ G  G  G  GP+G PGL G  G PG  G  G++ +PG +G  G  G    G+PG  G PGP+G+ G  G  IG  G+ GL+G       KGD G PGL GP G  G  G         +               G+ G +G  G  G  G  G   + G  GD G  G  GP G  G +G  G  G+ G++G+KG +G+ G +G PG
Sbjct:   38 SCQCFPEKGARGRPGPIGIQGPTGPQGFTGSTGLSGLKGERGFPGLLGPYGPKGDKGPMGVPGFLGINGIPGHPGQPGPRGPPGLDGCNGTQGAVGFPGPDGYPGLLGPPGLPGQKGSKGDPVLAPGSFKGMKGDPGLPGLDGITGPQGAPGFPGAVGPAGPPGLQGPPGPPGPLGPDGNMGLGFQGEKGVKGDVGLPGPAGPPPSTGELEFMGFPKGKKGSKGEPGPKGFPGISGPPGFPGLGTTGEKGEKGEKGIPGLPGPRGPMGSEGVQGPPGQQGKKGTLGFPGLNGFQGIEGQKGDIGLPGPDVFIDIDGAVISGNPGDPGVPGLPGLKGDEGIQGLRGPSGVPGLP----------------ALSGVPGALGPQGF---PGLKGDQGNPGRT-TIGAAGLPGRDGLPGPPGPPGPPSPEFETETLHNK-ESGFPGLRGEQGPKGNLGLKGIKGDSGFCACDGGVPNTGPPGEPGPPGPWGLIGLPGLKGARGDRGSGGAQGPAGAPGLVGPLGPSGPKGKKGEPILSTIQGMPGDRGDSGS---------QGFRGV-IGEPGKDGVPGLPGLPGLPGDGGQGFPGEKGLPGLPGEKGHPGPPGLPGNGLPGLPGPRGLPGDKGKDGLPGQQGLPGSKGITLPCIIPGSYGPSGFPGTPGFPGPKGSRGLPGTPGQPGSSGSKGEPGSPGLVHLPELPGFPGPRGEKGLPGFPGLPGKDGLPGMIGSPGLPGSKGATGDIFGAENGAPGEQGLQGLTGHKGFLGDSGLPGLKGVHGKP----GLLGPKGERGSPGTPGQVGQPGTPGSSGPYGIKGKSGLPGAPGFPGISGHPGKKGTRGKKGPPGSIVKKGLPGLKGLPGNPGLVGLKGSPGSPGVAGLPALSGPK--GEKGSVGFVGFPGIPGLPGIPGTRGLKGIPGSTGKMGPSGRAGTPGEKGDRGNPGPVGIPSPRRPMSNLWLKGDKGSQGSAGSNGFPGPRGDKGEAGRPGPPGLPGAPGLPGIIKGVSGKPGPPGFMGIRGLPGLKGSSGITGFPGMPGESGSQGIRGSPGLPGASGLPGLKGDNGQTVEISGSPGPKGQPGESGFKGTKGRDGLIGNIGFPGNKGEDGKV---GVSGDVGLPGAPGFPGVAGMRGEPGLPGSSGHQGAIGPLGSPGLIGPKGFPGFPGLHGLNGLPGTKGTHGTPGPSITGVPGPAGLPGPKGEKGYPGIGIGAPGKPGLRGQ------KGDRGFPGLQGPAGLPGAPGI--------SLPSLIAGQPGDPGRPGLDGERGRPGPAGPPGPPGPSSNQGDTGDPGFPGIPGPKGPKGDQGIPGFSGLPGELGLKGMRGEPGFMGTPG 1336          

HSP 3 Score: 250.751 bits (639), Expect = 3.355e-66
Identity = 172/515 (33.40%), Postives = 232/515 (45.05%), Query Frame = 3
Query: 3990 IRGLQGRKGSTGLRGNIGIPG------------ERGDKGIPGL---------------------QGKVGNKGVKGDIGDKGFSGNIGDKGYSGISGDKGSFGVKGDKGFQGDVGML------------------GKSGLQGDRGQ----KGIIGFRGTRGIPGSMGLPGEIGEKGDVGPSGI-GVKGLKGYQ------NAVGIKGRKGEKGLPGFPGRPGKVGDQGDKGPKGMKNMNTXXXXXXXXXXXXXXXXXXXXXXXXXLPGDMGEIGPNGPIGYADNGFLYATHSQSKDFPPCHGGGSPLYNGYSLLAIHGDIDSVTMDLGTPGSCLKNFSTIPFVNCFLERNTFYGGRCHVNMRNSRSYWLSTLQSYMSSPQPPSKMDDYISRCSVCQTKTTVMAFHSQKSDWQMTKCPYGWQKLWAGFSFPMAVQASRSGSNQPFSSPGSCLKHFRSLPFIECNNHNSNCNHWRDGVSYYMTAVDSENQFVKAQGKVLKSQTDIMNSISKCVVCQRDM 5348
            +RG +G +G  GL+G  G+PG            + GD G PGL                     QG  G+ G  G  G KG  G+ G  G+SG+ G+ G  G++G+ GF G  G +                  G SGLQGD GQ    + +    G  G+PG  G+PG  G+ G  GP G+ G KGL G           G  G  G+ GLPG  G PG  G  G +GP GM  M                            PG    +           G+    HSQS+  PPC  G S L+ GYSLL + G   +   DLG  GSCL  FST+PF+ C +         CH   RN +SYWLST       P   +++  YISRCSVC+  +  +A HSQ  D  + +CP GW+ LW G+SF M   A   G  Q   SPGSCL+ FR+ PFIEC+     C+++ +  S+++T V+   QF +           +   +S+C VC + +
Sbjct: 1223 LRGQKGDRGFPGLQGPAGLPGAPGISLPSLIAGQPGDPGRPGLDGERGRPGPAGPPGPPGPSSNQGDTGDPGFPGIPGPKGPKGDQGIPGFSGLPGELGLKGMRGEPGFMGTPGKVGPPGDPGFPGMKGKAGPRGSSGLQGDPGQTPTAEAVQVPPGPLGLPGIDGIPGLTGDPGAQGPVGLQGSKGLPGIPGKDGPSGLPGPPGALGDPGLPGLQGPPGFEGAPGQQGPFGMPGM----------------------------PGQSMRV-----------GYTLVKHSQSEQVPPCPIGMSQLWVGYSLLFVEGQEKAHNQDLGFAGSCLPRFSTMPFIYCNINE------VCHYARRNDKSYWLSTTAPIPMMPVSQTQIPQYISRCSVCEAPSQAIAVHSQ--DITIPQCPLGWRSLWIGYSFLMHTAAGAEGGGQSLVSPGSCLEDFRATPFIECSGARGTCHYFANKYSFWLTTVEERQQFGELPVSETLKAGQLHTRVSRCQVCMKSL 1690          

HSP 4 Score: 248.44 bits (633), Expect = 1.506e-65
Identity = 449/1381 (32.51%), Postives = 559/1381 (40.48%), Query Frame = 3
Query:  237 GYQGVSGDKGDVGQFGMPGPKGYKGFTGAIG-PQGRKGERGIPGSPGYPGKMGEMGFPGI--------------------RGDIGEKGLTGCDGQQG---DFGNPGMNGLVGRTGQPGERGDDGDRGLSIIPKYGLKGNKGSRGLLGRYGRKGEKGFKGIKGYSGIFGIKGNKGYVGPMGRRGPKGDSLGTVIIQSEKGSKGDKGLKGQSGIPCKGF------------------QIEGRMYGRVGSDGPIGDKGIKGEKGLMGEIGQSGIDGARGLNGEKGLPGEAGPRGERGDRGNPGFPGDPGASGADGTRGRQGERGPKGVHGISGADGPRGSRGDKGPSGSLLSCPGRKGEKGFFGIPGIKGDIGNKGYQGHDGDIGEIG--------------------FKGEKGYEGPLG--------------PSCSEVEQGFRGTKGESGFPGLRGAKGQRGYS---------GNKGIKGKPNFGTGINNPGETGSYGNLGVPGEKGNKGFIGDTGEKGFSGTGK-QGPEGPRGDKGDDGV------NGQVGMIGMPGIKGDKGSTYPICPFCEKGYKGIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEGRMGLLGSKGRQGYKGGKGFSGSMGDAGEIGYVTISGTTIP-GVKGEKGNQGPKGNKGEFGEA------------GSRGRKGYSGLKGFKGLIGERGTSFSSGDPGDKGL------RGENGKDG-VSFAGIPGEKGLKGDKGNRGILGDVGSLSNCATRPITSKGFKGPQGAKGTSGSPGSAGKTGIVG---------NKGENGYPGKRGIDGDNGIPGSKGEEGET-------------------GIKGHAGRPGNLGKSGLQGLRGEYGVKGDLGIQGIPGRKGVMGDPG-PNGYAMIGSKGDKGIKGLPGIYGAKGDKGRPGYIGIPGFKGETGLIGRSGLKGDQGEIGEKGIKGFTFISNNPGDRGLLGNKGLKGFPGELGNKGQVGVCTVRGDQGLRGYSGLIGDMGMKGEQGSKGIVGDYGAASRSGIMGRTGKIGNQGLPGDQXXXXXXXXXXXXXXXXYIGIPGFEGDRGEKGNKGFPGFPGDIGQPGRLGNPGISTEGVXXXXXXXXXXXXXXXXXXXXXXXXXXKQGDSGISIPGRQGIKGE---------------------DGTIGLPGEMGEPGPRGDFGQKGNIGITGEFGLQGNRGDDGLKGDDG------------IPGLNGPRGFIGDIGFVGFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXELGLDGSMGGKGDNGPRGFNGPTGIPGSKGFE------------------GDKGIRGDIGVKGFQ---GQHGEIGFPGLKGVS 3794
            G+QG  G KGDVG  G  GP    G    +G P+G+KG +G PG  G+PG  G  GFPG+                    RG +G +G+ G  GQQG     G PG+NG  G  GQ G+ G  G      I    + GN G  G+ G  G KG++G +G++G SG+ G+    G  G +G +G               G KGD+G  G++ I   G                   + E        S    G  G++GE+G  G +G  GI G  G     G     GP GE G  G  G  G PG  GA G RG  G +GP G  G+ G  GP G +G             +KGE     I G+ GD G+ G QG  G IGE G                    F GEKG  G  G                     +G  G KG+ G PG +G  G +G +         G  G  G P F      PG  GS G  G PG+ G+ G  G+ G  G     +  G  GPRG+KG  G       +G  GMIG PG+ G KG+T  I    E G  G QG  G  G  G  G               D G  GL G  G+ G  G KG  GS G  G++G     G++ P G+KG+ G  G  G  G  G              GS  +KG  GLKG  G  G  G   S G PG  GL      +GE G  G V F GIPG  G+ G +G +GI G  G +              GP G  GT G  G  G  G VG         N    G  G +G  G NG PG +G++GE                    G+ G  G PG +G  GL GL+G  G+ G  G+ G  G +G+ G PG P    + G KGD G      I G+ G KG+PG  G  G KG  GLIG  G  G++GE G+ G+ G   +   PG  G+ G +G  G PG  G++G +G     G  G +G+ G  G  G+ G  G+KG  G  G +        TG  G  GLPG +G  G  G          IG PG  G RG+KG++GFPG  G  G PG    PGIS   +I                         + GD     PGR G+ GE                      G  G PG  G  GP+GD G  G  G+ GE GL+G RG+ G  G  G            + G  GPRG  G  G  G                              + +    G LGL G  G  G  G  G  GP G+ GSKG                    GD G+ G  G  GF+   GQ G  G PG+ G S
Sbjct:  221 GFQGEKGVKGDVGLPGPAGPPPSTGELEFMGFPKGKKGSKGEPGPKGFPGISGPPGFPGLGTTGEKGEKGEKGIPGLPGPRGPMGSEGVQGPPGQQGKKGTLGFPGLNGFQGIEGQKGDIGLPGPDVFIDIDGAVISGNPGDPGVPGLPGLKGDEGIQGLRGPSGVPGLPALSGVPGALGPQG-------------FPGLKGDQGNPGRTTIGAAGLPGRDGLPGPPGPPGPPSPEFETETLHNKES----GFPGLRGEQGPKGNLGLKGIKGDSGFCACDGGVPNTGPPGEPGPPGPWGLIGLPGLKGARGDRGSGGAQGPAGAPGLVGPLGPSGPKG-------------KKGEPILSTIQGMPGDRGDSGSQGFRGVIGEPGKDGVPGLPGLPGLPGDGGQGFPGEKGLPGLPGEKGHPGPPGLPGNGLPGLPGPRGLPGDKGKDGLPGQQGLPGSKGITLPCIIPGSYGPSGFPGTPGF------PGPKGSRGLPGTPGQPGSSGSKGEPGSPGLVHLPELPGFPGPRGEKGLPGFPGLPGKDGLPGMIGSPGLPGSKGATGDIF-GAENGAPGEQGLQGLTGHKGFLG---------------DSGLPGLKGVHGKPGLLGPKGERGSPGTPGQVGQPGTPGSSGPYGIKGKSGLPGAPGFPGISGHPGKKGTRGKKGPPGSIVKKGLPGLKGLPGNPGLVGLKGSPGSPGVAGLPALSGPKGEKGSVGFVGFPGIPGLPGIPGTRGLKGIPGSTGKM--------------GPSGRAGTPGEKGDRGNPGPVGIPSPRRPMSNLWLKGDKGSQGSAGSNGFPGPRGDKGEAGRPGPPGLPGAPGLPGIIKGVSGKPGPPGFMGIRGLPGLKGSSGITGFPGMPGESGSQGIRGSPGLPGASGLPGLKGDNGQTVE--ISGSPGPKGQPGESGFKGTKGRDGLIGNIGFPGNKGEDGKVGVSGDVGLPGAPGFPGVAGMRGEPGLPGSSGHQGAIGPLGSPGLIGPKGFPGFPGLHGLNGLPGTKGTHGTPGPSI-------TGVPGPAGLPGPKGEKGYPGIG--------IGAPGKPGLRGQKGDRGFPGLQGPAGLPGA---PGISLPSLIAG-----------------------QPGD-----PGRPGLDGERGRPGPAGPPGPPGPSSNQGDTGDPGFPGIPGPKGPKGDQGIPGFSGLPGELGLKGMRGEPGFMGTPGKVGPPGDPGFPGMKGKAGPRGSSGLQGDPG-------------------------QTPTAEAVQVPPGPLGLPGIDGIPGLTGDPGAQGPVGLQGSKGLPGIPGKDGPSGLPGPPGALGDPGLPGLQGPPGFEGAPGQQGPFGMPGMPGQS 1462          

HSP 5 Score: 198.749 bits (504), Expect = 2.776e-50
Identity = 294/910 (32.31%), Postives = 379/910 (41.65%), Query Frame = 3
Query:  177 TPDKCQCFGNKGRQGFPGPRGYQGVSGDKGDVGQFGMPGPKGYKGFTGAIGPQGRKGERGIPGSPGYPGKMGEMG--FPGIRGDIGEKGLTGCDGQQGDFGNPGMNGLVGRTGQPGERGDDGDRGLSIIP----KYGLKGNKGSRGLLGRYGRKGEKGFKGI---------------------KGYSGIFGIKGNKGYVGPMGRRGPKGDSLGTVIIQSEKGSKGDKGLKGQSGIPCKGFQIEGRMYGRVGSDGPIGDKGIKGEKGLMGEIGQSGIDGARGLNGEKGLPGEAGPRGERGDRGNPGFPGDPGASGADGTRGRQGERGPKG-------------------VHGISGADGPRGSRGDKGPSGSLLSCPGRKGEKGFFGIPGIKGDIGNKGYQGHDGDIGEIGFKGEKG-------YEGPLGPSCSEVEQGFRGTKGES------GFPGLRGAKGQRGYSGNKGIKGKPNFGTGINNPGETGSYGNLGVPGEKGNKGFIGDTGEKGFSGTGKQGPEGPRGDKGDDGVNGQVGMIGMPGIKGDKGSTYPIC-----------PFCEKGYKGIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEGRMGLLGSKGRQGYKGGKGFSGSMGDAGEIGYVTISGTTIPGVKGEKGNQGPKGNKGEFGEAGSRGRKGYSGLKGFKGLIGERGTSFSSGDPGDKGLRGENGKDGVSFAGIPGEKGLKGDKGNRGILGDVGSLSNCATRPITS-KGFKGPQGAKGTSGSPGSAGKTGIVGNKGENGYPGKRGIDGDNGIPGSKGEEGETGIKGHAGRPGNLGKSGLQGLRGEYGVKGDLGIQGIPGRKGVMGDPGPNGYAMIGSKGDKGIKGLPGIYGAKGDKGRPGYIGIPGFKGETGLIGRSGLKGDQGE 2693
            TP +    G+KG  G PG      +          G PGP+G KG  G  G  G+ G  G+ GSPG PG  G  G  F    G  GE+GL G  G +G  G+ G+ GL G  G+PG  G  G+RG    P    + G  G+ G  G+ G+ G  G  GF GI                     KG  G+ G+ GN G VG  G  G  G + G   +   KG KG  G  G  GIP              G  G  G +G+KG  G  G++G SG  G  G  G++G PG  G    R    N    GD G+ G+ G+ G  G RG KG                   + G+SG  GP G  G +G        PG KG  G  G PG+ G+ G++G +G  G  G  G  G KG         G  GP     E GF+GTKG        GFPG +G  G+ G SG+ G+ G P F      PG  G  G  G+PG  G++G IG  G  G  G            KG  G  G  G+ G+PG KG  G+  P             P  EKGY GI                                 +G  G  G +G KG +GF G  G AG  G   IS  ++  + G+ G+ G  G  GE G  G  G  G  G    +G  G+ G     G PG KG +G+ G  G  F+G+PGE GLKG +G  G +G  G +           KG  GP+G+ G  G PG       V        PG  G+ G +GIPG  G+ G                      +G  G++G  G+ GIPG+     D         G+ GD G+ GL G  G +G  G+ G  G+PG  G++  +G + +K  Q E
Sbjct:  685 TPGQPGSSGSKGEPGSPGLVHLPELP---------GFPGPRGEKGLPGFPGLPGKDGLPGMIGSPGLPGSKGATGDIFGAENGAPGEQGLQGLTGHKGFLGDSGLPGLKGVHGKPGLLGPKGERGSPGTPGQVGQPGTPGSSGPYGIKGKSGLPGAPGFPGISGHPGKKGTRGKKGPPGSIVKKGLPGLKGLPGNPGLVGLKGSPGSPGVA-GLPALSGPKGEKGSVGFVGFPGIP--------------GLPGIPGTRGLKGIPGSTGKMGPSGRAGTPGEKGDRGNPGPVGIPSPRRPMSNLWLKGDKGSQGSAGSNGFPGPRGDKGEAGRPGPPGLPGAPGLPGIIKGVSGKPGPPGFMGIRG-------LPGLKGSSGITGFPGMPGESGSQGIRGSPGLPGASGLPGLKGDNGQTVEISGSPGPKGQPGESGFKGTKGRDGLIGNIGFPGNKGEDGKVGVSGDVGLPGAPGF------PGVAGMRGEPGLPGSSGHQGAIGPLGSPGLIGP-----------KGFPGFPGLHGLNGLPGTKGTHGTPGPSITGVPGPAGLPGPKGEKGYPGIG--------------------------------IGAPGKPGLRGQKGDRGFPGLQGPAGLPGAPGISLPSL--IAGQPGDPGRPGLDGERGRPGPAGPPGPPGPSSNQGDTGDPGF---PGIPGPKGPKGDQGIPG--FSGLPGELGLKGMRGEPGFMGTPGKVGPPGDPGFPGMKGKAGPRGSSGLQGDPGQTPTAEAV-----QVPPGPLGLPGIDGIPGLTGDPGA---------------------QGPVGLQGSKGLPGIPGK-----DGPSGLPGPPGALGDPGLPGLQGPPGFEGAPGQQGPFGMPGMPGQSMRVGYTLVKHSQSE 1476          

HSP 6 Score: 197.208 bits (500), Expect = 9.334e-50
Identity = 400/1241 (32.23%), Postives = 511/1241 (41.18%), Query Frame = 3
Query:  660 IFGIKGNKGYVGPMGRRGPKGDSLGTVIIQSEKGSKGDKGLKGQSGIPCKGFQIEGRMYGRVGSDGPIGDKGIKGEKGLMG------------EIGQSGIDGARGLNGEKGLPGEAG---------PRGERGDRGNP--------GFPGDPGASGADGTRGRQGERGPKGVHGIS-----------------------GADGPRGSRGDKGPSGSLLSCPGRKGEKGFFGIP-GIKGDIGNKGYQGHDGDIGEIGFKGE--------------KGYEGPLGPSCSEVEQGF---RGTKGESGFPGLRGAKGQRGYSGNKGIKGKPNFGTGINNPGETGSYGNLGVPGEKGNKGFIGDTGEKGFSGTGKQGPEGPRGDKGDDGVNGQVGMIGMPGIKGDKGSTYPICPFCEKGYKGIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEGRMGLLGSKGRQGYKGGKGFSGSMGDAGEIGYVTISG-------------------TTIPGVKGEKGN------QGPKGNK---GEFGEAGSRGRKGYSGLKGFKGLIGERGTSFSSGDPGDKGLRGENGKDGVS---------------------FAGIPGEK--------------------GLKGDKGNRGILGDVGSL-SNCATRPITSKGFKGPQ---------GAKGTSGSPGSAGKTGIVGNKGENGYPGKRGIDGDNGIPGSKGEEGETGIKGHAGR---PGNLGKSGLQGLRG--------EYGVKGDLGIQGIPGRKGVMGDPGPNGYAMIGSKGDKGIKGLPGIYGAKGDKGRPGYIGIPGFKGETGLIGRSGLKGDQGEIGEKGIKGFTFISNN---------------------PGDRGLLGNKGLKGFPGELGNKGQVGVCTVRGDQGLRGYSGLIGDMGMKGEQGSKGIVGDYGAASRSGIMGRTGKIGNQGLPGDQXXXXXXXXXXXXXXXXYIGIPGFEGDRGEKGNKGFPGFPGDIGQPGRLGNPGISTEGVXXXXXXXXXXXXXXXXXXXXXXXXXXKQGDSGIS----IPGRQGIKGEDGTIGLPGEMGEPGPRGDFGQKGNI-------GITGEFGLQGNRGDDGLKGDDGIPGLNGPRGFIGDIGFVGFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXELGLDGSMGGKGDNGPRGFNGPTGIPGSKGFEGDKGIRGDIGVKGFQGQHGEIGFPGLKGVSGENG 3806
             F  KG +G  GP+G +GP G        Q   GS G  GLKG+ G P           G +G  GP GDKG  G  G +G              G  G+DG  G  G  G PG  G           G++G +G+P        G  GDPG  G DG  G QG  G  G  G +                       G  G +G +GD G        P   GE  F G P G KG  G  G +G  G  G  GF G                G  GP GP  SE  QG    +G KG  GFPGL G +G  G  G+ G+ G P+    I+    +G+ G+ GVPG  G K   GD G +G      +GP G  G     GV G +G  G PG+KGD+G+          G  G+      R             +   +         G  G +G QG KG  G  G  GD+   G+    G                     +PG+KG +G+      QGP G     G  G +G +G+KG   L   +G+ G+RG    SG  G +G+ GE GKDGV                        G+PGEK                    GL GDKG  G+ G  G   S   T P    G  GP          G KG+ G PG+ G+ G  G+KGE G PG   +    G PG +GE+G  G  G  G+   PG +G  GL G +G        E G  G+ G+QG+ G KG +GD         G  G KG+ G PG+ G KG++G P   G PG  G+ G  G SG  G +G+ G  G  GF  IS +                     PG +GL GN GL G  G  G+ G  G+  + G +G +G  G +G  G+ G  G  G  G  G    +G MG +G+ G  G  GD+G PG  G    +     + + G +G +G  G+ GFPG  GD G+ GR G PG+     +          P     +        K G SGI+    +PG  G +G  G+ GLPG  G PG +GD GQ   I       G  GE G +G +G DGL G+ G PG  G  G +G  G VG                         G  GF G+ G +GE GL GS G +G  GP G     G+ G KGF G  G+ G  G+ G +G HG  G P + GV G  G
Sbjct:   41 CFPEKGARGRPGPIGIQGPTGP-------QGFTGSTGLSGLKGERGFP-----------GLLGPYGPKGDKGPMGVPGFLGINGIPGHPGQPGPRGPPGLDGCNGTQGAVGFPGPDGYPGLLGPPGLPGQKGSKGDPVLAPGSFKGMKGDPGLPGLDGITGPQGAPGFPGAVGPAGPPGLQGPPGPPGPLGPDGNMGLGFQGEKGVKGDVG-LPGPAGPPPSTGELEFMGFPKGKKGSKGEPGPKGFPGISGPPGFPGLGTTGEKGEKGEKGIPGLPGPRGPMGSEGVQGPPGQQGKKGTLGFPGLNGFQGIEGQKGDIGLPG-PDVFIDIDGAVISGNPGDPGVPGLPGLK---GDEGIQGL-----RGPSGVPGLPALSGVPGALGPQGFPGLKGDQGNPG----RTTIGAAGLP----GRDGLPGPPGPPGPPSPEFETETLHNKESGFPGLRGEQGPKGNLGLKGIKGDS---GFCACDGGVPNTGPPGEPGPPGPWGLIGLPGLKGARGDRGSGGAQGPAGAPGLVGPLGPSGPKGKKGEPILSTIQGMPGDRG---DSGSQGFRGVIGEPGKDGVPGLPGLPGLPGDGGQGFPGEKGLPGLPGEKGHPGPPGLPGNGLPGLPGPRGLPGDKGKDGLPGQQGLPGSKGITLPCIIPGSYGPSGFPGTPGFPGPKGSRGLPGTPGQPGSSGSKGEPGSPGLVHLPELPGFPGPRGEKGLPGFPGLPGKDGLPGMIGSPGLPGSKGATGDIFGAENGAPGEQGLQGLTGHKGFLGD--------SGLPGLKGVHGKPGLLGPKGERGSP---GTPGQVGQPGTPGSSGPYGIKGKSGLPGAPGFPGISGHPGKKGTRGKKGPPGSIVKKGLPGLKGLPGNPGLVGLKGSPGSPGVAGLPALSGPKGEKGSVGFVGFPGIPGLPGIPGTRGLKGIPGSTGKMGPSGRAGTPGEKGDRGNPGPVGIPSPRRPMSNLWLKGDKGSQGSAGSNGFPGPRGDKGEAGRPGPPGLPGAPGLPGIIKGVSGKPGPPGFMGIRGLPGLK-GSSGITGFPGMPGESGSQGIRGSPGLPGASGLPGLKGDNGQTVEISGSPGPKGQPGESGFKGTKGRDGLIGNIGFPGNKGEDGKVGVSGDVGL-----------------------PGAPGFPGVAGMRGEPGLPGSSGHQGAIGPLGS---PGLIGPKGFPGFPGLHGLNGLPGTKGTHGTPG-PSITGVPGPAG 1200          

HSP 7 Score: 184.111 bits (466), Expect = 8.235e-46
Identity = 286/894 (31.99%), Postives = 357/894 (39.93%), Query Frame = 3
Query:  201 GNKGRQGFPGPRGYQGVSGDKGDVGQFGMPGPKGYKGFTGAIGPQGRKGERGIPGSPGYPGKMGEMGFPGIRGDIGEKGLTGCDGQQGDFGNPGMNGLVGRTGQPGERGDDGDRGLSIIPKYGLKGNKGSRGLLGRYGRKGEKGFKGIKGYSGIFGIKGNKGYVGPMGRRGPKGDSLGTVIIQSEKGSKGDKGLKGQSGIP-------CKGFQIEGRMYGRVGSDGPIGDKGIKGEKGLMGEIGQSGIDGARGLNGEKGLPGEAGPRGERGDRGNPGFPGDPG---------------------ASGADGTRGRQGERG---------------------PKGVHGISGADGPRGSRGDKG----------------------------PSG--SLLSCPGRKGEKGFFGIPGIKGDIGNKGYQGHDGDIGEIGFKGEKG-------YEGPLGPSCSEVEQGFRGTKGESG------FPGLRGAKGQRGYSGNKGIKGKPNFGTGINNPGETGSYGNLGVPGEKGNKGFIGDTGEKGFSGTGKQGPEGPRGDKGDDGVNGQVGMIGMPGIKGDKGSTYPIC-----------PFCEKGYKGIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEGRMGLLGSKGRQGYKGGKGFSGSMGDAGEIGYVTISGTTI----------PGVKGE---------------KGNQGPKGNKGEFGEAGSRGRKGYSGLKGFKGLIGERGTSFSSGDPG---------------------------DKGLRGENGKDGVSFAG--IPGEKGLKGDKGNRGILGDVGSLSNCATRPITSKGFKGPQG------AKGTSGSPGSAGKTGIVGNKGENGYPGKRGIDGDNGIPGSKGEEGETGIK 2393
            G+KG+ G PG    QG+ G KG      +PG  G  GF G  G  G KG RG+PG+PG PG  G  G PG  G +    L G  G +G+ G PG  GL G+ G PG  G  G  G             G+ G  G  G  G KGF G  G  G+ G+ G  G +GP G RG  G + G V      GS G  G+KG+SG+P         G   +    G+ G  G I  KG+ G KGL G  G  G+ G+ G  G  GLP  +GP+GE+G  G  GFPG PG                      SG  GT G +G+RG                      KG  G +G++G  G RGDKG                            P G   +   PG KG  G  G PG+ G+ G++G +G  G  G  G  G KG         G  GP     E GF+GTKG  G      FPG +G  G+ G SG+ G+ G P F      PG  G  G  G+PG  G++G IG  G  G  G            KG  G  G  G+ G+PG KG  G+  P             P  EKGY GI                                 +G  G  G +G KG +GF G  G AG  G   IS  ++          PG+ GE                 NQG  G+ G  G  G +G KG  G+ GF GL GE G     G+PG                             GL+G+ G+   + A    PG  GL G  G  G+ GD G+      +   SKG  G  G        G  G+ G  G  G+ G  G  G PG++G  G  G+PG     G T +K
Sbjct:  633 GDKGKDGLPG---QQGLPGSKGITLPCIIPGSYGPSGFPGTPGFPGPKGSRGLPGTPGQPGSSGSKGEPGSPGLVHLPELPGFPGPRGEKGLPGFPGLPGKDGLPGMIGSPGLPGSKGATGDIFGAENGAPGEQGLQGLTGHKGFLGDSGLPGLKGVHGKPGLLGPKGERGSPG-TPGQVGQPGTPGSSGPYGIKGKSGLPGAPGFPGISGHPGKKGTRGKKGPPGSIVKKGLPGLKGLPGNPGLVGLKGSPGSPGVAGLPALSGPKGEKGSVGFVGFPGIPGLPGIPGTRGLKGIPGSTGKMGPSGRAGTPGEKGDRGNPGPVGIPSPRRPMSNLWLKGDKGSQGSAGSNGFPGPRGDKGEAGRPGPPGLPGAPGLPGIIKGVSGKPGPPGFMGIRGLPGLKGSSGITGFPGMPGESGSQGIRGSPGLPGASGLPGLKGDNGQTVEISGSPGPKGQPGESGFKGTKGRDGLIGNIGFPGNKGEDGKVGVSGDVGLPGAPGF------PGVAGMRGEPGLPGSSGHQGAIGPLGSPGLIGP-----------KGFPGFPGLHGLNGLPGTKGTHGTPGPSITGVPGPAGLPGPKGEKGYPGIG--------------------------------IGAPGKPGLRGQKGDRGFPGLQGPAGLPGAPGISLPSLIAGQPGDPGRPGLDGERGRPGPAGPPGPPGPSSNQGDTGDPGFPGIPGPKGPKGDQGIPGFSGLPGELGLKGMRGEPGFMGTPGKVGPPGDPGFPGMKGKAGPRGSSGLQGDPGQTPTAEAVQVPPGPLGLPGIDGIPGLTGDPGAQGPVGLQ--GSKGLPGIPGKDGPSGLPGPPGALGDPGLPGLQGPPGFEGAPGQQGPFGMPGMPGQSMRVGYTLVK 1471          

HSP 8 Score: 135.576 bits (340), Expect = 5.043e-31
Identity = 344/1087 (31.65%), Postives = 435/1087 (40.02%), Query Frame = 3
Query: 1536 FSGTGKQGPEGPRGDKGDDGVNGQVGMIGMPGIKGDKGSTYPICPFCEKGYKGIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEGRMGLLGSKGRQGYKGGKGFSGSMGDAGEIGYVTISGTTIPGVKGEKGNQGPKGNKGEFGEAGSRGRKGYSGLKGFKGLIGERGTSFSSGDPGDKGLRGENGKDGVSFAGIPGEKGLKGDKGNRGILGDVGSLSNCATRPITSKGFKGPQGAKGTSGSPGSAGKTGIVGNKGENGYPG-----KRGIDGDNGIPGSKGEEGETGIKGHAGRPGNLGKSGLQGLRGEYGVKGDLGIQGIPGRKGVMGDPGPN------GYAMIGSKGDKGIKGLPG------IYGAKGDKGRPGYIGIPGFKGETGLIGRSGLKGDQGEIGEKGIKGFTFISNNPG--------------DRGLLGNK--GLKGFPGELGNKGQVGVCTVRGDQGLRGYSG---------------------LIGDMGMKGEQGSKGIVGDYGAASRSGIMGRTGKIGNQGLPGDQXXXXXXXXXXXXXXXXYIGIPGFEGDRGEKGNKGFPGFPGDIGQ--------------------PGRLGNPGISTEGVXXXXXXXXXXXXXXXXXXXXXXXXXXKQGDSGIS-IPGRQGIK------GEDGTIGLPGEMGEPGPRGDFGQKGNIGITGEFGLQGNRGDDGLKGDDGIPGLNGPRGFIGDIGFVGFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXELGLDGSMGGKGDNGPRGFNGPTGIPGSKGFEGD-----KGIRGDIGVKGFQGQHGEIGFPGLKGVSGENGRQXXXXXXXXXXXXXXXXVCMQPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEVGESIRGLQGRKGSTGLRGNIGIPGERGD------------------KGIPGLQGKVGNKGVKGDIGDKGFSGNIGDKGYSGISGDKGSFGVKGDKGFQGDVGMLGKSGLQGDRGQKGIIGFRGTRGIPGSMGLPGEIGEKGDVGPSGIGVKGLKGYQNAVGIKGRKGEKGLPGFPGRPGKVGDQGD 4484
            F   G +G  GP G +G  G  G  G  G+ G+KG++G    + P+  KG KG  G  G  G NG  G  G  G +G  GL G  G  G +G  G  GY G  G  G  G  G  G   ++  +             KG KG+ G  G  G  G  G  GF G +G  G     G PG  G  G +G  G+ F G   EKG+KGD     +     +    +T  +   GF  P+G KG+ G PG  G  GI    G  G+PG     ++G  G+ GIPG  G  G  G +G  G PG       QG +G  G  G  G QGI G+KG +G PGP+      G  + G+ GD G+ GLPG      I G +G  G PG   + G  G  G  G  GLKGDQG  G   I        +                +   L NK  G  G  GE G KG +G+  ++GD G     G                     L G  G +G++GS G  G  GA    G +G +G  G +G P                      I G  GDRG+ G++GF G  G+ G+                    PG  G PG+  E     P      G  G PG  GL G  GK G  G   +PG +GI       G  G  G PG  G PGP+G  G  G  G  G  G +G  G  GL     +PG  GPRG                                               E GL G  G  G +G  G  G  G+PGSKG  GD      G  G+ G++G  G  G +G  GL G+ G +G+ G  G KG  G  G  G   QP                                        G  G KG +GL G  G PG  G                   KG+PGL+G  GN G+   +G KG  G+ G  G   +SG KG    KG  GF G  G+ G  G+ G RG KGI G  G  G  G  G PGE G++G+ GP  +G+   +   + + +KG KG +G  G  G PG  GD+G+
Sbjct:   42 FPEKGARGRPGPIGIQGPTGPQGFTGSTGLSGLKGERGFPGLLGPYGPKGDKGPMGVPGFLGINGIPGHPGQPGPRGPPGLDGCNGTQGAVGFPGPDGYPGLLGPPGLPGQKGSKGDPVLAPGSF------------KGMKGDPGLPGLDGITGPQGAPGFPGAVGPAGPPGLQGPPGPPGPLGPDGNMGLGFQG---EKGVKGD-----VGLPGPAGPPPSTGELEFMGF--PKGKKGSKGEPGPKGFPGI---SGPPGFPGLGTTGEKGEKGEKGIPGLPGPRGPMGSEGVQGPPGQ------QGKKGTLGFPGLNGFQGIEGQKGDIGLPGPDVFIDIDGAVISGNPGDPGVPGLPGLKGDEGIQGLRGPSGVPGLPALSGVPGALGPQGFPGLKGDQGNPGRTTIGAAGLPGRDGLPGPPGPPGPPSPEFETETLHNKESGFPGLRGEQGPKGNLGLKGIKGDSGFCACDGGVPNTGPPGEPGPPGPWGLIGLPGLKGARGDRGSGGAQGPAGAPGLVGPLGPSGPKGKKGEP------------------ILSTIQGMPGDRGDSGSQGFRGVIGEPGKDGVPGLPGLPGLPGDGGQGFPGEKGLPGLPGEKGHPGPPGLPGNGLPGLPGPRGLPGDKGKDGLPGQQGLPGSKGITLPCIIPGSYGPSGFPGTPGFPGPKGSRGLPGTPGQPGSSGSKGEPGSPGLVHLPELPGFPGPRG-----------------------------------------------EKGLPGFPGLPGKDGLPGMIGSPGLPGSKGATGDIFGAENGAPGEQGLQGLTGHKGFLGDSGLPGLKGVHGKPGLLGPKGERGSPGTPGQVGQPGTPGS----------------------------------SGPYGIKGKSGLPGAPGFPGISGHPGKKGTRGKKGPPGSIVKKGLPGLKGLPGNPGL---VGLKGSPGSPGVAGLPALSGPKGE---KGSVGFVGFPGIPGLPGIPGTRGLKGIPGSTGKMGPSGRAGTPGEKGDRGNPGP--VGIPSPRRPMSNLWLKGDKGSQGSAGSNGFPGPRGDKGE 990          

HSP 9 Score: 130.183 bits (326), Expect = 2.273e-29
Identity = 325/968 (33.57%), Postives = 408/968 (42.15%), Query Frame = 3
Query: 1965 FGEAGSRGRKGYSGLKGFKGLIGERGTSFSSGDPGDKGLRGENGKDGVSFAGIPGEKGLKGDKGNRGILGDVG-----------------SLSNCATRPITSKGFKGPQG------------AKGTSGSPGSAGKTGIVGNKGENGYPGKRGIDGDNGIPGSKGE---------EGETGIKGHAGRPGNLGKSGLQGLRGEYGVKGD---------------LGIQGIP-GRKGVMGDPGPNGYAMIGSKGDKGIKGL--------------PGIYGAKGDKGRPGYIGIPGFKGETGLIGRSGLKGDQGEIGEKGIKGF-----------TFISNNPGDRGLLGNKGLKGFPGELGNKGQVGVCTVRGDQGLRGYSGLIGDMGMKGEQGSKGIVGDYGAASRSGIMGRTGKIGNQGLPGDQXXXXXXXXXXXXXXXXYIGIPGFEGDRGEKGNKGFPGFPGDIGQPGRLGNPGISTEGVXXXXXXXXXXXXXXXXXXXXXXXXXXKQGDSGISIPGRQGIKGEDGT------IGLPGEMGEPGPRGDFGQKGNIGITGEFGLQGNRGDDGLKGDDGIPGLNG-----------------PRGFIGDIGFVGFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXELGLDGSMGGK------GDNGPRGFNGPTGIPG---SKGFEGDKGIRGDIGVKGFQGQHGEIGFPGLKGVSGENGRQXXXXXXXXXXXXXXXXVCMQPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEVGESIRGLQGRKGSTGLRGNIGIPGERGDKGIPGLQGKVGNKGVKGDIGDKGFSGNIGDKGYSGISGDKGSFGVKGDKGFQGDVGMLGKSGLQGDRGQKGIIGFRGTRGIPGSMGLPGEIGEKGDVGPSGIGVKGLKGYQNAVGIKGRKGEKGLPGFPGR---------PGKVGDQGDKGPKGMKN 4508
            F E G+RGR G  G++G  G  G  G++      G  GL+GE G     F G+ G  G KGDKG  G+ G +G                  L  C      + GF GP G             KG+ G P  A  +   G KG+ G PG  GI G  G PG  G          +G  G  G  G  GN+G     G +GE GVKGD               L   G P G+KG  G+PGP G+  I   G  G  GL              PG+ G +G  G  G  G PG +G+ G +G  GL G QG  G+KG  G              IS NPGD G+ G  GLKG           G+  +RG  G+ G   L G  G  G QG  G+ GD G   R+        IG  GLPG  G PG  G  G    +       FE +       GFPG  G+ G  G LG  GI  +               G P                I +PG +G +G+ G+       G PG +G  GP G  G+KG   ++   G+ G+RGD G +G  G+ G  G                  +GF G+ G  G  G KG+ G  G  G     + G +G  G KG  G  G+ GL GS G        G  GP GF G  G PG   S+G  G  G  G  G KG  G  G +  P L G  G  G +G  G  GL G  G  G+   P +             + G  G  G+ G  G KG +G+S  GL G KG  G  G +G  GERG  G PG  G+ G  G  G  G KG SG  G  G+ GISG  G  G +G KG  G +   G  GL+G  G  G++G +G+ G PG  GLP   G KG+ G   +G  G  G     GI G +G KG+PG  G+         PG+ GD+G+ GP G+ +
Sbjct:   42 FPEKGARGRPGPIGIQGPTGPQGFTGST------GLSGLKGERG-----FPGLLGPYGPKGDKGPMGVPGFLGINGIPGHPGQPGPRGPPGLDGCNGT-QGAVGFPGPDGYPGLLGPPGLPGQKGSKGDPVLAPGS-FKGMKGDPGLPGLDGITGPQGAPGFPGAVGPAGPPGLQGPPGPPGPLGPDGNMG----LGFQGEKGVKGDVGLPGPAGPPPSTGELEFMGFPKGKKGSKGEPGPKGFPGI--SGPPGFPGLGTTGEKGEKGEKGIPGLPGPRGPMGSEGVQGPPGQQGKKGTLGFPGLNGFQGIEGQKGDIGLPGPDVFIDIDGAVISGNPGDPGVPGLPGLKG---------DEGIQGLRGPSGVPGLPALSGVPGALGPQGFPGLKGDQGNPGRT-------TIGAAGLPGRDGLPGPPGPPGPPSPE-------FETETLHNKESGFPGLRGEQGPKGNLGLKGIKGD-------SGFCACDGGVPNTGPPGEPGPPGPWGLIGLPGLKGARGDRGSGGAQGPAGAPGLVGPLGPSGPKGKKGEPILSTIQGMPGDRGDSGSQGFRGVIGEPGKDGVPGLPGLPGLPGDGGQGFPGEKGLPGLPGEKGHPGPPGLPGNGLPGLPGPRGLPGDKGKDGLPGQQGLPGSKGITLPCIIPGSYGPSGFPGTPGFPGPKGSRGLPGTPGQPGSSGSKGEPGSPGLVHLPELPGFPGPRGEKGLPGFPGLPGKDGLPGMIGSPGLPGSKGATGDIFGAENGAPGEQGLQGLTGHKGFLGDS--GLPGLKGVHGKPGLLGPKGERGSPGTPGQVGQPGTPGSSGPYGIKGKSGLPGAPGFPGISGHPGKKGTRGKKGPPGSIVKKGLPGLKGLPGNPGLVGLKGSPGSPGVAGLPALSGPKGEKG--SVGFVGFPGIPGLPGIPGTRGLKGIPGSTGKMGPSGRAGTPGEKGDRGNPGPVGIPS 956          

HSP 10 Score: 95.9005 bits (237), Expect = 6.854e-19
Identity = 123/335 (36.72%), Postives = 155/335 (46.27%), Query Frame = 3
Query:  210 GRQGFPGPRGYQGVSGDKGDVGQFGMPGPK--GYKGFTGAIGPQGRKGERGI----PGSPGYPGKMGEMGFPGIRGDIGEKGLTGCD------GQQGDFGNPGMNG---------LVGRTGQPGERGDDGDRGLSIIPKYGLKGNKGSRGLLGRYGRKGEKGFKGIKGYSGIFGIKGN------------KGYVGPMGRRGPKGDSLGTVIIQSEKGSKGDKGLKGQSGIPCKGFQIEGRMYGRVGSDGPIGDKGIKGEKGLMGEIGQSGIDGARGLNGEKGLPGEAGPRG------ERGDRGNPGFPGDPGASGADGTRGRQGERGPKGVHGIS 1097
            G +GFPG  G  G++G  G  G  G PGP   G  G  G  GP+G KG  GI    PG PG  G+ G+ GFPG++G  G  G  G        GQ GD G PG++G           G  G    +GD GD G   IP  G KG KG +G+ G  G  GE G KG++G  G  G  G             KG  GP G  G +GD   T   ++ +   G  GL G  GIP         + G  G+ GP+G +G KG  G+ G+ G SG+ G  G  G+ GLPG  GP G      ++G  G PG PG     G    +  Q E+ P    G+S
Sbjct: 1162 GPKGFPGFPGLHGLNGLPGTKGTHGTPGPSITGVPGPAGLPGPKGEKGYPGIGIGAPGKPGLRGQKGDRGFPGLQGPAGLPGAPGISLPSLIAGQPGDPGRPGLDGERGRPGPAGPPGPPGPSSNQGDTGDPGFPGIP--GPKGPKGDQGIPGFSGLPGELGLKGMRGEPGFMGTPGKVGPPGDPGFPGMKGKAGPRGSSGLQGDPGQTPTAEAVQVPPGPLGLPGIDGIP--------GLTGDPGAQGPVGLQGSKGLPGIPGKDGPSGLPGPPGALGDPGLPGLQGPPGFEGAPGQQGPFGMPGMPGQSMRVGYTLVKHSQSEQVPPCPIGMS 1486          

HSP 11 Score: 90.1225 bits (222), Expect = 3.696e-17
Identity = 86/213 (40.38%), Postives = 105/213 (49.30%), Query Frame = 3
Query: 3990 IRGLQGRKGSTGLRGNIGIPGERGDKGI---PGLQGKVGNKGVKGDIGD----KGFSGNIGDKGYSGISGDKGSFGVKGDKGFQGDVGMLGKSGLQGDRGQKGIIGFRGTRGIPGSMGLPGEIGEKGDVGPSG----IGVKGLKGYQN--------------------------AVGIKGRKGEKGLPGF----PGRPGKVGDQGDKGPKGMK 4505
            IRGL G KGS+G+ G  G+PGE G +GI   PGL G  G  G+KGD G      G  G  G  G SG  G KG  G+ G+ GF G+ G  GK G+ GD G  G  GF G  G+ G  GLPG  G +G +GP G    IG KG  G+                              G+ G KGEKG PG     PG+PG  G +GD+G  G++
Sbjct: 1024 IRGLPGLKGSSGITGFPGMPGESGSQGIRGSPGLPGASGLPGLKGDNGQTVEISGSPGPKGQPGESGFKGTKGRDGLIGNIGFPGNKGEDGKVGVSGDVGLPGAPGFPGVAGMRGEPGLPGSSGHQGAIGPLGSPGLIGPKGFPGFPGLHGLNGLPGTKGTHGTPGPSITGVPGPAGLPGPKGEKGYPGIGIGAPGKPGLRGQKGDRGFPGLQ 1236          

HSP 12 Score: 80.1073 bits (196), Expect = 4.207e-14
Identity = 71/182 (39.01%), Postives = 98/182 (53.85%), Query Frame = 3
Query: 3990 IRGLQGRKGSTGLRGNIGIPGERGDKGI---PGLQGKVGNKGVKGDIGDKGFSGNIGDKGYSG----ISGDKGSFGVKGDKGFQGDV---GMLGKSGLQGDRGQKGIIGFRGTRGIPGSMGLPGEIGEKGDVGPSGIGVKGLKGYQNAVGIKGRKGEKGLPGFPGRPGKVGDQGDKGPKGMK 4505
            I+G+ G+ G  G  G  G+PG +G  GI   PG+ G+ G++G++G  G  G SG  G KG +G    ISG  G  G  G+ GF+G     G++G  G  G++G+ G +G  G  G+PG+ G PG  G +G+      G+ G  G+Q A+G  G  G  G  GFPG PG  G  G  G KG  
Sbjct: 1009 IKGVSGKPGPPGFMGIRGLPGLKGSSGITGFPGMPGESGSQGIRGSPGLPGASGLPGLKGDNGQTVEISGSPGPKGQPGESGFKGTKGRDGLIGNIGFPGNKGEDGKVGVSGDVGLPGAPGFPGVAGMRGEP-----GLPGSSGHQGAIGPLGSPGLIGPKGFPGFPGLHGLNGLPGTKGTH 1185          

HSP 13 Score: 80.1073 bits (196), Expect = 4.425e-14
Identity = 68/172 (39.53%), Postives = 88/172 (51.16%), Query Frame = 3
Query: 3999 LQGRKGSTGLRGNIGIPGERGDKGIPGLQGKVGNKGVKGDIGDKGFSGNIGDKGYSGISGDKGSFGVKGDKGFQGDVGMLGKSGLQGDRGQKGIIGFRGTRGIPGSMGLPGEIGEKGDVGPSGI-GVKGLKGYQNAVGIKGRKGEKGLPGFPGRPGKVGDQGDKGPKGMKNM 4511
            + G  G +G  G  G PG +G +G+PG  G+ G+ G KG+ G  G        G+ G  G+KG  G  G  G  G  GM+G  GL G +G  G I F    G PG  GL G  G KG +G SG+ G+KG+ G    +G KG +G  G PG  G+PG  G  G  G KG   +
Sbjct:  658 IPGSYGPSGFPGTPGFPGPKGSRGLPGTPGQPGSSGSKGEPGSPGLVHLPELPGFPGPRGEKGLPGFPGLPGKDGLPGMIGSPGLPGSKGATGDI-FGAENGAPGEQGLQGLTGHKGFLGDSGLPGLKGVHGKPGLLGPKGERGSPGTPGQVGQPGTPGSSGPYGIKGKSGL 828          

HSP 14 Score: 76.6406 bits (187), Expect = 4.884e-13
Identity = 74/197 (37.56%), Postives = 95/197 (48.22%), Query Frame = 3
Query: 3993 RGLQGRKGSTGLRGNIGIPGERGDKGIPGLQGKVGNKGVKGDIGDKGFSGNIGDKG-----YSGISGDKGSFGVKGDKGFQGDVGMLGKSGLQGDRGQKGIIGFRGTRGIPGSMGLPGEIGEKGDVGPSGI-GVKGLKGYQNAVGIKG------------------RKGEKGLPGFPGRPGKVGDQGDKGPKGMKNM 4511
            +G  G  G   L    G PG RG+KG+PG  G  G  G+ G IG  G  G+ G  G      +G  G++G  G+ G KGF GD G+    GL+G  G+ G++G +G RG PG+ G  G+ G  G  GP GI G  GL G     GI G                  +KG  GL G PG PG VG +G  G  G+  +
Sbjct:  695 KGEPGSPGLVHLPELPGFPGPRGEKGLPGFPGLPGKDGLPGMIGSPGLPGSKGATGDIFGAENGAPGEQGLQGLTGHKGFLGDSGL---PGLKGVHGKPGLLGPKGERGSPGTPGQVGQPGTPGSSGPYGIKGKSGLPGAPGFPGISGHPGKKGTRGKKGPPGSIVKKGLPGLKGLPGNPGLVGLKGSPGSPGVAGL 888          

HSP 15 Score: 69.3218 bits (168), Expect = 7.657e-11
Identity = 72/188 (38.30%), Postives = 87/188 (46.28%), Query Frame = 3
Query: 3987 SIRGLQGRKGSTG------LRGNIGIPGERGDKGIPGLQGKVGNKGVKGDIGDKGFSGNIGDKGYSGISGDKGSFGVKGDKGFQGDVGMLGKSGLQGDRGQKG----------------IIGFRGTRGIPGSMGLPGEIGEKGDVGPSGIGVKGLKGYQNAVGIKGRKGEKGLPGFPGRPGKVGDQGD 4484
            ++ G +G KGS G      + G  GIPG RG KGIPG  GK+G  G  G  G+KG  GN G  G         +  +KGDKG QG  G  G  G +GD+G+ G                I G  G  G PG MG+ G  G KG       G+ G  G     G +G +G  GLPG  G PG  GD G 
Sbjct:  890 ALSGPKGEKGSVGFVGFPGIPGLPGIPGTRGLKGIPGSTGKMGPSGRAGTPGEKGDRGNPGPVGIPSPRRPMSNLWLKGDKGSQGSAGSNGFPGPRGDKGEAGRPGPPGLPGAPGLPGIIKGVSGKPGPPGFMGIRGLPGLKGSS-----GITGFPGMPGESGSQGIRGSPGLPGASGLPGLKGDNGQ 1072          

HSP 16 Score: 66.2402 bits (160), Expect = 6.396e-10
Identity = 70/174 (40.23%), Postives = 84/174 (48.28%), Query Frame = 3
Query: 3975 EVGESIRGLQGRKGSTGLRGNIGIPGERGD------------KGIPGLQGKVGNKGVKGDIGDKGFSGNIGDKGYSGISGDKGSFGVKGDKGFQGDVGMLGKSGLQGDRGQKGIIGFRGTRGIPGSMGLPGEIGEKG--DVGPSGIGVKGLKGYQNAVGIKGRKGEKGLPGFPG 4454
            + GES  G +G KG  GL GNIG PG +G+             G PG  G  G +G  G  G  G  G I         G  GS G+ G KGF G  G+ G +GL G +G  G  G   T G+PG  GLPG  GEKG   +G    G  GL+G +   G  G +G  GLPG PG
Sbjct: 1085 QPGES--GFKGTKGRDGLIGNIGFPGNKGEDGKVGVSGDVGLPGAPGFPGVAGMRGEPGLPGSSGHQGAI---------GPLGSPGLIGPKGFPGFPGLHGLNGLPGTKGTHGTPGPSIT-GVPGPAGLPGPKGEKGYPGIGIGAPGKPGLRGQKGDRGFPGLQGPAGLPGAPG 1246          

HSP 17 Score: 61.6178 bits (148), Expect = 1.596e-8
Identity = 80/233 (34.33%), Postives = 98/233 (42.06%), Query Frame = 3
Query: 3999 LQGRKGSTGLRGNIGIPGERGDKG-------------------IPGLQGKVGNKGVKGDIGDKGFSGNIGDKGYSGISGDKGSFGVKGDKGFQGDVGMLGKSGLQGDRGQK-GIIGFRGTRGIPGSMGLPGEIGEKGDVGPSGIGVKGLKGYQNAVGIKGRKGEKGLPGFPGRPGKVGDQGDKGPKGMKNMNTXXXXXXXXXXXXXXXXXXXXXXXXXLPGDMGEIGPNGPIG 4637
            L+G KGS G  G+ G PG RGDKG                   I G+ GK G  G  G  G  G  G+ G  G+ G+ G+ GS G++G  G  G  G+    GL+GD GQ   I G  G +G PG  G  G  G  G +G   IG  G KG    VG+ G   + GLPG PG PG  G +G+ G                                  LPG  G  G  GP+G
Sbjct:  966 LKGDKGSQGSAGSNGFPGPRGDKGEAGRPGPPGLPGAPGLPGIIKGVSGKPGPPGFMGIRGLPGLKGSSGITGFPGMPGESGSQGIRGSPGLPGASGL---PGLKGDNGQTVEISGSPGPKGQPGESGFKGTKGRDGLIG--NIGFPGNKGEDGKVGVSG---DVGLPGAPGFPGVAGMRGEPG----------------------------------LPGSSGHQGAIGPLG 1156          

HSP 18 Score: 61.6178 bits (148), Expect = 1.624e-8
Identity = 68/174 (39.08%), Postives = 86/174 (49.43%), Query Frame = 3
Query: 3993 RGLQGRKGSTGLRGNIGIPGERGDKGIPGLQGKVGNKGVKGDIGDKGFSGNIGDKGYSGISGDKGSFGVKGDKGFQGDVGMLGKSGLQGDRGQKGIIGFRGTRGIPGSMGLPGEIGEKGDVGPSGIGVKGLKGYQNAVGIKGRKGEKGLPGFPGRPGKVGDQGDKGPKGMKNMN 4514
            RGL G KG  GL G  G+PG +G   +P +    G+ G  G  G  GF G  G +G  G  G  GS G KG+ G  G V +    G  G RG+KG+ GF G   +PG  GLPG IG  G  G  G     + G +N     G  GE+GL G  G  G +GD G     G+K ++
Sbjct:  629 RGLPGDKGKDGLPGQQGLPGSKGIT-LPCI--IPGSYGPSGFPGTPGFPGPKGSRGLPGTPGQPGSSGSKGEPGSPGLVHLPELPGFPGPRGEKGLPGFPG---LPGKDGLPGMIGSPGLPGSKGA-TGDIFGAEN-----GAPGEQGLQGLTGHKGFLGDSGLP---GLKGVH 787          

HSP 19 Score: 53.9138 bits (128), Expect = 4.035e-6
Identity = 54/141 (38.30%), Postives = 68/141 (48.23%), Query Frame = 3
Query: 4095 GNKGVKGDIGDKGFSGNIGDKGYSGISGDKGSFGVKGD--KGFQGDVGMLGKSGLQGDRGQKGIIGFRGTRGIPGSMGLPGEIGEKGDVGPSGIGVKGLKGYQNAVGIKGRKGEKGLPGFPGRPGKVGDQGDKGPKGMKNM 4511
            G KG KG+ G KGF G  G  G+ G+               G  G  G +G  G+QG  GQ+G    +GT G PG  G  G  G+KGD+G  G  V        AV I G  G+ G+PG PG  G  G QG +GP G+  +
Sbjct:  255 GKKGSKGEPGPKGFPGISGPPGFPGLGTTGEKGEKGEKGIPGLPGPRGPMGSEGVQGPPGQQGK---KGTLGFPGLNGFQGIEGQKGDIGLPGPDV--FIDIDGAV-ISGNPGDPGVPGLPGLKGDEGIQGLRGPSGVPGL 389          
BLAST of Collagen IV NC1 domain-containing protein vs. Ensembl Human
Match: COL4A6 (collagen type IV alpha 6 chain [Source:HGNC Symbol;Acc:HGNC:2208])

HSP 1 Score: 276.174 bits (705), Expect = 5.210e-74
Identity = 439/1198 (36.64%), Postives = 547/1198 (45.66%), Query Frame = 3
Query:  201 GNKGRQGFPGPRGYQGVSGDKGDVGQFGMPGPKGYKGFTGAIGPQGRKGERGIPGSPGYPGKMGEMGFPGIRGDIGEKGLTGCDGQQGDFGNPGMNGLVGRTGQPGERGDDGDRGLSIIPKYGLKG--------------------------NKGSRGLLGRYGRKGEKGFKGIKGYSGIFGIKGNKGYVGPMGRRGPKGDSLGTVI--IQSEKGSKGDKGLKGQSGIPCKGFQIEGRMYGRVGSDGPIGDKGIKGE------KGLMGEIGQSGIDGARGLNGEKG-----------LPGEAGPRGERGDRGNPGFPGD--PGASGADGTRGRQGERGPKGVHGISGADGPRGSRGDKGPSGSLLSC--PGRKGEKGFFGIPGIKGDIGNKGYQGHDGDIGEIGFKGEKGYEGPLGPSCSEVEQGFRGTKGESGFPGLRGAKGQRGYSGNKGIKGKPNFGTGINNPGETGSYGNLGVPGEKGNKGFIGDTGEKGFSGT-GKQGPEGPRGDKGDDGVNGQVGMIGMPGIKGDKG----STYPICPFCEKGYKGIQXXXXXXXXXXXXXXXXXXXXXXXXXX---XXDEGRMGLLGSKGRQGYKGGKGFSGSMGDAGEIGYVTISGTTIPGVKGEKGNQGPKGNKGEFGEAGSRGRKGYSGLKGFKGLIGERGTSFSSGDPGDKGLRGENGKDGVSFA-GIPGEKGLKGDKGN----------------RGILGDVGSLSNCATRPITSKGFKGPQGAKGTSGSPGSAGKTGIVGNKGENGYPGKRGIDGDNG-------IPGSKGEEGETGIKGHAGRPGNLGKSGLQGLRGE---YGVKGDLGIQGIPGRKGVMGDPGPNGYAMIGSKGDKGIKGLPGIYGAKGDKGRPGYIGIPGFKGETGLIGRSGLKGDQGEIGEKGIKGFTFISNNPGDRGLLGNKGLKGFPGE-LGNKGQVGVCTVRGDQGLRGYSGLIGDMGMKGEQGSKGIVGDYGAASRSGIMGRTGKIGNQGLPGDQXXXXXXXXXXXXXXXX---------YIGIPGFEGDRGEKGNKGFPGFPGDIGQPGRLGNPGISTEGVXXXXXXXXXXXXXXXXXXXXXXXXXXKQGDSGISIPGRQGIKGEDGTIGLPGEMGEPGPRGDFGQKGNIGITGEFGLQGNRGDDG---------LKGDDGIPGLNGPRGFIGDIG 3485
            G KG  GFPG  G+QG+ G KGD+G   +PGP  +    GA+         G PG PG PG       PG++GD G +GL G  G  G     G+ G +G  G PG +GD G+ G + I   GL G                            G  GL G  G KG  G KGIKG SG     G     GP G  GP G      +  ++  +G +G  G +G +G P           G VG  GP G KG KGE      +G+ G+ G SG  G RG+ GE G                G +G  G++G PG PG+            G  G  GP+G+ G  G DG  G +G  G  G  L C  PG  G  GF G PG  G  G++G  G  G  G  G KGE G  G +         G RG KG  GFPGL G  G  G  G+ G+ G     TG     E G+ G  G+ G  G+KGF+GD+G  G  G  GK G  GP+G++G  G  GQVG  G PG  G  G    S  P  P    G+ GI G  G++G  G  G  G    KG  GL   PG+ G +GL GS G  G  G    SG  G+ G +G+V   G  IPG+ G  G +G KG  G  G+ G  GR G  G KG +G  G  G         +  L+G+ G  G + + G PG +G KG+ G                 +G+ G  G       R +   G KG  G  G  G PG +G  GI G+ G  G  G  G+ GDNG        PG KG+ GE+G KG  GR G +G  G  G +GE    GV GD+G+ G PG  GV G            +G+ G+ G  G  GA G  G PG IG  GF G  GL G +GL G +G  G  G      I+  PG  GL G KG KG+PG  +G  G+ G+   RG +G RG+ GL         QG  G+ G  G +  S I G+ G  G  GL G++G PG  G  G  G            + GIPG +G +G++G  GF G PG++G  G  G PG    G  G  G  G PG  G  G  G  G  G QGD G   P  + ++   G +GLPG  G PG  GD G +G +G+ G  GL G  G DG           GD G+PGL GP GF G  G
Sbjct:  318 GKKGTLGFPGLNGFQGIEGQKGDIG---LPGPDVFIDIDGAV-------ISGNPGDPGVPG------LPGLKGDEGIQGLRGPSGVPGLPALSGVPGALGPQGFPGLKGDQGNPGRTTIGAAGLPGRDGLPGPPGPPGPPSPEFETETLHNKESGFPGLRGEQGPKGNLGLKGIKGDSGFCACDGGVPNTGPPGEPGPPGPWGLIGLPGLKGARGDRGSGGAQGPAGAP-----------GLVGPLGPSGPKGKKGEPILSTIQGMPGDRGDSGSQGFRGVIGEPGKDGVPGLPGLPGLPGDGGQGFPGEKGLPGLPGEKGHPGPPGLPGNGLPGLPGPRGLPGDKGKDGLPGQQGLPGSKGITLPCIIPGSYGPSGFPGTPGFPGPKGSRGLPGTPGQPGSSGSKGEPGSPGLVHLPELPGFPGPRGEKGLPGFPGLPGKDGLPGMIGSPGLPGS-KGATGDIFGAENGAPGEQGLQGLTGHKGFLGDSGLPGLKGVHGKPGLLGPKGERGSPGTPGQVGQPGTPGSSGPYGIKGKSGLPGAP----GFPGISGHPGKKGTRGKKGPPGSIVKKGLPGLKGLPGNPGLVGLKGSPGSPGVAGLPALSGPKGEKGSVGFVGFPG--IPGLPGIPGTRGLKGIPGSTGKMGPSGRAGTPGEKGDRGNPGPVGIPSPRRPMSNLWLKGDKGSQGSAGSNGFPGPRGDKGEAGRPGPPGLPGAPGLPGIIKGVSGKPGPPGFMGIRGLP--GLKGSSGITGFPGMPGESGSQGIRGSPGLPGASGLPGLKGDNGQTVEISGSPGPKGQPGESGFKGTKGRDGLIGNIGFPGNKGEDGKVGVSGDVGLPGAPGFPGVAG-----------MRGEPGLPGSSGHQGAIGPLGSPGLIGPKGFPGFPGLHGLNGLPGTKGTHGTPGPS----ITGVPGPAGLPGPKGEKGYPGIGIGAPGKPGL---RGQKGDRGFPGL---------QGPAGLPGAPGISLPSLIAGQPGDPGRPGLDGERGRPGPAGPPGPPGPSSNQGDTGDPGFPGIPGPKGPKGDQGIPGFSGLPGELGLKGMRGEPGFM--GTPGKVGPPGDPGFPGMKGKAGPRGSSGLQGDPG-QTPTAEAVQVPPGPLGLPGIDGIPGLTGDPGAQGPVGLQGSKGLPGIPGKDGPSGLPGPPGALGDPGLPGLQGPPGFEGAPG 1449          

HSP 2 Score: 265.003 bits (676), Expect = 1.207e-70
Identity = 459/1325 (34.64%), Postives = 585/1325 (44.15%), Query Frame = 3
Query:  186 KCQCFGNKGRQGFPGPRGYQGVSGDKGDVGQFGMPGPKGYKGFTGAIGPQGRKGERGIPGSPGYPGKMGEMGFPGIRGDIGEKGLTGCDGQQGDFGNPGMNGL---VGRTGQPGERGDDGDRGLSIIPKYGLKGNKGSRGLLGRYGRKGEKGFKGIK--------------------------GYSGIFGIKGNKGYVGPMGRRGPKGDSLGTVIIQSEKGSKGDKGLKGQSGIP-CKGFQ-----------IEGRMYGRVGSDGPIGDKGIK---GEKGLMGEIGQSGIDGARGLNGEKGLPGEAGPR-----GERGDRGNPGFPGDPGASGADGTRGRQGERGPKGVHGISGADGPRGSRGDKGPSGSLLSCPGRKGEKGFFGIPGIKGDIGNKGYQGHDGDIGEIGFKGEKGYEGPLGPSCSEVEQGFRGTKGESGFPGLRGAKGQRGYSGNKGIKGKPNFGT---GINNP------GETGSYGNLGVPGEKGNKGFIGDTGEKGFSGT-GKQGPEGPRGDKGDDGVNGQVGMIGMPGIKGDKGSTYPICPFCEKGYKGIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEGRMGLLGSKGRQGYKGGKGFSGSMGDAGEIGYVTISGTTIPGVKGEKGNQGPKGNKGEFGEA------GSRGRKGYSGLKGFKGLIGERGTSFSSGDPGDKGLRGENGKDG-VSFAGIPGEKGLKGDKGNRGILGDVGSLSNCATRPITSKGFKGPQGAKG-----TSGSPGSAGKTGIVGNK---GENGYPGKRGIDGDNGIPGSKGEEGETGIKGHAGRPGNLGKSGLQGLRGEYGVKGDLGIQGI------------------------PGRKGVMGDPGPNGYAMIGSKGDKGIKGLPGIYGAKGDKGRPGYIGIPGFKGETGLIGRSGLKGDQGEIGEKGIKGFTFISNNPGDRGLLGNKGLKGFPGELGNKGQVGVCTVRGDQGLRGYSGLIGDMGMKGEQGSKGIVGDYGAASRSGIM-------GRTGKIGNQGLPGDQXXXXXXXXXXXXXXXXYIGIPGFEGDRGEKGNKGFPGFPGDIGQPGRLGNPGISTEGVXXXXXXXXXXXXXXXXXXXXXXXXXXKQGDSGIS-IPGRQGIKG---------EDGTIGLPGEMGEPGPRGDFGQKGNIGITGEFGLQGNRGDDGLKGDDGIPGLNGPRGFIGDIGFVGFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXELGLDGSMGGKGDNGP--RGFNGPTGIPGSKGFEGDKGI-RGDIGVKGFQGQHGEIGFPGLKGVSGENG 3806
             CQCF  KG +G PGP G QG +G +G  G  G+ G KG +GF G +GP G KG++G  G PG+ G  G  G PG  G  G  GL GC+G QG  G PG +G    +G  G PG++G  GD  L+     G+KG+ G  GL G  G +G  GF G                            G+ G  G+KG+ G  GP G     G+       + +KGSKG+ G KG  GI    GF             E  + G  G  GP+G +G++   G++G  G +G  G++G +G+ G+KG  G  GP            GNPG PG PG  G  G  G QG RGP GV G+                 +L   PG  G +GF   PG+KGD GN G     G  G  G  G  G  GP GP   E E      K ESGFPGLRG +G +G  G KGIKG   F     G+ N       G  G +G +G+PG KG +G  G  G +G +G  G  GP GP G KG  G      + GMPG +GD GS         +G++G+                              +G  G  G KG  G  G KG  G  G  G           +PG KG+ G  G +G  G  G        GS G  G+ G  GF G  G RG   + G PG  G +GE G  G V    +PG  G +G+KG  G  G  G         I S G  G +GA G      +G+PG  G  G+ G+K   G++G PG +G+ G  G+ G KGE G  G  G  G+PG  G SG  G++G+ G+ G  G  GI                        PG KG+ G+PG  G  + GS G  G+ GLP + G KG+KG  G++G PG  G  G+ G  GLKG  G  G+ G  G    +  PG++G  GN G  G P        + +   +G QG  G +G  G  G KGE G  G  G  GA    GI+       G  G +G +GLPG +            GS G  G PG  G+ G +G +G PG PG  G PG  G+ G + E                   + G  G  G+ G+SG     GR G+ G         EDG +G+ G++G P   G  G  G  G+ GE GL G+ G  G  G  G PGL GP+GF G  G  G                                        GL G+ G  G  GP   G  GP G+PG KG +G  GI  G  G  G +GQ G+ GFPGL+G +G  G
Sbjct:   39 SCQCFPEKGARGRPGPIGIQGPTGPQGFTGSTGLSGLKGERGFPGLLGPYGPKGDKGPMGVPGFLGINGIPGHPGQPGPRGPPGLDGCNGTQGAVGFPGPDGYPGLLGPPGLPGQKGSKGDPVLAPGSFKGMKGDPGLPGLDGITGPQGAPGFPGAVGPAGPPGLQGPPGPPGPLGPDGNMGLGFQGEKGVKGDVGLPGPAGPPPSTGELEFMGFPKGKKGSKGEPGPKGFPGISGPPGFPGLGTTGEKGEKGEKGIPGLPGPRGPMGSEGVQGPPGQQGKKGTLGFPGLNGFQGIEGQKGDIGLPGPDVFIDIDGAVISGNPGDPGVPGLPGLKGDEGIQGLRGPSGVPGLP----------------ALSGVPGALGPQGF---PGLKGDQGNPGRT-TIGAAGLPGRDGLPGPPGPPGPPSPEFETETLHNK-ESGFPGLRGEQGPKGNLGLKGIKGDSGFCACDGGVPNTGPPGEPGPPGPWGLIGLPGLKGARGDRGSGGAQGPAGAPGLVGPLGPSGPKGKKGEPILSTIQGMPGDRGDSGS---------QGFRGV----------IGEPGKDGVPGLPGLPGLPGDGGQGFPGEKGLPGLPGEKGHPGPPGLPGNGLPGLPGPRGLPGDKGKDGLPGQQGLPGSKGITLPCIIPGSYGPSGFPGTPGFPGPKGSRGLPGTPGQPGSSGSKGEPGSPGLVHLPELPGFPGPRGEKGLPGFPGLPGKDGLPGM--IGSPGLPGSKGATGDIFGAENGAPGEQGLQGLTGHKGFLGDSGLPGLKGVHGKPGLLGPKGERGSPGTPGQVGQPGTPGSSGPYGIKGKSGLPGAPGFPGISGHPGKKGTRGKKGPPGSIVKKGLPGLKGLPGNPGLVG--LKGSPGSPGVAGLPALSGPKGEKGSVGFVGFPGIPGLPGIPGTRGLKGIPGSTGKMGPSGR---AGTPGEKGDRGNPGPVGIPSPRRPMSNLWLKGDKGSQGSAGSNGFPGPRGDKGEAGRPGPPGLPGAPGLPGIIKGVSGKPGPPGFMGIRGLPGLK------------GSSGITGFPGMPGESGSQGIRGSPGLPGASGLPGLKGDNGQTVE-------------------ISGSPGPKGQPGESGFKGTKGRDGLIGNIGFPGNKGEDGKVGVSGDVGLP---GAPGFPGVAGMRGEPGLPGSSGHQGAIGPLGSPGLIGPKGFPGFPGLHGLN--------------------------------------GLPGTKGTHGTPGPSITGVPGPAGLPGPKGEKGYPGIGIGAPGKPGLRGQKGDRGFPGLQGPAGLPG 1244          

HSP 3 Score: 250.366 bits (638), Expect = 4.567e-66
Identity = 172/515 (33.40%), Postives = 232/515 (45.05%), Query Frame = 3
Query: 3990 IRGLQGRKGSTGLRGNIGIPG------------ERGDKGIPGL---------------------QGKVGNKGVKGDIGDKGFSGNIGDKGYSGISGDKGSFGVKGDKGFQGDVGML------------------GKSGLQGDRGQ----KGIIGFRGTRGIPGSMGLPGEIGEKGDVGPSGI-GVKGLKGYQ------NAVGIKGRKGEKGLPGFPGRPGKVGDQGDKGPKGMKNMNTXXXXXXXXXXXXXXXXXXXXXXXXXLPGDMGEIGPNGPIGYADNGFLYATHSQSKDFPPCHGGGSPLYNGYSLLAIHGDIDSVTMDLGTPGSCLKNFSTIPFVNCFLERNTFYGGRCHVNMRNSRSYWLSTLQSYMSSPQPPSKMDDYISRCSVCQTKTTVMAFHSQKSDWQMTKCPYGWQKLWAGFSFPMAVQASRSGSNQPFSSPGSCLKHFRSLPFIECNNHNSNCNHWRDGVSYYMTAVDSENQFVKAQGKVLKSQTDIMNSISKCVVCQRDM 5348
            +RG +G +G  GL+G  G+PG            + GD G PGL                     QG  G+ G  G  G KG  G+ G  G+SG+ G+ G  G++G+ GF G  G +                  G SGLQGD GQ    + +    G  G+PG  G+PG  G+ G  GP G+ G KGL G           G  G  G+ GLPG  G PG  G  G +GP GM  M                            PG    +           G+    HSQS+  PPC  G S L+ GYSLL + G   +   DLG  GSCL  FST+PF+ C +         CH   RN +SYWLST       P   +++  YISRCSVC+  +  +A HSQ  D  + +CP GW+ LW G+SF M   A   G  Q   SPGSCL+ FR+ PFIEC+     C+++ +  S+++T V+   QF +           +   +S+C VC + +
Sbjct: 1224 LRGQKGDRGFPGLQGPAGLPGAPGISLPSLIAGQPGDPGRPGLDGERGRPGPAGPPGPPGPSSNQGDTGDPGFPGIPGPKGPKGDQGIPGFSGLPGELGLKGMRGEPGFMGTPGKVGPPGDPGFPGMKGKAGPRGSSGLQGDPGQTPTAEAVQVPPGPLGLPGIDGIPGLTGDPGAQGPVGLQGSKGLPGIPGKDGPSGLPGPPGALGDPGLPGLQGPPGFEGAPGQQGPFGMPGM----------------------------PGQSMRV-----------GYTLVKHSQSEQVPPCPIGMSQLWVGYSLLFVEGQEKAHNQDLGFAGSCLPRFSTMPFIYCNINE------VCHYARRNDKSYWLSTTAPIPMMPVSQTQIPQYISRCSVCEAPSQAIAVHSQ--DITIPQCPLGWRSLWIGYSFLMHTAAGAEGGGQSLVSPGSCLEDFRATPFIECSGARGTCHYFANKYSFWLTTVEERQQFGELPVSETLKAGQLHTRVSRCQVCMKSL 1691          

HSP 4 Score: 247.669 bits (631), Expect = 2.834e-65
Identity = 449/1381 (32.51%), Postives = 559/1381 (40.48%), Query Frame = 3
Query:  237 GYQGVSGDKGDVGQFGMPGPKGYKGFTGAIG-PQGRKGERGIPGSPGYPGKMGEMGFPGI--------------------RGDIGEKGLTGCDGQQG---DFGNPGMNGLVGRTGQPGERGDDGDRGLSIIPKYGLKGNKGSRGLLGRYGRKGEKGFKGIKGYSGIFGIKGNKGYVGPMGRRGPKGDSLGTVIIQSEKGSKGDKGLKGQSGIPCKGF------------------QIEGRMYGRVGSDGPIGDKGIKGEKGLMGEIGQSGIDGARGLNGEKGLPGEAGPRGERGDRGNPGFPGDPGASGADGTRGRQGERGPKGVHGISGADGPRGSRGDKGPSGSLLSCPGRKGEKGFFGIPGIKGDIGNKGYQGHDGDIGEIG--------------------FKGEKGYEGPLG--------------PSCSEVEQGFRGTKGESGFPGLRGAKGQRGYS---------GNKGIKGKPNFGTGINNPGETGSYGNLGVPGEKGNKGFIGDTGEKGFSGTGK-QGPEGPRGDKGDDGV------NGQVGMIGMPGIKGDKGSTYPICPFCEKGYKGIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEGRMGLLGSKGRQGYKGGKGFSGSMGDAGEIGYVTISGTTIP-GVKGEKGNQGPKGNKGEFGEA------------GSRGRKGYSGLKGFKGLIGERGTSFSSGDPGDKGL------RGENGKDG-VSFAGIPGEKGLKGDKGNRGILGDVGSLSNCATRPITSKGFKGPQGAKGTSGSPGSAGKTGIVG---------NKGENGYPGKRGIDGDNGIPGSKGEEGET-------------------GIKGHAGRPGNLGKSGLQGLRGEYGVKGDLGIQGIPGRKGVMGDPG-PNGYAMIGSKGDKGIKGLPGIYGAKGDKGRPGYIGIPGFKGETGLIGRSGLKGDQGEIGEKGIKGFTFISNNPGDRGLLGNKGLKGFPGELGNKGQVGVCTVRGDQGLRGYSGLIGDMGMKGEQGSKGIVGDYGAASRSGIMGRTGKIGNQGLPGDQXXXXXXXXXXXXXXXXYIGIPGFEGDRGEKGNKGFPGFPGDIGQPGRLGNPGISTEGVXXXXXXXXXXXXXXXXXXXXXXXXXXKQGDSGISIPGRQGIKGE---------------------DGTIGLPGEMGEPGPRGDFGQKGNIGITGEFGLQGNRGDDGLKGDDG------------IPGLNGPRGFIGDIGFVGFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXELGLDGSMGGKGDNGPRGFNGPTGIPGSKGFE------------------GDKGIRGDIGVKGFQ---GQHGEIGFPGLKGVS 3794
            G+QG  G KGDVG  G  GP    G    +G P+G+KG +G PG  G+PG  G  GFPG+                    RG +G +G+ G  GQQG     G PG+NG  G  GQ G+ G  G      I    + GN G  G+ G  G KG++G +G++G SG+ G+    G  G +G +G               G KGD+G  G++ I   G                   + E        S    G  G++GE+G  G +G  GI G  G     G     GP GE G  G  G  G PG  GA G RG  G +GP G  G+ G  GP G +G             +KGE     I G+ GD G+ G QG  G IGE G                    F GEKG  G  G                     +G  G KG+ G PG +G  G +G +         G  G  G P F      PG  GS G  G PG+ G+ G  G+ G  G     +  G  GPRG+KG  G       +G  GMIG PG+ G KG+T  I    E G  G QG  G  G  G  G               D G  GL G  G+ G  G KG  GS G  G++G     G++ P G+KG+ G  G  G  G  G              GS  +KG  GLKG  G  G  G   S G PG  GL      +GE G  G V F GIPG  G+ G +G +GI G  G +              GP G  GT G  G  G  G VG         N    G  G +G  G NG PG +G++GE                    G+ G  G PG +G  GL GL+G  G+ G  G+ G  G +G+ G PG P    + G KGD G      I G+ G KG+PG  G  G KG  GLIG  G  G++GE G+ G+ G   +   PG  G+ G +G  G PG  G++G +G     G  G +G+ G  G  G+ G  G+KG  G  G +        TG  G  GLPG +G  G  G          IG PG  G RG+KG++GFPG  G  G PG    PGIS   +I                         + GD     PGR G+ GE                      G  G PG  G  GP+GD G  G  G+ GE GL+G RG+ G  G  G            + G  GPRG  G  G  G                              + +    G LGL G  G  G  G  G  GP G+ GSKG                    GD G+ G  G  GF+   GQ G  G PG+ G S
Sbjct:  222 GFQGEKGVKGDVGLPGPAGPPPSTGELEFMGFPKGKKGSKGEPGPKGFPGISGPPGFPGLGTTGEKGEKGEKGIPGLPGPRGPMGSEGVQGPPGQQGKKGTLGFPGLNGFQGIEGQKGDIGLPGPDVFIDIDGAVISGNPGDPGVPGLPGLKGDEGIQGLRGPSGVPGLPALSGVPGALGPQG-------------FPGLKGDQGNPGRTTIGAAGLPGRDGLPGPPGPPGPPSPEFETETLHNKES----GFPGLRGEQGPKGNLGLKGIKGDSGFCACDGGVPNTGPPGEPGPPGPWGLIGLPGLKGARGDRGSGGAQGPAGAPGLVGPLGPSGPKG-------------KKGEPILSTIQGMPGDRGDSGSQGFRGVIGEPGKDGVPGLPGLPGLPGDGGQGFPGEKGLPGLPGEKGHPGPPGLPGNGLPGLPGPRGLPGDKGKDGLPGQQGLPGSKGITLPCIIPGSYGPSGFPGTPGF------PGPKGSRGLPGTPGQPGSSGSKGEPGSPGLVHLPELPGFPGPRGEKGLPGFPGLPGKDGLPGMIGSPGLPGSKGATGDIF-GAENGAPGEQGLQGLTGHKGFLG---------------DSGLPGLKGVHGKPGLLGPKGERGSPGTPGQVGQPGTPGSSGPYGIKGKSGLPGAPGFPGISGHPGKKGTRGKKGPPGSIVKKGLPGLKGLPGNPGLVGLKGSPGSPGVAGLPALSGPKGEKGSVGFVGFPGIPGLPGIPGTRGLKGIPGSTGKM--------------GPSGRAGTPGEKGDRGNPGPVGIPSPRRPMSNLWLKGDKGSQGSAGSNGFPGPRGDKGEAGRPGPPGLPGAPGLPGIIKGVSGKPGPPGFMGIRGLPGLKGSSGITGFPGMPGESGSQGIRGSPGLPGASGLPGLKGDNGQTVE--ISGSPGPKGQPGESGFKGTKGRDGLIGNIGFPGNKGEDGKVGVSGDVGLPGAPGFPGVAGMRGEPGLPGSSGHQGAIGPLGSPGLIGPKGFPGFPGLHGLNGLPGTKGTHGTPGPSI-------TGVPGPAGLPGPKGEKGYPGIG--------IGAPGKPGLRGQKGDRGFPGLQGPAGLPGA---PGISLPSLIAG-----------------------QPGD-----PGRPGLDGERGRPGPAGPPGPPGPSSNQGDTGDPGFPGIPGPKGPKGDQGIPGFSGLPGELGLKGMRGEPGFMGTPGKVGPPGDPGFPGMKGKAGPRGSSGLQGDPG-------------------------QTPTAEAVQVPPGPLGLPGIDGIPGLTGDPGAQGPVGLQGSKGLPGIPGKDGPSGLPGPPGALGDPGLPGLQGPPGFEGAPGQQGPFGMPGMPGQS 1463          

HSP 5 Score: 197.978 bits (502), Expect = 4.620e-50
Identity = 294/910 (32.31%), Postives = 379/910 (41.65%), Query Frame = 3
Query:  177 TPDKCQCFGNKGRQGFPGPRGYQGVSGDKGDVGQFGMPGPKGYKGFTGAIGPQGRKGERGIPGSPGYPGKMGEMG--FPGIRGDIGEKGLTGCDGQQGDFGNPGMNGLVGRTGQPGERGDDGDRGLSIIP----KYGLKGNKGSRGLLGRYGRKGEKGFKGI---------------------KGYSGIFGIKGNKGYVGPMGRRGPKGDSLGTVIIQSEKGSKGDKGLKGQSGIPCKGFQIEGRMYGRVGSDGPIGDKGIKGEKGLMGEIGQSGIDGARGLNGEKGLPGEAGPRGERGDRGNPGFPGDPGASGADGTRGRQGERGPKG-------------------VHGISGADGPRGSRGDKGPSGSLLSCPGRKGEKGFFGIPGIKGDIGNKGYQGHDGDIGEIGFKGEKG-------YEGPLGPSCSEVEQGFRGTKGES------GFPGLRGAKGQRGYSGNKGIKGKPNFGTGINNPGETGSYGNLGVPGEKGNKGFIGDTGEKGFSGTGKQGPEGPRGDKGDDGVNGQVGMIGMPGIKGDKGSTYPIC-----------PFCEKGYKGIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEGRMGLLGSKGRQGYKGGKGFSGSMGDAGEIGYVTISGTTIPGVKGEKGNQGPKGNKGEFGEAGSRGRKGYSGLKGFKGLIGERGTSFSSGDPGDKGLRGENGKDGVSFAGIPGEKGLKGDKGNRGILGDVGSLSNCATRPITS-KGFKGPQGAKGTSGSPGSAGKTGIVGNKGENGYPGKRGIDGDNGIPGSKGEEGETGIKGHAGRPGNLGKSGLQGLRGEYGVKGDLGIQGIPGRKGVMGDPGPNGYAMIGSKGDKGIKGLPGIYGAKGDKGRPGYIGIPGFKGETGLIGRSGLKGDQGE 2693
            TP +    G+KG  G PG      +          G PGP+G KG  G  G  G+ G  G+ GSPG PG  G  G  F    G  GE+GL G  G +G  G+ G+ GL G  G+PG  G  G+RG    P    + G  G+ G  G+ G+ G  G  GF GI                     KG  G+ G+ GN G VG  G  G  G + G   +   KG KG  G  G  GIP              G  G  G +G+KG  G  G++G SG  G  G  G++G PG  G    R    N    GD G+ G+ G+ G  G RG KG                   + G+SG  GP G  G +G        PG KG  G  G PG+ G+ G++G +G  G  G  G  G KG         G  GP     E GF+GTKG        GFPG +G  G+ G SG+ G+ G P F      PG  G  G  G+PG  G++G IG  G  G  G            KG  G  G  G+ G+PG KG  G+  P             P  EKGY GI                                 +G  G  G +G KG +GF G  G AG  G   IS  ++  + G+ G+ G  G  GE G  G  G  G  G    +G  G+ G     G PG KG +G+ G  G  F+G+PGE GLKG +G  G +G  G +           KG  GP+G+ G  G PG       V        PG  G+ G +GIPG  G+ G                      +G  G++G  G+ GIPG+     D         G+ GD G+ GL G  G +G  G+ G  G+PG  G++  +G + +K  Q E
Sbjct:  686 TPGQPGSSGSKGEPGSPGLVHLPELP---------GFPGPRGEKGLPGFPGLPGKDGLPGMIGSPGLPGSKGATGDIFGAENGAPGEQGLQGLTGHKGFLGDSGLPGLKGVHGKPGLLGPKGERGSPGTPGQVGQPGTPGSSGPYGIKGKSGLPGAPGFPGISGHPGKKGTRGKKGPPGSIVKKGLPGLKGLPGNPGLVGLKGSPGSPGVA-GLPALSGPKGEKGSVGFVGFPGIP--------------GLPGIPGTRGLKGIPGSTGKMGPSGRAGTPGEKGDRGNPGPVGIPSPRRPMSNLWLKGDKGSQGSAGSNGFPGPRGDKGEAGRPGPPGLPGAPGLPGIIKGVSGKPGPPGFMGIRG-------LPGLKGSSGITGFPGMPGESGSQGIRGSPGLPGASGLPGLKGDNGQTVEISGSPGPKGQPGESGFKGTKGRDGLIGNIGFPGNKGEDGKVGVSGDVGLPGAPGF------PGVAGMRGEPGLPGSSGHQGAIGPLGSPGLIGP-----------KGFPGFPGLHGLNGLPGTKGTHGTPGPSITGVPGPAGLPGPKGEKGYPGI--------------------------------GIGAPGKPGLRGQKGDRGFPGLQGPAGLPGAPGISLPSL--IAGQPGDPGRPGLDGERGRPGPAGPPGPPGPSSNQGDTGDPGF---PGIPGPKGPKGDQGIPG--FSGLPGELGLKGMRGEPGFMGTPGKVGPPGDPGFPGMKGKAGPRGSSGLQGDPGQTPTAEAV-----QVPPGPLGLPGIDGIPGLTGDPGA---------------------QGPVGLQGSKGLPGIPGK-----DGPSGLPGPPGALGDPGLPGLQGPPGFEGAPGQQGPFGMPGMPGQSMRVGYTLVKHSQSE 1477          

HSP 6 Score: 183.726 bits (465), Expect = 1.258e-45
Identity = 286/894 (31.99%), Postives = 357/894 (39.93%), Query Frame = 3
Query:  201 GNKGRQGFPGPRGYQGVSGDKGDVGQFGMPGPKGYKGFTGAIGPQGRKGERGIPGSPGYPGKMGEMGFPGIRGDIGEKGLTGCDGQQGDFGNPGMNGLVGRTGQPGERGDDGDRGLSIIPKYGLKGNKGSRGLLGRYGRKGEKGFKGIKGYSGIFGIKGNKGYVGPMGRRGPKGDSLGTVIIQSEKGSKGDKGLKGQSGIP-------CKGFQIEGRMYGRVGSDGPIGDKGIKGEKGLMGEIGQSGIDGARGLNGEKGLPGEAGPRGERGDRGNPGFPGDPG---------------------ASGADGTRGRQGERG---------------------PKGVHGISGADGPRGSRGDKG----------------------------PSGSL--LSCPGRKGEKGFFGIPGIKGDIGNKGYQGHDGDIGEIGFKGEKG-------YEGPLGPSCSEVEQGFRGTKGESG------FPGLRGAKGQRGYSGNKGIKGKPNFGTGINNPGETGSYGNLGVPGEKGNKGFIGDTGEKGFSGTGKQGPEGPRGDKGDDGVNGQVGMIGMPGIKGDKGSTYPIC-----------PFCEKGYKGIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEGRMGLLGSKGRQGYKGGKGFSGSMGDAGEIGYVTISGTTI----------PGVKGE---------------KGNQGPKGNKGEFGEAGSRGRKGYSGLKGFKGLIGERGTSFSSGDPG---------------------------DKGLRGENGKDGVSFAG--IPGEKGLKGDKGNRGILGDVGSLSNCATRPITSKGFKGPQG------AKGTSGSPGSAGKTGIVGNKGENGYPGKRGIDGDNGIPGSKGEEGETGIK 2393
            G+KG+ G PG    QG+ G KG      +PG  G  GF G  G  G KG RG+PG+PG PG  G  G PG  G +    L G  G +G+ G PG  GL G+ G PG  G  G  G             G+ G  G  G  G KGF G  G  G+ G+ G  G +GP G RG  G + G V      GS G  G+KG+SG+P         G   +    G+ G  G I  KG+ G KGL G  G  G+ G+ G  G  GLP  +GP+GE+G  G  GFPG PG                      SG  GT G +G+RG                      KG  G +G++G  G RGDKG                            P G +     PG KG  G  G PG+ G+ G++G +G  G  G  G  G KG         G  GP     E GF+GTKG  G      FPG +G  G+ G SG+ G+ G P F      PG  G  G  G+PG  G++G IG  G  G  G            KG  G  G  G+ G+PG KG  G+  P             P  EKGY GI                                 +G  G  G +G KG +GF G  G AG  G   IS  ++          PG+ GE                 NQG  G+ G  G  G +G KG  G+ GF GL GE G     G+PG                             GL+G+ G+   + A    PG  GL G  G  G+ GD G+      +   SKG  G  G        G  G+ G  G  G+ G  G  G PG++G  G  G+PG     G T +K
Sbjct:  634 GDKGKDGLPG---QQGLPGSKGITLPCIIPGSYGPSGFPGTPGFPGPKGSRGLPGTPGQPGSSGSKGEPGSPGLVHLPELPGFPGPRGEKGLPGFPGLPGKDGLPGMIGSPGLPGSKGATGDIFGAENGAPGEQGLQGLTGHKGFLGDSGLPGLKGVHGKPGLLGPKGERGSPG-TPGQVGQPGTPGSSGPYGIKGKSGLPGAPGFPGISGHPGKKGTRGKKGPPGSIVKKGLPGLKGLPGNPGLVGLKGSPGSPGVAGLPALSGPKGEKGSVGFVGFPGIPGLPGIPGTRGLKGIPGSTGKMGPSGRAGTPGEKGDRGNPGPVGIPSPRRPMSNLWLKGDKGSQGSAGSNGFPGPRGDKGEAGRPGPPGLPGAPGLPGIIKGVSGKPGPPGFMGIRGLPGLKGSSGITGFPGMPGESGSQGIRGSPGLPGASGLPGLKGDNGQTVEISGSPGPKGQPGESGFKGTKGRDGLIGNIGFPGNKGEDGKVGVSGDVGLPGAPGF------PGVAGMRGEPGLPGSSGHQGAIGPLGSPGLIGP-----------KGFPGFPGLHGLNGLPGTKGTHGTPGPSITGVPGPAGLPGPKGEKGYPGIG--------------------------------IGAPGKPGLRGQKGDRGFPGLQGPAGLPGAPGISLPSLIAGQPGDPGRPGLDGERGRPGPAGPPGPPGPSSNQGDTGDPGFPGIPGPKGPKGDQGIPGFSGLPGELGLKGMRGEPGFMGTPGKVGPPGDPGFPGMKGKAGPRGSSGLQGDPGQTPTAEAVQVPPGPLGLPGIDGIPGLTGDPGAQGPVGLQ--GSKGLPGIPGKDGPSGLPGPPGALGDPGLPGLQGPPGFEGAPGQQGPFGMPGMPGQSMRVGYTLVK 1472          

HSP 7 Score: 134.806 bits (338), Expect = 9.188e-31
Identity = 344/1087 (31.65%), Postives = 435/1087 (40.02%), Query Frame = 3
Query: 1536 FSGTGKQGPEGPRGDKGDDGVNGQVGMIGMPGIKGDKGSTYPICPFCEKGYKGIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEGRMGLLGSKGRQGYKGGKGFSGSMGDAGEIGYVTISGTTIPGVKGEKGNQGPKGNKGEFGEAGSRGRKGYSGLKGFKGLIGERGTSFSSGDPGDKGLRGENGKDGVSFAGIPGEKGLKGDKGNRGILGDVGSLSNCATRPITSKGFKGPQGAKGTSGSPGSAGKTGIVGNKGENGYPG-----KRGIDGDNGIPGSKGEEGETGIKGHAGRPGNLGKSGLQGLRGEYGVKGDLGIQGIPGRKGVMGDPGPN------GYAMIGSKGDKGIKGLPG------IYGAKGDKGRPGYIGIPGFKGETGLIGRSGLKGDQGEIGEKGIKGFTFISNNPG--------------DRGLLGNK--GLKGFPGELGNKGQVGVCTVRGDQGLRGYSG---------------------LIGDMGMKGEQGSKGIVGDYGAASRSGIMGRTGKIGNQGLPGDQXXXXXXXXXXXXXXXXYIGIPGFEGDRGEKGNKGFPGFPGDIGQ--------------------PGRLGNPGISTEGVXXXXXXXXXXXXXXXXXXXXXXXXXXKQGDSGIS-IPGRQGIK------GEDGTIGLPGEMGEPGPRGDFGQKGNIGITGEFGLQGNRGDDGLKGDDGIPGLNGPRGFIGDIGFVGFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXELGLDGSMGGKGDNGPRGFNGPTGIPGSKGFEGD-----KGIRGDIGVKGFQGQHGEIGFPGLKGVSGENGRQXXXXXXXXXXXXXXXXVCMQPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEVGESIRGLQGRKGSTGLRGNIGIPGERGD------------------KGIPGLQGKVGNKGVKGDIGDKGFSGNIGDKGYSGISGDKGSFGVKGDKGFQGDVGMLGKSGLQGDRGQKGIIGFRGTRGIPGSMGLPGEIGEKGDVGPSGIGVKGLKGYQNAVGIKGRKGEKGLPGFPGRPGKVGDQGD 4484
            F   G +G  GP G +G  G  G  G  G+ G+KG++G    + P+  KG KG  G  G  G NG  G  G  G +G  GL G  G  G +G  G  GY G  G  G  G  G  G   ++  +             KG KG+ G  G  G  G  G  GF G +G  G     G PG  G  G +G  G+ F G   EKG+KGD     +     +    +T  +   GF  P+G KG+ G PG  G  GI    G  G+PG     ++G  G+ GIPG  G  G  G +G  G PG       QG +G  G  G  G QGI G+KG +G PGP+      G  + G+ GD G+ GLPG      I G +G  G PG   + G  G  G  G  GLKGDQG  G   I        +                +   L NK  G  G  GE G KG +G+  ++GD G     G                     L G  G +G++GS G  G  GA    G +G +G  G +G P                      I G  GDRG+ G++GF G  G+ G+                    PG  G PG+  E     P      G  G PG  GL G  GK G  G   +PG +GI       G  G  G PG  G PGP+G  G  G  G  G  G +G  G  GL     +PG  GPRG                                               E GL G  G  G +G  G  G  G+PGSKG  GD      G  G+ G++G  G  G +G  GL G+ G +G+ G  G KG  G  G  G   QP                                        G  G KG +GL G  G PG  G                   KG+PGL+G  GN G+   +G KG  G+ G  G   +SG KG    KG  GF G  G+ G  G+ G RG KGI G  G  G  G  G PGE G++G+ GP  +G+   +   + + +KG KG +G  G  G PG  GD+G+
Sbjct:   43 FPEKGARGRPGPIGIQGPTGPQGFTGSTGLSGLKGERGFPGLLGPYGPKGDKGPMGVPGFLGINGIPGHPGQPGPRGPPGLDGCNGTQGAVGFPGPDGYPGLLGPPGLPGQKGSKGDPVLAPGSF------------KGMKGDPGLPGLDGITGPQGAPGFPGAVGPAGPPGLQGPPGPPGPLGPDGNMGLGFQG---EKGVKGD-----VGLPGPAGPPPSTGELEFMGF--PKGKKGSKGEPGPKGFPGI---SGPPGFPGLGTTGEKGEKGEKGIPGLPGPRGPMGSEGVQGPPGQ------QGKKGTLGFPGLNGFQGIEGQKGDIGLPGPDVFIDIDGAVISGNPGDPGVPGLPGLKGDEGIQGLRGPSGVPGLPALSGVPGALGPQGFPGLKGDQGNPGRTTIGAAGLPGRDGLPGPPGPPGPPSPEFETETLHNKESGFPGLRGEQGPKGNLGLKGIKGDSGFCACDGGVPNTGPPGEPGPPGPWGLIGLPGLKGARGDRGSGGAQGPAGAPGLVGPLGPSGPKGKKGEP------------------ILSTIQGMPGDRGDSGSQGFRGVIGEPGKDGVPGLPGLPGLPGDGGQGFPGEKGLPGLPGEKGHPGPPGLPGNGLPGLPGPRGLPGDKGKDGLPGQQGLPGSKGITLPCIIPGSYGPSGFPGTPGFPGPKGSRGLPGTPGQPGSSGSKGEPGSPGLVHLPELPGFPGPRG-----------------------------------------------EKGLPGFPGLPGKDGLPGMIGSPGLPGSKGATGDIFGAENGAPGEQGLQGLTGHKGFLGDSGLPGLKGVHGKPGLLGPKGERGSPGTPGQVGQPGTPGS----------------------------------SGPYGIKGKSGLPGAPGFPGISGHPGKKGTRGKKGPPGSIVKKGLPGLKGLPGNPGL---VGLKGSPGSPGVAGLPALSGPKGE---KGSVGFVGFPGIPGLPGIPGTRGLKGIPGSTGKMGPSGRAGTPGEKGDRGNPGP--VGIPSPRRPMSNLWLKGDKGSQGSAGSNGFPGPRGDKGE 991          

HSP 8 Score: 129.798 bits (325), Expect = 3.468e-29
Identity = 325/968 (33.57%), Postives = 408/968 (42.15%), Query Frame = 3
Query: 1965 FGEAGSRGRKGYSGLKGFKGLIGERGTSFSSGDPGDKGLRGENGKDGVSFAGIPGEKGLKGDKGNRGILGDVG-----------------SLSNCATRPITSKGFKGPQG------------AKGTSGSPGSAGKTGIVGNKGENGYPGKRGIDGDNGIPGSKGE---------EGETGIKGHAGRPGNLGKSGLQGLRGEYGVKGD---------------LGIQGIP-GRKGVMGDPGPNGYAMIGSKGDKGIKGL--------------PGIYGAKGDKGRPGYIGIPGFKGETGLIGRSGLKGDQGEIGEKGIKGF-----------TFISNNPGDRGLLGNKGLKGFPGELGNKGQVGVCTVRGDQGLRGYSGLIGDMGMKGEQGSKGIVGDYGAASRSGIMGRTGKIGNQGLPGDQXXXXXXXXXXXXXXXXYIGIPGFEGDRGEKGNKGFPGFPGDIGQPGRLGNPGISTEGVXXXXXXXXXXXXXXXXXXXXXXXXXXKQGDSGISIPGRQGIKGEDGT------IGLPGEMGEPGPRGDFGQKGNIGITGEFGLQGNRGDDGLKGDDGIPGLNG-----------------PRGFIGDIGFVGFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXELGLDGSMGGK------GDNGPRGFNGPTGIPG---SKGFEGDKGIRGDIGVKGFQGQHGEIGFPGLKGVSGENGRQXXXXXXXXXXXXXXXXVCMQPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEVGESIRGLQGRKGSTGLRGNIGIPGERGDKGIPGLQGKVGNKGVKGDIGDKGFSGNIGDKGYSGISGDKGSFGVKGDKGFQGDVGMLGKSGLQGDRGQKGIIGFRGTRGIPGSMGLPGEIGEKGDVGPSGIGVKGLKGYQNAVGIKGRKGEKGLPGFPGR---------PGKVGDQGDKGPKGMKN 4508
            F E G+RGR G  G++G  G  G  G++      G  GL+GE G     F G+ G  G KGDKG  G+ G +G                  L  C      + GF GP G             KG+ G P  A  +   G KG+ G PG  GI G  G PG  G          +G  G  G  G  GN+G     G +GE GVKGD               L   G P G+KG  G+PGP G+  I   G  G  GL              PG+ G +G  G  G  G PG +G+ G +G  GL G QG  G+KG  G              IS NPGD G+ G  GLKG           G+  +RG  G+ G   L G  G  G QG  G+ GD G   R+        IG  GLPG  G PG  G  G    +       FE +       GFPG  G+ G  G LG  GI  +               G P                I +PG +G +G+ G+       G PG +G  GP G  G+KG   ++   G+ G+RGD G +G  G+ G  G                  +GF G+ G  G  G KG+ G  G  G     + G +G  G KG  G  G+ GL GS G        G  GP GF G  G PG   S+G  G  G  G  G KG  G  G +  P L G  G  G +G  G  GL G  G  G+   P +             + G  G  G+ G  G KG +G+S  GL G KG  G  G +G  GERG  G PG  G+ G  G  G  G KG SG  G  G+ GISG  G  G +G KG  G +   G  GL+G  G  G++G +G+ G PG  GLP   G KG+ G   +G  G  G     GI G +G KG+PG  G+         PG+ GD+G+ GP G+ +
Sbjct:   43 FPEKGARGRPGPIGIQGPTGPQGFTGST------GLSGLKGERG-----FPGLLGPYGPKGDKGPMGVPGFLGINGIPGHPGQPGPRGPPGLDGCNGT-QGAVGFPGPDGYPGLLGPPGLPGQKGSKGDPVLAPGS-FKGMKGDPGLPGLDGITGPQGAPGFPGAVGPAGPPGLQGPPGPPGPLGPDGNMG----LGFQGEKGVKGDVGLPGPAGPPPSTGELEFMGFPKGKKGSKGEPGPKGFPGI--SGPPGFPGLGTTGEKGEKGEKGIPGLPGPRGPMGSEGVQGPPGQQGKKGTLGFPGLNGFQGIEGQKGDIGLPGPDVFIDIDGAVISGNPGDPGVPGLPGLKG---------DEGIQGLRGPSGVPGLPALSGVPGALGPQGFPGLKGDQGNPGRT-------TIGAAGLPGRDGLPGPPGPPGPPSPE-------FETETLHNKESGFPGLRGEQGPKGNLGLKGIKGD-------SGFCACDGGVPNTGPPGEPGPPGPWGLIGLPGLKGARGDRGSGGAQGPAGAPGLVGPLGPSGPKGKKGEPILSTIQGMPGDRGDSGSQGFRGVIGEPGKDGVPGLPGLPGLPGDGGQGFPGEKGLPGLPGEKGHPGPPGLPGNGLPGLPGPRGLPGDKGKDGLPGQQGLPGSKGITLPCIIPGSYGPSGFPGTPGFPGPKGSRGLPGTPGQPGSSGSKGEPGSPGLVHLPELPGFPGPRGEKGLPGFPGLPGKDGLPGMIGSPGLPGSKGATGDIFGAENGAPGEQGLQGLTGHKGFLGDS--GLPGLKGVHGKPGLLGPKGERGSPGTPGQVGQPGTPGSSGPYGIKGKSGLPGAPGFPGISGHPGKKGTRGKKGPPGSIVKKGLPGLKGLPGNPGLVGLKGSPGSPGVAGLPALSGPKGEKG--SVGFVGFPGIPGLPGIPGTRGLKGIPGSTGKMGPSGRAGTPGEKGDRGNPGPVGIPS 957          

HSP 9 Score: 95.5153 bits (236), Expect = 8.046e-19
Identity = 123/335 (36.72%), Postives = 155/335 (46.27%), Query Frame = 3
Query:  210 GRQGFPGPRGYQGVSGDKGDVGQFGMPGPK--GYKGFTGAIGPQGRKGERGI----PGSPGYPGKMGEMGFPGIRGDIGEKGLTGCD------GQQGDFGNPGMNG---------LVGRTGQPGERGDDGDRGLSIIPKYGLKGNKGSRGLLGRYGRKGEKGFKGIKGYSGIFGIKGN------------KGYVGPMGRRGPKGDSLGTVIIQSEKGSKGDKGLKGQSGIPCKGFQIEGRMYGRVGSDGPIGDKGIKGEKGLMGEIGQSGIDGARGLNGEKGLPGEAGPRG------ERGDRGNPGFPGDPGASGADGTRGRQGERGPKGVHGIS 1097
            G +GFPG  G  G++G  G  G  G PGP   G  G  G  GP+G KG  GI    PG PG  G+ G+ GFPG++G  G  G  G        GQ GD G PG++G           G  G    +GD GD G   IP  G KG KG +G+ G  G  GE G KG++G  G  G  G             KG  GP G  G +GD   T   ++ +   G  GL G  GIP         + G  G+ GP+G +G KG  G+ G+ G SG+ G  G  G+ GLPG  GP G      ++G  G PG PG     G    +  Q E+ P    G+S
Sbjct: 1163 GPKGFPGFPGLHGLNGLPGTKGTHGTPGPSITGVPGPAGLPGPKGEKGYPGIGIGAPGKPGLRGQKGDRGFPGLQGPAGLPGAPGISLPSLIAGQPGDPGRPGLDGERGRPGPAGPPGPPGPSSNQGDTGDPGFPGIP--GPKGPKGDQGIPGFSGLPGELGLKGMRGEPGFMGTPGKVGPPGDPGFPGMKGKAGPRGSSGLQGDPGQTPTAEAVQVPPGPLGLPGIDGIP--------GLTGDPGAQGPVGLQGSKGLPGIPGKDGPSGLPGPPGALGDPGLPGLQGPPGFEGAPGQQGPFGMPGMPGQSMRVGYTLVKHSQSEQVPPCPIGMS 1487          

HSP 10 Score: 90.1225 bits (222), Expect = 4.449e-17
Identity = 86/213 (40.38%), Postives = 105/213 (49.30%), Query Frame = 3
Query: 3990 IRGLQGRKGSTGLRGNIGIPGERGDKGI---PGLQGKVGNKGVKGDIGD----KGFSGNIGDKGYSGISGDKGSFGVKGDKGFQGDVGMLGKSGLQGDRGQKGIIGFRGTRGIPGSMGLPGEIGEKGDVGPSG----IGVKGLKGYQN--------------------------AVGIKGRKGEKGLPGF----PGRPGKVGDQGDKGPKGMK 4505
            IRGL G KGS+G+ G  G+PGE G +GI   PGL G  G  G+KGD G      G  G  G  G SG  G KG  G+ G+ GF G+ G  GK G+ GD G  G  GF G  G+ G  GLPG  G +G +GP G    IG KG  G+                              G+ G KGEKG PG     PG+PG  G +GD+G  G++
Sbjct: 1025 IRGLPGLKGSSGITGFPGMPGESGSQGIRGSPGLPGASGLPGLKGDNGQTVEISGSPGPKGQPGESGFKGTKGRDGLIGNIGFPGNKGEDGKVGVSGDVGLPGAPGFPGVAGMRGEPGLPGSSGHQGAIGPLGSPGLIGPKGFPGFPGLHGLNGLPGTKGTHGTPGPSITGVPGPAGLPGPKGEKGYPGIGIGAPGKPGLRGQKGDRGFPGLQ 1237          

HSP 11 Score: 80.1073 bits (196), Expect = 4.938e-14
Identity = 71/182 (39.01%), Postives = 98/182 (53.85%), Query Frame = 3
Query: 3990 IRGLQGRKGSTGLRGNIGIPGERGDKGI---PGLQGKVGNKGVKGDIGDKGFSGNIGDKGYSG----ISGDKGSFGVKGDKGFQGDV---GMLGKSGLQGDRGQKGIIGFRGTRGIPGSMGLPGEIGEKGDVGPSGIGVKGLKGYQNAVGIKGRKGEKGLPGFPGRPGKVGDQGDKGPKGMK 4505
            I+G+ G+ G  G  G  G+PG +G  GI   PG+ G+ G++G++G  G  G SG  G KG +G    ISG  G  G  G+ GF+G     G++G  G  G++G+ G +G  G  G+PG+ G PG  G +G+      G+ G  G+Q A+G  G  G  G  GFPG PG  G  G  G KG  
Sbjct: 1010 IKGVSGKPGPPGFMGIRGLPGLKGSSGITGFPGMPGESGSQGIRGSPGLPGASGLPGLKGDNGQTVEISGSPGPKGQPGESGFKGTKGRDGLIGNIGFPGNKGEDGKVGVSGDVGLPGAPGFPGVAGMRGEP-----GLPGSSGHQGAIGPLGSPGLIGPKGFPGFPGLHGLNGLPGTKGTH 1186          

HSP 12 Score: 79.7221 bits (195), Expect = 5.651e-14
Identity = 68/172 (39.53%), Postives = 88/172 (51.16%), Query Frame = 3
Query: 3999 LQGRKGSTGLRGNIGIPGERGDKGIPGLQGKVGNKGVKGDIGDKGFSGNIGDKGYSGISGDKGSFGVKGDKGFQGDVGMLGKSGLQGDRGQKGIIGFRGTRGIPGSMGLPGEIGEKGDVGPSGI-GVKGLKGYQNAVGIKGRKGEKGLPGFPGRPGKVGDQGDKGPKGMKNM 4511
            + G  G +G  G  G PG +G +G+PG  G+ G+ G KG+ G  G        G+ G  G+KG  G  G  G  G  GM+G  GL G +G  G I F    G PG  GL G  G KG +G SG+ G+KG+ G    +G KG +G  G PG  G+PG  G  G  G KG   +
Sbjct:  659 IPGSYGPSGFPGTPGFPGPKGSRGLPGTPGQPGSSGSKGEPGSPGLVHLPELPGFPGPRGEKGLPGFPGLPGKDGLPGMIGSPGLPGSKGATGDI-FGAENGAPGEQGLQGLTGHKGFLGDSGLPGLKGVHGKPGLLGPKGERGSPGTPGQVGQPGTPGSSGPYGIKGKSGL 829          

HSP 13 Score: 76.2554 bits (186), Expect = 5.637e-13
Identity = 74/197 (37.56%), Postives = 95/197 (48.22%), Query Frame = 3
Query: 3993 RGLQGRKGSTGLRGNIGIPGERGDKGIPGLQGKVGNKGVKGDIGDKGFSGNIGDKG-----YSGISGDKGSFGVKGDKGFQGDVGMLGKSGLQGDRGQKGIIGFRGTRGIPGSMGLPGEIGEKGDVGPSGI-GVKGLKGYQNAVGIKG------------------RKGEKGLPGFPGRPGKVGDQGDKGPKGMKNM 4511
            +G  G  G   L    G PG RG+KG+PG  G  G  G+ G IG  G  G+ G  G      +G  G++G  G+ G KGF GD G+    GL+G  G+ G++G +G RG PG+ G  G+ G  G  GP GI G  GL G     GI G                  +KG  GL G PG PG VG +G  G  G+  +
Sbjct:  696 KGEPGSPGLVHLPELPGFPGPRGEKGLPGFPGLPGKDGLPGMIGSPGLPGSKGATGDIFGAENGAPGEQGLQGLTGHKGFLGDSGL---PGLKGVHGKPGLLGPKGERGSPGTPGQVGQPGTPGSSGPYGIKGKSGLPGAPGFPGISGHPGKKGTRGKKGPPGSIVKKGLPGLKGLPGNPGLVGLKGSPGSPGVAGL 889          

HSP 14 Score: 69.3218 bits (168), Expect = 9.063e-11
Identity = 72/188 (38.30%), Postives = 87/188 (46.28%), Query Frame = 3
Query: 3987 SIRGLQGRKGSTG------LRGNIGIPGERGDKGIPGLQGKVGNKGVKGDIGDKGFSGNIGDKGYSGISGDKGSFGVKGDKGFQGDVGMLGKSGLQGDRGQKG----------------IIGFRGTRGIPGSMGLPGEIGEKGDVGPSGIGVKGLKGYQNAVGIKGRKGEKGLPGFPGRPGKVGDQGD 4484
            ++ G +G KGS G      + G  GIPG RG KGIPG  GK+G  G  G  G+KG  GN G  G         +  +KGDKG QG  G  G  G +GD+G+ G                I G  G  G PG MG+ G  G KG       G+ G  G     G +G +G  GLPG  G PG  GD G 
Sbjct:  891 ALSGPKGEKGSVGFVGFPGIPGLPGIPGTRGLKGIPGSTGKMGPSGRAGTPGEKGDRGNPGPVGIPSPRRPMSNLWLKGDKGSQGSAGSNGFPGPRGDKGEAGRPGPPGLPGAPGLPGIIKGVSGKPGPPGFMGIRGLPGLKGSS-----GITGFPGMPGESGSQGIRGSPGLPGASGLPGLKGDNGQ 1073          

HSP 15 Score: 66.2402 bits (160), Expect = 7.197e-10
Identity = 70/174 (40.23%), Postives = 84/174 (48.28%), Query Frame = 3
Query: 3975 EVGESIRGLQGRKGSTGLRGNIGIPGERGD------------KGIPGLQGKVGNKGVKGDIGDKGFSGNIGDKGYSGISGDKGSFGVKGDKGFQGDVGMLGKSGLQGDRGQKGIIGFRGTRGIPGSMGLPGEIGEKG--DVGPSGIGVKGLKGYQNAVGIKGRKGEKGLPGFPG 4454
            + GES  G +G KG  GL GNIG PG +G+             G PG  G  G +G  G  G  G  G I         G  GS G+ G KGF G  G+ G +GL G +G  G  G   T G+PG  GLPG  GEKG   +G    G  GL+G +   G  G +G  GLPG PG
Sbjct: 1086 QPGES--GFKGTKGRDGLIGNIGFPGNKGEDGKVGVSGDVGLPGAPGFPGVAGMRGEPGLPGSSGHQGAI---------GPLGSPGLIGPKGFPGFPGLHGLNGLPGTKGTHGTPGPSIT-GVPGPAGLPGPKGEKGYPGIGIGAPGKPGLRGQKGDRGFPGLQGPAGLPGAPG 1247          

HSP 16 Score: 61.6178 bits (148), Expect = 1.922e-8
Identity = 80/233 (34.33%), Postives = 98/233 (42.06%), Query Frame = 3
Query: 3999 LQGRKGSTGLRGNIGIPGERGDKG-------------------IPGLQGKVGNKGVKGDIGDKGFSGNIGDKGYSGISGDKGSFGVKGDKGFQGDVGMLGKSGLQGDRGQK-GIIGFRGTRGIPGSMGLPGEIGEKGDVGPSGIGVKGLKGYQNAVGIKGRKGEKGLPGFPGRPGKVGDQGDKGPKGMKNMNTXXXXXXXXXXXXXXXXXXXXXXXXXLPGDMGEIGPNGPIG 4637
            L+G KGS G  G+ G PG RGDKG                   I G+ GK G  G  G  G  G  G+ G  G+ G+ G+ GS G++G  G  G  G+    GL+GD GQ   I G  G +G PG  G  G  G  G +G   IG  G KG    VG+ G   + GLPG PG PG  G +G+ G                                  LPG  G  G  GP+G
Sbjct:  967 LKGDKGSQGSAGSNGFPGPRGDKGEAGRPGPPGLPGAPGLPGIIKGVSGKPGPPGFMGIRGLPGLKGSSGITGFPGMPGESGSQGIRGSPGLPGASGL---PGLKGDNGQTVEISGSPGPKGQPGESGFKGTKGRDGLIG--NIGFPGNKGEDGKVGVSG---DVGLPGAPGFPGVAGMRGEPG----------------------------------LPGSSGHQGAIGPLG 1157          

HSP 17 Score: 61.6178 bits (148), Expect = 2.021e-8
Identity = 68/174 (39.08%), Postives = 86/174 (49.43%), Query Frame = 3
Query: 3993 RGLQGRKGSTGLRGNIGIPGERGDKGIPGLQGKVGNKGVKGDIGDKGFSGNIGDKGYSGISGDKGSFGVKGDKGFQGDVGMLGKSGLQGDRGQKGIIGFRGTRGIPGSMGLPGEIGEKGDVGPSGIGVKGLKGYQNAVGIKGRKGEKGLPGFPGRPGKVGDQGDKGPKGMKNMN 4514
            RGL G KG  GL G  G+PG +G   +P +    G+ G  G  G  GF G  G +G  G  G  GS G KG+ G  G V +    G  G RG+KG+ GF G   +PG  GLPG IG  G  G  G     + G +N     G  GE+GL G  G  G +GD G     G+K ++
Sbjct:  630 RGLPGDKGKDGLPGQQGLPGSKGIT-LPCI--IPGSYGPSGFPGTPGFPGPKGSRGLPGTPGQPGSSGSKGEPGSPGLVHLPELPGFPGPRGEKGLPGFPG---LPGKDGLPGMIGSPGLPGSKGA-TGDIFGAEN-----GAPGEQGLQGLTGHKGFLGDSGLP---GLKGVH 788          

HSP 18 Score: 53.5286 bits (127), Expect = 4.695e-6
Identity = 54/141 (38.30%), Postives = 68/141 (48.23%), Query Frame = 3
Query: 4095 GNKGVKGDIGDKGFSGNIGDKGYSGISGDKGSFGVKGD--KGFQGDVGMLGKSGLQGDRGQKGIIGFRGTRGIPGSMGLPGEIGEKGDVGPSGIGVKGLKGYQNAVGIKGRKGEKGLPGFPGRPGKVGDQGDKGPKGMKNM 4511
            G KG KG+ G KGF G  G  G+ G+               G  G  G +G  G+QG  GQ+G    +GT G PG  G  G  G+KGD+G  G  V        AV I G  G+ G+PG PG  G  G QG +GP G+  +
Sbjct:  256 GKKGSKGEPGPKGFPGISGPPGFPGLGTTGEKGEKGEKGIPGLPGPRGPMGSEGVQGPPGQQGK---KGTLGFPGLNGFQGIEGQKGDIGLPGPDV--FIDIDGAV-ISGNPGDPGVPGLPGLKGDEGIQGLRGPSGVPGL 390          
BLAST of Collagen IV NC1 domain-containing protein vs. Ensembl Human
Match: COL4A6 (collagen type IV alpha 6 chain [Source:HGNC Symbol;Acc:HGNC:2208])

HSP 1 Score: 275.404 bits (703), Expect = 8.058e-74
Identity = 438/1188 (36.87%), Postives = 543/1188 (45.71%), Query Frame = 3
Query:  201 GNKGRQGFPGPRGYQGVSGDKGDVGQFGMPGPKGYKGFTGAIGPQGRKGERGIPGSPGYPGKMGEMGFPGIRGDIGEKGLTGCDGQQGDFGNPGMNGLVGRTGQPGERGDDGDRGLSIIPKYGLKG--------------------------NKGSRGLLGRYGRKGEKGFKGIKGYSGIFGIKGNKGYVGPMGRRGPKGDSLGTVI--IQSEKGSKGDKGLKGQSGIPCKGFQIEGRMYGRVGSDGPIGDKGIKGE------KGLMGEIGQSGIDGARGLNGEKG-----------LPGEAGPRGERGDRGNPGFPGD--PGASGADGTRGRQGERGPKGVHGISGADGPRGSRGDKGPSGSLLSC--PGRKGEKGFFGIPGIKGDIGNKGYQGHDGDIGEIGFKGEKGYEGPLGPSCSEVEQGFRGTKGESGFPGLRGAKGQRGYSGNKGIKGKPNFGTGINNPGETGSYGNLGVPGEKGNKGFIGDTGEKGFSGT-GKQGPEGPRGDKGDDGVNGQVGMIGMPGIKGDKGSTYPICPFCEKGYKGIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEGRMGLLGSKGRQGYKGGKGFSGSMGDAGEIGYVTISGTTIPGVKGEKGNQGPKGNKGEFGEAGSRGRKGYSGLKGFKGLIGERGTSFSSGDPGDKGLRGENGKDGVSFAGIP-GEKGLKGDKGNRGILGDVGSLSNCATRPITSKGFKGPQGAKGTSGSP----------------GSAGKTGIVGNKGENGYPGKRGIDGDNGIPGSKGEEGETGIKGHAGRPGNLGKSGLQGLRGEYG----VKGDLGIQGIPGRKGVMGDPGPNGYA-MIGSKGDKGIKGLPGIYGAKGDKGRPGYIGIPGFKGETGLIGRSGLKGDQGEIGEKGIKGF--TFISNNPGDRGLLGNKGLKGFPGE-LGNKGQVGVCTVRGDQGLRGYSGLIGDMGMKGEQGSKGIVGDYGAASRSGIMGRTGKIGNQGLPGDQXXXXXXXXXXXXXXXX---------YIGIPGFEGDRGEKGNKGFPGFPGDIGQPGRLGNPGISTEGVXXXXXXXXXXXXXXXXXXXXXXXXXXKQGDSGISIPGRQGIKGEDGTIGLPGEMGEPGPRGDFGQKGNIGITGEFGLQGNRGDDG---------LKGDDGIPGLNGPRGFIGDIG 3485
            G KG  GFPG  G+QG+ G KGD+G   +PGP  +    GA+         G PG PG PG       PG++GD G +GL G  G  G     G+ G +G  G PG +GD G+ G + I   GL G                            G  GL G  G KG  G KGIKG SG     G     GP G  GP G      +  ++  +G +G  G +G +G P           G VG  GP G KG KGE      +G+ G+ G SG  G RG+ GE G                G +G  G++G PG PG+            G  G  GP+G+ G  G DG  G +G  G  G  L C  PG  G  GF G PG  G  G++G  G  G  G  G KGE G  G +         G RG KG  GFPGL G  G  G  G+ G+ G     TG     E G+ G  G+ G  G+KGF+GD+G  G  G  GK G  GP+G++G  G  GQVG  G PG  G         P+  KG  G+ G  G  G +G+ G  G +G KG  G    +G  GL G  G  G  G KG  GS G AG           +P + G KG +G  G  G  G  G  G  G  GLKG  G  G+ G S  +G PG+KG RG  G  G+     P     LKGDKG++G  G              S GF GP+G KG +G P                G +GK G  G  G  G PG +G  G  G PG  GE G  GI+G  G PG    SGL GL+G+ G    + G  G +G PG  G  G  G +G    IG  G+KG  G  G+ G  G  G PG+ G+ G +GE GL G SG +G  G +G  G+ G     I+  PG  GL G KG KG+PG  +G  G+ G+   RG +G RG+ GL         QG  G+ G  G +  S I G+ G  G  GL G++G PG  G  G  G            + GIPG +G +G++G  GF G PG++G  G  G PG    G  G  G  G PG  G  G  G  G  G QGD G   P  + ++   G +GLPG  G PG  GD G +G +G+ G  GL G  G DG           GD G+PGL GP GF G  G
Sbjct:  317 GKKGTLGFPGLNGFQGIEGQKGDIG---LPGPDVFIDIDGAV-------ISGNPGDPGVPG------LPGLKGDEGIQGLRGPSGVPGLPALSGVPGALGPQGFPGLKGDQGNPGRTTIGAAGLPGRDGLPGPPGPPGPPSPEFETETLHNKESGFPGLRGEQGPKGNLGLKGIKGDSGFCACDGGVPNTGPPGEPGPPGPWGLIGLPGLKGARGDRGSGGAQGPAGAP-----------GLVGPLGPSGPKGKKGEPILSTIQGMPGDRGDSGSQGFRGVIGEPGKDGVPGLPGLPGLPGDGGQGFPGEKGLPGLPGEKGHPGPPGLPGNGLPGLPGPRGLPGDKGKDGLPGQQGLPGSKGITLPCIIPGSYGPSGFPGTPGFPGPKGSRGLPGTPGQPGSSGSKGEPGSPGLVHLPELPGFPGPRGEKGLPGFPGLPGKDGLPGMIGSPGLPGS-KGATGDIFGAENGAPGEQGLQGLTGHKGFLGDSGLPGLKGVHGKPGLLGPKGERGSPGTPGQVGQPGTPGSSG---------PYGIKGKSGLPGAPGFPGISGHPGKKGTRGKKGPPGSIVKKGLPGLKGLPGNPGLVGLKGSPGSPGVAG-----------LPALSGPKGEKGSVGFVGFPGIPGLPGIPGTRGLKGIPGSTGKMGPSGRAGTPGEKGDRGNPGPVGIPSPRRPMSNLWLKGDKGSQGSAG--------------SNGFPGPRGDKGEAGRPGPPGLPGAPGLPGIIKGVSGKPGPPGFMGIRGLPGLKGSSGITGFPGMPGESGSQGIRGSPGLPG---ASGLPGLKGDNGQTVEISGSPGPKGQPGESGFKGTKGRDGLIGNIGFPGNKGEDGKVGVSGDVGLPGAPGFPGVAGMRGEPGLPGSSGHQGAIGPLGSPGLIGPKGPSITGVPGPAGLPGPKGEKGYPGIGIGAPGKPGL---RGQKGDRGFPGL---------QGPAGLPGAPGISLPSLIAGQPGDPGRPGLDGERGRPGPAGPPGPPGPSSNQGDTGDPGFPGIPGPKGPKGDQGIPGFSGLPGELGLKGMRGEPGFM--GTPGKVGPPGDPGFPGMKGKAGPRGSSGLQGDPG-QTPTAEAVQVPPGPLGLPGIDGIPGLTGDPGAQGPVGLQGSKGLPGIPGKDGPSGLPGPPGALGDPGLPGLQGPPGFEGAPG 1424          

HSP 2 Score: 261.536 bits (667), Expect = 1.377e-69
Identity = 452/1322 (34.19%), Postives = 574/1322 (43.42%), Query Frame = 3
Query:  186 KCQCFGNKGRQGFPGPRGYQGVSGDKGDVGQFGMPGPKGYKGFTGAIGPQGRKGERGIPGSPGYPGKMGEMGFPGIRGDIGEKGLTGCDGQQGDFGNPGMNGL---VGRTGQPGERGDDGDRGLSIIPKYGLKGNKGSRGLLGRYGRKGEKGFKGIK--------------------------GYSGIFGIKGNKGYVGPMGRRGPKGDSLGTVIIQSEKGSKGDKGLKGQSGIP-CKGFQ-----------IEGRMYGRVGSDGPIGDKGIK---GEKGLMGEIGQSGIDGARGLNGEKGLPGEAGPR-----GERGDRGNPGFPGDPGASGADGTRGRQGERGPKGVHGISGADGPRGSRGDKGPSGSLLSCPGRKGEKGFFGIPGIKGDIGNKGYQGHDGDIGEIGFKGEKGYEGPLGPSCSEVEQGFRGTKGESGFPGLRGAKGQRGYSGNKGIKGKPNFGT---GINNP------GETGSYGNLGVPGEKGNKGFIGDTGEKGFSGT-GKQGPEGPRGDKGDDGVNGQVGMIGMPGIKGDKGSTYPICPFCEKGYKGIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEGRMGLLGSKGRQGYKGGKGFSGSMGDAGEIGYVTISGTTIPGVKGEKGNQGPKGNKGEFGEA------GSRGRKGYSGLKGFKGLIGERGTSFSSGDPGDKGLRGENGKDG-VSFAGIPGEKGLKGDKGNRGILGDVGSLSNCATRPITSKGFKGPQGAKG-----TSGSPGSAGKTGIVGNK---GENGYPGKRGIDGDNGIPGSKGEEGETGIKGHAGRPGNLGKSGLQGLRGEYGVKGDLGIQGI------------------------PGRKGVMGDPGPNGYAMIGSKGDKGIKGLPGIYGAKGDKGRPGYIGIPGFKGETGLIGRSGLKGDQGEIGEKGIKGFTFISNNPGDRGLLGNKGLKGFPGELGNKGQVGVCTVRGDQGLRGYSGLIGDMGMKGEQGSKGIVGDYGAASRSGIM-GRTGKIGNQGLPGDQXXXXXXXXXXXXXXXXYIGIPGFEGDRGEKGNKGFPGFPGDIGQPGRLGNPGISTEGVXXXXXXXXXXXXXXXXXXXXXXXXXXKQGDSGISIPGRQGIKGEDGTI-GLPGEMGEPGPRGDFGQKGNIGITGEFGLQGNRGDDGLKGDDGIPGLNGPRGFIGDIGFVGFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXELGLDGSMGGKGDNGPR---GFNGP-----TGIPGSKGFEGDKGIRGDIGV-------KGFQGQHGEIGFPGLKGVSGENG 3806
             CQCF  KG +G PGP G QG +G +G  G  G+ G KG +GF G +GP G KG++G  G PG+ G  G  G PG  G  G  GL GC+G QG  G PG +G    +G  G PG++G  GD  L+     G+KG+ G  GL G  G +G  GF G                            G+ G  G+KG+ G  GP G     G+       + +KGSKG+ G KG  GI    GF             E  + G  G  GP+G +G++   G++G  G +G  G++G +G+ G+KG  G  GP            GNPG PG PG  G  G  G QG RGP GV G+                 +L   PG  G +GF   PG+KGD GN G     G  G  G  G  G  GP GP   E E      K ESGFPGLRG +G +G  G KGIKG   F     G+ N       G  G +G +G+PG KG +G  G  G +G +G  G  GP GP G KG  G      + GMPG +GD GS         +G++G+                              +G  G  G KG  G  G KG  G  G  G           +PG KG+ G  G +G  G  G        GS G  G+ G  GF G  G RG   + G PG  G +GE G  G V    +PG  G +G+KG  G  G  G         I S G  G +GA G      +G+PG  G  G+ G+K   G++G PG +G+ G  G+ G KGE G  G  G  G+PG  G SG  G++G+ G+ G  G  GI                        PG KG+ G+PG  G  + GS G  G+ GLP + G KG+KG  G++G PG  G  G+ G  GLKG  G  G+ G  G    +  PG++G  GN G  G P        + +   +G QG  G +G  G  G KGE G  G  G  GA    GI+ G +GK G  G                     ++GI G  G +G  G  GFPG PG+ G  G  G+PG+                                 G SG+  PG +G  G+   I G PG  G+PG  G  G KG  G+ G  G  GN+G+DG  G  G  GL G  GF G  G  G                                      E GL GS G +G  GP    G  GP     TG+PG  G  G KG +G  G+        G +GQ G+ GFPGL+G +G  G
Sbjct:   38 SCQCFPEKGARGRPGPIGIQGPTGPQGFTGSTGLSGLKGERGFPGLLGPYGPKGDKGPMGVPGFLGINGIPGHPGQPGPRGPPGLDGCNGTQGAVGFPGPDGYPGLLGPPGLPGQKGSKGDPVLAPGSFKGMKGDPGLPGLDGITGPQGAPGFPGAVGPAGPPGLQGPPGPPGPLGPDGNMGLGFQGEKGVKGDVGLPGPAGPPPSTGELEFMGFPKGKKGSKGEPGPKGFPGISGPPGFPGLGTTGEKGEKGEKGIPGLPGPRGPMGSEGVQGPPGQQGKKGTLGFPGLNGFQGIEGQKGDIGLPGPDVFIDIDGAVISGNPGDPGVPGLPGLKGDEGIQGLRGPSGVPGLP----------------ALSGVPGALGPQGF---PGLKGDQGNPGRT-TIGAAGLPGRDGLPGPPGPPGPPSPEFETETLHNK-ESGFPGLRGEQGPKGNLGLKGIKGDSGFCACDGGVPNTGPPGEPGPPGPWGLIGLPGLKGARGDRGSGGAQGPAGAPGLVGPLGPSGPKGKKGEPILSTIQGMPGDRGDSGS---------QGFRGV----------IGEPGKDGVPGLPGLPGLPGDGGQGFPGEKGLPGLPGEKGHPGPPGLPGNGLPGLPGPRGLPGDKGKDGLPGQQGLPGSKGITLPCIIPGSYGPSGFPGTPGFPGPKGSRGLPGTPGQPGSSGSKGEPGSPGLVHLPELPGFPGPRGEKGLPGFPGLPGKDGLPGM--IGSPGLPGSKGATGDIFGAENGAPGEQGLQGLTGHKGFLGDSGLPGLKGVHGKPGLLGPKGERGSPGTPGQVGQPGTPGSSGPYGIKGKSGLPGAPGFPGISGHPGKKGTRGKKGPPGSIVKKGLPGLKGLPGNPGLVG--LKGSPGSPGVAGLPALSGPKGEKGSVGFVGFPGIPGLPGIPGTRGLKGIPGSTGKMGPSGR---AGTPGEKGDRGNPGPVGIPSPRRPMSNLWLKGDKGSQGSAGSNGFPGPRGDKGEAGRPGPPGLPGAPGLPGIIKGVSGKPGPPG---------------------FMGIRGLPGLKGSSGITGFPGMPGESGSQGIRGSPGLP--------------------------------GASGL--PGLKGDNGQTVEISGSPGPKGQPGESGFKGTKGRDGLIGNIGFPGNKGEDGKVGVSGDVGLPGAPGFPGVAGMRG--------------------------------------EPGLPGSSGHQGAIGPLGSPGLIGPKGPSITGVPGPAGLPGPKGEKGYPGIGIGAPGKPGLRGQKGDRGFPGLQGPAGLPG 1219          

HSP 3 Score: 250.366 bits (638), Expect = 3.826e-66
Identity = 172/515 (33.40%), Postives = 232/515 (45.05%), Query Frame = 3
Query: 3990 IRGLQGRKGSTGLRGNIGIPG------------ERGDKGIPGL---------------------QGKVGNKGVKGDIGDKGFSGNIGDKGYSGISGDKGSFGVKGDKGFQGDVGML------------------GKSGLQGDRGQ----KGIIGFRGTRGIPGSMGLPGEIGEKGDVGPSGI-GVKGLKGYQ------NAVGIKGRKGEKGLPGFPGRPGKVGDQGDKGPKGMKNMNTXXXXXXXXXXXXXXXXXXXXXXXXXLPGDMGEIGPNGPIGYADNGFLYATHSQSKDFPPCHGGGSPLYNGYSLLAIHGDIDSVTMDLGTPGSCLKNFSTIPFVNCFLERNTFYGGRCHVNMRNSRSYWLSTLQSYMSSPQPPSKMDDYISRCSVCQTKTTVMAFHSQKSDWQMTKCPYGWQKLWAGFSFPMAVQASRSGSNQPFSSPGSCLKHFRSLPFIECNNHNSNCNHWRDGVSYYMTAVDSENQFVKAQGKVLKSQTDIMNSISKCVVCQRDM 5348
            +RG +G +G  GL+G  G+PG            + GD G PGL                     QG  G+ G  G  G KG  G+ G  G+SG+ G+ G  G++G+ GF G  G +                  G SGLQGD GQ    + +    G  G+PG  G+PG  G+ G  GP G+ G KGL G           G  G  G+ GLPG  G PG  G  G +GP GM  M                            PG    +           G+    HSQS+  PPC  G S L+ GYSLL + G   +   DLG  GSCL  FST+PF+ C +         CH   RN +SYWLST       P   +++  YISRCSVC+  +  +A HSQ  D  + +CP GW+ LW G+SF M   A   G  Q   SPGSCL+ FR+ PFIEC+     C+++ +  S+++T V+   QF +           +   +S+C VC + +
Sbjct: 1199 LRGQKGDRGFPGLQGPAGLPGAPGISLPSLIAGQPGDPGRPGLDGERGRPGPAGPPGPPGPSSNQGDTGDPGFPGIPGPKGPKGDQGIPGFSGLPGELGLKGMRGEPGFMGTPGKVGPPGDPGFPGMKGKAGPRGSSGLQGDPGQTPTAEAVQVPPGPLGLPGIDGIPGLTGDPGAQGPVGLQGSKGLPGIPGKDGPSGLPGPPGALGDPGLPGLQGPPGFEGAPGQQGPFGMPGM----------------------------PGQSMRV-----------GYTLVKHSQSEQVPPCPIGMSQLWVGYSLLFVEGQEKAHNQDLGFAGSCLPRFSTMPFIYCNINE------VCHYARRNDKSYWLSTTAPIPMMPVSQTQIPQYISRCSVCEAPSQAIAVHSQ--DITIPQCPLGWRSLWIGYSFLMHTAAGAEGGGQSLVSPGSCLEDFRATPFIECSGARGTCHYFANKYSFWLTTVEERQQFGELPVSETLKAGQLHTRVSRCQVCMKSL 1666          

HSP 4 Score: 236.498 bits (602), Expect = 8.304e-62
Identity = 448/1377 (32.53%), Postives = 553/1377 (40.16%), Query Frame = 3
Query:  237 GYQGVSGDKGDVGQFGMPGPKGYKGFTGAIG-PQGRKGERGIPGSPGYPGKMGEMGFPGI--------------------RGDIGEKGLTGCDGQQG---DFGNPGMNGLVGRTGQPGERGDDGDRGLSIIPKYGLKGNKGSRGLLGRYGRKGEKGFKGIKGYSGIFGIKGNKGYVGPMGRRGPKGDSLGTVIIQSEKGSKGDKGLKGQSGIPCKGF------------------QIEGRMYGRVGSDGPIGDKGIKGEKGLMGEIGQSGIDGARGLNGEKGLPGEAGPRGERGDRGNPGFPGDPGASGADGTRGRQGERGPKGVHGISGADGPRGSRGDKGPSGSLLSCPGRKGEKGFFGIPGIKGDIGNKGYQGHDGDIGEIG--------------------FKGEKGYEGPLG--------------PSCSEVEQGFRGTKGESGFPGLRGAKGQRGYS---------GNKGIKGKPNFGTGINNPGETGSYGNLGVPGEKGNKGFIGDTGEKGFSGTGK-QGPEGPRGDKGDDGV------NGQVGMIGMPGIKGDKGSTYPICPFCEKGYKGIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEGRMGLLGSKGRQGYKGGKGFSGSMGDAGEIGYVTISGTTIPGVKGEKGNQGPKGNKGEFGEAGSRGRKGYSGLKGFKGLIGERGTSFSSGDPGDKGLRGENGKDG-VSFAGIPGEKGLKGDKGNRGILGDVGSLSNCATRPITSKGFKGPQGAKGTSGSPGSAGKTGIVGNKGENGYPGKRGIDGDNGIPGSKGEEGETGIKGHAGRPGNLGKSGLQGLRGEYGVKGDLGIQGIPGR-------------------------KGVMGDPGPNGYA----MIGSKGDKGIKGLPGI------YGAKGDKGRPGYIGIPGFKGETG-LIGRSGLKGDQGEIGEKGIKGFTFISNNPGDRGLLGNKGLKGFPGELGNKGQVGVCTVRGDQGLRGYSGLIGDMGMKGEQGSKGIVGDYGAASRSGIMGR--------TGKIGNQGLPGDQXXXXXXXXXXXXXXXXYIGIPGFEGDRGEKGNKGFPGFPGDIGQPGRLGNPGISTEGVXXXXXXXXXXXXXXXXXXXXXXXXXXKQGDSGISIPGRQGIKGE---------------------DGTIGLPGEMGEPGPRGDFGQKGNIGITGEFGLQGNRGDDGLKGDDG------------IPGLNGPRGFIGDIGFVGFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXELGLDGSMGGKGDNGPRGFNGPTGIPGSKGFE------------------GDKGIRGDIGVKGFQ---GQHGEIGFPGLKGVS 3794
            G+QG  G KGDVG  G  GP    G    +G P+G+KG +G PG  G+PG  G  GFPG+                    RG +G +G+ G  GQQG     G PG+NG  G  GQ G+ G  G      I    + GN G  G+ G  G KG++G +G++G SG+ G+    G  G +G +G               G KGD+G  G++ I   G                   + E        S    G  G++GE+G  G +G  GI G  G     G     GP GE G  G  G  G PG  GA G RG  G +GP G  G+ G  GP G +G             +KGE     I G+ GD G+ G QG  G IGE G                    F GEKG  G  G                     +G  G KG+ G PG +G  G +G +         G  G  G P F      PG  GS G  G PG+ G+ G  G+ G  G     +  G  GPRG+KG  G       +G  GMIG PG+ G KG+T  I                                             G  G +G QG  G KGF   +GD+G  G   + G   PG+ G KG +G  G  G+ G+ G+ G  G  G+KG  GL G  G    SG PG KG RG+ G  G +   G+PG KGL G+ G  G+ G  GS    A  P  S G KG +G+ G  G PG  G  GI G +G  G PG  G  G +G  G+ GE+G+ G  G  G P          L+G+ G +G  G  G PG                          KGV G PGP G+     + G KG  GI G PG+       G +G  G PG  G+PG KG+ G  +  SG  G +G+ GE G KG        G  GL+GN G   FPG  G  G+VGV    GD GL G  G  G  GM+GE G  G  G  GA    G  G         TG  G  GLPG +G  G  G          IG PG  G RG+KG++GFPG  G  G PG    PGIS   +I                         + GD     PGR G+ GE                      G  G PG  G  GP+GD G  G  G+ GE GL+G RG+ G  G  G            + G  GPRG  G  G  G                              + +    G LGL G  G  G  G  G  GP G+ GSKG                    GD G+ G  G  GF+   GQ G  G PG+ G S
Sbjct:  221 GFQGEKGVKGDVGLPGPAGPPPSTGELEFMGFPKGKKGSKGEPGPKGFPGISGPPGFPGLGTTGEKGEKGEKGIPGLPGPRGPMGSEGVQGPPGQQGKKGTLGFPGLNGFQGIEGQKGDIGLPGPDVFIDIDGAVISGNPGDPGVPGLPGLKGDEGIQGLRGPSGVPGLPALSGVPGALGPQG-------------FPGLKGDQGNPGRTTIGAAGLPGRDGLPGPPGPPGPPSPEFETETLHNKES----GFPGLRGEQGPKGNLGLKGIKGDSGFCACDGGVPNTGPPGEPGPPGPWGLIGLPGLKGARGDRGSGGAQGPAGAPGLVGPLGPSGPKG-------------KKGEPILSTIQGMPGDRGDSGSQGFRGVIGEPGKDGVPGLPGLPGLPGDGGQGFPGEKGLPGLPGEKGHPGPPGLPGNGLPGLPGPRGLPGDKGKDGLPGQQGLPGSKGITLPCIIPGSYGPSGFPGTPGF------PGPKGSRGLPGTPGQPGSSGSKGEPGSPGLVHLPELPGFPGPRGEKGLPGFPGLPGKDGLPGMIGSPGLPGSKGATGDIF----------------------------------------GAENGAPGEQGLQGLTGHKGF---LGDSGLPGLKGVHGK--PGLLGPKGERGSPGTPGQVGQPGTPGSSGPYGIKGKSGLPGAPGFPGISGHPGKKGTRGKKGPPGSIVKKGLPGLKGLPGNPGLVGLKGSPGS-PGVAGLPALS-GPKGEKGSVGFVGFPGIPGLPGIPGTRGLKGIPGSTGKMGPSGRAGTPGEKGDRGNPGPVGIPSPRRPMSNLWLKGDKGSQGSAGSNGFPGPRGDKGEAGRPGPPGLPGAPGLPGIIKGVSGKPGPPGFMGIRGLPGLKGSSGITGFPGMPGESGSQGIRGSPGLPGASGLPGLKGDNGQTVEISGSPGPKGQPGESGFKGTK------GRDGLIGNIG---FPGNKGEDGKVGV---SGDVGLPGAPGFPGVAGMRGEPGLPGSSGHQGAIGPLGSPGLIGPKGPSITGVPGPAGLPGPKGEKGYPGIG--------IGAPGKPGLRGQKGDRGFPGLQGPAGLPGA---PGISLPSLIAG-----------------------QPGD-----PGRPGLDGERGRPGPAGPPGPPGPSSNQGDTGDPGFPGIPGPKGPKGDQGIPGFSGLPGELGLKGMRGEPGFMGTPGKVGPPGDPGFPGMKGKAGPRGSSGLQGDPG-------------------------QTPTAEAVQVPPGPLGLPGIDGIPGLTGDPGAQGPVGLQGSKGLPGIPGKDGPSGLPGPPGALGDPGLPGLQGPPGFEGAPGQQGPFGMPGMPGQS 1438          

HSP 5 Score: 194.897 bits (494), Expect = 4.445e-49
Identity = 287/862 (33.29%), Postives = 363/862 (42.11%), Query Frame = 3
Query:  177 TPDKCQCFGNKGRQGFPGPRGYQGVSGDKGDVGQFGMPGPKGYKGFTGAIGPQGRKGERGIPGSPGYPGKMGEMG--FPGIRGDIGEKGLTGCDGQQGDFGNPGMNGLVGRTGQPGERGDDGDRGLSIIP----KYGLKGNKGSRGLLGRYGRKGEKGFKGI---------------------KGYSGIFGIKGNKGYVGPMGRRGPKGDSLGTVIIQSEKGSKGDKGLKGQSGIPCKGFQIEGRMYGRVGSDGPIGDKGIKGEKGLMGEIGQSGIDGARGLNGEKGLPGEAGPRGERGDRGNPGFPGDPGASGADGTRGRQGERGPKG-------------------VHGISGADGPRGSRGDKGPSGSLLSCPGRKGEKGFFGIPGIKGDIGNKGYQGHDGDIGEIGFKGEKG-------YEGPLGPSCSEVEQGFRGTKGES------GFPGLRGAKGQRGYSGNKGIKGKPNFGTGINNPGETGSYGNLGVPGEKGNKGFIGDTGEKGFSGTGKQGPEGPRGDKGDDGVNGQVGMIGMPGIKGDKGSTYPICPFCEKGYKGIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEGRMGLLGSKGRQGYKGGKGFSGSMGDAGEIGYVTISGTTIPGVKGEKGNQGPKGNKGEFGEAGSRGRKGYSGLKGFKGLIGERGTSFSSGDPGDKGLRGENGKDGVSFAGIPGEKGLKGDKGNRGILGDVGSLSNCATRPITS-KGFKGPQGAKGTSGSPG-SAGKTGIVGNKGENGYPGKRGIDGDNGIPGSKGEEGETGIKGHAGRPGN------------LGKSGLQGLRGEYGVKGDLGIQGIPGRKGVMGDPGPNGYAMI 2543
            TP +    G+KG  G PG      +          G PGP+G KG  G  G  G+ G  G+ GSPG PG  G  G  F    G  GE+GL G  G +G  G+ G+ GL G  G+PG  G  G+RG    P    + G  G+ G  G+ G+ G  G  GF GI                     KG  G+ G+ GN G VG  G  G  G + G   +   KG KG  G  G  GIP              G  G  G +G+KG  G  G++G SG  G  G  G++G PG  G    R    N    GD G+ G+ G+ G  G RG KG                   + G+SG  GP G  G +G        PG KG  G  G PG+ G+ G++G +G  G  G  G  G KG         G  GP     E GF+GTKG        GFPG +G  G+ G SG+ G+ G P F      PG  G  G  G+PG  G++G IG  G  G       GP+GP        + G  G  G+PG KG            EKGY GI                                 +G  G  G +G KG +GF G  G AG  G   IS  ++  + G+ G+ G  G  GE G  G  G  G  G    +G  G+ G     G PG KG +G+ G  G  F+G+PGE GLKG +G  G +G  G +           KG  GP+G+ G  G PG +     +    G  G PG  GI G  G PG++G  G  G KG  G PG             LG  GL GL+G  G +G  G QG  G  G+ G     GY ++
Sbjct:  685 TPGQPGSSGSKGEPGSPGLVHLPELP---------GFPGPRGEKGLPGFPGLPGKDGLPGMIGSPGLPGSKGATGDIFGAENGAPGEQGLQGLTGHKGFLGDSGLPGLKGVHGKPGLLGPKGERGSPGTPGQVGQPGTPGSSGPYGIKGKSGLPGAPGFPGISGHPGKKGTRGKKGPPGSIVKKGLPGLKGLPGNPGLVGLKGSPGSPGVA-GLPALSGPKGEKGSVGFVGFPGIP--------------GLPGIPGTRGLKGIPGSTGKMGPSGRAGTPGEKGDRGNPGPVGIPSPRRPMSNLWLKGDKGSQGSAGSNGFPGPRGDKGEAGRPGPPGLPGAPGLPGIIKGVSGKPGPPGFMGIRG-------LPGLKGSSGITGFPGMPGESGSQGIRGSPGLPGASGLPGLKGDNGQTVEISGSPGPKGQPGESGFKGTKGRDGLIGNIGFPGNKGEDGKVGVSGDVGLPGAPGF------PGVAGMRGEPGLPGSSGHQGAIGPLGSPGLI-----GPKGPS-------ITGVPGPAGLPGPKG------------EKGYPGI--------------------------------GIGAPGKPGLRGQKGDRGFPGLQGPAGLPGAPGISLPSL--IAGQPGDPGRPGLDGERGRPGPAGPPGPPGPSSNQGDTGDPGF---PGIPGPKGPKGDQGIPG--FSGLPGELGLKGMRGEPGFMGTPGKVGPPGDPGFPGMKGKAGPRGSSGLQGDPGQTPTAEAVQVPPGPLGLPGIDGIPGLTGDPGAQGPVGLQGSKGLPGIPGKDGPSGLPGPPGALGDPGLPGLQGPPGFEGAPGQQGPFGMPGMPGQSMRVGYTLV 1446          

HSP 6 Score: 160.229 bits (404), Expect = 1.829e-38
Identity = 353/1113 (31.72%), Postives = 448/1113 (40.25%), Query Frame = 3
Query:  984 ERGDRGNPGFPGDPGASGADGTRGRQGERGPKGVHGISGADGPRGSRGDKGPSGSLLSCPGRKGEKGFFGIPGIKGDIGNKGYQGHDGDIGEIGFKGEKGYEGPLGPSCSEVEQG-----------FRGTKGESGFPGLRGAKGQRGYSGNKGIKGKPNFGTGINNPGETGSYGN-----LGVPGEKGNKGFIG---------DTGEKGFSG--TGKQGPEGPRGDKGDDGVNGQVGMIGM--------------PGIKGDKGSTYPICPFCEKGYKGIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEGRMGLLGSKGRQGYKGGKGFSGSMGDAGEIGYVTISGTTIPGVKGEKGNQGPKGNKGEFGEAGSRGRKGYSGLKGFKGLIGERGTSFSSGDPGDKGLRGENGKDGVSFAGI--------------------------------PGEKGLKGDKGNRGILGDVGSLSNCATR---PITS----------------KGFKGPQGAKGTSGSPGSAGKTGIVGNKGENGYPGKRG---IDGDNGIPGSKGEEGETGIKGHAGRPGN--------------------LGKSGLQGLRGE--------------------YGVKGDLGIQGIPGRKGVMGDPGPNGYAMI-GSKGDKGIKGLPGIYGAKGDKGRPGYIGIPGFKGE------TGLIGRSGLKGDQGEIGEKGIKGFTFISNNPGDRGLLGNKGLKGFPGELGNKGQV-----GVCTVRGDQGLRGYSGLIGDMGMKGEQGSKGIVGDYGAASRSGIMGRTGKIGNQGLPGDQXXXXXXXXXXXXXXXXYIGI---------------PGFEGDRGEKGNKGFPGFPGDIGQPGRLGNPGISTEGVXXXXXXXXXXXXXXXXXXXXXXXXXXKQGDSGISIPGRQGIKGEDGTIGL---PGEMGEPGPRGDFGQKGNIGITGEFGLQGNRGDDGLKGDDGIP---GLNGPRGFIGDIGFVGFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXELGLDGSMGGKGDNGPRGFNGPTGIPGSKGFEGDKGIRGDIGVKGFQGQHGEIGFP---GLKGVSGENGR 3809
            E+G RG PG  G  G +G  G  G  G  G KG  G  G  GP G +GDKGP G     PG  G  G  G PG  G  G  G  G +G  G +GF G  GY G LGP     ++G           F+G KG+ G PGL G  G +G  G  G  G          PG  G  G      LG  GEKG KG +G          TGE  F G   GK+G +G  G KG  G++G  G  G+              PG+ G +G           G +G+QG  G                         +G+ G LG  G  G++G +G  G +G  G   ++ I G  I G  G+ G  G  G KG+ G  G RG  G  GL    G+ G  G     G PG KG +G  G+  +  AG+                                PG +G +G KGN G+ G  G    CA     P T                  G KG +G +G+ G+ G AG  G+VG  G +G  GK+G   +    G+PG +G+ G  G +G  G PG                      G+ GL GL GE                     G+ GD G  G+PG++G+ G  G     +I GS G  G  G PG  G KG +G PG  G PG  G        GL+    L G  G  GEKG+ GF  +   PG  GL G  G  G PG  G  G +     G    +G QGL G+ G +GD G+ G +G  G  G  G     G  G  G++G  G PG  G  G KG  G  G+ G+ GI               PG    +G  G KG PG PG +G  G  G+PG++                                      +P   G KGE G++G    PG  G PG  G  G KG  G TG+ G  G  G  G KGD G P   G+  PR  + ++   G +GS+G+ G  G  G RG + +  +              +      G  G  GP GF G  G+PG KG  G  G  G  G  G QG  G  G P   GL G+ G+NG+
Sbjct:   44 EKGARGRPGPIGIQGPTGPQGFTGSTGLSGLKGERGFPGLLGPYGPKGDKGPMG----VPGFLGINGIPGHPGQPGPRGPPGLDGCNGTQGAVGFPGPDGYPGLLGPPGLPGQKGSKGDPVLAPGSFKGMKGDPGLPGLDGITGPQGAPGFPGAVGPAGPPGLQGPPGPPGPLGPDGNMGLGFQGEKGVKGDVGLPGPAGPPPSTGELEFMGFPKGKKGSKGEPGPKGFPGISGPPGFPGLGTTGEKGEKGEKGIPGLPGPRGPM---------GSEGVQGPPG------------------------QQGKKGTLGFPGLNGFQGIEGQKGDIGLPGPDVFIDIDGAVISGNPGDPGVPGLPGLKGDEGIQGLRGPSGVPGLPALSGVPGALGPQ---GFPGLKGDQGNPGRTTIGAAGLPGRDGLPGPPGPPGPPSPEFETETLHNKESGFPGLRGEQGPKGNLGLKGIKGDSGFCACDGGVPNTGPPGEPGPPGPWGLIGLPGLKGARGDRGSGGAQGPAGAPGLVGPLGPSGPKGKKGEPILSTIQGMPGDRGDSGSQGFRGVIGEPGKDGVPGLPGLPGLPGDGGQGFPGEKGLPGLPGEKGHPGPPGLPGNGLPGLPGPRGLPGDKGKDGLPGQQGLPGSKGITLPCIIPGSYGPSGFPGTPGFPGPKGSRGLPGTPGQPGSSGSKGEPGSPGLVHLPELPGFPGPRGEKGLPGFPGL---PGKDGLPGMIGSPGLPGSKGATGDIFGAENGAPGEQGLQGLTGHKGFLGDSGLPGLKGVHGKPGLLGPKGERGSPGTPGQVGQPGTPGSSGPYGIKGKSGLPGAPGFPGISGHPGKKGTRGKKGPPGSIVKKGLPGLKGLPGNPGLVGLKGSPGSPGVA-------------------------------------GLPALSGPKGEKGSVGFVGFPGIPGLPGIPGTRGLKGIPGSTGKMGPSGRAGTPGEKGDRGNPGPVGIPSPRRPMSNLWLKGDKGSQGSAGSNGFPGPRGDKGEAGRPGPPGLPGAPGLPGI----IKGVSGKPGPPGFMGIRGLPGLKGSSGITGFPGMPGESGSQGIRGSPGLPGASGLPGLKGDNGQ 1072          

HSP 7 Score: 135.191 bits (339), Expect = 8.095e-31
Identity = 344/1087 (31.65%), Postives = 435/1087 (40.02%), Query Frame = 3
Query: 1536 FSGTGKQGPEGPRGDKGDDGVNGQVGMIGMPGIKGDKGSTYPICPFCEKGYKGIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEGRMGLLGSKGRQGYKGGKGFSGSMGDAGEIGYVTISGTTIPGVKGEKGNQGPKGNKGEFGEAGSRGRKGYSGLKGFKGLIGERGTSFSSGDPGDKGLRGENGKDGVSFAGIPGEKGLKGDKGNRGILGDVGSLSNCATRPITSKGFKGPQGAKGTSGSPGSAGKTGIVGNKGENGYPG-----KRGIDGDNGIPGSKGEEGETGIKGHAGRPGNLGKSGLQGLRGEYGVKGDLGIQGIPGRKGVMGDPGPN------GYAMIGSKGDKGIKGLPG------IYGAKGDKGRPGYIGIPGFKGETGLIGRSGLKGDQGEIGEKGIKGFTFISNNPG--------------DRGLLGNK--GLKGFPGELGNKGQVGVCTVRGDQGLRGYSG---------------------LIGDMGMKGEQGSKGIVGDYGAASRSGIMGRTGKIGNQGLPGDQXXXXXXXXXXXXXXXXYIGIPGFEGDRGEKGNKGFPGFPGDIGQ--------------------PGRLGNPGISTEGVXXXXXXXXXXXXXXXXXXXXXXXXXXKQGDSGIS-IPGRQGIK------GEDGTIGLPGEMGEPGPRGDFGQKGNIGITGEFGLQGNRGDDGLKGDDGIPGLNGPRGFIGDIGFVGFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXELGLDGSMGGKGDNGPRGFNGPTGIPGSKGFEGD-----KGIRGDIGVKGFQGQHGEIGFPGLKGVSGENGRQXXXXXXXXXXXXXXXXVCMQPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEVGESIRGLQGRKGSTGLRGNIGIPGERGD------------------KGIPGLQGKVGNKGVKGDIGDKGFSGNIGDKGYSGISGDKGSFGVKGDKGFQGDVGMLGKSGLQGDRGQKGIIGFRGTRGIPGSMGLPGEIGEKGDVGPSGIGVKGLKGYQNAVGIKGRKGEKGLPGFPGRPGKVGDQGD 4484
            F   G +G  GP G +G  G  G  G  G+ G+KG++G    + P+  KG KG  G  G  G NG  G  G  G +G  GL G  G  G +G  G  GY G  G  G  G  G  G   ++  +             KG KG+ G  G  G  G  G  GF G +G  G     G PG  G  G +G  G+ F G   EKG+KGD     +     +    +T  +   GF  P+G KG+ G PG  G  GI    G  G+PG     ++G  G+ GIPG  G  G  G +G  G PG       QG +G  G  G  G QGI G+KG +G PGP+      G  + G+ GD G+ GLPG      I G +G  G PG   + G  G  G  G  GLKGDQG  G   I        +                +   L NK  G  G  GE G KG +G+  ++GD G     G                     L G  G +G++GS G  G  GA    G +G +G  G +G P                      I G  GDRG+ G++GF G  G+ G+                    PG  G PG+  E     P      G  G PG  GL G  GK G  G   +PG +GI       G  G  G PG  G PGP+G  G  G  G  G  G +G  G  GL     +PG  GPRG                                               E GL G  G  G +G  G  G  G+PGSKG  GD      G  G+ G++G  G  G +G  GL G+ G +G+ G  G KG  G  G  G   QP                                        G  G KG +GL G  G PG  G                   KG+PGL+G  GN G+   +G KG  G+ G  G   +SG KG    KG  GF G  G+ G  G+ G RG KGI G  G  G  G  G PGE G++G+ GP  +G+   +   + + +KG KG +G  G  G PG  GD+G+
Sbjct:   42 FPEKGARGRPGPIGIQGPTGPQGFTGSTGLSGLKGERGFPGLLGPYGPKGDKGPMGVPGFLGINGIPGHPGQPGPRGPPGLDGCNGTQGAVGFPGPDGYPGLLGPPGLPGQKGSKGDPVLAPGSF------------KGMKGDPGLPGLDGITGPQGAPGFPGAVGPAGPPGLQGPPGPPGPLGPDGNMGLGFQG---EKGVKGD-----VGLPGPAGPPPSTGELEFMGF--PKGKKGSKGEPGPKGFPGI---SGPPGFPGLGTTGEKGEKGEKGIPGLPGPRGPMGSEGVQGPPGQ------QGKKGTLGFPGLNGFQGIEGQKGDIGLPGPDVFIDIDGAVISGNPGDPGVPGLPGLKGDEGIQGLRGPSGVPGLPALSGVPGALGPQGFPGLKGDQGNPGRTTIGAAGLPGRDGLPGPPGPPGPPSPEFETETLHNKESGFPGLRGEQGPKGNLGLKGIKGDSGFCACDGGVPNTGPPGEPGPPGPWGLIGLPGLKGARGDRGSGGAQGPAGAPGLVGPLGPSGPKGKKGEP------------------ILSTIQGMPGDRGDSGSQGFRGVIGEPGKDGVPGLPGLPGLPGDGGQGFPGEKGLPGLPGEKGHPGPPGLPGNGLPGLPGPRGLPGDKGKDGLPGQQGLPGSKGITLPCIIPGSYGPSGFPGTPGFPGPKGSRGLPGTPGQPGSSGSKGEPGSPGLVHLPELPGFPGPRG-----------------------------------------------EKGLPGFPGLPGKDGLPGMIGSPGLPGSKGATGDIFGAENGAPGEQGLQGLTGHKGFLGDSGLPGLKGVHGKPGLLGPKGERGSPGTPGQVGQPGTPGS----------------------------------SGPYGIKGKSGLPGAPGFPGISGHPGKKGTRGKKGPPGSIVKKGLPGLKGLPGNPGL---VGLKGSPGSPGVAGLPALSGPKGE---KGSVGFVGFPGIPGLPGIPGTRGLKGIPGSTGKMGPSGRAGTPGEKGDRGNPGP--VGIPSPRRPMSNLWLKGDKGSQGSAGSNGFPGPRGDKGE 990          

HSP 8 Score: 129.798 bits (325), Expect = 3.713e-29
Identity = 325/968 (33.57%), Postives = 408/968 (42.15%), Query Frame = 3
Query: 1965 FGEAGSRGRKGYSGLKGFKGLIGERGTSFSSGDPGDKGLRGENGKDGVSFAGIPGEKGLKGDKGNRGILGDVG-----------------SLSNCATRPITSKGFKGPQG------------AKGTSGSPGSAGKTGIVGNKGENGYPGKRGIDGDNGIPGSKGE---------EGETGIKGHAGRPGNLGKSGLQGLRGEYGVKGD---------------LGIQGIP-GRKGVMGDPGPNGYAMIGSKGDKGIKGL--------------PGIYGAKGDKGRPGYIGIPGFKGETGLIGRSGLKGDQGEIGEKGIKGF-----------TFISNNPGDRGLLGNKGLKGFPGELGNKGQVGVCTVRGDQGLRGYSGLIGDMGMKGEQGSKGIVGDYGAASRSGIMGRTGKIGNQGLPGDQXXXXXXXXXXXXXXXXYIGIPGFEGDRGEKGNKGFPGFPGDIGQPGRLGNPGISTEGVXXXXXXXXXXXXXXXXXXXXXXXXXXKQGDSGISIPGRQGIKGEDGT------IGLPGEMGEPGPRGDFGQKGNIGITGEFGLQGNRGDDGLKGDDGIPGLNG-----------------PRGFIGDIGFVGFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXELGLDGSMGGK------GDNGPRGFNGPTGIP---GSKGFEGDKGIRGDIGVKGFQGQHGEIGFPGLKGVSGENGRQXXXXXXXXXXXXXXXXVCMQPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEVGESIRGLQGRKGSTGLRGNIGIPGERGDKGIPGLQGKVGNKGVKGDIGDKGFSGNIGDKGYSGISGDKGSFGVKGDKGFQGDVGMLGKSGLQGDRGQKGIIGFRGTRGIPGSMGLPGEIGEKGDVGPSGIGVKGLKGYQNAVGIKGRKGEKGLPGFPGR---------PGKVGDQGDKGPKGMKN 4508
            F E G+RGR G  G++G  G  G  G++      G  GL+GE G     F G+ G  G KGDKG  G+ G +G                  L  C      + GF GP G             KG+ G P  A  +   G KG+ G PG  GI G  G PG  G          +G  G  G  G  GN+G     G +GE GVKGD               L   G P G+KG  G+PGP G+  I   G  G  GL              PG+ G +G  G  G  G PG +G+ G +G  GL G QG  G+KG  G              IS NPGD G+ G  GLKG           G+  +RG  G+ G   L G  G  G QG  G+ GD G   R+        IG  GLPG  G PG  G  G    +       FE +       GFPG  G+ G  G LG  GI  +               G P                I +PG +G +G+ G+       G PG +G  GP G  G+KG   ++   G+ G+RGD G +G  G+ G  G                  +GF G+ G  G  G KG+ G  G  G     + G +G  G KG  G  G+ GL GS G        G  GP GF G  G P   GS+G  G  G  G  G KG  G  G +  P L G  G  G +G  G  GL G  G  G+   P +             + G  G  G+ G  G KG +G+S  GL G KG  G  G +G  GERG  G PG  G+ G  G  G  G KG SG  G  G+ GISG  G  G +G KG  G +   G  GL+G  G  G++G +G+ G PG  GLP   G KG+ G   +G  G  G     GI G +G KG+PG  G+         PG+ GD+G+ GP G+ +
Sbjct:   42 FPEKGARGRPGPIGIQGPTGPQGFTGST------GLSGLKGERG-----FPGLLGPYGPKGDKGPMGVPGFLGINGIPGHPGQPGPRGPPGLDGCNGT-QGAVGFPGPDGYPGLLGPPGLPGQKGSKGDPVLAPGS-FKGMKGDPGLPGLDGITGPQGAPGFPGAVGPAGPPGLQGPPGPPGPLGPDGNMG----LGFQGEKGVKGDVGLPGPAGPPPSTGELEFMGFPKGKKGSKGEPGPKGFPGI--SGPPGFPGLGTTGEKGEKGEKGIPGLPGPRGPMGSEGVQGPPGQQGKKGTLGFPGLNGFQGIEGQKGDIGLPGPDVFIDIDGAVISGNPGDPGVPGLPGLKG---------DEGIQGLRGPSGVPGLPALSGVPGALGPQGFPGLKGDQGNPGRT-------TIGAAGLPGRDGLPGPPGPPGPPSPE-------FETETLHNKESGFPGLRGEQGPKGNLGLKGIKGD-------SGFCACDGGVPNTGPPGEPGPPGPWGLIGLPGLKGARGDRGSGGAQGPAGAPGLVGPLGPSGPKGKKGEPILSTIQGMPGDRGDSGSQGFRGVIGEPGKDGVPGLPGLPGLPGDGGQGFPGEKGLPGLPGEKGHPGPPGLPGNGLPGLPGPRGLPGDKGKDGLPGQQGLPGSKGITLPCIIPGSYGPSGFPGTPGFPGPKGSRGLPGTPGQPGSSGSKGEPGSPGLVHLPELPGFPGPRGEKGLPGFPGLPGKDGLPGMIGSPGLPGSKGATGDIFGAENGAPGEQGLQGLTGHKGFLGDS--GLPGLKGVHGKPGLLGPKGERGSPGTPGQVGQPGTPGSSGPYGIKGKSGLPGAPGFPGISGHPGKKGTRGKKGPPGSIVKKGLPGLKGLPGNPGLVGLKGSPGSPGVAGLPALSGPKGEKG--SVGFVGFPGIPGLPGIPGTRGLKGIPGSTGKMGPSGRAGTPGEKGDRGNPGPVGIPS 956          

HSP 9 Score: 102.834 bits (255), Expect = 5.965e-21
Identity = 152/434 (35.02%), Postives = 196/434 (45.16%), Query Frame = 3
Query:  201 GNKGRQGFPGPRGYQGVSGDKGDVGQFGMPGPKGYKG----FTGAIGPQGRKGERGIPGSPGYPGKMGEMGFPGIRGDIGEKGLTGCDGQQGDFGNPGMNGLVGRTGQPGERGDDGDRGLSIIPKYGLKGNKGSR-----GLLGRYGRKGEKGFKGI----KGYSGIFGIKGNKGYVG---PMGRRGPKGDSLGTVIIQSEKGSKGDKGLKGQSGIPC-------------KGFQIEGRMYGRVGSDGPIGDKGIKGEKGLMGEIGQSGIDGARGLNGEKG------------LPGEAGPRGERGDRGNPG-------------------FPGDPGASGADGTRGRQGERGPKGVHGISGADGPRG------SRGDKGPSGSLLSCPGRKGEKGFFGIPGIKGDIGNKGYQGHDGDIGEIGFKGEKGYEGPLGP 1304
            G  G  G PG  G QG+ G  G  G  G+PG KG  G     +G+ GP+G+ GE G  G+ G  G +G +GFPG +G+ G+ G++G  G  G  G PG+ G+ G  G PG  G  G  G    P  GL G KG       G  G  G KGEKG+ GI     G  G+ G KG++G+ G   P G  G  G SL + +I  + G  G  GL G+ G P              +G   +    G  G  GP GD+GI G  GL GE+G  G+ G  G  G  G            + G+AGPRG  G +G+PG                     G PG +G  G +G  G +G KG+ GI G DGP G      + GD G        PG +G  GF G PG +G  G  G  G    +G    K  +  + P  P
Sbjct: 1035 GITGFPGMPGESGSQGIRGSPGLPGASGLPGLKGDNGQTVEISGSPGPKGQPGESGFKGTKGRDGLIGNIGFPGNKGEDGKVGVSGDVGLPGAPGFPGVAGMRGEPGLPGSSGHQGAIGPLGSP--GLIGPKGPSITGVPGPAGLPGPKGEKGYPGIGIGAPGKPGLRGQKGDRGFPGLQGPAGLPGAPGISLPS-LIAGQPGDPGRPGLDGERGRPGPAGPPGPPGPSSNQGDTGDPGFPGIPGPKGPKGDQGIPGFSGLPGELGLKGMRGEPGFMGTPGKVGPPGDPGFPGMKGKAGPRGSSGLQGDPGQTPTAEAVQVPPGPLGLPGIDGIPGLTGDPGAQGPVGLQGSKGLPGIPGKDGPSGLPGPPGALGDPG-------LPGLQGPPGFEGAPGQQGPFGMPGMPGQSMRVGYTLVKHSQSEQVPPCP 1458          

HSP 10 Score: 98.2117 bits (243), Expect = 1.285e-19
Identity = 86/189 (45.50%), Postives = 105/189 (55.56%), Query Frame = 3
Query: 3990 IRGLQGRKGSTGLRGNIGIPGERGDKGI---PGLQGKVGNKGVKGDIGD----KGFSGNIGDKGYSGISGDKGSFGVKGDKGFQGDVGMLGKSGLQGDRGQKGIIGFRGTRGIPGSMGLPGEIGEKGDVGPSG----IGVKG--LKGYQNAVGIKGRKGEKGLPGF----PGRPGKVGDQGDKGPKGMK 4505
            IRGL G KGS+G+ G  G+PGE G +GI   PGL G  G  G+KGD G      G  G  G  G SG  G KG  G+ G+ GF G+ G  GK G+ GD G  G  GF G  G+ G  GLPG  G +G +GP G    IG KG  + G     G+ G KGEKG PG     PG+PG  G +GD+G  G++
Sbjct: 1024 IRGLPGLKGSSGITGFPGMPGESGSQGIRGSPGLPGASGLPGLKGDNGQTVEISGSPGPKGQPGESGFKGTKGRDGLIGNIGFPGNKGEDGKVGVSGDVGLPGAPGFPGVAGMRGEPGLPGSSGHQGAIGPLGSPGLIGPKGPSITGVPGPAGLPGPKGEKGYPGIGIGAPGKPGLRGQKGDRGFPGLQ 1212          

HSP 11 Score: 94.3597 bits (233), Expect = 2.240e-18
Identity = 123/338 (36.39%), Postives = 154/338 (45.56%), Query Frame = 3
Query:  201 GNKGRQGFPGPRGYQGVSGDKGDVGQFGMPGPK--GYKGFTGAIGPQGRKGERGI----PGSPGYPGKMGEMGFPGIRGDIGEKGLTGCD------GQQGDFGNPGMNG---------LVGRTGQPGERGDDGDRGLSIIPKYGLKGNKGSRGLLGRYGRKGEKGFKGIKGYSGIFGIKGN------------KGYVGPMGRRGPKGDSLGTVIIQSEKGSKGDKGLKGQSGIPCKGFQIEGRMYGRVGSDGPIGDKGIKGEKGLMGEIGQSGIDGARGLNGEKGLPGEAGPRG------ERGDRGNPGFPGDPGASGADGTRGRQGERGPKGVHGIS 1097
            G +G  G PG  G+QG  G  G  G  G  GP   G  G  G  GP+G KG  GI    PG PG  G+ G+ GFPG++G  G  G  G        GQ GD G PG++G           G  G    +GD GD G   IP  G KG KG +G+ G  G  GE G KG++G  G  G  G             KG  GP G  G +GD   T   ++ +   G  GL G  GIP         + G  G+ GP+G +G KG  G+ G+ G SG+ G  G  G+ GLPG  GP G      ++G  G PG PG     G    +  Q E+ P    G+S
Sbjct: 1135 GMRGEPGLPGSSGHQGAIGPLGSPGLIGPKGPSITGVPGPAGLPGPKGEKGYPGIGIGAPGKPGLRGQKGDRGFPGLQGPAGLPGAPGISLPSLIAGQPGDPGRPGLDGERGRPGPAGPPGPPGPSSNQGDTGDPGFPGIP--GPKGPKGDQGIPGFSGLPGELGLKGMRGEPGFMGTPGKVGPPGDPGFPGMKGKAGPRGSSGLQGDPGQTPTAEAVQVPPGPLGLPGIDGIP--------GLTGDPGAQGPVGLQGSKGLPGIPGKDGPSGLPGPPGALGDPGLPGLQGPPGFEGAPGQQGPFGMPGMPGQSMRVGYTLVKHSQSEQVPPCPIGMS 1462          

HSP 12 Score: 79.7221 bits (195), Expect = 5.535e-14
Identity = 68/172 (39.53%), Postives = 88/172 (51.16%), Query Frame = 3
Query: 3999 LQGRKGSTGLRGNIGIPGERGDKGIPGLQGKVGNKGVKGDIGDKGFSGNIGDKGYSGISGDKGSFGVKGDKGFQGDVGMLGKSGLQGDRGQKGIIGFRGTRGIPGSMGLPGEIGEKGDVGPSGI-GVKGLKGYQNAVGIKGRKGEKGLPGFPGRPGKVGDQGDKGPKGMKNM 4511
            + G  G +G  G  G PG +G +G+PG  G+ G+ G KG+ G  G        G+ G  G+KG  G  G  G  G  GM+G  GL G +G  G I F    G PG  GL G  G KG +G SG+ G+KG+ G    +G KG +G  G PG  G+PG  G  G  G KG   +
Sbjct:  658 IPGSYGPSGFPGTPGFPGPKGSRGLPGTPGQPGSSGSKGEPGSPGLVHLPELPGFPGPRGEKGLPGFPGLPGKDGLPGMIGSPGLPGSKGATGDI-FGAENGAPGEQGLQGLTGHKGFLGDSGLPGLKGVHGKPGLLGPKGERGSPGTPGQVGQPGTPGSSGPYGIKGKSGL 828          

HSP 13 Score: 76.2554 bits (186), Expect = 5.761e-13
Identity = 74/197 (37.56%), Postives = 95/197 (48.22%), Query Frame = 3
Query: 3993 RGLQGRKGSTGLRGNIGIPGERGDKGIPGLQGKVGNKGVKGDIGDKGFSGNIGDKG-----YSGISGDKGSFGVKGDKGFQGDVGMLGKSGLQGDRGQKGIIGFRGTRGIPGSMGLPGEIGEKGDVGPSGI-GVKGLKGYQNAVGIKG------------------RKGEKGLPGFPGRPGKVGDQGDKGPKGMKNM 4511
            +G  G  G   L    G PG RG+KG+PG  G  G  G+ G IG  G  G+ G  G      +G  G++G  G+ G KGF GD G+    GL+G  G+ G++G +G RG PG+ G  G+ G  G  GP GI G  GL G     GI G                  +KG  GL G PG PG VG +G  G  G+  +
Sbjct:  695 KGEPGSPGLVHLPELPGFPGPRGEKGLPGFPGLPGKDGLPGMIGSPGLPGSKGATGDIFGAENGAPGEQGLQGLTGHKGFLGDSGL---PGLKGVHGKPGLLGPKGERGSPGTPGQVGQPGTPGSSGPYGIKGKSGLPGAPGFPGISGHPGKKGTRGKKGPPGSIVKKGLPGLKGLPGNPGLVGLKGSPGSPGVAGL 888          

HSP 14 Score: 69.707 bits (169), Expect = 5.685e-11
Identity = 79/221 (35.75%), Postives = 104/221 (47.06%), Query Frame = 3
Query: 3975 EVGESIRGLQGRKGSTGLRGNIGIPGERGD------------KGIPGLQGKVGNKGVKGDIGDKGFSGNIGDKGYSGISGDKGSF-----------GVKGDKGFQGD-VGMLGKSGLQGDRGQKGIIGFRGTRGIPGSMG--LPGEI-GEKGDVGPSGI----------------------GVKGLKGYQNAVGIKGRKGEKGLPGFPGRPGKVGDQGDKG 4490
            + GES  G +G KG  GL GNIG PG +G+             G PG  G  G +G  G  G  G  G IG  G  G+ G KG             G KG+KG+ G  +G  GK GL+G +G +G  G +G  G+PG+ G  LP  I G+ GD G  G+                      G  G  G+    G KG KG++G+PGF G PG++G +G +G
Sbjct: 1085 QPGES--GFKGTKGRDGLIGNIGFPGNKGEDGKVGVSGDVGLPGAPGFPGVAGMRGEPGLPGSSGHQGAIGPLGSPGLIGPKGPSITGVPGPAGLPGPKGEKGYPGIGIGAPGKPGLRGQKGDRGFPGLQGPAGLPGAPGISLPSLIAGQPGDPGRPGLDGERGRPGPAGPPGPPGPSSNQGDTGDPGFPGIPGPKGPKGDQGIPGFSGLPGELGLKGMRG 1303          

HSP 15 Score: 69.3218 bits (168), Expect = 8.736e-11
Identity = 72/188 (38.30%), Postives = 87/188 (46.28%), Query Frame = 3
Query: 3987 SIRGLQGRKGSTG------LRGNIGIPGERGDKGIPGLQGKVGNKGVKGDIGDKGFSGNIGDKGYSGISGDKGSFGVKGDKGFQGDVGMLGKSGLQGDRGQKG----------------IIGFRGTRGIPGSMGLPGEIGEKGDVGPSGIGVKGLKGYQNAVGIKGRKGEKGLPGFPGRPGKVGDQGD 4484
            ++ G +G KGS G      + G  GIPG RG KGIPG  GK+G  G  G  G+KG  GN G  G         +  +KGDKG QG  G  G  G +GD+G+ G                I G  G  G PG MG+ G  G KG       G+ G  G     G +G +G  GLPG  G PG  GD G 
Sbjct:  890 ALSGPKGEKGSVGFVGFPGIPGLPGIPGTRGLKGIPGSTGKMGPSGRAGTPGEKGDRGNPGPVGIPSPRRPMSNLWLKGDKGSQGSAGSNGFPGPRGDKGEAGRPGPPGLPGAPGLPGIIKGVSGKPGPPGFMGIRGLPGLKGSS-----GITGFPGMPGESGSQGIRGSPGLPGASGLPGLKGDNGQ 1072          

HSP 16 Score: 61.6178 bits (148), Expect = 1.949e-8
Identity = 80/233 (34.33%), Postives = 98/233 (42.06%), Query Frame = 3
Query: 3999 LQGRKGSTGLRGNIGIPGERGDKG-------------------IPGLQGKVGNKGVKGDIGDKGFSGNIGDKGYSGISGDKGSFGVKGDKGFQGDVGMLGKSGLQGDRGQK-GIIGFRGTRGIPGSMGLPGEIGEKGDVGPSGIGVKGLKGYQNAVGIKGRKGEKGLPGFPGRPGKVGDQGDKGPKGMKNMNTXXXXXXXXXXXXXXXXXXXXXXXXXLPGDMGEIGPNGPIG 4637
            L+G KGS G  G+ G PG RGDKG                   I G+ GK G  G  G  G  G  G+ G  G+ G+ G+ GS G++G  G  G  G+    GL+GD GQ   I G  G +G PG  G  G  G  G +G   IG  G KG    VG+ G   + GLPG PG PG  G +G+ G                                  LPG  G  G  GP+G
Sbjct:  966 LKGDKGSQGSAGSNGFPGPRGDKGEAGRPGPPGLPGAPGLPGIIKGVSGKPGPPGFMGIRGLPGLKGSSGITGFPGMPGESGSQGIRGSPGLPGASGL---PGLKGDNGQTVEISGSPGPKGQPGESGFKGTKGRDGLIG--NIGFPGNKGEDGKVGVSG---DVGLPGAPGFPGVAGMRGEPG----------------------------------LPGSSGHQGAIGPLG 1156          

HSP 17 Score: 61.6178 bits (148), Expect = 2.033e-8
Identity = 68/174 (39.08%), Postives = 86/174 (49.43%), Query Frame = 3
Query: 3993 RGLQGRKGSTGLRGNIGIPGERGDKGIPGLQGKVGNKGVKGDIGDKGFSGNIGDKGYSGISGDKGSFGVKGDKGFQGDVGMLGKSGLQGDRGQKGIIGFRGTRGIPGSMGLPGEIGEKGDVGPSGIGVKGLKGYQNAVGIKGRKGEKGLPGFPGRPGKVGDQGDKGPKGMKNMN 4514
            RGL G KG  GL G  G+PG +G   +P +    G+ G  G  G  GF G  G +G  G  G  GS G KG+ G  G V +    G  G RG+KG+ GF G   +PG  GLPG IG  G  G  G     + G +N     G  GE+GL G  G  G +GD G     G+K ++
Sbjct:  629 RGLPGDKGKDGLPGQQGLPGSKGIT-LPCI--IPGSYGPSGFPGTPGFPGPKGSRGLPGTPGQPGSSGSKGEPGSPGLVHLPELPGFPGPRGEKGLPGFPG---LPGKDGLPGMIGSPGLPGSKGA-TGDIFGAEN-----GAPGEQGLQGLTGHKGFLGDSGLP---GLKGVH 787          

HSP 18 Score: 53.5286 bits (127), Expect = 4.607e-6
Identity = 54/141 (38.30%), Postives = 68/141 (48.23%), Query Frame = 3
Query: 4095 GNKGVKGDIGDKGFSGNIGDKGYSGISGDKGSFGVKGD--KGFQGDVGMLGKSGLQGDRGQKGIIGFRGTRGIPGSMGLPGEIGEKGDVGPSGIGVKGLKGYQNAVGIKGRKGEKGLPGFPGRPGKVGDQGDKGPKGMKNM 4511
            G KG KG+ G KGF G  G  G+ G+               G  G  G +G  G+QG  GQ+G    +GT G PG  G  G  G+KGD+G  G  V        AV I G  G+ G+PG PG  G  G QG +GP G+  +
Sbjct:  255 GKKGSKGEPGPKGFPGISGPPGFPGLGTTGEKGEKGEKGIPGLPGPRGPMGSEGVQGPPGQQGK---KGTLGFPGLNGFQGIEGQKGDIGLPGPDV--FIDIDGAV-ISGNPGDPGVPGLPGLKGDEGIQGLRGPSGVPGL 389          
BLAST of Collagen IV NC1 domain-containing protein vs. Ensembl Celegans
Match: emb-9 (Collagen alpha-1(IV) chain [Source:UniProtKB/Swiss-Prot;Acc:P17139])

HSP 1 Score: 556.984 bits (1434), Expect = 2.871e-167
Identity = 665/1882 (35.33%), Postives = 860/1882 (45.70%), Query Frame = 3
Query:   99 LLLIMVSQSYYAQDS-DPDPFKCLRICTPDKCQCFGNKGRQGFPG---PRGYQGVSGDKGDVGQFGMPGPKGYKGFTGAIGPQGRKGERGIPGSPGYPGKMGEMGFPGIRGDIGEKGLTGCDGQQGDFGNPGMNGLVGRTGQPGERGDDGDRGLSIIPKYGLKGNKGSRGLLGRYGRKGEKGFKGIKGYSGIFGIKGNKG------YVGPMGRRGPKGDSLGTVIIQSEKGSKGDKGLKGQSGIPCKGFQIEGRMYGRVGSDGPIGDKGIKGEKGLMGEIGQSGI------DGARGLNGEKGLPGEAGPRGERGDRGNPGFPGDPGASGADGTRGRQGERGPKGVHGISGADGPRGSRGDKGPSGSLLSCPGRKGEKGFFGIPGIKGDIGNKGYQGHDGDIGEIGFKGEKGYEGPLGPSCSE-----VEQGFRGTKGESGF---PGLRGAKGQRGYSGNKGIKGKPNFGTGINNPGETGSYGNLGVPGEKGNKGFIGDTGEKGFSGTG--KQGPEGPRGDKGDDGVNGQVGMIGMPGIKGDKGSTYPICPFCEKGYKGIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEGRMGLLGSKGRQGYKGGKGFSGSMGDAGEIGYVTISGTT------------IPGVKGEKGNQGPKGN---------------------KGEFGEAGSRGRKGYSGLKGFKGLIGERGTSFSSGDPGDKGLRGENGKDGVSFAGIPGEKGLKGDKGNRGILGDVGSLSNCATRPITS--KGFKGPQGAKGTSGSPGSAGKTGIVGNKGENGYPGKRGIDGDNGIPGSKGEEGETGIKGHAGRPGNLGKSGLQGLRGE-----------YGVKGDLGIQGIPGRKGVMGDPGPNGYAMIGSKGDKGIKGLPGIYGAKGDKGRPGYIGIPGFKGETGLIGRSGLKGDQGEIGEKGIKGFTFISNNPGDRGLLGNKGLKGFPGELGNKGQVGVCTVRGDQGLRGYSGLIGDMGMKGEQGSKGIVGDYGAA----SR--SGIMGRTGKIGNQGLPGDQXXXXXXXXXXXXXXXXYIGIPGFEGDRGEKGNKGFPGFPGDIGQPGRLGNPGISTEGVXXXXXXXXXXXXXXXXXXXXXXXXXXKQGDSGISIPGRQGIKGEDGTIGLPGEMGEPGPRGDFGQKGNIGITGEFGLQGNRGDDGL---KGDDGIPGLNGPRGFIGDIGFVGFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXELGLDGSMGGKGDNGPRGFNGPTGIPGSKGFEGDKGIRGDIGV---KGFQGQHGEIGFPG---LKGVSGENGRQXXXXXXXXXXXXXXXXVCMQPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEVGES-IRGLQGRKGSTGLRGNIG------------------IPGERGDKGIPGLQGKVGN------KGVKGDIGDKGFSGNIGDKGYSGISGDKGSFGVKGDKGFQGDVGMLGKSG---LQGDRGQKGIIGFRGTRGIPGSMGL---PGEIGEKGDVGPSGIGVKGLKGYQNAVGIKGRKGEKGLPGFP------------GRPGKVGDQGDKGPKGMKNMNTXXXXXXXXXXXXXXXXXXXXXXXXXLPGDMGEIGPNGPIGYADN-GFLYATHSQSKDFPPCHGGGSPLYNGYSLLAIHGDIDSVTMDLGTPGSCLKNFSTIPFVNCFLERNTFYGGRCHVNMRNSRSYWLSTLQ--SYMSSPQPPSKMDDYISRCSVCQTKTTVMAFHSQKSDWQMTKCPYGWQKLWAGFSFPMAVQASRSGSNQPFSSPGSCLKHFRSLPFIECNNHNSNCNHWRDGVSYYMTAVDSENQFVKAQGKVLKSQTDIMNSISKCVVCQRD 5345
            L   +V  S + QD    D     + C P  C C G KG +G PG     G+ G  G  G  G  G PG  G +G  G +G +G +G+RG+PGSPG+PG  G  G PG++G   E+G+ GC+G  G    PGM GL G  GQ G+ G+ G  GLS  P  G   ++G +G+ G  GR G  G  G  GY G+ G KG+ G      + G  G +G  G     V  +           +  S  P     IE  +       GP+G  G+KGEKG  G +G  G+       G  GL G+KG  G+AG RG+RG  G PG  G+ G+ G  G  G  G  G KG  G  G  G  G  GD GP G L    G  G  G  G  G++G    KG  GHDG  G +G +G  G  G  G    +      E+G RG  G  GF   PGL G  G  GY G  G+ G    G     PG  G  G  G PG  G+ G  G +GEKGF GTG  K GP G  G  G+ G+ G++G+ G PG  G+ G     C +C  G  G           G+ G  G+ G  G  G  GD G  G+ G+ G+ G  G  G SGS G  G  GY  + G              IPG+KG+ G  G  G                      +GE G AG  G++G  G  G  GL G  G SF  G PG  G +GE G DG+         GL G +G RGI   +  ++  A +P      G  G +GA G  G PG  G  G  G  GE G  G  G  G +G PG +G++GE G  G  G   + G+ GL G  G            +G  G +G  G  G  G  G PGP+GY      G  G+ G PG  G  G  G+ G  G PG +GE+GL+G  G KG  G  G +G  G    S   G  G  G  G  G PG+ G  G  G     G  G+ G  GL+G  G++GE G  G+ G  G      SR   G+ G  G+ G  GLPG                     +PG +G  G  G  G PG PG  GQPG  GN  ++  G  GD G  G  GP G PG  GL G  G++GD+G S PG  G+ G+      PG+ G  G  G  G  G  GITG  GL+G  G  GL   +G+DGIPG  G  G  G+ GF G                                     G+ G  G  G +G+ G  G  G  G+PG +G +G  G++G+ G+    G+ G  G++G PG     G  GENG  G+ G  G  G  G+ G   QP +  +  +                     G  G+ G+    GL G  G+ GL G  G                  +PG  G++G+PGL GK G+       GV G  G  G  G+ G+ GY G  G  GS G  G++G  G  G  G+SG     G  GQ GI G RG  G PG  GL   PG  G +G  GP  + V+   G     G  G  GEKG PG P            G PG  G  G  GP G+  M        G  G  G  G  G+ G  GLPG  G   P  P G+A + GF +A HSQ+   P C  G S L+ GYSLL + G+  +   DLG PGSCL  F+T+PF+ C +         CHV+ RN  S+WLST +  + M +P   + +  YISRC+VC+  T ++A HSQ  D  + +CP GW  +W G+SF M   A   G+ Q   SPGSCL+ FR++PFIEC+   + CN++     ++++ VD + QF K   + LK+   + + +S+C VC ++
Sbjct:    9 LTAAVVLLSSFCQDRIHVDAAAACKGCAP-PCVCPGTKGERGNPGFGGEPGHPGAPGQDGPEGAPGAPGMFGAEGDFGDMGSKGARGDRGLPGSPGHPGLQGLDGLPGLKG---EEGIPGCNGTDG---FPGMPGLAGPPGQSGQNGNPGRPGLSGPPGEGGVNSQGRKGVKGESGRSGVPGLPGNSGYPGLKGAKGDPGPYGLPGFPGVSGLKGRMGVRTSGVKGEKGLPGPPGPPGQPGS-YPWASKPIEMEVL-----QGPVGPAGVKGEKGRDGPVGPPGMLGLDGPPGYPGLKGQKGDLGDAGQRGKRGKDGVPGNYGEKGSQGEQGLGGTPGYPGTKGGAGEPGYPGRPGFEGDCGPEGPLGEGTGEAGPHGAQGFDGVQG---GKGLPGHDGLPGPVGPRGPVGAPGAPGQPGIDGMPGYTEKGDRGEDGYPGFAGEPGLPGEPGDCGYPGEDGLPGYDIQGP----PGLDGQSGRDGFPGIPGDIGDPGYSGEKGFPGTGVNKVGPPGMTGLPGEPGMPGRIGVDGYPGPPGNNGERGEDCGYCPDGVPG---------NAGDPGFPGMNGYPGPPGPNGDHGDCGMPGAPGKPGSAGSDGLSGSPGLPGIPGYPGMKGEAGEIVGPMENPAGIPGLKGDHGLPGLPGRPGSDGLPGYPGGPGQNGFPGLQGEPGLAGIDGKRGRQGSLGIPGLQGPPGDSFP-GQPGTPGYKGERGADGL--------PGLPGAQGPRGIPAPLRIVNQVAGQPGVDGMPGLPGDRGADGLPGLPGPVGPDGYPGTPGERGMDGLPGFPGLHGEPGMRGQQGEVGFNGIDG---DCGEPGLDGYPGAPGAPGAPGETGFGFPGQVGYPGPNGDAGAAGLPGPDGY-----PGRDGLPGTPGYPGEAGMNGQDGAPGQPGSRGESGLVGIDGKKGRDGTPGTRGQDGGPGYSGEAGAPGQNGMDGYPGAPGDQGYPGSPGQDGYPGPSGIPGEDGLVGFPGLRGEHGDNGLPGLEGECGEEGSRGLDGVPGYPGEHGTDGLPG---------------------LPGADGQPGFVGEAGEPGTPGYRGQPGEPGN--LAYPGQPGDVGYPGPDGPPGLPGQDGLPGLNGERGDNGDSYPGNPGLSGQ------PGDAGYDGLDGVPGPPGYPGITGMPGLKGESGLPGLPGRQGNDGIPGQPGLEGECGEDGFPG-----------------------------------SPGQPGYPGQQGREGEKGYPGIPGENGLPGLRGQDGQPGLKGENGLDGQPGYPGSAGQLGTPGDVGYPGAPGENGDNGNQGRDGQPGLRGESGQPGQPGLPGRDGQPGPVGPPGDDGYPGAPGQDIYGPPGQAGQDGYPGLDGLPGAPGLNGEPGSPGQYGMPGLPGGPGESGLPGYPGERGLPGLDGKRGHDGLPGAPGVPGVEGVPGLEGDCGEDGYPGAPGAPGSNGYPGERGLPGVPGQQGRSGDNGYPGAPGQPGIKGPRGDDGFPGRDGLDGLPGRPGREGLPGPMAMAVRNPPG---QPGENGYPGEKGYPGLPGDNGLSGPPGKAGYPGAPGTDGYPGPPGLSGM-------PGHGGDQGFQGAAGRTGNPGLPGTPGY--PGSPGGWAPSRGFTFAKHSQTTAVPQCPPGASQLWEGYSLLYVQGNGRASGQDLGQPGSCLSKFNTMPFMFCNMNS------VCHVSSRNDYSFWLSTDEPMTPMMNPVTGTAIRPYISRCAVCEVPTQIIAVHSQ--DTSVPQCPQGWSGMWTGYSFVMHTAAGAEGTGQSLQSPGSCLEEFRAVPFIECHGRGT-CNYYATNHGFWLSIVDQDKQFRKPMSQTLKA-GGLKDRVSRCQVCLKN 1758          
BLAST of Collagen IV NC1 domain-containing protein vs. Ensembl Celegans
Match: emb-9 (Collagen alpha-1(IV) chain [Source:UniProtKB/Swiss-Prot;Acc:P17139])

HSP 1 Score: 452.981 bits (1164), Expect = 1.956e-132
Identity = 556/1606 (34.62%), Postives = 714/1606 (44.46%), Query Frame = 3
Query:  981 GERGDRGNPGF---PGDPGASGADGTRGRQGERGPKGVHGISGADGPRGSRGDKGPSGSLLSCPGRKGEKGFFGIPGIKGDIGNKGYQGHDGDIGEIGFKGEKGYEG----PLGPSCS-------EVEQGFRGTKGESGFPGLRGAKGQRGYSGNKGIKGKPNFGTGINNPGETGSYGNLGVPGEKGNKGFIG-------------------------DTGEKGFSGTGKQGPEGPRGDKGDDGVNGQVGMIGM---------PGIKGDKGSTYPICPFCEKGYKGIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEGRMGLLGSKGRQGYKGGKGFSGSMGDAGEIGYVTISGTTIPGVKGEKGNQGPKGNKGE-FGEAGSRGRKGYSGLKGFKGL---------IGERGTSFSSGDPGDKGL--------RGENGKDGVSFAGIPGEKGLKGDKGNRGILGDVGSLSNCATRPITSKGFKGPQGAKGTSGS---PGSAGKTGI-------VGNKGENGYPGKRGIDGDNGIPGSKGEEGETGIKGHAGRPGNLGKSGLQGLRGE--------------YGVKGDLGIQGIPGRKGVMGDPGPNGYAMIGSKGDKGIKGLPGIYGAKGDKGRPGYIGIPGFKGETGLIGRSGLKGDQGEIGEKGIKGFTFISNNPGDRGLLGNKGLKGFPGELGNKGQVGVCTVRGDQGLRGYSGLIGDMGMKGEQGSKGIVGDYGAA----SR--SGIMGRTGKIGNQGLPGDQXXXXXXXXXXXXXXXXYIGIPGFEGDRGEKGNKGFPGFPGDIGQPGRLGNPGISTEGVXXXXXXXXXXXXXXXXXXXXXXXXXXKQGDSGISIPGRQGIKGEDGTIGLPGEMGEPGPRGDFGQKGNIGITGEFGLQGNRGDDGL---KGDDGIPGLNGPRGFIGDIGFVGFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXELGLDGSMGGKGDNGPRGFNGPTGIPGSKGFEGDKGIRGDIGV---KGFQGQHGEIGFPG---LKGVSGENGRQXXXXXXXXXXXXXXXXVCMQPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEVGES-IRGLQGRKGSTGLRGNIG------------------IPGERGDKGIPGLQGKVGN------KGVKGDIGDKGFSGNIGDKGYSGISGDKGSFGVKGDKGFQGDVGMLGKSG---LQGDRGQKGIIGFRGTRGIPGSMGL---PGEIGEKGDVGPSGIGVKGLKGYQNAVGIKGRKGEKGLPGFP------------GRPGKVGDQGDKGPKGMKNMNTXXXXXXXXXXXXXXXXXXXXXXXXXLPGDMGEIGPNGPIGYADN-GFLYATHSQSKDFPPCHGGGSPLYNGYSLLAIHGDIDSVTMDLGTPGSCLKNFSTIPFVNCFLERNTFYGGRCHVNMRNSRSYWLSTLQ--SYMSSPQPPSKMDDYISRCSVCQTKTTVMAFHSQKSDWQMTKCPYGWQKLWAGFSFPMAVQASRSGSNQPFSSPGSCLKHFRSLPFIECNNHNSNCNHWRDGVSYYMTAVDSENQFVKAQGKVLKSQTDIMNSISKCVVCQRD 5345
            G +G+RGNPGF   PG PGA G DG  G  G  G  G  G  G  G +G+RGD+G    L   PG  G +G  G+PG+KG+ G  G  G DG  G  G  G  G  G    P  P  S          QG +G KGESG  G+ G  G  GY G KG KG P            G YG  G PG  G KG +G                             K       QGP GP G KG+ G +G VG  GM         PG+KG KG         ++G  G+                               G  G  GS+G QG  G  G+ G+ G AGE GY        PG  G +G+ GP+G  GE  GEAG  G +G+ G++G KGL         +G RG   + G PG  G+        +G+ G+DG  + G  GE GL G+ G+ G  G+ G        P    G  G  G  G  G    PG +G+ G        VG  G  G PG+RG+DG  G PG  GE G  G +G  G  G  G  G  GL G               +G  G +G  G  G  G  G PGP+GY      G  G+ G PG  G  G  G+ G  G PG +GE+GL+G  G KG  G  G +G  G    S   G  G  G  G  G PG+ G  G  G     G  G+ G  GL+G  G++GE G  G+ G  G      SR   G+ G  G+ G  GLPG                     +PG +G  G  G  G PG PG  GQPG  GN  ++  G  GD G  G  GP G PG  GL G  G++GD+G S PG  G+ G+      PG+ G  G  G  G  G  GITG  GL+G  G  GL   +G+DGIPG  G  G  G+ GF G                                     G+ G  G  G +G+ G  G  G  G+PG +G +G  G++G+ G+    G+ G  G++G PG     G  GENG  G+ G  G  G  G+ G   QP +  +  +                     G  G+ G+    GL G  G+ GL G  G                  +PG  G++G+PGL GK G+       GV G  G  G  G+ G+ GY G  G  GS G  G++G  G  G  G+SG     G  GQ GI G RG  G PG  GL   PG  G +G  GP  + V+   G     G  G  GEKG PG P            G PG  G  G  GP G+  M        G  G  G  G  G+ G  GLPG  G   P  P G+A + GF +A HSQ+   P C  G S L+ GYSLL + G+  +   DLG PGSCL  F+T+PF+ C +         CHV+ RN  S+WLST +  + M +P   + +  YISRC+VC+  T ++A HSQ  D  + +CP GW  +W G+SF M   A   G+ Q   SPGSCL+ FR++PFIEC+   + CN++     ++++ VD + QF K   + LK+   + + +S+C VC ++
Sbjct:   43 GTKGERGNPGFGGEPGHPGAPGQDGPEGAPGAPGMFGAEGDFGDMGSKGARGDRG----LPGSPGHPGLQGLDGLPGLKGEEGIPGCNGTDGFPGMPGLAGPPGQSGQNGNPGRPGLSGPPGEGGVNSQGRKGVKGESGRSGVPGLPGNSGYPGLKGAKGDP------------GPYGLPGFPGVSGLKGRMGVRTSGVKGEKGLPGPPGPPGQPGSYPWASKPIEMEVLQGPVGPAGVKGEKGRDGPVGPPGMLGLDGPPGYPGLKGQKGDLGDAGQRGKRGKDGV------------------------------PGNYGEKGSQGEQGLGGTPGYPGTKGGAGEPGY--------PGRPGFEGDCGPEGPLGEGTGEAGPHGAQGFDGVQGGKGLPGHDGLPGPVGPRGPVGAPGAPGQPGIDGMPGYTEKGDRGEDG--YPGFAGEPGLPGEPGDCGYPGEDGLPGYDIQGPPGLDGQSGRDGFPGIPGDIGDPGYSGEKGFPGTGVNKVGPDGYPGTPGERGMDGLPGFPGLHGEPGMRGQQGEVGFNGIDGDCGEPGLDGYPGAPGAPGAPGETGFGFPGQVGYPGPNGDAGAAGLPGPDGY-----PGRDGLPGTPGYPGEAGMNGQDGAPGQPGSRGESGLVGIDGKKGRDGTPGTRGQDGGPGYSGEAGAPGQNGMDGYPGAPGDQGYPGSPGQDGYPGPSGIPGEDGLVGFPGLRGEHGDNGLPGLEGECGEEGSRGLDGVPGYPGEHGTDGLPG---------------------LPGADGQPGFVGEAGEPGTPGYRGQPGEPGN--LAYPGQPGDVGYPGPDGPPGLPGQDGLPGLNGERGDNGDSYPGNPGLSGQ------PGDAGYDGLDGVPGPPGYPGITGMPGLKGESGLPGLPGRQGNDGIPGQPGLEGECGEDGFPG-----------------------------------SPGQPGYPGQQGREGEKGYPGIPGENGLPGLRGQDGQPGLKGENGLDGQPGYPGSAGQLGTPGDVGYPGAPGENGDNGNQGRDGQPGLRGESGQPGQPGLPGRDGQPGPVGPPGDDGYPGAPGQDIYGPPGQAGQDGYPGLDGLPGAPGLNGEPGSPGQYGMPGLPGGPGESGLPGYPGERGLPGLDGKRGHDGLPGAPGVPGVEGVPGLEGDCGEDGYPGAPGAPGSNGYPGERGLPGVPGQQGRSGDNGYPGAPGQPGIKGPRGDDGFPGRDGLDGLPGRPGREGLPGPMAMAVRNPPG---QPGENGYPGEKGYPGLPGDNGLSGPPGKAGYPGAPGTDGYPGPPGLSGM-------PGHGGDQGFQGAAGRTGNPGLPGTPGY--PGSPGGWAPSRGFTFAKHSQTTAVPQCPPGASQLWEGYSLLYVQGNGRASGQDLGQPGSCLSKFNTMPFMFCNMNS------VCHVSSRNDYSFWLSTDEPMTPMMNPVTGTAIRPYISRCAVCEVPTQIIAVHSQ--DTSVPQCPQGWSGMWTGYSFVMHTAAGAEGTGQSLQSPGSCLEEFRAVPFIECHGRGT-CNYYATNHGFWLSIVDQDKQFRKPMSQTLKA-GGLKDRVSRCQVCLKN 1501          

HSP 2 Score: 323.939 bits (829), Expect = 1.110e-89
Identity = 484/1337 (36.20%), Postives = 601/1337 (44.95%), Query Frame = 3
Query:   99 LLLIMVSQSYYAQDS-DPDPFKCLRICTPDKCQCFGNKGRQGFPG---PRGYQGVSGDKGDVGQFGMPGPKGYKGFTGAIGPQGRKGERGIPGSPGYPGKMGEMGFPGIRGDIGEKGLTGCDGQQGDFGNPGMNGLVGRTGQPGERGDDGDRGLSIIP---------KYGLKGNKGSRGLLGRYGRKGEKGFKGIKGYSGIFGIKGNKGYVGPMGRRGPKGDSL---------------------GTVIIQSE--------KGSKGDKGLKGQSGIPCKGFQIEGRMYGRVGSDGPIGDKGIKGEKGLMGEIGQSGID---------GARGLNGEKGLPGEAGPRGERGDRGNPGFPGDPGASGADGTRGR----QGERGPKGVHGISGADGPRGSRGDKGPSGSL-----LSCPGRKGEKGFFGIPGI--KGDIGNKGYQGHDGDIGEIGFKGEKGYEGPLGPSCSEVE--QGFRGTKGESGFPGLRGAKGQRGYSGNKGIKGKPNFGTGINNPGETGSYGNLGVPGEKGNKGFIGDTGEKGFSGTGKQGPEGPRGDKGDDGVNGQVGMIGMPGIKGDKGSTYPICPFCEKGYKGIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEGRMGLLGSKGRQGYKGGKGFSGSMGDAGEIGYVTISGTT-IPGVKGEKGNQGPKGNKGEFGEAGSRGRKGYSGLKGFKGLIGERGTSFSSGDPGDKGLRGENGKDGVS-FAGIPGEKGLKGDKGNRGILGDVGSLSNCATRPITSKGFKGPQGAKGTSGSPGSAGKTGIVGNKGENGYPGKRGIDGDNGIPGSKGEEGETGIKGHAGRPGNL------------GKSGLQGLRGEYGVKGDLGIQGIPGRKGVMGDPGPNGY-------------AMIGSKGDKGIKGLPGIYGAKGDKGRPGYIGIPGFKGETGLIGRSGLKGDQGEIGEKGIKGFTFISNNPGDRGLLGNKGLKGFPGELGNKGQVGVCTVRGDQGLRGYSGLIGDMGMKGEQGSKGIVGDYGAASRSGIMGRTGKIGNQGLPGDQXXXXXXXXXXXXXXXXYIGIPG--FEGDRGEKGNKGFPGFPGDIGQPGRLGNPGISTE-GVXXXXXXXXXXXXXXXXXXXXXXXXXXKQGDSGIS----IPGRQGIKGEDGTIGLPGEMGEPGPRGDFGQKGNIGITGEFGLQGNRGDDGLKGDDGIPGLNGPRGFIGDIGFVGFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXELGLDGSMGGKGDNGPRGFNGPTGIPGSKGFEGDKGIRGDIGV---KGFQGQHGEIGFPGLKGVSGENG 3806
            L   +V  S + QD    D     + C P  C C G KG +G PG     G+ G  G  G  G  G PG  G +G  G +G +G +G+RG+PGSPG+PG  G  G PG++   GE+G+ GC+G     G PGM GL G  GQ G+ G+ G  GLS  P         + G+KG  G  G+ G  G  G  G KG KG  G +G+ G  G  G  GR G +   +                      +  I+ E         G KG+KG  G  G P           G +G DGP G  G+KG+KG +G+ GQ G           G +G  GE+GL G  G  G +G  G PG+PG PG  G  G  G      GE GP G  G  G  G +G  G  G  G +     +  PG  G+ G  G+PG   KGD G  GY G  G+ G  G  G+ GY G  G    +++   G  G  G  GFPG+ G  G  GYSG KG       GTG+N   + G  G  G PGE+G  G  G  G  G  G         RG +G+ G NG  G  G PG+ G  G+        E G+                      G  G  G PG  G  G  G  G  GY G  G  G+ G  GE G     G    PG +GE G  G  G KG  G  G+RG+ G  G  G  G  G+ G     G PGD+G  G  G+DG    +GIPGE GL G  G RG  GD G                  +G  G  G PG  G  G+ G  G +G PG  G  G+ G PG +G+ GE G   + G+PG++            G+ GL GL GE G  GD      PG  G+ G PG  GY              + G  G KG  GLPG+ G +G+ G PG  G+ G  GE G  G  G  G  G+ G +G KG+  I   PG+ GL    GL+G  G+ G KG+ G+    G  G  G  G  GD+G  G  G  G  G+ G   + G+ G +G+ G  GLPG     G  G  G  G  GY G PG    G  G+ G  G+PG  G  G PG  G PG   + G+ G PG  G  G  G PG  GL G  GK+G  G+     +PG +G+ G +G  G  G  G PG  G  G  G  G+ G  G QG  GD+G  G  G PG+ GPR   GD GF G  G  G  GR G +G  G     V+   G  G  G+ GE G  G  G  G +GP G  G  G PG+ G+ G  G+ G  G    +GFQG  G  G PGL G  G  G
Sbjct:    9 LTAAVVLLSSFCQDRIHVDAAAACKGCAP-PCVCPGTKGERGNPGFGGEPGHPGAPGQDGPEGAPGAPGMFGAEGDFGDMGSKGARGDRGLPGSPGHPGLQGLDGLPGLK---GEEGIPGCNGTD---GFPGMPGLAGPPGQSGQNGNPGRPGLSGPPGEGGVNSQGRKGVKGESGRSGVPGLPGNSGYPGLKGAKGDPGPYGLPGFPGVSGLKGRMGVRTSGVKGEKGLPGPPGPPGQPGSYPWASKPIEMEVLQGPVGPAGVKGEKGRDGPVGPP-----------GMLGLDGPPGYPGLKGQKGDLGDAGQRGKRGKDGVPGNYGEKGSQGEQGLGGTPGYPGTKGGAGEPGYPGRPGFEGDCGPEGPLGEGTGEAGPHGAQGFDGVQGGKGLPGHDGLPGPVGPRGPVGAPGAPGQPGIDGMPGYTEKGDRGEDGYPGFAGEPGLPGEPGDCGYPGEDGLPGYDIQGPPGLDGQSGRDGFPGIPGDIGDPGYSGEKGFP-----GTGVN---KVGPDGYPGTPGERGMDGLPGFPGLHGEPGM--------RGQQGEVGFNGIDGDCGEPGLDGYPGAPGAPGAPGETGF----------------------GFPGQVGYPGPNGDAGAAGLPGPDGYPGRDGLPGTPGYPGEAGMNGQDGAPGQPGSRGESGLVGIDGKKGRDGTPGTRGQDGGPGYSGEAGAPGQNGMDGYPGAPGDQGYPGSPGQDGYPGPSGIPGEDGLVGFPGLRGEHGDNGLPGLEGECGEEGS-----RGLDGVPGYPGEHGTDGLPGLPGADGQPGFVGEAGEPGTPGYRGQPGEPGNLAYPGQPGDVGYPGPDGPPGLPGQDGLPGLNGERGDNGDS----YPGNPGLSGQPGDAGYDGLDGVPGPPGYPGITGMPGLKGESGLPGLPGRQGNDGIPGQPGLEGECGEDGFPGSPGQPGYPGQQGREGEKGYPGI---PGENGL---PGLRGQDGQPGLKGENGLDGQPGYPGSAGQLGTPGDVGYPGAPGENGDNGNQGRDGQPGLRGESGQPGQPGLPG---RDGQPGPVGPPGDDGYPGAPGQDIYGPPGQAGQDGYPGLDGLPGAPGLNGEPGSPGQYGMPGLPGGPGESGLPGYPGERGLPGLDGKRGHDGLPGAPGVPGVEGVPGLEGDCGEDGYPGAPGAPGSNGYPGERGLPGVPGQQGRSGDNGYPGAPGQPGIKGPR---GDDGFPGRDGLDGLPGRPGREGLPGPMAMAVRNPPGQPGENGYPGEKGYPGLPGDNGLSGPPGKAGYPGAPGTDGYPGPPGLSGMPGHGGDQGFQGAAGRTGNPGLPGTPGYPG 1268          

HSP 3 Score: 253.062 bits (645), Expect = 1.677e-67
Identity = 367/1043 (35.19%), Postives = 458/1043 (43.91%), Query Frame = 3
Query:  198 FGNKGRQGFPGPRGYQGVSGDKGDVGQFGMPGPKGYKGFTGAIGPQGRKGERGIPGSPGYPGK---MGEMGFPGI----------------RGDIGEKGLTGCDGQQGDFGNPGMNGL---------VGRTGQPGERGDDG--------DRGLSIIPKY----GLKGNKGSRGLLGR-----YGRKGEKGFKGIKGYSGIFGIKGNKGYVGPMGRRGPKGDSLGTVIIQSEKGSKGDKGLKGQSGIPCKGFQIEGRMYGRVGSDGPIGDKGIKGEKGL-----------------MGEIGQSGIDGARGLNGEKGLPGEAGPRGERGDRGNPGFPGDPGASGADGTRGRQGERGPKGVHGISGADGPRGSRGDKGPSGSLLSCPGRKGEKGFFGIPGIKGDIGNKGYQGHDGDIGEIGFKGEKGYEGPLGPSCSEVEQGFRGTKGESGFPGLRGAKGQRGYSGNKGIKGKPNFGTGINNPGETGSYGNLGVPGEKGNKGFIGDTGEKGFSGTGKQGPEGPRGDKGDDGVNGQVGMI---------------GMPGI---KGDKGSTYPICPFC-----EKGYKGIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEGRMGLLGSKGRQGYKGGKGFSGSMGDAGEIGYVTISGTT-IPGVKGEKGNQGPKGNKGEFGEAGSRGRKGYSGLKGFKGLIGERGTSFSSGD---PGDKGLRGENGKDGVS-FAGIPGEKGLKGDKGNRGILGDVGSLSNCATRP---------ITSKGFKGPQGAKGTSGSPGSAGKTGIVGNKGENGYPGKRGIDGDNG------IPGSKGEEGETGIKGHAGRPGNLGKSGLQGLRGEYGVKGDLGIQGIPGRKGVMGDPGPNGYAMIGSKGDKGIKGLPGIYGAKGDKGRPGYIGIPGFKG---ETGLIGRSGLKGDQGEIGEKGIKGFTFIS-----NNPGDRGLLGNKGLKGFPGELGNKGQVGVCTVRGDQGLRGYSGLIGDMGMKGEQGSKGIVGDYGAASRSGIMGRTGKIGNQGLPG 2987
             G  G  G  GP GY G+ G KGD+G  G  G +G  G  G  G +G +GE+G+ G+PGYPG     GE G+PG                  G+ G  G  G DG QG  G PG +GL         VG  G PG+ G DG        DRG    P +    GL G  G  G  G      Y  +G  G  G  G  G  GI G+ G  G  G +G  G  +  V      G+ G++G+ G  G P  G   E  M G+ G  G  G  G  GE GL                  G  GQ G  G  G  G  GLPG  G  G  G  G PG+PG+ G +G DG  G+ G RG  G+ GI G  G  G+ G +G          + G  G+ G  G  G  G  GY G  GD G  G  G+ GY GP G    +   GF G +GE G  GL G +G+ G  G++G+ G P +      PGE G+ G  G+PG  G  GF+G+ GE G  G   Q      G+ G+    GQ G +               G+PG+   +GD G +YP  P       + GY G+ G  G  G  G  G+ GL            +G  GL G  GRQG  G  G  G  G+ GE G+    G    PG +G +G +G  G  GE G  G RG+ G  GLKG  GL G+ G   S+G    PGD G  G  G++G +   G  G+ GL+G+ G  G  G  G                     +   GP G  G  G PG  G  G  G  GE G PG+ G+ G  G      +PG  GE G  G+ G  G  G  G  G+ G+ G  G++GD G  G PG  G    PG NGY      G++G+ G+PG  G  GD G PG  G PG KG   + G  GR GL G  G  G +G+ G   ++       PG+ G  G KG  G PG+ G  G  G     G  G  GY G  G  GM G  G +G     GAA R+G  G  G  G  G PG
Sbjct:  275 VGPPGMLGLDGPPGYPGLKGQKGDLGDAGQRGKRGKDGVPGNYGEKGSQGEQGLGGTPGYPGTKGGAGEPGYPGRPGFEGDCGPEGPLGEGTGEAGPHGAQGFDGVQGGKGLPGHDGLPGPVGPRGPVGAPGAPGQPGIDGMPGYTEKGDRGEDGYPGFAGEPGLPGEPGDCGYPGEDGLPGYDIQGPPGLDGQSGRDGFPGIPGDIGDPGYSGEKGFPGTGVNKVGPDGYPGTPGERGMDGLPGFP--GLHGEPGMRGQQGEVGFNGIDGDCGEPGLDGYPGAPGAPGAPGETGFGFPGQVGYPGPNGDAGAAGLPGPDGYPGRDGLPGTPGYPGEAGMNGQDGAPGQPGSRGESGLVGIDGKKGRDGTPGTRG----------QDGGPGYSGEAGAPGQNGMDGYPGAPGDQGYPGSPGQDGYPGPSGIPGEDGLVGFPGLRGEHGDNGLPGLEGECGEEGSRGLDGVPGY------PGEHGTDGLPGLPGADGQPGFVGEAGEPGTPGYRGQ-----PGEPGNLAYPGQPGDVGYPGPDGPPGLPGQDGLPGLNGERGDNGDSYPGNPGLSGQPGDAGYDGLDGVPGPPGYPGITGMPGL------------KGESGLPGLPGRQGNDGIPGQPGLEGECGEDGFPGSPGQPGYPGQQGREGEKGYPGIPGENGLPGLRGQDGQPGLKGENGLDGQPGYPGSAGQLGTPGDVGYPGAPGENGDNGNQGRDGQPGLRGESGQPGQPGLPGRDGQPGPVGPPGDDGYPGAPGQDIYGPPGQAGQDGYPGLDGLPGAPGLNGEPGSPGQYGMPGLPGGPGESGLPGYPGERGLPGLDGKRGHDGLPGAPGVPGVEGVPGLEGDCGEDGYPGAPGA---PGSNGY-----PGERGLPGVPGQQGRSGDNGYPGAPGQPGIKGPRGDDGFPGRDGLDGLPGRPGREGLPGPMAMAVRNPPGQPGENGYPGEKGYPGLPGDNGLSGPPGKAGYPGAPGTDGYPGPPGLSGMPGHGGDQGF---QGAAGRTGNPGLPGTPGYPGSPG 1271          

HSP 4 Score: 83.5741 bits (205), Expect = 1.475e-15
Identity = 134/402 (33.33%), Postives = 162/402 (40.30%), Query Frame = 3
Query:  192 QCFGNKGRQGFPGPRGYQGVSGDKGDVGQFGMPGPKGYKGFTGAIGPQGRKGERGIPGSPGYPGKMGEMG------FPGIRGDIGEKGLTGCDGQ---QGDFGNPGMNGLVGRT-----------------------GQPGERGDDGDRGLSIIP-------------KYG------------LKGNKGSRGLLGRYGRKGEKGFKGIKGYSGIFGIKGNKGYVGPMGRRGPKGD--------SLGTVIIQSEKGSKGDKGLKGQSGIP-------CKGFQ-------IEGRMYGRVGSDGPI-----------GDKGIKGEKGLMGEIGQSGIDGARGLNGEKGLPGEAGPRGERGDRGNPGFPGDPGASGADGTRGRQGERGPKGVHGISGADGPRGSRG 1127
            +C G  G  G PG  GY G  G +G+ G  G+PG  G  G  G  G  G KGE G+ G PGYPG  G++G      +PG  G+ G+ G  G DGQ   +G+ G PG  GL GR                        G PG+ G DG  GL  +P             +YG            L G  G RGL G  G++G  G  G  G  G+ G+ G +G  G  G  G  G           G   +  ++G  GD G  G  G P         GF        + GR  GR G  GP+           G+ G  GEKG  G  G +G+ G  G  G  G PG  G  G  G  G PG  GD G  GA G  G  G  G  G  G  G   P  SRG
Sbjct:  881 EC-GEDGFPGSPGQPGYPGQQGREGEKGYPGIPGENGLPGLRGQDGQPGLKGENGLDGQPGYPGSAGQLGTPGDVGYPGAPGENGDNGNQGRDGQPGLRGESGQPGQPGLPGRDGQPGPVGPPGDDGYPGAPGQDIYGPPGQAGQDGYPGLDGLPGAPGLNGEPGSPGQYGMPGLPGGPGESGLPGYPGERGLPGLDGKRGHDGLPGAPGVPGVEGVPGLEGDCGEDGYPGAPGAPGSNGYPGERGLPGVPGQQGRSGDNGYPGAPGQPGIKGPRGDDGFPGRDGLDGLPGRP-GREGLPGPMAMAVRNPPGQPGENGYPGEKGYPGLPGDNGLSGPPGKAGYPGAPGTDGYPGPPGLSGMPGHGGDQGFQGAAGRTGNPGLPGTPGYPGSPGGWAP--SRG 1278          

HSP 5 Score: 66.6254 bits (161), Expect = 1.991e-10
Identity = 66/172 (38.37%), Postives = 86/172 (50.00%), Query Frame = 3
Query: 4044 IPGERGDKGIPGLQGKVGNKGVKGDIGDKGFSGNIGDKGYSGISGDKGSFGVKGDKGFQGDVG---MLGKSGLQGDRGQKGIIGFRGTRGIPGSMGL---PGEIGEKGDVGPSGIGVKGLKGYQNAVGIKGRKGEKGLPGFPGRP---------GKVGDQGDKGPKGMKNMN 4514
             PG +G++G PG  G+ G+ G  G  G +G  G  G  G  G  GD GS G +GD+G  G  G   + G  GL G +G++GI G  GT G PG  GL   PG+ G+ G+ G  G+     +G  N+ G KG KGE G  G PG P         G  GD G  G  G   ++
Sbjct:   41 CPGTKGERGNPGFGGEPGHPGAPGQDGPEGAPGAPGMFGAEGDFGDMGSKGARGDRGLPGSPGHPGLQGLDGLPGLKGEEGIPGCNGTDGFPGMPGLAGPPGQSGQNGNPGRPGLSGPPGEGGVNSQGRKGVKGESGRSGVPGLPGNSGYPGLKGAKGDPGPYGLPGFPGVS 212          
BLAST of Collagen IV NC1 domain-containing protein vs. Ensembl Celegans
Match: let-2 (Collagen alpha-2(IV) chain [Source:UniProtKB/Swiss-Prot;Acc:P17140])

HSP 1 Score: 409.068 bits (1050), Expect = 1.816e-116
Identity = 510/1519 (33.57%), Postives = 666/1519 (43.84%), Query Frame = 3
Query: 1116 GSRGDKGPSGSLLSCPGRKGEKGFFGIPG--IKGDIGNKGYQGHDGDIGEIGFKGEKGYEGPLGPSCSEVEQGFRGTKGESGFPGLRGAKGQRGYSGNKGIKGKPNFGTGINNPGETGSYGNLGVPGEKGNKGFIGDTGEKGFSGT-GKQGPEGPRGDKGDDGVNGQVGMIG---------MPGIKGDKGSTYPIC----PFCEKGYKGIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEGRMGLLGSKGRQGYKGGKGFSGSMGDAG--EIGYVTISGTT----------IPGVKGEKGNQGPKGNKGEFGEAGSRGRKGYSGLKGFKGLIGERGTSFSSGDPGDKGLRGENGKDGVS-------------FAGIPGEKGLKGDKGNRGILGDVGSLSNCATRPITSKGFKGPQGAKGTSGSPGSAGKTGIVGNKGENGYPGKRGIDGDNGIPGSKGEEGETGIKGHAGRPGNLGKSGLQGLRGEYGVKGDLGIQGIPGRKGVMGDPGPNGYAMI-GSKGDKGIKGLPGIYGAKGDKGRPGYIGIPGFKGETGLIGRSGLKGDQGEIGEKGIKGFTFISNNPGDRGLLGNKGLKGFPGELGNKGQVGVCTVRGDQGLRGYSGLIGDMGMKGEQGSKGIVGDYGAASRSGIMGRTGKIGNQGLPGDQXXXXXXXXXXXXXXXXYIGIPGFEGDRG--------EKGNKGFPGFPGDIGQPGRLGNPGISTEGVXXXXXXXXXXXXXXXXXXXXXXXXXXKQGDSGISIPGRQGIKGEDGTIGLPGEMGEPGPRGDFGQKGNIGITGEFGLQGNRGDDGLKGDDG---IPGLNGPRGFIGDIGFVGFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXELGLDGSMGGKGDNGPRGFNGPTGIPGSKGFEGDKGIRGDIGVKGFQGQHGEIGFPGLK---GVSGENGRQXXXXXXXXXXXXXXXXVCMQPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEVGESIRGLQGRKGSTGLRGNIGIPGERGDKGIPGLQGKVGNKGVKGDIGDKGFSGNIGDKGYSGISGDKGSFGVKGDKGFQGDVGMLGKSG------LQGDRGQKGIIGFRGTRGIPGSMGLPGEIGEKGDVGPSG---------------------------IGVKGLKGYQNAVGIKGRKGEKGLP------------------GFPGRPGKVGDQGDKGPKGMKNMNTXXXXXXXXXXXXXXXXXXXXXXXXXLPGDMGEIGPNGPIGYADNGFLYATHSQSKDFPPCHGGGSPLYNGYSLLAIHGDIDSVTMDLGTPGSCLKNFSTIPFVNCFLERNTFYGGRCHVNMRNSRSYWLSTLQSYMSSPQPPSKMDDYISRCSVCQTKTTVMAFHSQKSDWQMTKCPYGWQKLWAGFSFPMAVQASRSGSNQPFSSPGSCLKHFRSLPFIECNNHNSNCNHWRDGVSYYMTAVDSENQFVKAQGKVLKSQTDIMNSISKCVVCQRDMN 5351
            G+ G  GPSG +   PG KGE G+ G PG  I G  G  G  G DG  G  G  G  G  GP G S +          G  G PG RGA G  GY G  G+ G P         G+ G   +   PG KG KG  G +G+ G  G  G  G  GP GD GDDG+ G  G  G          PG+ G KG    +     P    G KG  G  G+ G +G  G +G  G  G  G PG++G  GL G  G+ G  G  G  G+ G+AG  + G     G             PG++G  G   P+ N+      G  G  G  G KG  G  G  G     G PG  G++G++G  G               F G+PG  G+ G KG+                 + + G  G  G KG  G        G+ G  G  G+PG +G  G  G+PG+ G EG+ G  G  G  G  G  GL G  G  G KGD G+ G+PGR+G  G PG +G   + G KG+ G+ GLPG+ G KGD G PG  G PG  G  G     G+KG+ G  G  G KG   +   PG  G  G  G+ G PG  G KG  G+  + G  GL G  G+ GD G  G  G KG   + G A+R G  G  G  G  GL G QG  G              G+PGF+G+ G        + G KG PG PG  G+ G  G+PG   +G+ G PG                      +G+SG   PG+ G+ G DG  G+PG+      +GD GQ G  G++G  GL G  G  G++GD G   +PG+ G RG                                                  +DG  G KG+NG  G  G  G+ G KGF G  G  G  G  G+ GQ G  G PGLK   G  G+ G++G  GL G  G  G  G+  QP     G  G  G  G +G                  +   GL G+KG +GL G  G PG +G+ G+PG        G KGD+G  G  G  G+ G  G+ G  G  G+ G KG  G  G+ G+ G      L+G+ G  G  G +G  G PG+ G+PG  GEKGD G  G                            G KGL G   A G++G KG  GL                   G+PG PG  G++G  G  G   ++    G       G                            Y D GF+   HSQ+ + P C  G + L++GYSLL I G+  S   DLG  GSCL+ FST+PF+ C           C+   RN +SYWLST ++    P    +++ YISRC+VC+     +A HSQ    Q+  CP GW  LW G+SF M   A   G  Q  SSPGSCL+ FR+ PFIECN    +C+++ +  S+++T +D++++F   + + LKS  ++   +S+C VC +  +
Sbjct:  429 GAPGVSGPSG-IPGLPGPKGEPGYRGTPGQSIPGLPGKDGKPGLDGAPGRKGENGLPGVRGPPGDSLN----------GLPGAPGQRGAPGPNGYDGRDGVNGLPGA---PGTKGDRGGTCSACAPGTKGEKGLPGYSGQPGPQGDRGLPGMPGPVGDAGDDGLPGPAGRPGSPGPPGQDGFPGLPGQKGEPTQLTLRPGPPGYPGLKGENGFPGQPGVDGLPGPSGPVGPPGAPGYPGEKGDAGLPGLSGKPGQDGLPGLPGNKGEAGYGQPGQPGFPGAKGDGGLPGLPGTPGLQGMPGEPAPE-NQVNPAPPGQPGLPGLPGTKGEGGYPGRPGEVGQPGFPGLPGMKGDSGLPGPPGLPGHPGVPGDKGFGGVPGLPGIPGPKGD-----------------VGNPGLPGLNGQKGEPG-------VGVPGQPGSPGFPGLKGDAGLPGLPGTPGLEGQRGFPGAPGLKGGDGLPGLSGQPGYPGEKGDAGLPGVPGREGSPGFPGQDGLPGVPGMKGEDGLPGLPGVTGLKGDLGAPGQSGAPGLPGAPGY---PGMKGNAGIPGVPGFKGDGGLPGLPGLNGPKGEPGVPGMPGTPGMKGNGGLPGLPGRDGLSGVPGMKGDRGFNGLPGEKG---EAGPAARDGQKGDAGLPGQPGLRGPQGPSG------------LPGVPGFKGETGLPGYGQPGQPGEKGLPGIPGKAGRQGAPGSPG--QDGLPGFPG---------------------MKGESGY--PGQDGLPGRDGLPGVPGQ------KGDLGQSGQPGLSGAPGLDGQPGVPGIRGDKGQGGLPGIPGDRG--------------------------------------------------MDGYPGQKGENGYPGQPGLPGLGGEKGFAGTPGFPGLKGSPGYPGQDGLPGIPGLKGDSGFPGQPGQEGLPGLSGEKGMGGLPGMPGQPGQSIAGPVGPPGAPGLQGK-----------------DGFPGLPGQKGESGLSGLPGAPGLKGESGMPGF------PGAKGDLGANGIPGKRGEDGLPGVPGRDGQPGIPGLKGEVGGAGLPGQPGFPGIPGLKGEGGLPGFPGAKGEAGFPGTPGVPGYAGEKGDGGLPGLPGRDGLPGADGPVGPPGPSGPQNLVEPGEKGLPGLPGAPGLRGEKGMPGLDGPPGNDGPPGLPGQRGNDGYPGAPGLSGEKGMGGLPGFPGLDGQPGGPGAPGLPGAPGAAGPA--------------------YRD-GFVLVKHSQTTEVPRCPEGQTKLWDGYSLLYIEGNEKSHNQDLGHAGSCLQRFSTMPFLFCDFNN------VCNYASRNDKSYWLSTSEAIPMMPVNEREIEPYISRCAVCEAPANTIAVHSQT--IQIPNCPAGWSSLWIGYSFAMHTGAGAEGGGQSLSSPGSCLEDFRATPFIECNGARGSCHYFANKFSFWLTTIDNDSEFKVPESQTLKS-GNLRTRVSRCQVCVKSTD 1756          

HSP 2 Score: 253.832 bits (647), Expect = 1.409e-67
Identity = 415/1184 (35.05%), Postives = 513/1184 (43.33%), Query Frame = 3
Query:  246 GVSGDKGDVGQFGMPGPKGYKGFTGAIGPQ--GRKGERGIPGSPGYPGKMGEMGFPGIRGDIGEKGLTGCDGQQGDFGNPGMNGLVGR---TGQPGERGDDGDRGLSIIPKYGLKGNKGSRGLLGRYGRKGEKGFKGIKGYSGIFGIKGNKGYVGPM---------------GRRGPKGDSLGTVIIQSEKGSKGDKGLKGQSGIP-------------------------CKGFQIEGRMYGRVGSDGPIGDKGIKGEKGLMGEIGQSGIDGARG---------LNGEKGLPGEAGPRGE--RGDRGNPGFPGDPGASGADGTRGRQGERGPKGVHGISGA--DGPRGSRGDKGPSGSLLSCPGRKGEKGFFGIPGIKGDIGNKGYQGHDGDIGE--IGFKGEKGYEGPLGPSCSEVEQGFRGTKGESGFPGLRGA---KGQRGYSGNKGIKG---KPNFGTGINNPGETGSYGNLGVPGEKGNKGFIGDTGEKGFSGT----GKQGPEGPRGDKGDDGVNGQVGMIGMPGIKGDKGSTYPICPFCEKGYKGIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEGRMGLLGSKGRQGYKGGKGFSGSMGDAGEIGYVTISGTTIPGVKGEKGNQGPKGNKGEFGEAGSRGRKGYSGLKGFKGLIGERGTSFSSGDPGDKGLRGENGKDGVSFAGIPGEKGLKGDKGNRGILGDVGSLSNCATRPITSKGFKGPQGAKGTSGSPGSAGKTGIVGNKGENGYPGKRGI---DGDNGIPGSKGEEGETGIKGHAGRPGNLGKSGLQGLRGEYGVKGDLGIQGIPGRKGVMGDPG---PNGYAMIG-------SKGDKGIKGLPGIYGAKGDKGRPGYIGIPGFKGETGLIGRSGLKGDQGEIGEKGIKGFTFISNNPGDR--------GLLGNKGLKGFPGELGNKGQVGVCTVRGDQGLRGYSGLIGDMGMKGEQGSKGIVGDYGAASRSGIMGRTGKIGNQGLPGDQXXXXXXXXXXXXXXXXYIGIPGFEGDRGEKGNKGFPGFPGDIGQPGRLGNPGIS---------TEGVXXXXXXXXXXXXXXXXXXXXXXXXXXKQGDSGIS-IPGRQGIKGEDGTI------------GLPGEMGEPGPRGDFGQKGNIGITGEFGLQGNRGDDGLKGDDGIPGLNG 3458
            G  G  G  G  G+PGPKG  G+ G  G    G  G+ G PG  G PG+ GE G PG+RG  G+  L G  G  G  G PG NG  GR    G PG  G  GDRG +        G KG +GL G  G+ G +G +G+ G  G  G  G+ G  GP                G  G KG+     +     G  G  GLKG++G P                          KG      + G+ G DG  G  G KGE G  G+ GQ G  GA+G           G +G+PGE  P  +      G PG PG PG  G  G  GR GE G  G  G+ G   D              +    G  G  G  GIPG KGD+GN G  G +G  GE  +G  G+ G              GF G KG++G PGL G    +GQRG+ G  G+KG    P        PGE G  G  GVPG +G+ GF G  G  G  G     G  G  G  G KGD G  GQ G  G+PG  G  G          KG  GI G  G +G+ G  G+ GL G          +G  G+ G  G  G KG  G  G  G  G  G        +PG+KG++G  G  G KGE G A   G+KG +GL G  GL   RG    SG PG  G +GE G  G    G PGEKGL G  G                            G +G  GSPG  G  G  G KGE+GYPG+ G+   DG  G+PG KG+ G++G  G +G PG  G+ G+ G+RG+   KG  G+ GIPG +G+ G PG    NGY            KG  G  G PG+ G+ G  G+ G  GIPG KG++G  G+ G +G  G  GEKG+ G   +   PG          G  G +G  GFPG  G KG+ G+  + G  GL+G SG+ G  G KG+ G+ GI G  G     G+ GR G+ G  GL G+             G  G  G PGF G  G KG  G PGFPG  G+ G  G PG+              +              P  P       + G+ G+  +PG  G++GE G                          G  GQ+GN G  G  GL G +G  GL    G PGL+G
Sbjct:  429 GAPGVSGPSGIPGLPGPKGEPGYRGTPGQSIPGLPGKDGKPGLDGAPGRKGENGLPGVRGPPGDS-LNGLPGAPGQRGAPGPNGYDGRDGVNGLPGAPGTKGDRGGTC--SACAPGTKGEKGLPGYSGQPGPQGDRGLPGMPGPVGDAGDDGLPGPAGRPGSPGPPGQDGFPGLPGQKGEPTQLTL---RPGPPGYPGLKGENGFPGQPGVDGLPGPSGPVGPPGAPGYPGEKGDAGLPGLSGKPGQDGLPGLPGNKGEAG-YGQPGQPGFPGAKGDGGLPGLPGTPGLQGMPGEPAPENQVNPAPPGQPGLPGLPGTKGEGGYPGRPGEVGQPGFPGLPGMKGDSGLPGPPGLPGHPGVPGDKGFGGVPGLPGIPGPKGDVGNPGLPGLNGQKGEPGVGVPGQPG------------SPGFPGLKGDAGLPGLPGTPGLEGQRGFPGAPGLKGGDGLPGLSGQPGYPGEKGDAGLPGVPGREGSPGFPGQDGLPGVPGMKGEDGLPGLPGVTGLKGDLGAPGQSGAPGLPGAPGYPGM---------KGNAGIPGVPGFKGDGGLPGLPGLNG---------PKGEPGVPGMPGTPGMKGNGGLPGLPGRDGLSG--------VPGMKGDRGFNGLPGEKGEAGPAARDGQKGDAGLPGQPGL---RGPQGPSGLPGVPGFKGETGLPGYGQPGQPGEKGLPGIPGK--------------------------AGRQGAPGSPGQDGLPGFPGMKGESGYPGQDGLPGRDGLPGVPGQKGDLGQSGQPGLSGAPGLDGQPGVPGIRGD---KGQGGLPGIPGDRGMDGYPGQKGENGYPGQPGLPGLGGEKGFAGTPGFPGLKGSPGYPGQDGLPGIPGLKGDSGFPGQPGQEGLPGLSGEKGMGGLPGMPGQPGQSIAGPVGPPGAPGLQGKDGFPGLPGQKGESGLSGLPGAPGLKGESGMPGFPGAKGDLGANGIPGKRGEDGLPGVPGRDGQPGIPGLKGE------------VGGAGLPGQPGFPGIPGLKGEGGLPGFPGAKGEAGFPGTPGVPGYAGEKGDGGLPGLPGRDGLPGADGPVGPPGPSGPQNLVEPGEKGLPGLPGAPGLRGEKGMPGLDGPPGNDGPP------------GLPGQRGNDGYPGAPGLSGEKGMGGLP---GFPGLDG 1508          

HSP 3 Score: 218.394 bits (555), Expect = 1.085e-56
Identity = 384/1106 (34.72%), Postives = 466/1106 (42.13%), Query Frame = 3
Query:  471 GNPGMNGLVGRTGQPGERGDDGDRGLSIIPKYGLKGNKGSRGLLGRYGRKGEKGFKGIKGYSGIFGIKGNKGYVGPMGRRGPKGDSLGTVIIQSEKGSKGDKGLKGQSGIPCKGFQIEGRMYGRVGSDGPIGDKGIKGEKGLMGEIGQSGIDGARGLNGEKGLPGEAGPRGERGDRGNPGFPGDPGASGADGTRGRQGERGPKGVHGISGADGPRGSRGDK-------GPSGSLLSCPGRKGEKGFFGIPGI---------------------KGDIGNKGYQGHDGDIGEIGFKGEKGYEGPLGPSCSEVEQGFRGTKGESGFPGLRGAKGQRGYSGNKGIKGKPNFGTGIN--NPGETGSYGNLGVPGEKGNKGFIGDTGEKGFSGTGKQGPEGPRGDKG---------------DDGVNGQVGMIGMPGIKGDKGSTYPICPFC--EKGYKGIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEGRMGLLGSKGRQGYKGGKGFSGSMGDAGEIGYVTISGTTIPGVKGEKGNQGPKGNKGEFGEAGSRGRKGYSGLKGFKGLIGERGTSFSSGDPGDKGLRGENGKDGVSFA-GIPGEKGLKGDKGNRGILGDVG----SLSNCATRPITSKGFKGPQGAKGTSGSPGSAGKTGIVGNKGENGYPGKRGIDGDNGIPGSKGEEGETGIKGHAGRPGNLGKSGLQGLRGEYGVKGDLGIQGIPGRKGVMGDPGPNGYAMIGSKGDKGIKGLPGIYGAKGDKGRPGYIGIPGF---KGETGLIGRSGLKGDQGEIGEKGIKGFTFISNNPGDRGLLGNKGLKGFPGELGNKGQVGVCTVRGDQGLRGYSG---------------------LIGDMGMKGEQGSKGIVGDYGAASRSGIMGRTG---KIGNQGLPG-----------------DQXXXXXXXXXXXXXXXXYIGIPGFEGDRGEKGNKGFPGFPGDIGQPGRLGNPGISTEGVXXXXXXXXXXXXXXXXXXXXXXXXXXKQGDSGIS-IPGRQGIKGEDGTIGLPGEMGEPGPRGDFGQKGNIGITGEFGLQGNRGDDGLKGDDGIPGLNGPRGFIGDIGFVGF 3497
            G PG++G  G  G PG +G+ G RG       GL G  G  GL G  GRKGE G  G+                     RGP GDSL            G  G  GQ G P           G  G DG  G  G+ G  G  G+ G +    A G  GEKGLPG +G  G +GDRG PG PG  G +G DG  G  G  G  G  G  G  G  G +G+        GP G     PG KGE GF G PG+                     KGD G  G  G  G  G  G  G KG            E G+ G  G+ GFPG +G  G  G  G  G++G P      N  NP   G  G  G+PG KG  G+ G  GE G  G    G  G +GD G               D G  G  G+ G+PG KGD G+  P  P    +KG  G+                G+ G  G+ G PG +G  GL G  G  G +G +GF G+ G  G        G  +PG+ G+ G  G KG+ G  G  G  G  G+ G  G  G+ G +G     G PG  GL+G+ G  G S A G+PG  G  G KGN GI G  G                KG  G  G  GT G  G+ G  G+ G  G +G PG +G  G NG+PG KGE G       A R G  G +GL G  G  G +G  G+ G+PG KG  G PG   Y   G  G+KG+ G+PG  G +G  G PG  G+PGF   KGE+G  G+ GL G  G  G  G KG    S  PG  G  G  G  G PG  G+KGQ G+  + GD+G+ GY G                       G  G  G +GS G  G  G     G+ G +G   + G +GLPG                  Q   G  G  G  G +G  G PG  G +GE G  G PG PG  G+ G  G PG                                 +GD G + IPG+   +GEDG  G+PG  G+PG  G  G+ G  G+ G+ G  G  G  G  G  G PG  G  GF G  G  G+
Sbjct:  429 GAPGVSGPSGIPGLPGPKGEPGYRGTPGQSIPGLPGKDGKPGLDGAPGRKGENGLPGV---------------------RGPPGDSL-----------NGLPGAPGQRGAP-----------GPNGYDGRDGVNGLPGAPGTKGDRGGTCSACAPGTKGEKGLPGYSGQPGPQGDRGLPGMPGPVGDAGDDGLPGPAGRPGSPGPPGQDGFPGLPGQKGEPTQLTLRPGPPGY----PGLKGENGFPGQPGVDGLPGPSGPVGPPGAPGYPGEKGDAGLPGLSGKPGQDGLPGLPGNKG------------EAGY-GQPGQPGFPGAKGDGGLPGLPGTPGLQGMPGEPAPENQVNPAPPGQPGLPGLPGTKGEGGYPGRPGEVGQPGF--PGLPGMKGDSGLPGPPGLPGHPGVPGDKGFGGVPGLPGIPGPKGDVGN--PGLPGLNGQKGEPGV----------------GVPGQPGSPGFPGLKGDAGLPGLPGTPGLEGQRGFPGAPGLKG--------GDGLPGLSGQPGYPGEKGDAGLPGVPGREGSPGFPGQDGLPGVPGMKGEDGLPGLPGVTGLKGDLGAPGQSGAPGLPGAPGYPGMKGNAGIPGVPGFKGDGGLPGLPGLNGPKGEPGVPGMPGTPGMKGNGGLPGLPGRDGLSGVPGMKGDRGFNGLPGEKGEAGP------AARDGQKGDAGLPGQPGLRGPQGPSGLPGVPGFKGETGLPG---YGQPGQPGEKGLPGIPGKAGRQGAPGSPGQDGLPGFPGMKGESGYPGQDGLPGRDGLPGVPGQKGDLGQSGQPGLSGAPGLDGQPGVPGIRGDKGQGGLPGIPGDRGMDGYPGQKGENGYPGQPGLPGLGGEKGFAGTPGFPGLKGSPGYPGQDGLPGIPGLKGDSGFPGQPGQEGLPGLSGEKGMGGLPGMPGQPGQSIAGPVGPPGAPGLQGKDGFPGLPGQKGESGLSGLPGAPGLKGESGMPGFPGA--------------------------------KGDLGANGIPGK---RGEDGLPGVPGRDGQPGIPGLKGEVGGAGLPGQPGFPGIPGLKGEGGLPGFPGAKGEAGFPGTPGVPGY 1402          

HSP 4 Score: 213.772 bits (543), Expect = 3.153e-55
Identity = 386/1120 (34.46%), Postives = 471/1120 (42.05%), Query Frame = 3
Query:  201 GNKGRQGFPGPRGYQGVSGDKGDVGQFGMPGPKGYKGFTGAIGPQGRKGERGIPGSPGYPGKMGEMGFPGIRGDIGEKG---------------------LTGCDGQQGDF----------GNPGMNGLVGRTGQPG---------------------ERGDDGDRGLSIIP----KYGLKGNKGSRGLLGRYGRKGEKGFKGIKGYSGIFGIKGNKGYVGPMGRRGPKGDSLGTVIIQSEKGSKGDKGLKGQSGIPCKGFQIEGRMYGRVGSDGPIGDKGIKGE------------------KGLMGEIGQSGIDGARGLNGEKGLPGEAGPRGERG-----DRGNPGFPG---DPGASGADGTRGRQGERGPKGVHGISGADGPRGSRGDKGPSGSLLSCPGRKGEKGFFGIPGIKGDIGNKGYQGHDGDIGEIGFKGEKGYEGPLGPSCSEVEQGFRGTKGESGFPGLRGAKGQRGYSGNKGIKGKPNF------------GTGINNPGETGSYGNLG------------------VPGEKGNKGFIGDTGEKGFSGTGKQGPEGPRGDKGDDGVNGQVGM------IGMPGIKGDKGST------YPICPFCEKGYKGIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEGRMGLLGSKGRQGYKGGKGFSGSMGDAGEIGYVTISGTTIPGVKGEKGNQGPKGNKGEFGEAGSRGRKGYSGLKGFKGLIGERGTSFSSGDPGDKGLRGENGKDGVS----------FAGIPGEKGLKGDKGNRGILGDVGSLSNCATRPITSKGFKGPQGAKGTSGSPGSAGKTGIVGNKGENG---------YPGKR-----------GIDGDNGIPGSKGEEGETGIKGHAGRPGNLGKSGLQGLRGEYGVKGDLGIQGIPGRKGVMGDPGPNGYAMIGSKGDKGIKGLPGIYGAKGDKGRPGYIGIPGFKGETGLIGRSGLKGDQGEIGEKGIKGFTFISNNPGDRGLLGNKGLKGFPGELGNKGQVGVCTVRGDQGLRGYSGLIGDMGMKGEQGSKGIVGDYGAASRSGIMGRTGKIGNQGLPGDQXXXXXXXXXXXXXXXXYIGIPGFEGDRGEKGNKGF 3098
            G  G++G PGP GY G  G  G     G PG KG +G T +    G KGE+G+PG  G PG  G+ G PG+ G +G+ G                       G  GQ+G+           G PG+ G  G  GQPG                     E+GD G  GLS  P      GL GNKG  G    YG+ G+ GF G KG  G+ G+ G  G  G  G   P+           + G  G  G KG+ G P +         G VG  G  G  G+KG+                  KG  G  G  GI G +G  G  GLPG  G +GE G       G+PGFPG   D G  G  GT G +G+RG  G  G+ G DG  G  G           PG  GEKG  G+PG+ G  G+ G+ G DG  G  G KGE G  G   P  + + +G  G  G+SG PGL GA G  G  GN GI G P F                  PG  G  G  G                  VPG KG++GF G  GEKG     + GP    G KGD G+ GQ G+       G+PG+ G KG T       P  P  EKG  GI G                             GR G  GS G+ G  G  G  G  G  G+ G     G  +PGV G+KG+ G  G  G  G  G  G+ G  G++G KG  G  G     G  G  G +GENG  G            FAG PG  GLKG  G  G                   G  G  G KG SG PG  G+ G+ G  GE G          PG+            G+ G +G PG  G++GE+G+ G  G PG  G+SG+ G  G    KGDLG  GIPG++G  G PG     + G  G  GI GL G  G  G  G+PG+ GIPG KGE GL G  G KG+ G  G  G+ G+     + G  GL G  GL G  G +G  G  G   +  + G +G  GL G  G++GE+G  G+ G  G     G+ G+ G  G  G PG           G KG  G  G PG +G  G  G  G 
Sbjct:  499 GAPGQRGAPGPNGYDGRDGVNG---LPGAPGTKGDRGGTCSACAPGTKGEKGLPGYSGQPGPQGDRGLPGMPGPVGDAGDDGLPGPAGRPGSPGPPGQDGFPGLPGQKGEPTQLTLRPGPPGYPGLKGENGFPGQPGVDGLPGPSGPVGPPGAPGYPGEKGDAGLPGLSGKPGQDGLPGLPGNKGEAG----YGQPGQPGFPGAKGDGGLPGLPGTPGLQGMPGEPAPENQV--NPAPPGQPGLPGLPGTKGEGGYPGR--------PGEVGQPGFPGLPGMKGDSGLPGPPGLPGHPGVPGDKGFGGVPGLPGIPGPKGDVGNPGLPGLNGQKGEPGVGVPGQPGSPGFPGLKGDAGLPGLPGTPGLEGQRGFPGAPGLKGGDGLPGLSGQ----------PGYPGEKGDAGLPGVPGREGSPGFPGQDGLPGVPGMKGEDGLPG--LPGVTGL-KGDLGAPGQSGAPGLPGAPGYPGMKGNAGIPGVPGFKGDGGLPGLPGLNGPKGEPGVPGMPGTPGMKGNGGLPGLPGRDGLSGVPGMKGDRGFNGLPGEKG-----EAGPAARDGQKGDAGLPGQPGLRGPQGPSGLPGVPGFKGETGLPGYGQPGQP-GEKGLPGIPG---------------------------KAGRQGAPGSPGQDGLPGFPGMKGESGYPGQDGLPGRDG--LPGVPGQKGDLGQSGQPGLSGAPGLDGQPGVPGIRGDKGQGGLPGIPGDRGMDGYPGQKGENGYPGQPGLPGLGGEKGFAGTPGFPGLKGSPGYPG-----------------QDGLPGIPGLKGDSGFPGQPGQEGLPGLSGEKGMGGLPGMPGQPGQSIAGPVGPPGAPGLQGKDGFPGLPGQKGESGLSGLPGAPGLKGESGMPGFPG---AKGDLGANGIPGKRGEDGLPG-----VPGRDGQPGIPGLKGEVGGAGLPGQPGFPGIPGLKGEGGLPGFPGAKGEAGFPGTPGVPGYAGEKGDGGLPGLPGRDGLPGADGPVGPPGPSGPQNLV-EPGEKGLPGLPGAPGLRGEKGMPGLDGPPGNDGPPGLPGQRGNDGYPGAPG---------LSGEKGMGGLPGFPGLDGQPGGPGAPGL 1518          

HSP 5 Score: 120.168 bits (300), Expect = 1.141e-26
Identity = 200/597 (33.50%), Postives = 254/597 (42.55%), Query Frame = 3
Query: 2253 TSGSPGSAGKTGIVGNKGENGYPGKRGIDGDNGIPGSKGEEGETGIKGHAGRPGNLGKSGLQGLRGEYGVKGDLGIQGIPGRKGVMGDPGPNGYAMIGSKGDKGIKGLPGIYGAKGDKGRPGYIGIPGFKGETGLIGRSGLKGDQGEIGEKGIKGF-------------------------------------TFISNNPGDRGLLGNKGLKGFPGELG------------NKGQVGVCTVRGDQGLRGYSGLIGDMGMKGEQGSKGIVGDYGAASRSGIMGRTG---------KIGNQGLPGDQXXXXXXXXXXXXXXXXYIGIPGFEGDRGEKGNKGFPGFPGDIGQPGRLGNPGIS-------------------TEGVXXXXXXXXXXXXXXXXXXXXXXXXXXKQGDSGISIPGRQGIKGEDGTIGLPGEMGEPGPRGDFGQKGNIGITGEFGLQGNRGDDGLKGDDGIPGLNGPRGFIGDIGFVGFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXELGLDGSMGGKGDNGPRGFNGPTGIPGSKGFEGDKGIRGDIGVKGFQGQHGEIGFPGLKGVSGENGRQ 3812
              G+PG +G +GI G  G  G PG RG  G + IPG  G++G+ G+ G  GR    G++GL G+RG  G      + G+PG  G  G PGPNGY      G  G+ GLPG  G KGD+G       PG KGE GL G SG  G QG+ G  G+ G                                      T ++  PG  G  G KG  GFPG+ G              G  G    +GD GL G SG  G  G+ G  G+KG  G YG   + G  G  G           G QG+PG+                   G PG  G  G KG  G+PG PG++GQPG  G PG+                     +G  G PGL G+PGP G+ G PGL G  G++G+ G+ +PG+            PG  G PG +GD G  G  G  G  G +G  G  GLKG DG+PGL+G  G+ G+ G                                         + GL G  G +G  G  G +G  G+PG KG +G  G+ G  G+KG  G  G+ G PGL G  G  G +
Sbjct:  427 IPGAPGVSGPSGIPGLPGPKGEPGYRGTPGQS-IPGLPGKDGKPGLDGAPGR---KGENGLPGVRGPPGDS----LNGLPGAPGQRGAPGPNGY-----DGRDGVNGLPGAPGTKGDRGGTCSACAPGTKGEKGLPGYSGQPGPQGDRGLPGMPGPVGDAGDDGLPGPAGRPGSPGPPGQDGFPGLPGQKGEPTQLTLRPGPPGYPGLKGENGFPGQPGVDGLPGPSGPVGPPGAPGYPGEKGDAGLPGLSGKPGQDGLPGLPGNKGEAG-YGQPGQPGFPGAKGDGGLPGLPGTPGLQGMPGEPAPENQVNPAPP-------GQPGLPGLPGTKGEGGYPGRPGEVGQPGFPGLPGMKGDSGLPGPPGLPGHPGVPGDKGFGGVPGLPGIPGPKGDVGNPGLPGLNGQKGEPGVGVPGQ------------PGSPGFPGLKGDAGLPGLPGTPGLEGQRGFPGAPGLKGGDGLPGLSGQPGYPGEKG-----------------------------------------DAGLPGVPGREGSPGFPGQDGLPGVPGMKGEDGLPGLPGVTGLKGDLGAPGQSGAPGLPGAPGYPGMK 949          
BLAST of Collagen IV NC1 domain-containing protein vs. Ensembl Celegans
Match: let-2 (Collagen alpha-2(IV) chain [Source:UniProtKB/Swiss-Prot;Acc:P17140])

HSP 1 Score: 409.068 bits (1050), Expect = 1.816e-116
Identity = 510/1519 (33.57%), Postives = 666/1519 (43.84%), Query Frame = 3
Query: 1116 GSRGDKGPSGSLLSCPGRKGEKGFFGIPG--IKGDIGNKGYQGHDGDIGEIGFKGEKGYEGPLGPSCSEVEQGFRGTKGESGFPGLRGAKGQRGYSGNKGIKGKPNFGTGINNPGETGSYGNLGVPGEKGNKGFIGDTGEKGFSGT-GKQGPEGPRGDKGDDGVNGQVGMIG---------MPGIKGDKGSTYPIC----PFCEKGYKGIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEGRMGLLGSKGRQGYKGGKGFSGSMGDAG--EIGYVTISGTT----------IPGVKGEKGNQGPKGNKGEFGEAGSRGRKGYSGLKGFKGLIGERGTSFSSGDPGDKGLRGENGKDGVS-------------FAGIPGEKGLKGDKGNRGILGDVGSLSNCATRPITSKGFKGPQGAKGTSGSPGSAGKTGIVGNKGENGYPGKRGIDGDNGIPGSKGEEGETGIKGHAGRPGNLGKSGLQGLRGEYGVKGDLGIQGIPGRKGVMGDPGPNGYAMI-GSKGDKGIKGLPGIYGAKGDKGRPGYIGIPGFKGETGLIGRSGLKGDQGEIGEKGIKGFTFISNNPGDRGLLGNKGLKGFPGELGNKGQVGVCTVRGDQGLRGYSGLIGDMGMKGEQGSKGIVGDYGAASRSGIMGRTGKIGNQGLPGDQXXXXXXXXXXXXXXXXYIGIPGFEGDRG--------EKGNKGFPGFPGDIGQPGRLGNPGISTEGVXXXXXXXXXXXXXXXXXXXXXXXXXXKQGDSGISIPGRQGIKGEDGTIGLPGEMGEPGPRGDFGQKGNIGITGEFGLQGNRGDDGLKGDDG---IPGLNGPRGFIGDIGFVGFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXELGLDGSMGGKGDNGPRGFNGPTGIPGSKGFEGDKGIRGDIGVKGFQGQHGEIGFPGLK---GVSGENGRQXXXXXXXXXXXXXXXXVCMQPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEVGESIRGLQGRKGSTGLRGNIGIPGERGDKGIPGLQGKVGNKGVKGDIGDKGFSGNIGDKGYSGISGDKGSFGVKGDKGFQGDVGMLGKSG------LQGDRGQKGIIGFRGTRGIPGSMGLPGEIGEKGDVGPSG---------------------------IGVKGLKGYQNAVGIKGRKGEKGLP------------------GFPGRPGKVGDQGDKGPKGMKNMNTXXXXXXXXXXXXXXXXXXXXXXXXXLPGDMGEIGPNGPIGYADNGFLYATHSQSKDFPPCHGGGSPLYNGYSLLAIHGDIDSVTMDLGTPGSCLKNFSTIPFVNCFLERNTFYGGRCHVNMRNSRSYWLSTLQSYMSSPQPPSKMDDYISRCSVCQTKTTVMAFHSQKSDWQMTKCPYGWQKLWAGFSFPMAVQASRSGSNQPFSSPGSCLKHFRSLPFIECNNHNSNCNHWRDGVSYYMTAVDSENQFVKAQGKVLKSQTDIMNSISKCVVCQRDMN 5351
            G+ G  GPSG +   PG KGE G+ G PG  I G  G  G  G DG  G  G  G  G  GP G S +          G  G PG RGA G  GY G  G+ G P         G+ G   +   PG KG KG  G +G+ G  G  G  G  GP GD GDDG+ G  G  G          PG+ G KG    +     P    G KG  G  G+ G +G  G +G  G  G  G PG++G  GL G  G+ G  G  G  G+ G+AG  + G     G             PG++G  G   P+ N+      G  G  G  G KG  G  G  G     G PG  G++G++G  G               F G+PG  G+ G KG+                 + + G  G  G KG  G        G+ G  G  G+PG +G  G  G+PG+ G EG+ G  G  G  G  G  GL G  G  G KGD G+ G+PGR+G  G PG +G   + G KG+ G+ GLPG+ G KGD G PG  G PG  G  G     G+KG+ G  G  G KG   +   PG  G  G  G+ G PG  G KG  G+  + G  GL G  G+ GD G  G  G KG   + G A+R G  G  G  G  GL G QG  G              G+PGF+G+ G        + G KG PG PG  G+ G  G+PG   +G+ G PG                      +G+SG   PG+ G+ G DG  G+PG+      +GD GQ G  G++G  GL G  G  G++GD G   +PG+ G RG                                                  +DG  G KG+NG  G  G  G+ G KGF G  G  G  G  G+ GQ G  G PGLK   G  G+ G++G  GL G  G  G  G+  QP     G  G  G  G +G                  +   GL G+KG +GL G  G PG +G+ G+PG        G KGD+G  G  G  G+ G  G+ G  G  G+ G KG  G  G+ G+ G      L+G+ G  G  G +G  G PG+ G+PG  GEKGD G  G                            G KGL G   A G++G KG  GL                   G+PG PG  G++G  G  G   ++    G       G                            Y D GF+   HSQ+ + P C  G + L++GYSLL I G+  S   DLG  GSCL+ FST+PF+ C           C+   RN +SYWLST ++    P    +++ YISRC+VC+     +A HSQ    Q+  CP GW  LW G+SF M   A   G  Q  SSPGSCL+ FR+ PFIECN    +C+++ +  S+++T +D++++F   + + LKS  ++   +S+C VC +  +
Sbjct:  429 GAPGVSGPSG-IPGLPGPKGEPGYRGTPGQSIPGLPGKDGKPGLDGAPGRKGENGLPGVRGPPGDSLN----------GLPGAPGQRGAPGPNGYDGRDGVNGLPGA---PGTKGDRGGTCSACAPGTKGEKGLPGYSGQPGPQGDRGLPGMPGPVGDAGDDGLPGPAGRPGSPGPPGQDGFPGLPGQKGEPTQLTLRPGPPGYPGLKGENGFPGQPGVDGLPGPSGPVGPPGAPGYPGEKGDAGLPGLSGKPGQDGLPGLPGNKGEAGYGQPGQPGFPGAKGDGGLPGLPGTPGLQGMPGEPAPE-NQVNPAPPGQPGLPGLPGTKGEGGYPGRPGEVGQPGFPGLPGMKGDSGLPGPPGLPGHPGVPGDKGFGGVPGLPGIPGPKGD-----------------VGNPGLPGLNGQKGEPG-------VGVPGQPGSPGFPGLKGDAGLPGLPGTPGLEGQRGFPGAPGLKGGDGLPGLSGQPGYPGEKGDAGLPGVPGREGSPGFPGQDGLPGVPGMKGEDGLPGLPGVTGLKGDLGAPGQSGAPGLPGAPGY---PGMKGNAGIPGVPGFKGDGGLPGLPGLNGPKGEPGVPGMPGTPGMKGNGGLPGLPGRDGLSGVPGMKGDRGFNGLPGEKG---EAGPAARDGQKGDAGLPGQPGLRGPQGPSG------------LPGVPGFKGETGLPGYGQPGQPGEKGLPGIPGKAGRQGAPGSPG--QDGLPGFPG---------------------MKGESGY--PGQDGLPGRDGLPGVPGQ------KGDLGQSGQPGLSGAPGLDGQPGVPGIRGDKGQGGLPGIPGDRG--------------------------------------------------MDGYPGQKGENGYPGQPGLPGLGGEKGFAGTPGFPGLKGSPGYPGQDGLPGIPGLKGDSGFPGQPGQEGLPGLSGEKGMGGLPGMPGQPGQSIAGPVGPPGAPGLQGK-----------------DGFPGLPGQKGESGLSGLPGAPGLKGESGMPGF------PGAKGDLGANGIPGKRGEDGLPGVPGRDGQPGIPGLKGEVGGAGLPGQPGFPGIPGLKGEGGLPGFPGAKGEAGFPGTPGVPGYAGEKGDGGLPGLPGRDGLPGADGPVGPPGPSGPQNLVEPGEKGLPGLPGAPGLRGEKGMPGLDGPPGNDGPPGLPGQRGNDGYPGAPGLSGEKGMGGLPGFPGLDGQPGGPGAPGLPGAPGAAGPA--------------------YRD-GFVLVKHSQTTEVPRCPEGQTKLWDGYSLLYIEGNEKSHNQDLGHAGSCLQRFSTMPFLFCDFNN------VCNYASRNDKSYWLSTSEAIPMMPVNEREIEPYISRCAVCEAPANTIAVHSQT--IQIPNCPAGWSSLWIGYSFAMHTGAGAEGGGQSLSSPGSCLEDFRATPFIECNGARGSCHYFANKFSFWLTTIDNDSEFKVPESQTLKS-GNLRTRVSRCQVCVKSTD 1756          

HSP 2 Score: 253.832 bits (647), Expect = 1.409e-67
Identity = 415/1184 (35.05%), Postives = 513/1184 (43.33%), Query Frame = 3
Query:  246 GVSGDKGDVGQFGMPGPKGYKGFTGAIGPQ--GRKGERGIPGSPGYPGKMGEMGFPGIRGDIGEKGLTGCDGQQGDFGNPGMNGLVGR---TGQPGERGDDGDRGLSIIPKYGLKGNKGSRGLLGRYGRKGEKGFKGIKGYSGIFGIKGNKGYVGPM---------------GRRGPKGDSLGTVIIQSEKGSKGDKGLKGQSGIP-------------------------CKGFQIEGRMYGRVGSDGPIGDKGIKGEKGLMGEIGQSGIDGARG---------LNGEKGLPGEAGPRGE--RGDRGNPGFPGDPGASGADGTRGRQGERGPKGVHGISGA--DGPRGSRGDKGPSGSLLSCPGRKGEKGFFGIPGIKGDIGNKGYQGHDGDIGE--IGFKGEKGYEGPLGPSCSEVEQGFRGTKGESGFPGLRGA---KGQRGYSGNKGIKG---KPNFGTGINNPGETGSYGNLGVPGEKGNKGFIGDTGEKGFSGT----GKQGPEGPRGDKGDDGVNGQVGMIGMPGIKGDKGSTYPICPFCEKGYKGIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEGRMGLLGSKGRQGYKGGKGFSGSMGDAGEIGYVTISGTTIPGVKGEKGNQGPKGNKGEFGEAGSRGRKGYSGLKGFKGLIGERGTSFSSGDPGDKGLRGENGKDGVSFAGIPGEKGLKGDKGNRGILGDVGSLSNCATRPITSKGFKGPQGAKGTSGSPGSAGKTGIVGNKGENGYPGKRGI---DGDNGIPGSKGEEGETGIKGHAGRPGNLGKSGLQGLRGEYGVKGDLGIQGIPGRKGVMGDPG---PNGYAMIG-------SKGDKGIKGLPGIYGAKGDKGRPGYIGIPGFKGETGLIGRSGLKGDQGEIGEKGIKGFTFISNNPGDR--------GLLGNKGLKGFPGELGNKGQVGVCTVRGDQGLRGYSGLIGDMGMKGEQGSKGIVGDYGAASRSGIMGRTGKIGNQGLPGDQXXXXXXXXXXXXXXXXYIGIPGFEGDRGEKGNKGFPGFPGDIGQPGRLGNPGIS---------TEGVXXXXXXXXXXXXXXXXXXXXXXXXXXKQGDSGIS-IPGRQGIKGEDGTI------------GLPGEMGEPGPRGDFGQKGNIGITGEFGLQGNRGDDGLKGDDGIPGLNG 3458
            G  G  G  G  G+PGPKG  G+ G  G    G  G+ G PG  G PG+ GE G PG+RG  G+  L G  G  G  G PG NG  GR    G PG  G  GDRG +        G KG +GL G  G+ G +G +G+ G  G  G  G+ G  GP                G  G KG+     +     G  G  GLKG++G P                          KG      + G+ G DG  G  G KGE G  G+ GQ G  GA+G           G +G+PGE  P  +      G PG PG PG  G  G  GR GE G  G  G+ G   D              +    G  G  G  GIPG KGD+GN G  G +G  GE  +G  G+ G              GF G KG++G PGL G    +GQRG+ G  G+KG    P        PGE G  G  GVPG +G+ GF G  G  G  G     G  G  G  G KGD G  GQ G  G+PG  G  G          KG  GI G  G +G+ G  G+ GL G          +G  G+ G  G  G KG  G  G  G  G  G        +PG+KG++G  G  G KGE G A   G+KG +GL G  GL   RG    SG PG  G +GE G  G    G PGEKGL G  G                            G +G  GSPG  G  G  G KGE+GYPG+ G+   DG  G+PG KG+ G++G  G +G PG  G+ G+ G+RG+   KG  G+ GIPG +G+ G PG    NGY            KG  G  G PG+ G+ G  G+ G  GIPG KG++G  G+ G +G  G  GEKG+ G   +   PG          G  G +G  GFPG  G KG+ G+  + G  GL+G SG+ G  G KG+ G+ GI G  G     G+ GR G+ G  GL G+             G  G  G PGF G  G KG  G PGFPG  G+ G  G PG+              +              P  P       + G+ G+  +PG  G++GE G                          G  GQ+GN G  G  GL G +G  GL    G PGL+G
Sbjct:  429 GAPGVSGPSGIPGLPGPKGEPGYRGTPGQSIPGLPGKDGKPGLDGAPGRKGENGLPGVRGPPGDS-LNGLPGAPGQRGAPGPNGYDGRDGVNGLPGAPGTKGDRGGTC--SACAPGTKGEKGLPGYSGQPGPQGDRGLPGMPGPVGDAGDDGLPGPAGRPGSPGPPGQDGFPGLPGQKGEPTQLTL---RPGPPGYPGLKGENGFPGQPGVDGLPGPSGPVGPPGAPGYPGEKGDAGLPGLSGKPGQDGLPGLPGNKGEAG-YGQPGQPGFPGAKGDGGLPGLPGTPGLQGMPGEPAPENQVNPAPPGQPGLPGLPGTKGEGGYPGRPGEVGQPGFPGLPGMKGDSGLPGPPGLPGHPGVPGDKGFGGVPGLPGIPGPKGDVGNPGLPGLNGQKGEPGVGVPGQPG------------SPGFPGLKGDAGLPGLPGTPGLEGQRGFPGAPGLKGGDGLPGLSGQPGYPGEKGDAGLPGVPGREGSPGFPGQDGLPGVPGMKGEDGLPGLPGVTGLKGDLGAPGQSGAPGLPGAPGYPGM---------KGNAGIPGVPGFKGDGGLPGLPGLNG---------PKGEPGVPGMPGTPGMKGNGGLPGLPGRDGLSG--------VPGMKGDRGFNGLPGEKGEAGPAARDGQKGDAGLPGQPGL---RGPQGPSGLPGVPGFKGETGLPGYGQPGQPGEKGLPGIPGK--------------------------AGRQGAPGSPGQDGLPGFPGMKGESGYPGQDGLPGRDGLPGVPGQKGDLGQSGQPGLSGAPGLDGQPGVPGIRGD---KGQGGLPGIPGDRGMDGYPGQKGENGYPGQPGLPGLGGEKGFAGTPGFPGLKGSPGYPGQDGLPGIPGLKGDSGFPGQPGQEGLPGLSGEKGMGGLPGMPGQPGQSIAGPVGPPGAPGLQGKDGFPGLPGQKGESGLSGLPGAPGLKGESGMPGFPGAKGDLGANGIPGKRGEDGLPGVPGRDGQPGIPGLKGE------------VGGAGLPGQPGFPGIPGLKGEGGLPGFPGAKGEAGFPGTPGVPGYAGEKGDGGLPGLPGRDGLPGADGPVGPPGPSGPQNLVEPGEKGLPGLPGAPGLRGEKGMPGLDGPPGNDGPP------------GLPGQRGNDGYPGAPGLSGEKGMGGLP---GFPGLDG 1508          

HSP 3 Score: 218.394 bits (555), Expect = 1.085e-56
Identity = 384/1106 (34.72%), Postives = 466/1106 (42.13%), Query Frame = 3
Query:  471 GNPGMNGLVGRTGQPGERGDDGDRGLSIIPKYGLKGNKGSRGLLGRYGRKGEKGFKGIKGYSGIFGIKGNKGYVGPMGRRGPKGDSLGTVIIQSEKGSKGDKGLKGQSGIPCKGFQIEGRMYGRVGSDGPIGDKGIKGEKGLMGEIGQSGIDGARGLNGEKGLPGEAGPRGERGDRGNPGFPGDPGASGADGTRGRQGERGPKGVHGISGADGPRGSRGDK-------GPSGSLLSCPGRKGEKGFFGIPGI---------------------KGDIGNKGYQGHDGDIGEIGFKGEKGYEGPLGPSCSEVEQGFRGTKGESGFPGLRGAKGQRGYSGNKGIKGKPNFGTGIN--NPGETGSYGNLGVPGEKGNKGFIGDTGEKGFSGTGKQGPEGPRGDKG---------------DDGVNGQVGMIGMPGIKGDKGSTYPICPFC--EKGYKGIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEGRMGLLGSKGRQGYKGGKGFSGSMGDAGEIGYVTISGTTIPGVKGEKGNQGPKGNKGEFGEAGSRGRKGYSGLKGFKGLIGERGTSFSSGDPGDKGLRGENGKDGVSFA-GIPGEKGLKGDKGNRGILGDVG----SLSNCATRPITSKGFKGPQGAKGTSGSPGSAGKTGIVGNKGENGYPGKRGIDGDNGIPGSKGEEGETGIKGHAGRPGNLGKSGLQGLRGEYGVKGDLGIQGIPGRKGVMGDPGPNGYAMIGSKGDKGIKGLPGIYGAKGDKGRPGYIGIPGF---KGETGLIGRSGLKGDQGEIGEKGIKGFTFISNNPGDRGLLGNKGLKGFPGELGNKGQVGVCTVRGDQGLRGYSG---------------------LIGDMGMKGEQGSKGIVGDYGAASRSGIMGRTG---KIGNQGLPG-----------------DQXXXXXXXXXXXXXXXXYIGIPGFEGDRGEKGNKGFPGFPGDIGQPGRLGNPGISTEGVXXXXXXXXXXXXXXXXXXXXXXXXXXKQGDSGIS-IPGRQGIKGEDGTIGLPGEMGEPGPRGDFGQKGNIGITGEFGLQGNRGDDGLKGDDGIPGLNGPRGFIGDIGFVGF 3497
            G PG++G  G  G PG +G+ G RG       GL G  G  GL G  GRKGE G  G+                     RGP GDSL            G  G  GQ G P           G  G DG  G  G+ G  G  G+ G +    A G  GEKGLPG +G  G +GDRG PG PG  G +G DG  G  G  G  G  G  G  G  G +G+        GP G     PG KGE GF G PG+                     KGD G  G  G  G  G  G  G KG            E G+ G  G+ GFPG +G  G  G  G  G++G P      N  NP   G  G  G+PG KG  G+ G  GE G  G    G  G +GD G               D G  G  G+ G+PG KGD G+  P  P    +KG  G+                G+ G  G+ G PG +G  GL G  G  G +G +GF G+ G  G        G  +PG+ G+ G  G KG+ G  G  G  G  G+ G  G  G+ G +G     G PG  GL+G+ G  G S A G+PG  G  G KGN GI G  G                KG  G  G  GT G  G+ G  G+ G  G +G PG +G  G NG+PG KGE G       A R G  G +GL G  G  G +G  G+ G+PG KG  G PG   Y   G  G+KG+ G+PG  G +G  G PG  G+PGF   KGE+G  G+ GL G  G  G  G KG    S  PG  G  G  G  G PG  G+KGQ G+  + GD+G+ GY G                       G  G  G +GS G  G  G     G+ G +G   + G +GLPG                  Q   G  G  G  G +G  G PG  G +GE G  G PG PG  G+ G  G PG                                 +GD G + IPG+   +GEDG  G+PG  G+PG  G  G+ G  G+ G+ G  G  G  G  G  G PG  G  GF G  G  G+
Sbjct:  429 GAPGVSGPSGIPGLPGPKGEPGYRGTPGQSIPGLPGKDGKPGLDGAPGRKGENGLPGV---------------------RGPPGDSL-----------NGLPGAPGQRGAP-----------GPNGYDGRDGVNGLPGAPGTKGDRGGTCSACAPGTKGEKGLPGYSGQPGPQGDRGLPGMPGPVGDAGDDGLPGPAGRPGSPGPPGQDGFPGLPGQKGEPTQLTLRPGPPGY----PGLKGENGFPGQPGVDGLPGPSGPVGPPGAPGYPGEKGDAGLPGLSGKPGQDGLPGLPGNKG------------EAGY-GQPGQPGFPGAKGDGGLPGLPGTPGLQGMPGEPAPENQVNPAPPGQPGLPGLPGTKGEGGYPGRPGEVGQPGF--PGLPGMKGDSGLPGPPGLPGHPGVPGDKGFGGVPGLPGIPGPKGDVGN--PGLPGLNGQKGEPGV----------------GVPGQPGSPGFPGLKGDAGLPGLPGTPGLEGQRGFPGAPGLKG--------GDGLPGLSGQPGYPGEKGDAGLPGVPGREGSPGFPGQDGLPGVPGMKGEDGLPGLPGVTGLKGDLGAPGQSGAPGLPGAPGYPGMKGNAGIPGVPGFKGDGGLPGLPGLNGPKGEPGVPGMPGTPGMKGNGGLPGLPGRDGLSGVPGMKGDRGFNGLPGEKGEAGP------AARDGQKGDAGLPGQPGLRGPQGPSGLPGVPGFKGETGLPG---YGQPGQPGEKGLPGIPGKAGRQGAPGSPGQDGLPGFPGMKGESGYPGQDGLPGRDGLPGVPGQKGDLGQSGQPGLSGAPGLDGQPGVPGIRGDKGQGGLPGIPGDRGMDGYPGQKGENGYPGQPGLPGLGGEKGFAGTPGFPGLKGSPGYPGQDGLPGIPGLKGDSGFPGQPGQEGLPGLSGEKGMGGLPGMPGQPGQSIAGPVGPPGAPGLQGKDGFPGLPGQKGESGLSGLPGAPGLKGESGMPGFPGA--------------------------------KGDLGANGIPGK---RGEDGLPGVPGRDGQPGIPGLKGEVGGAGLPGQPGFPGIPGLKGEGGLPGFPGAKGEAGFPGTPGVPGY 1402          

HSP 4 Score: 213.772 bits (543), Expect = 3.153e-55
Identity = 386/1120 (34.46%), Postives = 471/1120 (42.05%), Query Frame = 3
Query:  201 GNKGRQGFPGPRGYQGVSGDKGDVGQFGMPGPKGYKGFTGAIGPQGRKGERGIPGSPGYPGKMGEMGFPGIRGDIGEKG---------------------LTGCDGQQGDF----------GNPGMNGLVGRTGQPG---------------------ERGDDGDRGLSIIP----KYGLKGNKGSRGLLGRYGRKGEKGFKGIKGYSGIFGIKGNKGYVGPMGRRGPKGDSLGTVIIQSEKGSKGDKGLKGQSGIPCKGFQIEGRMYGRVGSDGPIGDKGIKGE------------------KGLMGEIGQSGIDGARGLNGEKGLPGEAGPRGERG-----DRGNPGFPG---DPGASGADGTRGRQGERGPKGVHGISGADGPRGSRGDKGPSGSLLSCPGRKGEKGFFGIPGIKGDIGNKGYQGHDGDIGEIGFKGEKGYEGPLGPSCSEVEQGFRGTKGESGFPGLRGAKGQRGYSGNKGIKGKPNF------------GTGINNPGETGSYGNLG------------------VPGEKGNKGFIGDTGEKGFSGTGKQGPEGPRGDKGDDGVNGQVGM------IGMPGIKGDKGST------YPICPFCEKGYKGIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEGRMGLLGSKGRQGYKGGKGFSGSMGDAGEIGYVTISGTTIPGVKGEKGNQGPKGNKGEFGEAGSRGRKGYSGLKGFKGLIGERGTSFSSGDPGDKGLRGENGKDGVS----------FAGIPGEKGLKGDKGNRGILGDVGSLSNCATRPITSKGFKGPQGAKGTSGSPGSAGKTGIVGNKGENG---------YPGKR-----------GIDGDNGIPGSKGEEGETGIKGHAGRPGNLGKSGLQGLRGEYGVKGDLGIQGIPGRKGVMGDPGPNGYAMIGSKGDKGIKGLPGIYGAKGDKGRPGYIGIPGFKGETGLIGRSGLKGDQGEIGEKGIKGFTFISNNPGDRGLLGNKGLKGFPGELGNKGQVGVCTVRGDQGLRGYSGLIGDMGMKGEQGSKGIVGDYGAASRSGIMGRTGKIGNQGLPGDQXXXXXXXXXXXXXXXXYIGIPGFEGDRGEKGNKGF 3098
            G  G++G PGP GY G  G  G     G PG KG +G T +    G KGE+G+PG  G PG  G+ G PG+ G +G+ G                       G  GQ+G+           G PG+ G  G  GQPG                     E+GD G  GLS  P      GL GNKG  G    YG+ G+ GF G KG  G+ G+ G  G  G  G   P+           + G  G  G KG+ G P +         G VG  G  G  G+KG+                  KG  G  G  GI G +G  G  GLPG  G +GE G       G+PGFPG   D G  G  GT G +G+RG  G  G+ G DG  G  G           PG  GEKG  G+PG+ G  G+ G+ G DG  G  G KGE G  G   P  + + +G  G  G+SG PGL GA G  G  GN GI G P F                  PG  G  G  G                  VPG KG++GF G  GEKG     + GP    G KGD G+ GQ G+       G+PG+ G KG T       P  P  EKG  GI G                             GR G  GS G+ G  G  G  G  G  G+ G     G  +PGV G+KG+ G  G  G  G  G  G+ G  G++G KG  G  G     G  G  G +GENG  G            FAG PG  GLKG  G  G                   G  G  G KG SG PG  G+ G+ G  GE G          PG+            G+ G +G PG  G++GE+G+ G  G PG  G+SG+ G  G    KGDLG  GIPG++G  G PG     + G  G  GI GL G  G  G  G+PG+ GIPG KGE GL G  G KG+ G  G  G+ G+     + G  GL G  GL G  G +G  G  G   +  + G +G  GL G  G++GE+G  G+ G  G     G+ G+ G  G  G PG           G KG  G  G PG +G  G  G  G 
Sbjct:  499 GAPGQRGAPGPNGYDGRDGVNG---LPGAPGTKGDRGGTCSACAPGTKGEKGLPGYSGQPGPQGDRGLPGMPGPVGDAGDDGLPGPAGRPGSPGPPGQDGFPGLPGQKGEPTQLTLRPGPPGYPGLKGENGFPGQPGVDGLPGPSGPVGPPGAPGYPGEKGDAGLPGLSGKPGQDGLPGLPGNKGEAG----YGQPGQPGFPGAKGDGGLPGLPGTPGLQGMPGEPAPENQV--NPAPPGQPGLPGLPGTKGEGGYPGR--------PGEVGQPGFPGLPGMKGDSGLPGPPGLPGHPGVPGDKGFGGVPGLPGIPGPKGDVGNPGLPGLNGQKGEPGVGVPGQPGSPGFPGLKGDAGLPGLPGTPGLEGQRGFPGAPGLKGGDGLPGLSGQ----------PGYPGEKGDAGLPGVPGREGSPGFPGQDGLPGVPGMKGEDGLPG--LPGVTGL-KGDLGAPGQSGAPGLPGAPGYPGMKGNAGIPGVPGFKGDGGLPGLPGLNGPKGEPGVPGMPGTPGMKGNGGLPGLPGRDGLSGVPGMKGDRGFNGLPGEKG-----EAGPAARDGQKGDAGLPGQPGLRGPQGPSGLPGVPGFKGETGLPGYGQPGQP-GEKGLPGIPG---------------------------KAGRQGAPGSPGQDGLPGFPGMKGESGYPGQDGLPGRDG--LPGVPGQKGDLGQSGQPGLSGAPGLDGQPGVPGIRGDKGQGGLPGIPGDRGMDGYPGQKGENGYPGQPGLPGLGGEKGFAGTPGFPGLKGSPGYPG-----------------QDGLPGIPGLKGDSGFPGQPGQEGLPGLSGEKGMGGLPGMPGQPGQSIAGPVGPPGAPGLQGKDGFPGLPGQKGESGLSGLPGAPGLKGESGMPGFPG---AKGDLGANGIPGKRGEDGLPG-----VPGRDGQPGIPGLKGEVGGAGLPGQPGFPGIPGLKGEGGLPGFPGAKGEAGFPGTPGVPGYAGEKGDGGLPGLPGRDGLPGADGPVGPPGPSGPQNLV-EPGEKGLPGLPGAPGLRGEKGMPGLDGPPGNDGPPGLPGQRGNDGYPGAPG---------LSGEKGMGGLPGFPGLDGQPGGPGAPGL 1518          

HSP 5 Score: 120.168 bits (300), Expect = 1.141e-26
Identity = 200/597 (33.50%), Postives = 254/597 (42.55%), Query Frame = 3
Query: 2253 TSGSPGSAGKTGIVGNKGENGYPGKRGIDGDNGIPGSKGEEGETGIKGHAGRPGNLGKSGLQGLRGEYGVKGDLGIQGIPGRKGVMGDPGPNGYAMIGSKGDKGIKGLPGIYGAKGDKGRPGYIGIPGFKGETGLIGRSGLKGDQGEIGEKGIKGF-------------------------------------TFISNNPGDRGLLGNKGLKGFPGELG------------NKGQVGVCTVRGDQGLRGYSGLIGDMGMKGEQGSKGIVGDYGAASRSGIMGRTG---------KIGNQGLPGDQXXXXXXXXXXXXXXXXYIGIPGFEGDRGEKGNKGFPGFPGDIGQPGRLGNPGIS-------------------TEGVXXXXXXXXXXXXXXXXXXXXXXXXXXKQGDSGISIPGRQGIKGEDGTIGLPGEMGEPGPRGDFGQKGNIGITGEFGLQGNRGDDGLKGDDGIPGLNGPRGFIGDIGFVGFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXELGLDGSMGGKGDNGPRGFNGPTGIPGSKGFEGDKGIRGDIGVKGFQGQHGEIGFPGLKGVSGENGRQ 3812
              G+PG +G +GI G  G  G PG RG  G + IPG  G++G+ G+ G  GR    G++GL G+RG  G      + G+PG  G  G PGPNGY      G  G+ GLPG  G KGD+G       PG KGE GL G SG  G QG+ G  G+ G                                      T ++  PG  G  G KG  GFPG+ G              G  G    +GD GL G SG  G  G+ G  G+KG  G YG   + G  G  G           G QG+PG+                   G PG  G  G KG  G+PG PG++GQPG  G PG+                     +G  G PGL G+PGP G+ G PGL G  G++G+ G+ +PG+            PG  G PG +GD G  G  G  G  G +G  G  GLKG DG+PGL+G  G+ G+ G                                         + GL G  G +G  G  G +G  G+PG KG +G  G+ G  G+KG  G  G+ G PGL G  G  G +
Sbjct:  427 IPGAPGVSGPSGIPGLPGPKGEPGYRGTPGQS-IPGLPGKDGKPGLDGAPGR---KGENGLPGVRGPPGDS----LNGLPGAPGQRGAPGPNGY-----DGRDGVNGLPGAPGTKGDRGGTCSACAPGTKGEKGLPGYSGQPGPQGDRGLPGMPGPVGDAGDDGLPGPAGRPGSPGPPGQDGFPGLPGQKGEPTQLTLRPGPPGYPGLKGENGFPGQPGVDGLPGPSGPVGPPGAPGYPGEKGDAGLPGLSGKPGQDGLPGLPGNKGEAG-YGQPGQPGFPGAKGDGGLPGLPGTPGLQGMPGEPAPENQVNPAPP-------GQPGLPGLPGTKGEGGYPGRPGEVGQPGFPGLPGMKGDSGLPGPPGLPGHPGVPGDKGFGGVPGLPGIPGPKGDVGNPGLPGLNGQKGEPGVGVPGQ------------PGSPGFPGLKGDAGLPGLPGTPGLEGQRGFPGAPGLKGGDGLPGLSGQPGYPGEKG-----------------------------------------DAGLPGVPGREGSPGFPGQDGLPGVPGMKGEDGLPGLPGVTGLKGDLGAPGQSGAPGLPGAPGYPGMK 949          
BLAST of Collagen IV NC1 domain-containing protein vs. Ensembl Celegans
Match: let-2 (Collagen alpha-2(IV) chain [Source:UniProtKB/Swiss-Prot;Acc:P17140])

HSP 1 Score: 406.757 bits (1044), Expect = 9.882e-116
Identity = 510/1519 (33.57%), Postives = 666/1519 (43.84%), Query Frame = 3
Query: 1116 GSRGDKGPSGSLLSCPGRKGEKGFFGIPG--IKGDIGNKGYQGHDGDIGEIGFKGEKGYEGPLGPSCSEVEQGFRGTKGESGFPGLRGAKGQRGYSGNKGIKGKPNFGTGINNPGETGSYGNLGVPGEKGNKGFIGDTGEKGFSGT-GKQGPEGPRGDKGDDGVNGQVGMIG---------MPGIKGDKGSTYPIC----PFCEKGYKGIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEGRMGLLGSKGRQGYKGGKGFSGSMGDAG--EIGYVTISGTT----------IPGVKGEKGNQGPKGNKGEFGEAGSRGRKGYSGLKGFKGLIGERGTSFSSGDPGDKGLRGENGKDGVS-------------FAGIPGEKGLKGDKGNRGILGDVGSLSNCATRPITSKGFKGPQGAKGTSGSPGSAGKTGIVGNKGENGYPGKRGIDGDNGIPGSKGEEGETGIKGHAGRPGNLGKSGLQGLRGEYGVKGDLGIQGIPGRKGVMGDPGPNGYAMI-GSKGDKGIKGLPGIYGAKGDKGRPGYIGIPGFKGETGLIGRSGLKGDQGEIGEKGIKGFTFISNNPGDRGLLGNKGLKGFPGELGNKGQVGVCTVRGDQGLRGYSGLIGDMGMKGEQGSKGIVGDYGAASRSGIMGRTGKIGNQGLPGDQXXXXXXXXXXXXXXXXYIGIPGFEGDRG--------EKGNKGFPGFPGDIGQPGRLGNPGISTEGVXXXXXXXXXXXXXXXXXXXXXXXXXXKQGDSGISIPGRQGIKGEDGTIGLPGEMGEPGPRGDFGQKGNIGITGEFGLQGNRGDDGLKGDDG---IPGLNGPRGFIGDIGFVGFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXELGLDGSMGGKGDNGPRGFNGPTGIPGSKGFEGDKGIRGDIGVKGFQGQHGEIGFPGLK---GVSGENGRQXXXXXXXXXXXXXXXXVCMQPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEVGESIRGLQGRKGSTGLRGNIGIPGERGDKGIPGLQGKVGNKGVKGDIGDKGFSGNIGDKGYSGISGDKGSFGVKGDKGFQGDVGMLGKSG------LQGDRGQKGIIGFRGTRGIPGSMGLPGEIGEKGDVGPSG---------------------------IGVKGLKGYQNAVGIKGRKGEKGLP------------------GFPGRPGKVGDQGDKGPKGMKNMNTXXXXXXXXXXXXXXXXXXXXXXXXXLPGDMGEIGPNGPIGYADNGFLYATHSQSKDFPPCHGGGSPLYNGYSLLAIHGDIDSVTMDLGTPGSCLKNFSTIPFVNCFLERNTFYGGRCHVNMRNSRSYWLSTLQSYMSSPQPPSKMDDYISRCSVCQTKTTVMAFHSQKSDWQMTKCPYGWQKLWAGFSFPMAVQASRSGSNQPFSSPGSCLKHFRSLPFIECNNHNSNCNHWRDGVSYYMTAVDSENQFVKAQGKVLKSQTDIMNSISKCVVCQRDMN 5351
            G+ G  GPSG +   PG KGE G+ G PG  I G  G  G  G DG  G  G  G  G  GP G S +          G  G PG RGA G  GY G  G+ G P         G+ G   +   PG KG KG  G +G+ G  G  G  G  GP GD GDDG+ G  G  G          PG+ G KG    +     P    G KG  G  G+ G +G  G +G  G  G  G PG++G  GL G  G+ G  G  G  G+ G+AG  + G     G             PG++G  G   P+ N+      G  G  G  G KG  G  G  G     G PG  G++G++G  G               F G+PG  G+ G KG+                 + + G  G  G KG  G        G+ G  G  G+PG +G  G  G+PG+ G EG+ G  G  G  G  G  GL G  G  G KGD G+ G+PGR+G  G PG +G   + G KG+ G+ GLPG+ G KGD G PG  G PG  G  G     G+KG+ G  G  G KG   +   PG  G  G  G+ G PG  G KG  G+  + G  GL G  G+ GD G  G  G KG   + G A+R G  G  G  G  GL G QG  G              G+PGF+G+ G        + G KG PG PG  G+ G  G+PG   +G+ G PG                      +G+SG   PG+ G+ G DG  G+PG+      +GD GQ G  G++G  GL G  G  G++GD G   +PG+ G RG                                                  +DG  G KG+NG  G  G  G+ G KGF G  G  G  G  G+ GQ G  G PGLK   G  G+ G++G  GL G  G  G  G+  QP     G  G  G  G +G                  +   GL G+KG +GL G  G PG +G+ G+PG        G KGD+G  G  G  G+ G  G+ G  G  G+ G KG  G  G+ G+ G      L+G+ G  G  G +G  G PG+ G+PG  GEKGD G  G                            G KGL G   A G++G KG  GL                   G+PG PG  G++G  G  G   ++    G       G                            Y D GF+   HSQ+ + P C  G + L++GYSLL I G+  S   DLG  GSCL+ FST+PF+ C           C+   RN +SYWLST ++    P    +++ YISRC+VC+     +A HSQ    Q+  CP GW  LW G+SF M   A   G  Q  SSPGSCL+ FR+ PFIECN    +C+++ +  S+++T +D++++F   + + LKS  ++   +S+C VC +  +
Sbjct:  428 GAPGVSGPSG-IPGLPGPKGEPGYRGTPGQSIPGLPGKDGKPGLDGAPGRKGENGLPGVRGPPGDSLN----------GLPGAPGQRGAPGPNGYDGRDGVNGLPGA---PGTKGDRGGTCSACAPGTKGEKGLPGYSGQPGPQGDRGLPGMPGPVGDAGDDGLPGPAGRPGSPGPPGQDGFPGLPGQKGEPTQLTLRPGPPGYPGLKGENGFPGQPGVDGLPGPSGPVGPPGAPGYPGEKGDAGLPGLSGKPGQDGLPGLPGNKGEAGYGQPGQPGFPGAKGDGGLPGLPGTPGLQGMPGEPAPE-NQVNPAPPGQPGLPGLPGTKGEGGYPGRPGEVGQPGFPGLPGMKGDSGLPGPPGLPGHPGVPGDKGFGGVPGLPGIPGPKGD-----------------VGNPGLPGLNGQKGEPG-------VGVPGQPGSPGFPGLKGDAGLPGLPGTPGLEGQRGFPGAPGLKGGDGLPGLSGQPGYPGEKGDAGLPGVPGREGSPGFPGQDGLPGVPGMKGEDGLPGLPGVTGLKGDLGAPGQSGAPGLPGAPGY---PGMKGNAGIPGVPGFKGDGGLPGLPGLNGPKGEPGVPGMPGTPGMKGNGGLPGLPGRDGLSGVPGMKGDRGFNGLPGEKG---EAGPAARDGQKGDAGLPGQPGLRGPQGPSG------------LPGVPGFKGETGLPGYGQPGQPGEKGLPGIPGKAGRQGAPGSPG--QDGLPGFPG---------------------MKGESGY--PGQDGLPGRDGLPGVPGQ------KGDLGQSGQPGLSGAPGLDGQPGVPGIRGDKGQGGLPGIPGDRG--------------------------------------------------MDGYPGQKGENGYPGQPGLPGLGGEKGFAGTPGFPGLKGSPGYPGQDGLPGIPGLKGDSGFPGQPGQEGLPGLSGEKGMGGLPGMPGQPGQSIAGPVGPPGAPGLQGK-----------------DGFPGLPGQKGESGLSGLPGAPGLKGESGMPGF------PGAKGDLGANGIPGKRGEDGLPGVPGRDGQPGIPGLKGEVGGAGLPGQPGFPGIPGLKGEGGLPGFPGAKGEAGFPGTPGVPGYAGEKGDGGLPGLPGRDGLPGADGPVGPPGPSGPQNLVEPGEKGLPGLPGAPGLRGEKGMPGLDGPPGNDGPPGLPGQRGNDGYPGAPGLSGEKGMGGLPGFPGLDGQPGGPGAPGLPGAPGAAGPA--------------------YRD-GFVLVKHSQTTEVPRCPEGQTKLWDGYSLLYIEGNEKSHNQDLGHAGSCLQRFSTMPFLFCDFNN------VCNYASRNDKSYWLSTSEAIPMMPVNEREIEPYISRCAVCEAPANTIAVHSQT--IQIPNCPAGWSSLWIGYSFAMHTGAGAEGGGQSLSSPGSCLEDFRATPFIECNGARGSCHYFANKFSFWLTTIDNDSEFKVPESQTLKS-GNLRTRVSRCQVCVKSTD 1755          

HSP 2 Score: 251.521 bits (641), Expect = 7.940e-67
Identity = 415/1184 (35.05%), Postives = 513/1184 (43.33%), Query Frame = 3
Query:  246 GVSGDKGDVGQFGMPGPKGYKGFTGAIGPQ--GRKGERGIPGSPGYPGKMGEMGFPGIRGDIGEKGLTGCDGQQGDFGNPGMNGLVGR---TGQPGERGDDGDRGLSIIPKYGLKGNKGSRGLLGRYGRKGEKGFKGIKGYSGIFGIKGNKGYVGPM---------------GRRGPKGDSLGTVIIQSEKGSKGDKGLKGQSGIP-------------------------CKGFQIEGRMYGRVGSDGPIGDKGIKGEKGLMGEIGQSGIDGARG---------LNGEKGLPGEAGPRGE--RGDRGNPGFPGDPGASGADGTRGRQGERGPKGVHGISGA--DGPRGSRGDKGPSGSLLSCPGRKGEKGFFGIPGIKGDIGNKGYQGHDGDIGE--IGFKGEKGYEGPLGPSCSEVEQGFRGTKGESGFPGLRGA---KGQRGYSGNKGIKG---KPNFGTGINNPGETGSYGNLGVPGEKGNKGFIGDTGEKGFSGT----GKQGPEGPRGDKGDDGVNGQVGMIGMPGIKGDKGSTYPICPFCEKGYKGIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEGRMGLLGSKGRQGYKGGKGFSGSMGDAGEIGYVTISGTTIPGVKGEKGNQGPKGNKGEFGEAGSRGRKGYSGLKGFKGLIGERGTSFSSGDPGDKGLRGENGKDGVSFAGIPGEKGLKGDKGNRGILGDVGSLSNCATRPITSKGFKGPQGAKGTSGSPGSAGKTGIVGNKGENGYPGKRGI---DGDNGIPGSKGEEGETGIKGHAGRPGNLGKSGLQGLRGEYGVKGDLGIQGIPGRKGVMGDPG---PNGYAMIG-------SKGDKGIKGLPGIYGAKGDKGRPGYIGIPGFKGETGLIGRSGLKGDQGEIGEKGIKGFTFISNNPGDR--------GLLGNKGLKGFPGELGNKGQVGVCTVRGDQGLRGYSGLIGDMGMKGEQGSKGIVGDYGAASRSGIMGRTGKIGNQGLPGDQXXXXXXXXXXXXXXXXYIGIPGFEGDRGEKGNKGFPGFPGDIGQPGRLGNPGIS---------TEGVXXXXXXXXXXXXXXXXXXXXXXXXXXKQGDSGIS-IPGRQGIKGEDGTI------------GLPGEMGEPGPRGDFGQKGNIGITGEFGLQGNRGDDGLKGDDGIPGLNG 3458
            G  G  G  G  G+PGPKG  G+ G  G    G  G+ G PG  G PG+ GE G PG+RG  G+  L G  G  G  G PG NG  GR    G PG  G  GDRG +        G KG +GL G  G+ G +G +G+ G  G  G  G+ G  GP                G  G KG+     +     G  G  GLKG++G P                          KG      + G+ G DG  G  G KGE G  G+ GQ G  GA+G           G +G+PGE  P  +      G PG PG PG  G  G  GR GE G  G  G+ G   D              +    G  G  G  GIPG KGD+GN G  G +G  GE  +G  G+ G              GF G KG++G PGL G    +GQRG+ G  G+KG    P        PGE G  G  GVPG +G+ GF G  G  G  G     G  G  G  G KGD G  GQ G  G+PG  G  G          KG  GI G  G +G+ G  G+ GL G          +G  G+ G  G  G KG  G  G  G  G  G        +PG+KG++G  G  G KGE G A   G+KG +GL G  GL   RG    SG PG  G +GE G  G    G PGEKGL G  G                            G +G  GSPG  G  G  G KGE+GYPG+ G+   DG  G+PG KG+ G++G  G +G PG  G+ G+ G+RG+   KG  G+ GIPG +G+ G PG    NGY            KG  G  G PG+ G+ G  G+ G  GIPG KG++G  G+ G +G  G  GEKG+ G   +   PG          G  G +G  GFPG  G KG+ G+  + G  GL+G SG+ G  G KG+ G+ GI G  G     G+ GR G+ G  GL G+             G  G  G PGF G  G KG  G PGFPG  G+ G  G PG+              +              P  P       + G+ G+  +PG  G++GE G                          G  GQ+GN G  G  GL G +G  GL    G PGL+G
Sbjct:  428 GAPGVSGPSGIPGLPGPKGEPGYRGTPGQSIPGLPGKDGKPGLDGAPGRKGENGLPGVRGPPGDS-LNGLPGAPGQRGAPGPNGYDGRDGVNGLPGAPGTKGDRGGTC--SACAPGTKGEKGLPGYSGQPGPQGDRGLPGMPGPVGDAGDDGLPGPAGRPGSPGPPGQDGFPGLPGQKGEPTQLTL---RPGPPGYPGLKGENGFPGQPGVDGLPGPSGPVGPPGAPGYPGEKGDAGLPGLSGKPGQDGLPGLPGNKGEAG-YGQPGQPGFPGAKGDGGLPGLPGTPGLQGMPGEPAPENQVNPAPPGQPGLPGLPGTKGEGGYPGRPGEVGQPGFPGLPGMKGDSGLPGPPGLPGHPGVPGDKGFGGVPGLPGIPGPKGDVGNPGLPGLNGQKGEPGVGVPGQPG------------SPGFPGLKGDAGLPGLPGTPGLEGQRGFPGAPGLKGGDGLPGLSGQPGYPGEKGDAGLPGVPGREGSPGFPGQDGLPGVPGMKGEDGLPGLPGVTGLKGDLGAPGQSGAPGLPGAPGYPGM---------KGNAGIPGVPGFKGDGGLPGLPGLNG---------PKGEPGVPGMPGTPGMKGNGGLPGLPGRDGLSG--------VPGMKGDRGFNGLPGEKGEAGPAARDGQKGDAGLPGQPGL---RGPQGPSGLPGVPGFKGETGLPGYGQPGQPGEKGLPGIPGK--------------------------AGRQGAPGSPGQDGLPGFPGMKGESGYPGQDGLPGRDGLPGVPGQKGDLGQSGQPGLSGAPGLDGQPGVPGIRGD---KGQGGLPGIPGDRGMDGYPGQKGENGYPGQPGLPGLGGEKGFAGTPGFPGLKGSPGYPGQDGLPGIPGLKGDSGFPGQPGQEGLPGLSGEKGMGGLPGMPGQPGQSIAGPVGPPGAPGLQGKDGFPGLPGQKGESGLSGLPGAPGLKGESGMPGFPGAKGDLGANGIPGKRGEDGLPGVPGRDGQPGIPGLKGE------------VGGAGLPGQPGFPGIPGLKGEGGLPGFPGAKGEAGFPGTPGVPGYAGEKGDGGLPGLPGRDGLPGADGPVGPPGPSGPQNLVEPGEKGLPGLPGAPGLRGEKGMPGLDGPPGNDGPP------------GLPGQRGNDGYPGAPGLSGEKGMGGLP---GFPGLDG 1507          

HSP 3 Score: 216.083 bits (549), Expect = 5.393e-56
Identity = 384/1106 (34.72%), Postives = 466/1106 (42.13%), Query Frame = 3
Query:  471 GNPGMNGLVGRTGQPGERGDDGDRGLSIIPKYGLKGNKGSRGLLGRYGRKGEKGFKGIKGYSGIFGIKGNKGYVGPMGRRGPKGDSLGTVIIQSEKGSKGDKGLKGQSGIPCKGFQIEGRMYGRVGSDGPIGDKGIKGEKGLMGEIGQSGIDGARGLNGEKGLPGEAGPRGERGDRGNPGFPGDPGASGADGTRGRQGERGPKGVHGISGADGPRGSRGDK-------GPSGSLLSCPGRKGEKGFFGIPGI---------------------KGDIGNKGYQGHDGDIGEIGFKGEKGYEGPLGPSCSEVEQGFRGTKGESGFPGLRGAKGQRGYSGNKGIKGKPNFGTGIN--NPGETGSYGNLGVPGEKGNKGFIGDTGEKGFSGTGKQGPEGPRGDKG---------------DDGVNGQVGMIGMPGIKGDKGSTYPICPFC--EKGYKGIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEGRMGLLGSKGRQGYKGGKGFSGSMGDAGEIGYVTISGTTIPGVKGEKGNQGPKGNKGEFGEAGSRGRKGYSGLKGFKGLIGERGTSFSSGDPGDKGLRGENGKDGVSFA-GIPGEKGLKGDKGNRGILGDVG----SLSNCATRPITSKGFKGPQGAKGTSGSPGSAGKTGIVGNKGENGYPGKRGIDGDNGIPGSKGEEGETGIKGHAGRPGNLGKSGLQGLRGEYGVKGDLGIQGIPGRKGVMGDPGPNGYAMIGSKGDKGIKGLPGIYGAKGDKGRPGYIGIPGF---KGETGLIGRSGLKGDQGEIGEKGIKGFTFISNNPGDRGLLGNKGLKGFPGELGNKGQVGVCTVRGDQGLRGYSG---------------------LIGDMGMKGEQGSKGIVGDYGAASRSGIMGRTG---KIGNQGLPG-----------------DQXXXXXXXXXXXXXXXXYIGIPGFEGDRGEKGNKGFPGFPGDIGQPGRLGNPGISTEGVXXXXXXXXXXXXXXXXXXXXXXXXXXKQGDSGIS-IPGRQGIKGEDGTIGLPGEMGEPGPRGDFGQKGNIGITGEFGLQGNRGDDGLKGDDGIPGLNGPRGFIGDIGFVGF 3497
            G PG++G  G  G PG +G+ G RG       GL G  G  GL G  GRKGE G  G+                     RGP GDSL            G  G  GQ G P           G  G DG  G  G+ G  G  G+ G +    A G  GEKGLPG +G  G +GDRG PG PG  G +G DG  G  G  G  G  G  G  G  G +G+        GP G     PG KGE GF G PG+                     KGD G  G  G  G  G  G  G KG            E G+ G  G+ GFPG +G  G  G  G  G++G P      N  NP   G  G  G+PG KG  G+ G  GE G  G    G  G +GD G               D G  G  G+ G+PG KGD G+  P  P    +KG  G+                G+ G  G+ G PG +G  GL G  G  G +G +GF G+ G  G        G  +PG+ G+ G  G KG+ G  G  G  G  G+ G  G  G+ G +G     G PG  GL+G+ G  G S A G+PG  G  G KGN GI G  G                KG  G  G  GT G  G+ G  G+ G  G +G PG +G  G NG+PG KGE G       A R G  G +GL G  G  G +G  G+ G+PG KG  G PG   Y   G  G+KG+ G+PG  G +G  G PG  G+PGF   KGE+G  G+ GL G  G  G  G KG    S  PG  G  G  G  G PG  G+KGQ G+  + GD+G+ GY G                       G  G  G +GS G  G  G     G+ G +G   + G +GLPG                  Q   G  G  G  G +G  G PG  G +GE G  G PG PG  G+ G  G PG                                 +GD G + IPG+   +GEDG  G+PG  G+PG  G  G+ G  G+ G+ G  G  G  G  G  G PG  G  GF G  G  G+
Sbjct:  428 GAPGVSGPSGIPGLPGPKGEPGYRGTPGQSIPGLPGKDGKPGLDGAPGRKGENGLPGV---------------------RGPPGDSL-----------NGLPGAPGQRGAP-----------GPNGYDGRDGVNGLPGAPGTKGDRGGTCSACAPGTKGEKGLPGYSGQPGPQGDRGLPGMPGPVGDAGDDGLPGPAGRPGSPGPPGQDGFPGLPGQKGEPTQLTLRPGPPGY----PGLKGENGFPGQPGVDGLPGPSGPVGPPGAPGYPGEKGDAGLPGLSGKPGQDGLPGLPGNKG------------EAGY-GQPGQPGFPGAKGDGGLPGLPGTPGLQGMPGEPAPENQVNPAPPGQPGLPGLPGTKGEGGYPGRPGEVGQPGF--PGLPGMKGDSGLPGPPGLPGHPGVPGDKGFGGVPGLPGIPGPKGDVGN--PGLPGLNGQKGEPGV----------------GVPGQPGSPGFPGLKGDAGLPGLPGTPGLEGQRGFPGAPGLKG--------GDGLPGLSGQPGYPGEKGDAGLPGVPGREGSPGFPGQDGLPGVPGMKGEDGLPGLPGVTGLKGDLGAPGQSGAPGLPGAPGYPGMKGNAGIPGVPGFKGDGGLPGLPGLNGPKGEPGVPGMPGTPGMKGNGGLPGLPGRDGLSGVPGMKGDRGFNGLPGEKGEAGP------AARDGQKGDAGLPGQPGLRGPQGPSGLPGVPGFKGETGLPG---YGQPGQPGEKGLPGIPGKAGRQGAPGSPGQDGLPGFPGMKGESGYPGQDGLPGRDGLPGVPGQKGDLGQSGQPGLSGAPGLDGQPGVPGIRGDKGQGGLPGIPGDRGMDGYPGQKGENGYPGQPGLPGLGGEKGFAGTPGFPGLKGSPGYPGQDGLPGIPGLKGDSGFPGQPGQEGLPGLSGEKGMGGLPGMPGQPGQSIAGPVGPPGAPGLQGKDGFPGLPGQKGESGLSGLPGAPGLKGESGMPGFPGA--------------------------------KGDLGANGIPGK---RGEDGLPGVPGRDGQPGIPGLKGEVGGAGLPGQPGFPGIPGLKGEGGLPGFPGAKGEAGFPGTPGVPGY 1401          

HSP 4 Score: 211.46 bits (537), Expect = 1.621e-54
Identity = 386/1120 (34.46%), Postives = 471/1120 (42.05%), Query Frame = 3
Query:  201 GNKGRQGFPGPRGYQGVSGDKGDVGQFGMPGPKGYKGFTGAIGPQGRKGERGIPGSPGYPGKMGEMGFPGIRGDIGEKG---------------------LTGCDGQQGDF----------GNPGMNGLVGRTGQPG---------------------ERGDDGDRGLSIIP----KYGLKGNKGSRGLLGRYGRKGEKGFKGIKGYSGIFGIKGNKGYVGPMGRRGPKGDSLGTVIIQSEKGSKGDKGLKGQSGIPCKGFQIEGRMYGRVGSDGPIGDKGIKGE------------------KGLMGEIGQSGIDGARGLNGEKGLPGEAGPRGERG-----DRGNPGFPG---DPGASGADGTRGRQGERGPKGVHGISGADGPRGSRGDKGPSGSLLSCPGRKGEKGFFGIPGIKGDIGNKGYQGHDGDIGEIGFKGEKGYEGPLGPSCSEVEQGFRGTKGESGFPGLRGAKGQRGYSGNKGIKGKPNF------------GTGINNPGETGSYGNLG------------------VPGEKGNKGFIGDTGEKGFSGTGKQGPEGPRGDKGDDGVNGQVGM------IGMPGIKGDKGST------YPICPFCEKGYKGIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEGRMGLLGSKGRQGYKGGKGFSGSMGDAGEIGYVTISGTTIPGVKGEKGNQGPKGNKGEFGEAGSRGRKGYSGLKGFKGLIGERGTSFSSGDPGDKGLRGENGKDGVS----------FAGIPGEKGLKGDKGNRGILGDVGSLSNCATRPITSKGFKGPQGAKGTSGSPGSAGKTGIVGNKGENG---------YPGKR-----------GIDGDNGIPGSKGEEGETGIKGHAGRPGNLGKSGLQGLRGEYGVKGDLGIQGIPGRKGVMGDPGPNGYAMIGSKGDKGIKGLPGIYGAKGDKGRPGYIGIPGFKGETGLIGRSGLKGDQGEIGEKGIKGFTFISNNPGDRGLLGNKGLKGFPGELGNKGQVGVCTVRGDQGLRGYSGLIGDMGMKGEQGSKGIVGDYGAASRSGIMGRTGKIGNQGLPGDQXXXXXXXXXXXXXXXXYIGIPGFEGDRGEKGNKGF 3098
            G  G++G PGP GY G  G  G     G PG KG +G T +    G KGE+G+PG  G PG  G+ G PG+ G +G+ G                       G  GQ+G+           G PG+ G  G  GQPG                     E+GD G  GLS  P      GL GNKG  G    YG+ G+ GF G KG  G+ G+ G  G  G  G   P+           + G  G  G KG+ G P +         G VG  G  G  G+KG+                  KG  G  G  GI G +G  G  GLPG  G +GE G       G+PGFPG   D G  G  GT G +G+RG  G  G+ G DG  G  G           PG  GEKG  G+PG+ G  G+ G+ G DG  G  G KGE G  G   P  + + +G  G  G+SG PGL GA G  G  GN GI G P F                  PG  G  G  G                  VPG KG++GF G  GEKG     + GP    G KGD G+ GQ G+       G+PG+ G KG T       P  P  EKG  GI G                             GR G  GS G+ G  G  G  G  G  G+ G     G  +PGV G+KG+ G  G  G  G  G  G+ G  G++G KG  G  G     G  G  G +GENG  G            FAG PG  GLKG  G  G                   G  G  G KG SG PG  G+ G+ G  GE G          PG+            G+ G +G PG  G++GE+G+ G  G PG  G+SG+ G  G    KGDLG  GIPG++G  G PG     + G  G  GI GL G  G  G  G+PG+ GIPG KGE GL G  G KG+ G  G  G+ G+     + G  GL G  GL G  G +G  G  G   +  + G +G  GL G  G++GE+G  G+ G  G     G+ G+ G  G  G PG           G KG  G  G PG +G  G  G  G 
Sbjct:  498 GAPGQRGAPGPNGYDGRDGVNG---LPGAPGTKGDRGGTCSACAPGTKGEKGLPGYSGQPGPQGDRGLPGMPGPVGDAGDDGLPGPAGRPGSPGPPGQDGFPGLPGQKGEPTQLTLRPGPPGYPGLKGENGFPGQPGVDGLPGPSGPVGPPGAPGYPGEKGDAGLPGLSGKPGQDGLPGLPGNKGEAG----YGQPGQPGFPGAKGDGGLPGLPGTPGLQGMPGEPAPENQV--NPAPPGQPGLPGLPGTKGEGGYPGR--------PGEVGQPGFPGLPGMKGDSGLPGPPGLPGHPGVPGDKGFGGVPGLPGIPGPKGDVGNPGLPGLNGQKGEPGVGVPGQPGSPGFPGLKGDAGLPGLPGTPGLEGQRGFPGAPGLKGGDGLPGLSGQ----------PGYPGEKGDAGLPGVPGREGSPGFPGQDGLPGVPGMKGEDGLPG--LPGVTGL-KGDLGAPGQSGAPGLPGAPGYPGMKGNAGIPGVPGFKGDGGLPGLPGLNGPKGEPGVPGMPGTPGMKGNGGLPGLPGRDGLSGVPGMKGDRGFNGLPGEKG-----EAGPAARDGQKGDAGLPGQPGLRGPQGPSGLPGVPGFKGETGLPGYGQPGQP-GEKGLPGIPG---------------------------KAGRQGAPGSPGQDGLPGFPGMKGESGYPGQDGLPGRDG--LPGVPGQKGDLGQSGQPGLSGAPGLDGQPGVPGIRGDKGQGGLPGIPGDRGMDGYPGQKGENGYPGQPGLPGLGGEKGFAGTPGFPGLKGSPGYPG-----------------QDGLPGIPGLKGDSGFPGQPGQEGLPGLSGEKGMGGLPGMPGQPGQSIAGPVGPPGAPGLQGKDGFPGLPGQKGESGLSGLPGAPGLKGESGMPGFPG---AKGDLGANGIPGKRGEDGLPG-----VPGRDGQPGIPGLKGEVGGAGLPGQPGFPGIPGLKGEGGLPGFPGAKGEAGFPGTPGVPGYAGEKGDGGLPGLPGRDGLPGADGPVGPPGPSGPQNLV-EPGEKGLPGLPGAPGLRGEKGMPGLDGPPGNDGPPGLPGQRGNDGYPGAPG---------LSGEKGMGGLPGFPGLDGQPGGPGAPGL 1517          

HSP 5 Score: 119.013 bits (297), Expect = 2.398e-26
Identity = 200/597 (33.50%), Postives = 254/597 (42.55%), Query Frame = 3
Query: 2253 TSGSPGSAGKTGIVGNKGENGYPGKRGIDGDNGIPGSKGEEGETGIKGHAGRPGNLGKSGLQGLRGEYGVKGDLGIQGIPGRKGVMGDPGPNGYAMIGSKGDKGIKGLPGIYGAKGDKGRPGYIGIPGFKGETGLIGRSGLKGDQGEIGEKGIKGF-------------------------------------TFISNNPGDRGLLGNKGLKGFPGELG------------NKGQVGVCTVRGDQGLRGYSGLIGDMGMKGEQGSKGIVGDYGAASRSGIMGRTG---------KIGNQGLPGDQXXXXXXXXXXXXXXXXYIGIPGFEGDRGEKGNKGFPGFPGDIGQPGRLGNPGIS-------------------TEGVXXXXXXXXXXXXXXXXXXXXXXXXXXKQGDSGISIPGRQGIKGEDGTIGLPGEMGEPGPRGDFGQKGNIGITGEFGLQGNRGDDGLKGDDGIPGLNGPRGFIGDIGFVGFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXELGLDGSMGGKGDNGPRGFNGPTGIPGSKGFEGDKGIRGDIGVKGFQGQHGEIGFPGLKGVSGENGRQ 3812
              G+PG +G +GI G  G  G PG RG  G + IPG  G++G+ G+ G  GR    G++GL G+RG  G      + G+PG  G  G PGPNGY      G  G+ GLPG  G KGD+G       PG KGE GL G SG  G QG+ G  G+ G                                      T ++  PG  G  G KG  GFPG+ G              G  G    +GD GL G SG  G  G+ G  G+KG  G YG   + G  G  G           G QG+PG+                   G PG  G  G KG  G+PG PG++GQPG  G PG+                     +G  G PGL G+PGP G+ G PGL G  G++G+ G+ +PG+            PG  G PG +GD G  G  G  G  G +G  G  GLKG DG+PGL+G  G+ G+ G                                         + GL G  G +G  G  G +G  G+PG KG +G  G+ G  G+KG  G  G+ G PGL G  G  G +
Sbjct:  426 IPGAPGVSGPSGIPGLPGPKGEPGYRGTPGQS-IPGLPGKDGKPGLDGAPGR---KGENGLPGVRGPPGDS----LNGLPGAPGQRGAPGPNGY-----DGRDGVNGLPGAPGTKGDRGGTCSACAPGTKGEKGLPGYSGQPGPQGDRGLPGMPGPVGDAGDDGLPGPAGRPGSPGPPGQDGFPGLPGQKGEPTQLTLRPGPPGYPGLKGENGFPGQPGVDGLPGPSGPVGPPGAPGYPGEKGDAGLPGLSGKPGQDGLPGLPGNKGEAG-YGQPGQPGFPGAKGDGGLPGLPGTPGLQGMPGEPAPENQVNPAPP-------GQPGLPGLPGTKGEGGYPGRPGEVGQPGFPGLPGMKGDSGLPGPPGLPGHPGVPGDKGFGGVPGLPGIPGPKGDVGNPGLPGLNGQKGEPGVGVPGQ------------PGSPGFPGLKGDAGLPGLPGTPGLEGQRGFPGAPGLKGGDGLPGLSGQPGYPGEKG-----------------------------------------DAGLPGVPGREGSPGFPGQDGLPGVPGMKGEDGLPGLPGVTGLKGDLGAPGQSGAPGLPGAPGYPGMK 948          

HSP 6 Score: 53.1434 bits (126), Expect = 2.715e-6
Identity = 52/137 (37.96%), Postives = 70/137 (51.09%), Query Frame = 3
Query: 3990 IRGLQGRKGSTGLRGNIGIPGERGDKGIPGLQGKVGNKGV-----KGDIGDKG------------FSGN---IGDKGYSGISGDKGSFGVKGDKGFQGDVGMLGKSGLQGDRGQKGI---IGFRGTRGIPGSMGLPG 4331
            + G  GR G  G +G+ G  G  G +G PG  G  GN G+     KGD GD G            F+G+   +G +G  G  GDKG  G  G +G+ G+ G+ G+ GL G +G+KG+    G RG  G PG+ G PG
Sbjct:  180 LPGPSGRDGYPGEKGDRGDTGNAGPRGPPGEAGSPGNPGIGSIGPKGDPGDLGSVGPPGPPGPREFTGSGSIVGPRGNPGEKGDKGEPGEGGQRGYPGNGGLSGQPGLPGMKGEKGLSGPAGPRGKEGRPGNAGPPG 316          
BLAST of Collagen IV NC1 domain-containing protein vs. Ensembl Fly
Match: Col4a1 (gene:FBgn0000299 transcript:FBtr0079003)

HSP 1 Score: 559.296 bits (1440), Expect = 5.972e-168
Identity = 671/1924 (34.88%), Postives = 859/1924 (44.65%), Query Frame = 3
Query:   87 YHYLLLLIMVSQSYYAQDS------DPDPFKCLRI---CTPDKCQCFGNKGRQGFPGPRGYQGVSGDKGDVGQFGMPGPKGYKGFTGAIGPQGRKGERGIPGSPGYPGKMGEMGFPGIRGDIGEKGLTGCDGQQGDFGNPGMNGLVGRTGQPGERGDDGDRGLSIIPKYGLKGNKGSRGLL-GRY--GRKGEKGFKGIKGYSGIFGI---KGNKGYVGPMGRRGPKGDSLGTVIIQSEKGSK-------GDKGLKGQSGIPCKGFQIEGRMYGRVGSDGPIGDKGIKGEKGLMGEIGQSGIDGARGLNG---EKGLPGEAGPRG------------ERGDRGNPGFPGDPGASGADGTRGRQGER----------------------------------GPKGVHGISGADGPRGSRGDKGPSGSL-----LSCPGRKGEKGFFGIPGIKGDIGNKGYQGHDGDIGEIGFKGEKGYEGPLGPSCSEVEQGFRGTKGESGFPGLRGAKGQRGYSGNKGIKGKPNFGT-----GINNPGETGSYGNLGVPGEKGNKGFIGDTGEKGFSGTGKQGPEGPRGDKGDDGVNGQVGMIGMPGIKGDKGSTYPICPFCEKGYKGIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEGRMGLLGSKGRQGYKGGKGFSGSMGDAGEIGYVTISGTTIPGVKGEKGNQGPKGNKGEFGEAGSRGRKGYSGLKGFKGLIGERGTSFSSGDPGDKGLRGENGKDGVSFAGIPGEK-----------GLKGDKGNRGILGDVGSLSNCATRPITSKGFKGPQGAKGTSGSPGSAGKTGIV---GNKGENGYPGKRGIDGDNGIPGSK------GEEGETGIKGHAGRPGNLGKSGLQGLRGEYGVKGDLGIQGIPGRKGVMGDPGPNGYAMIGSKGDKGIKGLPGIYGA---------KGDKGRPGYIGIPGF---KGETGLIGRSGLKGDQGEIGEKGIKGFTFISNNPGDRGLLGNKGLKGFPGELGNKGQVGVCTVRGDQGLRGYSGLIGDMGMKGEQGSKGIVGD------YGAASRSGIMGRTGKIGNQGLPGDQXXXXXXXXXXXXXXXXYIGIPGFEGDRGEKGNKGFPGFPGDIGQPGRLGNPGISTEGVXXXXXXXXXXXXXXXXXXXXXXXXXXKQGDSGIS-IPGRQGIKGEDGTIGLPGEMGEPGPRGDFGQKGNIGITG------------EFGLQGNRGDDGLKGDDGIPGLNGPRGFIGDIGFVGFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXELGLDGSMGGKGDNGPRGFNGPTGIPGSKGFE------GDKGIRGDIGVKGFQGQHGEIGFP--------GLKGVSGENGRQXXXXXXXXXXXXXXXXVCMQPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEVGESIRGLQGRKGSTGLRGNIGIPGERGDKGI---PGLQGKVGNKGVKGDIGDKGFSGNIGDKGYSGISGDKGSFGVKGDKGFQGDVGMLGKSGLQGDRGQKGIIGFRGTRGIPGSMGLPGEIGEKGDV---------------GPSG----IGVKGLKGYQNAVGIKGRKGEKGLPGFPGRPGKVGDQGDKGPKGMKNMNTXXXXXXXXXXXXXXXXXXXXXXXXXLPGDMGEIGPNGPIGYAD-NGFLYATHSQSKDFPPCHGGGSPLYNGYSLLAIHGDIDSVTMDLGTPGSCLKNFSTIPFVNCFLERNTFYGGRCHVNMRNSRSYWLSTLQSYMSSPQPPSKMDDYISRCSVCQTKTTVMAFHSQKSDWQMTKCPYGWQKLWAGFSFPMAVQASRSGSNQPFSSPGSCLKHFRSLPFIECNNHNSNCNHWRDGVSYYMTAVDSENQFVKAQGKVLKSQTDIMNSISKCVVCQRDMN 5351
            Y+       +  SY   DS      D  P  C      C P   +C   KG +G PGP G  G+   KG++G  GM GP G KG  G  GP G++G++G  GSPG     G+ G PG++G  G  G  G +G+ G  G  G+ GL G +G PG RG  G        + G KG KG      G Y  G KGE G++G  G +G  G    KG +G  GP G +GP+G+      ++ EKG+        G  G+KG+ G P   F ++          GP GD G KGE GL+G  G+ G +G  GL+G   EKGLPG  G RG            ++GDRG PG  G PG  G  G  GR G                                    GP+G++G+ G  GP+G  G KG +G          PG+KGEKG  G+ G KG IG  G+ G  G  G+ G  G  GY            QG +G  G  G+PGL+G+KG+RG+ GN G  G    G          PG+ G  G  G PG+KG+ G  GD G K  S        GP+GDKG  G+ G  G  G  G  G++G  YP     E+G+ GI                                  G  G  G +G  G  G  G+ G+ G+     +S   I  +KG+KG  G  G KG  G  G+ G  G  G KG  G  GE+G S   G PG+ G  G  G+DG  + GIPG+            G KGDKG+ G  G+ G   +CA   I          AKG  G PG  G  G     G+ GE GY G +G  G  G PG +      G  GE G +G  G PGN GK GL+G+ G  G  G  G  GI  R G MG PG NG  + G KGD+G  G  G  GA         +GD G PG  G PG    KG+ G IG +G+ G  G  G  G++G       PG  GL+G  G KG  G  GN G  G   V G  G RG +G+ G  G KG++G+ G+ G+       G     G+MG  G  G  G PG QG  G  G KG +G  G  G PG  GD  EKG KG PG  G  G  G  G PG   E              +    + G  G PG++GD G S I GR GI GE G  GL G  G+PG +G  G  G  G  G              G  G+RGD G  G  G+PGL G  G +G  GF G                                + G KG  G  G  G KG+ G RG  GP G+ G+KG        G  G+ G  G KG  G  GEIG+P        GL G  G NGRQG  G  GL G+ G  G+  +P +                                VG  + G  G  GS G RG  G PG+ G  G    PGL+G  G +G KG+ G  GF G  GDKG  G+ G  G  G+ G KG  G  G+ G  G  G  G++G  G +G  G  G+ GLPG+ GE G +               GP G     G +GL G Q   G KG +G  G  G  GRPG  GD+G+ G +G +                            GL G  GE G   P       G L   HSQS+  P C  G + L+ GYSLL + G+  +   DLG+PGSC+  FST+P ++C   +N      C+   RN +++WL+T  +    P    ++  YISRC VC+    V+A HSQ    ++  CP GW+ LW G+SF M       G  Q   SPGSCL+ FR+ PFIECN     C+ +    S++M  ++S   F + Q + +K+  +  + +S+C VC ++ +
Sbjct:   42 YNRNEPKFPIDDSYDIVDSAGVARGDLPPKNCTAGYAGCVP---KCIAEKGNRGLPGPLGPTGL---KGEMGFPGMEGPSGDKGQKGDPGPYGQRGDKGERGSPGL---HGQAGVPGVQGPAGNPGAPGINGKDGCDGQDGIPGLEGLSGMPGPRGYAG--------QLGSKGEKGEPAKENGDYAKGEKGEPGWRGTAGLAGPQGFPGEKGERGDSGPYGAKGPRGEH----GLKGEKGASCYGPMKPGAPGIKGEKGEPASSFPVKPTHT----VMGPRGDMGQKGEPGLVGRKGEPGPEGDTGLDGQKGEKGLPGGPGDRGRQGNFGPPGSTGQKGDRGEPGLNGLPGNPGQKGEPGRAGATGKPGLLGPPGPPGGGRGTPGPPGPKGPRGYVGAPGPQGLNGVDGLPGPQGYNGQKGGAGLPGRPGNEGPPGKKGEKGTAGLNGPKGSIGPIGHPGPPGPEGQKGDAGLPGYG----------IQGSKGDAGIPGYPGLKGSKGERGFKGNAGAPGDSKLGRPGTPGAAGAPGQKGDAGRPGTPGQKGDMGIKGDVGGKCSSCR-----AGPKGDKGTSGLPGIPGKDGARGPPGERG--YP----GERGHDGIN---------------------------------GQTGPPGEKGEDGRTGLPGATGEPGKPALCDLS--LIEPLKGDKGYPGAPGAKGVQGFKGAEGLPGIPGPKGEFGFKGEKGLS---GAPGNDGTPGRAGRDG--YPGIPGQSIKGEPGFHGRDGAKGDKGSFGRSGEKGEPGSCALDEIKMP-------AKGNKGEPGQTGMPGPPGEDGSPGERGYTGLKGNTGPQGPPGVEGPRGLNGPRGEKGNQGAVGVPGNPGKDGLRGIPGRNGQPGPRGEPGI-SRPGPMGPPGLNG--LQGEKGDRGPTGPIGFPGADGSVGYPGDRGDAGLPGVSGRPGIVGEKGDVGPIGPAGVAGPPGVPGIDGVRGRDGAKGEPGSPGLVGMPGNKGDRGAPGNDGPKGFAGVTGAPGKRGPAGIPGVSGAKGDKGATGLTGNDGPVGGRGPPGAPGLMGIKGDQGLAGAPGQQGLDGMPGEKGNQGFPGLDGPPGLPGDASEKGQKGEPGPSGLRGDTGPAGTPGWPGE------------KGLPGLAVHGRAGPPGEKGDQGRSGIDGRDGINGEKGEQGLQGVWGQPGEKGSVGAPGIPGAPGMDGLPGAAGAPGAVGYPGDRGDKGEPGLSGLPGLKGETGPVGLQGFTG----------APGPKGERGIRGQPGLPATVPDIRGDKGSQGERGYTGEKGEQGERGLTGPAGVAGAKGDRGLQGPPGASGLNGIPGAKGDIGPRGEIGYPGVTIKGEKGLPGRPGRNGRQGLIGAPGLIGERGLPGLAGEPGL--------------------------------VG--LPGPIGPAGSKGERGLAGSPGQPGQDGFPGAPGLKGDTGPQGFKGERGLNGFEGQKGDKGDRGLQGPSGLPGLVGQKGDTGYPGLNGNDGPVGAPGERGFTGPKGRDGRDGTPGLPGQKGEPGMLPPPGPKGEPGQPGRNGPKGEPGRPGERGLIGIQGERGEKGERGLIGETGNVGRPGPKGDRGEPGERGYEGA-------------------------IGLIGQKGEPGAPAPAALDYLTGILITRHSQSETVPACSAGHTELWTGYSLLYVDGNDYAHNQDLGSPGSCVPRFSTLPVLSCG--QNNV----CNYASRNDKTFWLTTNAAIPMMPVENIEIRQYISRCVVCEAPANVIAVHSQT--IEVPDCPNGWEGLWIGYSFLMHTAVGNGGGGQALQSPGSCLEDFRATPFIECNGAKGTCHFYETMTSFWMYNLESSQPFERPQQQTIKA-GERQSHVSRCQVCMKNSS 1779          

HSP 2 Score: 75.0998 bits (183), Expect = 7.963e-13
Identity = 35/121 (28.93%), Postives = 59/121 (48.76%), Query Frame = 3
Query: 4998 VMAFHSQKSDWQMTKCPYGWQKLWAGFSFPMAVQASRSGSNQPFSSPGSCLKHFRSLPFIECNNHNSNCNHW-RDGVSYYMTAVDSENQFVKAQGKVLKSQTDIMNSISKCVVCQRDMNIV 5357
            ++  HSQ     +  C  G  +LW G+S  + V  +    NQ   SPGSC+  F +LP + C  +N  CN+  R+  ++++T     N  +     +     +I   IS+CVVC+   N++
Sbjct: 1557 LITRHSQSE--TVPACSAGHTELWTGYSL-LYVDGNDYAHNQDLGSPGSCVPRFSTLPVLSCGQNNV-CNYASRNDKTFWLTT----NAAIPM---MPVENIEIRQYISRCVVCEAPANVI 1666          
BLAST of Collagen IV NC1 domain-containing protein vs. Ensembl Fly
Match: Col4a1 (gene:FBgn0000299 transcript:FBtr0079002)

HSP 1 Score: 559.296 bits (1440), Expect = 5.972e-168
Identity = 671/1924 (34.88%), Postives = 859/1924 (44.65%), Query Frame = 3
Query:   87 YHYLLLLIMVSQSYYAQDS------DPDPFKCLRI---CTPDKCQCFGNKGRQGFPGPRGYQGVSGDKGDVGQFGMPGPKGYKGFTGAIGPQGRKGERGIPGSPGYPGKMGEMGFPGIRGDIGEKGLTGCDGQQGDFGNPGMNGLVGRTGQPGERGDDGDRGLSIIPKYGLKGNKGSRGLL-GRY--GRKGEKGFKGIKGYSGIFGI---KGNKGYVGPMGRRGPKGDSLGTVIIQSEKGSK-------GDKGLKGQSGIPCKGFQIEGRMYGRVGSDGPIGDKGIKGEKGLMGEIGQSGIDGARGLNG---EKGLPGEAGPRG------------ERGDRGNPGFPGDPGASGADGTRGRQGER----------------------------------GPKGVHGISGADGPRGSRGDKGPSGSL-----LSCPGRKGEKGFFGIPGIKGDIGNKGYQGHDGDIGEIGFKGEKGYEGPLGPSCSEVEQGFRGTKGESGFPGLRGAKGQRGYSGNKGIKGKPNFGT-----GINNPGETGSYGNLGVPGEKGNKGFIGDTGEKGFSGTGKQGPEGPRGDKGDDGVNGQVGMIGMPGIKGDKGSTYPICPFCEKGYKGIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEGRMGLLGSKGRQGYKGGKGFSGSMGDAGEIGYVTISGTTIPGVKGEKGNQGPKGNKGEFGEAGSRGRKGYSGLKGFKGLIGERGTSFSSGDPGDKGLRGENGKDGVSFAGIPGEK-----------GLKGDKGNRGILGDVGSLSNCATRPITSKGFKGPQGAKGTSGSPGSAGKTGIV---GNKGENGYPGKRGIDGDNGIPGSK------GEEGETGIKGHAGRPGNLGKSGLQGLRGEYGVKGDLGIQGIPGRKGVMGDPGPNGYAMIGSKGDKGIKGLPGIYGA---------KGDKGRPGYIGIPGF---KGETGLIGRSGLKGDQGEIGEKGIKGFTFISNNPGDRGLLGNKGLKGFPGELGNKGQVGVCTVRGDQGLRGYSGLIGDMGMKGEQGSKGIVGD------YGAASRSGIMGRTGKIGNQGLPGDQXXXXXXXXXXXXXXXXYIGIPGFEGDRGEKGNKGFPGFPGDIGQPGRLGNPGISTEGVXXXXXXXXXXXXXXXXXXXXXXXXXXKQGDSGIS-IPGRQGIKGEDGTIGLPGEMGEPGPRGDFGQKGNIGITG------------EFGLQGNRGDDGLKGDDGIPGLNGPRGFIGDIGFVGFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXELGLDGSMGGKGDNGPRGFNGPTGIPGSKGFE------GDKGIRGDIGVKGFQGQHGEIGFP--------GLKGVSGENGRQXXXXXXXXXXXXXXXXVCMQPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEVGESIRGLQGRKGSTGLRGNIGIPGERGDKGI---PGLQGKVGNKGVKGDIGDKGFSGNIGDKGYSGISGDKGSFGVKGDKGFQGDVGMLGKSGLQGDRGQKGIIGFRGTRGIPGSMGLPGEIGEKGDV---------------GPSG----IGVKGLKGYQNAVGIKGRKGEKGLPGFPGRPGKVGDQGDKGPKGMKNMNTXXXXXXXXXXXXXXXXXXXXXXXXXLPGDMGEIGPNGPIGYAD-NGFLYATHSQSKDFPPCHGGGSPLYNGYSLLAIHGDIDSVTMDLGTPGSCLKNFSTIPFVNCFLERNTFYGGRCHVNMRNSRSYWLSTLQSYMSSPQPPSKMDDYISRCSVCQTKTTVMAFHSQKSDWQMTKCPYGWQKLWAGFSFPMAVQASRSGSNQPFSSPGSCLKHFRSLPFIECNNHNSNCNHWRDGVSYYMTAVDSENQFVKAQGKVLKSQTDIMNSISKCVVCQRDMN 5351
            Y+       +  SY   DS      D  P  C      C P   +C   KG +G PGP G  G+   KG++G  GM GP G KG  G  GP G++G++G  GSPG     G+ G PG++G  G  G  G +G+ G  G  G+ GL G +G PG RG  G        + G KG KG      G Y  G KGE G++G  G +G  G    KG +G  GP G +GP+G+      ++ EKG+        G  G+KG+ G P   F ++          GP GD G KGE GL+G  G+ G +G  GL+G   EKGLPG  G RG            ++GDRG PG  G PG  G  G  GR G                                    GP+G++G+ G  GP+G  G KG +G          PG+KGEKG  G+ G KG IG  G+ G  G  G+ G  G  GY            QG +G  G  G+PGL+G+KG+RG+ GN G  G    G          PG+ G  G  G PG+KG+ G  GD G K  S        GP+GDKG  G+ G  G  G  G  G++G  YP     E+G+ GI                                  G  G  G +G  G  G  G+ G+ G+     +S   I  +KG+KG  G  G KG  G  G+ G  G  G KG  G  GE+G S   G PG+ G  G  G+DG  + GIPG+            G KGDKG+ G  G+ G   +CA   I          AKG  G PG  G  G     G+ GE GY G +G  G  G PG +      G  GE G +G  G PGN GK GL+G+ G  G  G  G  GI  R G MG PG NG  + G KGD+G  G  G  GA         +GD G PG  G PG    KG+ G IG +G+ G  G  G  G++G       PG  GL+G  G KG  G  GN G  G   V G  G RG +G+ G  G KG++G+ G+ G+       G     G+MG  G  G  G PG QG  G  G KG +G  G  G PG  GD  EKG KG PG  G  G  G  G PG   E              +    + G  G PG++GD G S I GR GI GE G  GL G  G+PG +G  G  G  G  G              G  G+RGD G  G  G+PGL G  G +G  GF G                                + G KG  G  G  G KG+ G RG  GP G+ G+KG        G  G+ G  G KG  G  GEIG+P        GL G  G NGRQG  G  GL G+ G  G+  +P +                                VG  + G  G  GS G RG  G PG+ G  G    PGL+G  G +G KG+ G  GF G  GDKG  G+ G  G  G+ G KG  G  G+ G  G  G  G++G  G +G  G  G+ GLPG+ GE G +               GP G     G +GL G Q   G KG +G  G  G  GRPG  GD+G+ G +G +                            GL G  GE G   P       G L   HSQS+  P C  G + L+ GYSLL + G+  +   DLG+PGSC+  FST+P ++C   +N      C+   RN +++WL+T  +    P    ++  YISRC VC+    V+A HSQ    ++  CP GW+ LW G+SF M       G  Q   SPGSCL+ FR+ PFIECN     C+ +    S++M  ++S   F + Q + +K+  +  + +S+C VC ++ +
Sbjct:   42 YNRNEPKFPIDDSYDIVDSAGVARGDLPPKNCTAGYAGCVP---KCIAEKGNRGLPGPLGPTGL---KGEMGFPGMEGPSGDKGQKGDPGPYGQRGDKGERGSPGL---HGQAGVPGVQGPAGNPGAPGINGKDGCDGQDGIPGLEGLSGMPGPRGYAG--------QLGSKGEKGEPAKENGDYAKGEKGEPGWRGTAGLAGPQGFPGEKGERGDSGPYGAKGPRGEH----GLKGEKGASCYGPMKPGAPGIKGEKGEPASSFPVKPTHT----VMGPRGDMGQKGEPGLVGRKGEPGPEGDTGLDGQKGEKGLPGGPGDRGRQGNFGPPGSTGQKGDRGEPGLNGLPGNPGQKGEPGRAGATGKPGLLGPPGPPGGGRGTPGPPGPKGPRGYVGAPGPQGLNGVDGLPGPQGYNGQKGGAGLPGRPGNEGPPGKKGEKGTAGLNGPKGSIGPIGHPGPPGPEGQKGDAGLPGYG----------IQGSKGDAGIPGYPGLKGSKGERGFKGNAGAPGDSKLGRPGTPGAAGAPGQKGDAGRPGTPGQKGDMGIKGDVGGKCSSCR-----AGPKGDKGTSGLPGIPGKDGARGPPGERG--YP----GERGHDGIN---------------------------------GQTGPPGEKGEDGRTGLPGATGEPGKPALCDLS--LIEPLKGDKGYPGAPGAKGVQGFKGAEGLPGIPGPKGEFGFKGEKGLS---GAPGNDGTPGRAGRDG--YPGIPGQSIKGEPGFHGRDGAKGDKGSFGRSGEKGEPGSCALDEIKMP-------AKGNKGEPGQTGMPGPPGEDGSPGERGYTGLKGNTGPQGPPGVEGPRGLNGPRGEKGNQGAVGVPGNPGKDGLRGIPGRNGQPGPRGEPGI-SRPGPMGPPGLNG--LQGEKGDRGPTGPIGFPGADGSVGYPGDRGDAGLPGVSGRPGIVGEKGDVGPIGPAGVAGPPGVPGIDGVRGRDGAKGEPGSPGLVGMPGNKGDRGAPGNDGPKGFAGVTGAPGKRGPAGIPGVSGAKGDKGATGLTGNDGPVGGRGPPGAPGLMGIKGDQGLAGAPGQQGLDGMPGEKGNQGFPGLDGPPGLPGDASEKGQKGEPGPSGLRGDTGPAGTPGWPGE------------KGLPGLAVHGRAGPPGEKGDQGRSGIDGRDGINGEKGEQGLQGVWGQPGEKGSVGAPGIPGAPGMDGLPGAAGAPGAVGYPGDRGDKGEPGLSGLPGLKGETGPVGLQGFTG----------APGPKGERGIRGQPGLPATVPDIRGDKGSQGERGYTGEKGEQGERGLTGPAGVAGAKGDRGLQGPPGASGLNGIPGAKGDIGPRGEIGYPGVTIKGEKGLPGRPGRNGRQGLIGAPGLIGERGLPGLAGEPGL--------------------------------VG--LPGPIGPAGSKGERGLAGSPGQPGQDGFPGAPGLKGDTGPQGFKGERGLNGFEGQKGDKGDRGLQGPSGLPGLVGQKGDTGYPGLNGNDGPVGAPGERGFTGPKGRDGRDGTPGLPGQKGEPGMLPPPGPKGEPGQPGRNGPKGEPGRPGERGLIGIQGERGEKGERGLIGETGNVGRPGPKGDRGEPGERGYEGA-------------------------IGLIGQKGEPGAPAPAALDYLTGILITRHSQSETVPACSAGHTELWTGYSLLYVDGNDYAHNQDLGSPGSCVPRFSTLPVLSCG--QNNV----CNYASRNDKTFWLTTNAAIPMMPVENIEIRQYISRCVVCEAPANVIAVHSQT--IEVPDCPNGWEGLWIGYSFLMHTAVGNGGGGQALQSPGSCLEDFRATPFIECNGAKGTCHFYETMTSFWMYNLESSQPFERPQQQTIKA-GERQSHVSRCQVCMKNSS 1779          

HSP 2 Score: 75.0998 bits (183), Expect = 7.963e-13
Identity = 35/121 (28.93%), Postives = 59/121 (48.76%), Query Frame = 3
Query: 4998 VMAFHSQKSDWQMTKCPYGWQKLWAGFSFPMAVQASRSGSNQPFSSPGSCLKHFRSLPFIECNNHNSNCNHW-RDGVSYYMTAVDSENQFVKAQGKVLKSQTDIMNSISKCVVCQRDMNIV 5357
            ++  HSQ     +  C  G  +LW G+S  + V  +    NQ   SPGSC+  F +LP + C  +N  CN+  R+  ++++T     N  +     +     +I   IS+CVVC+   N++
Sbjct: 1557 LITRHSQSE--TVPACSAGHTELWTGYSL-LYVDGNDYAHNQDLGSPGSCVPRFSTLPVLSCGQNNV-CNYASRNDKTFWLTT----NAAIPM---MPVENIEIRQYISRCVVCEAPANVI 1666          
BLAST of Collagen IV NC1 domain-containing protein vs. Ensembl Fly
Match: Col4a1 (gene:FBgn0000299 transcript:FBtr0079001)

HSP 1 Score: 559.296 bits (1440), Expect = 5.972e-168
Identity = 671/1924 (34.88%), Postives = 859/1924 (44.65%), Query Frame = 3
Query:   87 YHYLLLLIMVSQSYYAQDS------DPDPFKCLRI---CTPDKCQCFGNKGRQGFPGPRGYQGVSGDKGDVGQFGMPGPKGYKGFTGAIGPQGRKGERGIPGSPGYPGKMGEMGFPGIRGDIGEKGLTGCDGQQGDFGNPGMNGLVGRTGQPGERGDDGDRGLSIIPKYGLKGNKGSRGLL-GRY--GRKGEKGFKGIKGYSGIFGI---KGNKGYVGPMGRRGPKGDSLGTVIIQSEKGSK-------GDKGLKGQSGIPCKGFQIEGRMYGRVGSDGPIGDKGIKGEKGLMGEIGQSGIDGARGLNG---EKGLPGEAGPRG------------ERGDRGNPGFPGDPGASGADGTRGRQGER----------------------------------GPKGVHGISGADGPRGSRGDKGPSGSL-----LSCPGRKGEKGFFGIPGIKGDIGNKGYQGHDGDIGEIGFKGEKGYEGPLGPSCSEVEQGFRGTKGESGFPGLRGAKGQRGYSGNKGIKGKPNFGT-----GINNPGETGSYGNLGVPGEKGNKGFIGDTGEKGFSGTGKQGPEGPRGDKGDDGVNGQVGMIGMPGIKGDKGSTYPICPFCEKGYKGIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEGRMGLLGSKGRQGYKGGKGFSGSMGDAGEIGYVTISGTTIPGVKGEKGNQGPKGNKGEFGEAGSRGRKGYSGLKGFKGLIGERGTSFSSGDPGDKGLRGENGKDGVSFAGIPGEK-----------GLKGDKGNRGILGDVGSLSNCATRPITSKGFKGPQGAKGTSGSPGSAGKTGIV---GNKGENGYPGKRGIDGDNGIPGSK------GEEGETGIKGHAGRPGNLGKSGLQGLRGEYGVKGDLGIQGIPGRKGVMGDPGPNGYAMIGSKGDKGIKGLPGIYGA---------KGDKGRPGYIGIPGF---KGETGLIGRSGLKGDQGEIGEKGIKGFTFISNNPGDRGLLGNKGLKGFPGELGNKGQVGVCTVRGDQGLRGYSGLIGDMGMKGEQGSKGIVGD------YGAASRSGIMGRTGKIGNQGLPGDQXXXXXXXXXXXXXXXXYIGIPGFEGDRGEKGNKGFPGFPGDIGQPGRLGNPGISTEGVXXXXXXXXXXXXXXXXXXXXXXXXXXKQGDSGIS-IPGRQGIKGEDGTIGLPGEMGEPGPRGDFGQKGNIGITG------------EFGLQGNRGDDGLKGDDGIPGLNGPRGFIGDIGFVGFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXELGLDGSMGGKGDNGPRGFNGPTGIPGSKGFE------GDKGIRGDIGVKGFQGQHGEIGFP--------GLKGVSGENGRQXXXXXXXXXXXXXXXXVCMQPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEVGESIRGLQGRKGSTGLRGNIGIPGERGDKGI---PGLQGKVGNKGVKGDIGDKGFSGNIGDKGYSGISGDKGSFGVKGDKGFQGDVGMLGKSGLQGDRGQKGIIGFRGTRGIPGSMGLPGEIGEKGDV---------------GPSG----IGVKGLKGYQNAVGIKGRKGEKGLPGFPGRPGKVGDQGDKGPKGMKNMNTXXXXXXXXXXXXXXXXXXXXXXXXXLPGDMGEIGPNGPIGYAD-NGFLYATHSQSKDFPPCHGGGSPLYNGYSLLAIHGDIDSVTMDLGTPGSCLKNFSTIPFVNCFLERNTFYGGRCHVNMRNSRSYWLSTLQSYMSSPQPPSKMDDYISRCSVCQTKTTVMAFHSQKSDWQMTKCPYGWQKLWAGFSFPMAVQASRSGSNQPFSSPGSCLKHFRSLPFIECNNHNSNCNHWRDGVSYYMTAVDSENQFVKAQGKVLKSQTDIMNSISKCVVCQRDMN 5351
            Y+       +  SY   DS      D  P  C      C P   +C   KG +G PGP G  G+   KG++G  GM GP G KG  G  GP G++G++G  GSPG     G+ G PG++G  G  G  G +G+ G  G  G+ GL G +G PG RG  G        + G KG KG      G Y  G KGE G++G  G +G  G    KG +G  GP G +GP+G+      ++ EKG+        G  G+KG+ G P   F ++          GP GD G KGE GL+G  G+ G +G  GL+G   EKGLPG  G RG            ++GDRG PG  G PG  G  G  GR G                                    GP+G++G+ G  GP+G  G KG +G          PG+KGEKG  G+ G KG IG  G+ G  G  G+ G  G  GY            QG +G  G  G+PGL+G+KG+RG+ GN G  G    G          PG+ G  G  G PG+KG+ G  GD G K  S        GP+GDKG  G+ G  G  G  G  G++G  YP     E+G+ GI                                  G  G  G +G  G  G  G+ G+ G+     +S   I  +KG+KG  G  G KG  G  G+ G  G  G KG  G  GE+G S   G PG+ G  G  G+DG  + GIPG+            G KGDKG+ G  G+ G   +CA   I          AKG  G PG  G  G     G+ GE GY G +G  G  G PG +      G  GE G +G  G PGN GK GL+G+ G  G  G  G  GI  R G MG PG NG  + G KGD+G  G  G  GA         +GD G PG  G PG    KG+ G IG +G+ G  G  G  G++G       PG  GL+G  G KG  G  GN G  G   V G  G RG +G+ G  G KG++G+ G+ G+       G     G+MG  G  G  G PG QG  G  G KG +G  G  G PG  GD  EKG KG PG  G  G  G  G PG   E              +    + G  G PG++GD G S I GR GI GE G  GL G  G+PG +G  G  G  G  G              G  G+RGD G  G  G+PGL G  G +G  GF G                                + G KG  G  G  G KG+ G RG  GP G+ G+KG        G  G+ G  G KG  G  GEIG+P        GL G  G NGRQG  G  GL G+ G  G+  +P +                                VG  + G  G  GS G RG  G PG+ G  G    PGL+G  G +G KG+ G  GF G  GDKG  G+ G  G  G+ G KG  G  G+ G  G  G  G++G  G +G  G  G+ GLPG+ GE G +               GP G     G +GL G Q   G KG +G  G  G  GRPG  GD+G+ G +G +                            GL G  GE G   P       G L   HSQS+  P C  G + L+ GYSLL + G+  +   DLG+PGSC+  FST+P ++C   +N      C+   RN +++WL+T  +    P    ++  YISRC VC+    V+A HSQ    ++  CP GW+ LW G+SF M       G  Q   SPGSCL+ FR+ PFIECN     C+ +    S++M  ++S   F + Q + +K+  +  + +S+C VC ++ +
Sbjct:   42 YNRNEPKFPIDDSYDIVDSAGVARGDLPPKNCTAGYAGCVP---KCIAEKGNRGLPGPLGPTGL---KGEMGFPGMEGPSGDKGQKGDPGPYGQRGDKGERGSPGL---HGQAGVPGVQGPAGNPGAPGINGKDGCDGQDGIPGLEGLSGMPGPRGYAG--------QLGSKGEKGEPAKENGDYAKGEKGEPGWRGTAGLAGPQGFPGEKGERGDSGPYGAKGPRGEH----GLKGEKGASCYGPMKPGAPGIKGEKGEPASSFPVKPTHT----VMGPRGDMGQKGEPGLVGRKGEPGPEGDTGLDGQKGEKGLPGGPGDRGRQGNFGPPGSTGQKGDRGEPGLNGLPGNPGQKGEPGRAGATGKPGLLGPPGPPGGGRGTPGPPGPKGPRGYVGAPGPQGLNGVDGLPGPQGYNGQKGGAGLPGRPGNEGPPGKKGEKGTAGLNGPKGSIGPIGHPGPPGPEGQKGDAGLPGYG----------IQGSKGDAGIPGYPGLKGSKGERGFKGNAGAPGDSKLGRPGTPGAAGAPGQKGDAGRPGTPGQKGDMGIKGDVGGKCSSCR-----AGPKGDKGTSGLPGIPGKDGARGPPGERG--YP----GERGHDGIN---------------------------------GQTGPPGEKGEDGRTGLPGATGEPGKPALCDLS--LIEPLKGDKGYPGAPGAKGVQGFKGAEGLPGIPGPKGEFGFKGEKGLS---GAPGNDGTPGRAGRDG--YPGIPGQSIKGEPGFHGRDGAKGDKGSFGRSGEKGEPGSCALDEIKMP-------AKGNKGEPGQTGMPGPPGEDGSPGERGYTGLKGNTGPQGPPGVEGPRGLNGPRGEKGNQGAVGVPGNPGKDGLRGIPGRNGQPGPRGEPGI-SRPGPMGPPGLNG--LQGEKGDRGPTGPIGFPGADGSVGYPGDRGDAGLPGVSGRPGIVGEKGDVGPIGPAGVAGPPGVPGIDGVRGRDGAKGEPGSPGLVGMPGNKGDRGAPGNDGPKGFAGVTGAPGKRGPAGIPGVSGAKGDKGATGLTGNDGPVGGRGPPGAPGLMGIKGDQGLAGAPGQQGLDGMPGEKGNQGFPGLDGPPGLPGDASEKGQKGEPGPSGLRGDTGPAGTPGWPGE------------KGLPGLAVHGRAGPPGEKGDQGRSGIDGRDGINGEKGEQGLQGVWGQPGEKGSVGAPGIPGAPGMDGLPGAAGAPGAVGYPGDRGDKGEPGLSGLPGLKGETGPVGLQGFTG----------APGPKGERGIRGQPGLPATVPDIRGDKGSQGERGYTGEKGEQGERGLTGPAGVAGAKGDRGLQGPPGASGLNGIPGAKGDIGPRGEIGYPGVTIKGEKGLPGRPGRNGRQGLIGAPGLIGERGLPGLAGEPGL--------------------------------VG--LPGPIGPAGSKGERGLAGSPGQPGQDGFPGAPGLKGDTGPQGFKGERGLNGFEGQKGDKGDRGLQGPSGLPGLVGQKGDTGYPGLNGNDGPVGAPGERGFTGPKGRDGRDGTPGLPGQKGEPGMLPPPGPKGEPGQPGRNGPKGEPGRPGERGLIGIQGERGEKGERGLIGETGNVGRPGPKGDRGEPGERGYEGA-------------------------IGLIGQKGEPGAPAPAALDYLTGILITRHSQSETVPACSAGHTELWTGYSLLYVDGNDYAHNQDLGSPGSCVPRFSTLPVLSCG--QNNV----CNYASRNDKTFWLTTNAAIPMMPVENIEIRQYISRCVVCEAPANVIAVHSQT--IEVPDCPNGWEGLWIGYSFLMHTAVGNGGGGQALQSPGSCLEDFRATPFIECNGAKGTCHFYETMTSFWMYNLESSQPFERPQQQTIKA-GERQSHVSRCQVCMKNSS 1779          

HSP 2 Score: 75.0998 bits (183), Expect = 7.963e-13
Identity = 35/121 (28.93%), Postives = 59/121 (48.76%), Query Frame = 3
Query: 4998 VMAFHSQKSDWQMTKCPYGWQKLWAGFSFPMAVQASRSGSNQPFSSPGSCLKHFRSLPFIECNNHNSNCNHW-RDGVSYYMTAVDSENQFVKAQGKVLKSQTDIMNSISKCVVCQRDMNIV 5357
            ++  HSQ     +  C  G  +LW G+S  + V  +    NQ   SPGSC+  F +LP + C  +N  CN+  R+  ++++T     N  +     +     +I   IS+CVVC+   N++
Sbjct: 1557 LITRHSQSE--TVPACSAGHTELWTGYSL-LYVDGNDYAHNQDLGSPGSCVPRFSTLPVLSCGQNNV-CNYASRNDKTFWLTT----NAAIPM---MPVENIEIRQYISRCVVCEAPANVI 1666          
BLAST of Collagen IV NC1 domain-containing protein vs. Ensembl Fly
Match: vkg (gene:FBgn0016075 transcript:FBtr0333541)

HSP 1 Score: 334.339 bits (856), Expect = 2.853e-92
Identity = 566/1607 (35.22%), Postives = 732/1607 (45.55%), Query Frame = 3
Query:   63 LLPKFKNSYHYLLLLIMVSQSYYAQDSDPDPFKCLRICTPDKCQCFGNKGRQGFPGPRGYQGVSGDKGDVGQFGMPGPKGYKGFTGAIGPQGRKGERGIPGSPGYPGKMGEMGFPGIRGDIGE------KGLTGCDGQ---QGDFGNPGMNGLVGRTGQPGERGDDGDRGLSIIPKYGLKGNKGSRGLLGRYGRKG---EKGFKGIKGYSGIFGIKGNKGYVGPMGRRGPKGDSLGTVIIQSEKGSKGDKGLKGQSGIPCKG-FQIEGRMYGRVGSDGPIGDKGIKGEKGLMGEIGQSGIDGARGLNGEKGLPGEAGPRGERGDRGNPGFPGDPGASGADGTRGRQGERGPKGVHGISGADGPRGSRGDKGPSGSLLSCPGRKGEKGFFGIPGIKGDIGNKGYQGHDGDIGEIGFKGEKGYEGPLGPSCSEVEQGFRGTKGESGFPGLRGAKGQRGYSGNKGIKGKPNFGTGINNP-GETGSYGNLGVPGEKGNKGFIGDTGEKGFSGTGKQ--------GPEGPRGDKGDDGVNGQVGMIGMPGIKGDKGSTYPICPFCEKGYKGIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEGRMGLLGSKGRQGYKGGKGFSGSMGDAGEIGYVTISGTTIPG---VKGEKGNQGPKGNKGEFGEAGSRGRKGYSGLKGFKGLIGERGTSFSSGDPGDKGLRGENGKDGVS----------------FAGIPGEKGLKGDKGNRGILGDV--GSLSNCATRPITSKGFKGPQGAKGTSGSPGSAGKTGIVGNKG-----------ENGYPGKRGIDGDNGIPGSKGEEGETGI------KGHAGRPGNL---------GKSGLQGLRGEYGVKGDLGIQGIPGRKGVMGDPGPNGYAMIGSKGDKGIKGLPGIYGAKGD--------------KGRPGYIGIPGFKGETGLIGRSGLKGDQGEIGEKGIKGFTFISNNPGDRGLLGNKGLKGFPGELGNKGQVGVCTVRGDQGLRGYSGLIGDMGMKG---EQGSKGIVGDYGA---ASRSGIMGRTGKIGNQGLPGDQXXXXXXXXXXXXXXXXYIGIPGFEGDRGEKGNKGFPGFPGDIGQPGRLGNPGISTEGVXXXXXXXXXXXXXXXXXXXXXXXXXXKQGDSGIS----------------IPGRQGIKGEDGTIGLPGEMGEPGPRGDFGQKGNIGITGEFGLQGNRG-------------------------------------DDGLKGDDGIPGLNGPRGFIG---------DIGF---VGFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXELGLDGSMGGKGDNGPRGFNGPTGIPGSKG--FEGDKGIRGDIG---VKGFQGQHGEIGFPGLKGVSGENGRQXXXXXXXXXXXXXXXXVCMQPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEVG-ESIRGLQGRKGSTGLRGNIGIPGERGDKG------IPGLQGKVGNKGV--------------KGDIGDKGFSGNIGDKGYSGISGDKGSFGVKGDKGFQGDVGMLGKSGLQGDRGQKGIIGFRGTRGIPGSMGLPGEIGE 4343
            +LP+       LL ++ +  S  +           +IC    C C G KGR G PGP G  G+ G  GD+G  G  GP G KG  G  G QG KG RG  G        GEMG+PGI G  GE      +G+ GCDG+   QG  G PG NG+ G  G+PG++G  G+ G   I   G KGN+G  G  G  G  G   ++G KG  GY+G+ G KG+ G  GP G  G   +   ++I        G  G KG+ G    G  + +  + G  G  G  GD+G +G  G  G +G++G+ GARG  G  G  G+ G  GE G  G+ G  G PG +GADG  G  GERG  G  G+ G  G  G  G   PS    S PG  G +G  G PG +G  G  G  G  G IG  G  G+ G  G  GP     E+G  G  G  G PG +G  G+ G  G  G+ G+P  G  +  P GE G  G  G+ G +G++G +G  G+KG  G G          GP G RG  GDDG NG  G+ G  G++GD       CP C  G +G +G+ G+ G  G++G  G  G  G        G  GL G+ GR G+KG  G +G  G+ G++G     G  I      KGE G+ G  G++G+ G+ G +GR G  G KG +G  G+RG    +G  G  G  G +G+DG                  + GI GE+G  GD G +G+ G+   G + +    P    G+ GP+G KG  G  G+ G  G +G++G             GYPG  G  G  G PG  G +GE G+      KG  G PG           G+SG++G  G+ G  G  G+ G PG KGV G+ GP+G          G  GLPG  G +GD               GR    G  G KGE G +G++G  G +G IG      F+      G RGLLGN GL+G PG  G  G  G+    G++G  GY+G  GD+G +G   E G KG+ GD G       +G+ GR G+ GN G PG           G KG   Y GI G +G+ G  G  G+PG PG  GQ G +G+   + +GV G  G  G PGP G PG  GL G   ++GD G+                  PGR GI G  G  G PG  G  GP+G+ G  G  G  G+ G QG RG                                     D GL+G+ G  G  GP GFIG         DIG+   +GF G++G +G +G++G RG     +   KG +G+ G  G  G  G  G KG  GP G NGP G  G +G   +G  G +GD+G     G  G+HG IG  G  G  G  G +G SG   +        +  Q                                 GE G +  +G QG  G  G  G +G PG RG  G      I G+ G VG KG               +G+ G  GF G  GD G  G+ G +G  G  G +G QG+VG  G  G QG RG KG +G  G    PG  GLPG  GE
Sbjct:    1 MLPRDLRHLSGLLGVVYLLGSLVSVT-----LADGKICNTTLCDCKGIKGRMGAPGPIGVPGLEGPAGDIGPPGRAGPLGEKGDVGEYGEQGEKGHRGDIGP------KGEMGYPGIMGKSGEPGTPGPRGIDGCDGRPGMQGPSGAPGQNGVRGPPGKPGQQGPPGEAGEGGINSKGTKGNRGETGQPGGVGPPGFDGDRGSKGDTGYAGLTGEKGDPGLPGPKGDTGAVSELPYSLI--------GPPGAKGEPGDSLSGVLKPDDTLKGYKGYVGLQGDEGPQGPTGEQGAVGRNGLPGARGEIGGPGERGKPGKDGEPGRFGDKGMKGAPGWTGADGLDGSPGERGEDGFTGMPGVQGGAGPPGIYDPS-LTKSLPGPIGSQGDIGPPGEQGPPGLPGKPGRRGPIGLAGQSGDPGLNGSRGPP-GRSERGEAGDYGFIGPPGPQGPPGEAGLPGRYGLHGEP--GQNVVGPKGEPGLNGQPGLEGYRGDRGEVGLPGDKGLPGEGYNIVGPPGSQGPPGFRGLPGDDGYNGLRGLPGEKGLRGDD------CPVCNAGPRGPRGQEGDTGYPGSHGNRGAIGLTGP------RGVQGLQGNPGRAGHKGLPGPAGIPGEPGKVGAAGPDGKAIEVGSLRKGEIGDTGDSGHRGDTGDDGEKGRDGSDGSKGERGETGQRGDYGDAGYQGRDGEPGRDGRDGAPGRNATTPKVYLIGEPGYDGIKGERGDDGDTGFKGVKGEPNPGQIYDNTGEP-GEDGYTGPKGVKGAKGEQGAIGLRGEIGDRGPAGEVIPGPVGAKGYPGPTGDYGQQGAPGLPGRDGEPGLDGGIGYKGQRGVPGQEVIQGEIGPPGRSGIKGFPGDVGAPGQYGLAGRPGPKGVKGEQGPDGAV--------GQTGLPGNKGQRGDFLVGPPGPKGQPGRNGRQAPHGAKGQKGEVGSLGQNGQNGAKGSIG------FS------GRRGLLGNAGLQGLPGSPGIPGLPGMIGEIGERGEIGYNGRQGDIGPRGPNGEFGPKGLSGDDGPDGYPGANGLPGRKGETGNPGFPG---------RPGAKGVAAYSGIKGDDGESGLTGPIGYPGAPGAKGQRGPVGDSQPALDGVAGRKGEVGSPGPNGLPGRHGLKG---QRGDRGLPGQQGRPGEPGAKGLGGYPGRNGINGLKGATGFPGPQGPKGPQGESGVVGLDGRNGQIGDQGPRGLIGEQGEQGEQGDEGEVGIPGRLENLRDRSFYRGFTGDQGLQGERGEQGDMGPIGFIGPPGAKGERGDIGYAGQLGFDGAEGLKGFQGDQGPRGPPGITLPAEKGDEGVAGLDGRAGRPGHFGQKGAPGPPGENGPNGAIGHRGPQIQGPPGPQGDVGFPGAPGHNGRHGLIGPKGELGDMGRQGERGESGYAIVGRQGDIGDIGFQ---------------------------------GEPGWDGAKGEQGYPGLPGKNGRVGAPGPRGPTGDAGWGGIDGMDGLVGPKGQPGVTYSYSMARPGDRGEPGLDGFQGEEGDGGAPGLIGFQGQRGAVGYRGDQGEVGYTGADGPQGQRGDKGYMGLTGA---PGLRGLPGPQGE 1503          

HSP 2 Score: 240.35 bits (612), Expect = 3.179e-63
Identity = 165/466 (35.41%), Postives = 230/466 (49.36%), Query Frame = 3
Query: 3996 GLQGRKGSTGLRGNIGIPGERGDKGIPGLQGKVGNK--GVKGDIGDKGFSGNIG------DKGYSGISGDKGSFGVKGDKGFQGDVG---MLGKSGLQGDRGQKGIIGFRGTRGIPGSMGLPGEIGEKGDVGPSGI-GVKGLKGYQNAVGIKGRKGEKGLPGFPGRPGKVGDQGDKGPKGMKNMNTXXXXXXXXXXXXXXXXXXXXXXXXXLPGDMGEIGPNGPIGYADNGFLYATHSQSKDFPPCHGGGSPLYNGYSLLAIHGDIDSVTMDLGTPGSCLKNFSTIPFVNCFLERNTFYGGRCHVNMRNSRSYWLSTLQSYMSSPQPPSKMD--DYISRCSVCQTKTTVMAFHSQKSDWQMTKCPYGWQKLWAGFSFPMAVQASRSGSNQPFSSPGSCLKHFRSLPFIECNNHNSNCNHWRDGVSYYMTAVDSENQFVKAQGKVLKSQTDIMNSISKCVVCQRDMN 5351
            G  G  G  G  G IG  GE GD G  G +G+ G    G +GDIGD GF G  G      ++GY G+ G  G  G  G +G  GD G   + G  GL G +GQ G+  +  +   PG  G PG  G +G+ G  G  G+ G +G + AVG +G +GE G  G  G  G+ GD+G  G  G   +                          GLPG  GE  P         GF++A HSQS   P C    + L+ GYSL        +V  DLG  GSC+  F+T+P++ C +         CH    N  S WLST +    +  P    D   YISRC VC+T T ++A HSQ     +  CP GW+++W G+S+ M+   +  G  Q   SPGSCL+ FR+ P IEC+ H   CN++    S+++T ++ ++QFV+ + + LK+  D  + IS+C VC+R  N
Sbjct: 1312 GFPGAPGHNGRHGLIGPKGELGDMGRQGERGESGYAIVGRQGDIGDIGFQGEPGWDGAKGEQGYPGLPGKNGRVGAPGPRGPTGDAGWGGIDGMDGLVGPKGQPGVT-YSYSMARPGDRGEPGLDGFQGEEGDGGAPGLIGFQGQRGAVGYRGDQGEVGYTGADGPQGQRGDKGYMGLTGAPGLR-------------------------GLPGPQGEPAPAP-PAPKSRGFIFARHSQSVHVPQCPANTNLLWEGYSLSGNVAASRAVGQDLGQSGSCMMRFTTMPYMLCDITN------VCHFAQNNDDSLWLSTAEPMPMTMTPIQGRDLMKYISRCVVCETTTRIIALHSQS--MSIPDCPGGWEEMWTGYSYFMSTLDNVGGVGQNLVSPGSCLEEFRAQPVIECHGH-GRCNYYDALASFWLTVIEEQDQFVQPRQQTLKA--DFTSKISRCTVCRRRGN 1739          

HSP 3 Score: 143.28 bits (360), Expect = 1.171e-33
Identity = 295/864 (34.14%), Postives = 377/864 (43.63%), Query Frame = 3
Query: 2196 CATRPITSKGFKGPQGAKGTSGSPGSAGKTGIVGNKGENGYPGKRGIDGDNGIPGSKGEEGETGIKGHAGRPGNLGKSGLQGL---RGEYGVKGDLGIQG---IPGRKGVMGDPGPNGY---------AMIGSKGDKGIKGLPGIYGA---------KGDKGRPGYIGIPGFKGETGLIGRSGLKGDQGEIGEKGIKGFTFISNNPGDRGLLGNKGLKGFPGELGNKGQVGVCTVRGDQGLRGYSGLIGDMGMKGEQGSKGIVGDYGAASRSGIMGRTGKIG---NQGLPGDQXXXXXXXXXXXXXXXXYIGIPGFEGDRGEKGNKGFPGFPGDIGQPGRLGNPGIS----TEGVXXXXXXXXXXXXXXXXXXXXXXXXXXKQGDSGISIPGRQGIKGEDGTIGLPGEMGEPGPRGDFGQKG---------NIGITGEFGLQGNRGDDGLKGDDGIPGLNGPRGFIGDIGFVGFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXELGLDGSMG--GKGDN-----------------GPRGFNGPTGIPGSKGFEGD---------KGIRGDIGVKGFQGQHGEIGFPGLKGVSGENGRQXXXXXXXXXXXXXXXXVCMQPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEVGESIRGLQGRKGSTGLRGNIGIPGERGDKGIPGLQGKVGNKGVKGDIGDKGFSGN------------------------IGDKGYSGISGDKGSFGVKGDKGFQGDVG---MLGKSGLQGDRGQKGIIGFRGTRGIPGSMGLPGEIGEKGDVGPSGIGVKGLKGYQNAVGIKGRKGEKGLPGFPGRPGKVGDQGDKGPKGM 4502
            C T     KG KG  GA G  G PG  G  G +G  G  G  G++G  G+ G  G KG  G+ G KG  G PG +GKSG  G    RG  G  G  G+QG    PG+ GV G PG  G            I SKG KG +G  G  G          +G KG  GY G+ G KG+ GL    G KGD G + E                 L+G  G KG PG+       GV  ++ D  L+GY G +G   ++G++G +G  G+ GA  R+G+ G  G+IG    +G PG  G PG  G KG KG+ G+ G  G +G  GE+G  GF G P   G  G  G PGI     T+ + G  G  G  GP GE G PGL GKPG++G  G++  G+ G  G +G+ G PG   E G  GD+G  G           G+ G +GL G  G + + G  G PGLNG  G  G  G  G                                      E+GL G  G  G+G N                 G  G+NG  G+PG KG  GD         +G RG  G  G+ G HG  G  GL G  G  G QG+ G  G  G  G  G+  +P          K                      EVG   +G  G  G +G RG+ G  GE+G  G  G +G+ G  G +GD GD G+ G                         IG+ GY GI G++G  G  G KG +G+     +   +G  G+ G  G  G +G +G  G++GL GEIG++G  G    G  G KGY    G  G++G  GLPG  G PG  G  G KG +G+
Sbjct:   33 CNTTLCDCKGIKGRMGAPGPIGVPGLEGPAGDIGPPGRAGPLGEKGDVGEYGEQGEKGHRGDIGPKGEMGYPGIMGKSGEPGTPGPRGIDGCDGRPGMQGPSGAPGQNGVRGPPGKPGQQGPPGEAGEGGINSKGTKGNRGETGQPGGVGPPGFDGDRGSKGDTGYAGLTGEKGDPGL---PGPKGDTGAVSELPYS-------------LIGPPGAKGEPGD----SLSGV--LKPDDTLKGYKGYVG---LQGDEGPQGPTGEQGAVGRNGLPGARGEIGGPGERGKPGKDGEPGRFGDKGMKGAPGWTGADGLDGSPGERGEDGFTGMP---GVQGGAGPPGIYDPSLTKSLPGPIGSQGDIGPPGEQGPPGLPGKPGRRGPIGLA--GQSGDPGLNGSRGPPGRS-ERGEAGDYGFIGPPGPQGPPGEAGLPGRYGLHGEPGQN-VVGPKGEPGLNGQPGLEGYRGDRG--------------------------------------EVGLPGDKGLPGEGYNIVGPPGSQGPPGFRGLPGDDGYNGLRGLPGEKGLRGDDCPVCNAGPRGPRGQEGDTGYPGSHGNRGAIGLTGPRGVQGLQGNPGRAGHKGLPGPAGIPGEPGKVGAAGPDGKAI--------------------EVGSLRKGEIGDTGDSGHRGDTGDDGEKGRDGSDGSKGERGETGQRGDYGDAGYQGRDGEPGRDGRDGAPGRNATTPKVYLIGEPGYDGIKGERGDDGDTGFKGVKGEPNPGQIYDNTGEPGEDGYTGPKGVKGAKGEQGAIGLRGEIGDRGPAGEVIPGPVGAKGYPGPTGDYGQQGAPGLPGRDGEPGLDGGIGYKGQRGV 806          

HSP 4 Score: 110.538 bits (275), Expect = 1.185e-23
Identity = 133/355 (37.46%), Postives = 170/355 (47.89%), Query Frame = 3
Query:  216 QGFPGPRGYQGVSGDKGDVGQFGMPGPKGYKGFTGAIGPQGRKGERGIPGSPGYPGKMGEMGFPGIRGDIGEKGLTGCDGQQGDFGNPGMNGLVGRTGQPGERGDDGDRGLSIIPKYGLKGNKGSRGLLGRYGRKGEKGFKGIKGYSGIFGIKGNKGYVGPMGRRGPKGDS----------LGTVIIQSEKGSKGDKGLKGQSGIPCKGFQIEGRMYGRVGSDGPIGDKG---IKGEKGLMGEIGQSGIDGARGLN--GEKGLPGEAGPRGERGDRGNPGFPGDPGASGADGTRGRQGERGPKGVHGISGADGPRGSRGDK---------------GPSGSLLSCPGRKGEKGFF 1190
            +GF G +G QG  G++GD+G  G  GP G KG  G IG  G+ G  G  G  G+ G  G  G PGI     EKG  G  G  G  G PG  G  G  G PGE G +G             G++G + + G  G +G+ GF G  G++G  G+ G KG +G MGR+G +G+S          +G +  Q E G  G KG +G  G+P K  ++     G  G  GP GD G   I G  GL+G  GQ G+  +  +   G++G PG  G +GE GD G PG  G  G  GA G RG QGE G       +GADGP+G RGDK               GP G     P     +GF 
Sbjct: 1187 RGFTGDQGLQGERGEQGDMGPIGFIGPPGAKGERGDIGYAGQLGFDGAEGLKGFQGDQGPRGPPGIT-LPAEKGDEGVAGLDGRAGRPGHFGQKGAPGPPGENGPNG-----------AIGHRGPQ-IQGPPGPQGDVGFPGAPGHNGRHGLIGPKGELGDMGRQGERGESGYAIVGRQGDIGDIGFQGEPGWDGAKGEQGYPGLPGKNGRV-----GAPGPRGPTGDAGWGGIDGMDGLVGPKGQPGVTYSYSMARPGDRGEPGLDGFQGEEGDGGAPGLIGFQGQRGAVGYRGDQGEVG------YTGADGPQGQRGDKGYMGLTGAPGLRGLPGPQGEPAPAPPAPKSRGFI 1517          

HSP 5 Score: 84.3445 bits (207), Expect = 1.030e-15
Identity = 74/184 (40.22%), Postives = 97/184 (52.72%), Query Frame = 3
Query: 3990 IRGLQGRKGSTGLRGNIGIPGERGDKGIPGLQGKVGNKGVKGDIGDKGFSGNIGDKGYSGISGDKGSFGVKGDKGFQGDVGMLGKSGLQGDRGQKGIIGFRGTRGIPGSMGLPGEIGEKGDVGPSGIGVKGLKGYQNAV---------GIKGRKGEKGLPGFPGRPGKVGDQGDKGPKGMKNMN 4514
            ++GL G  G  GL G IG  GERG+ G  G QG +G +G  G+ G KG SG+ G  GY G +G  G  G  G+ GF G  G  G +   G +G  G  G  G  G PG+ G  G+ G  GD  P+  GV G KG   +          G+KG++G++GLPG  GRPG+ G +G  G  G   +N
Sbjct:  931 LQGLPGSPGIPGLPGMIGEIGERGEIGYNGRQGDIGPRGPNGEFGPKGLSGDDGPDGYPGANGLPGRKGETGNPGFPGRPGAKGVAAYSGIKGDDGESGLTGPIGYPGAPGAKGQRGPVGDSQPALDGVAGRKGEVGSPGPNGLPGRHGLKGQRGDRGLPGQQGRPGEPGAKGLGGYPGRNGIN 1114          

HSP 6 Score: 79.337 bits (194), Expect = 3.567e-14
Identity = 86/223 (38.57%), Postives = 107/223 (47.98%), Query Frame = 3
Query: 3993 RGLQGRKGSTGLRGNIGIPGERGDKGIP---------GLQGKVGNKGVKGDIGDKGFSGNIGDKGYSGISGD--------------KGSFGVKGDKGFQGDVGMLGKSGLQGDR------GQKGIIGFRGTRGIPGSMGLP------GEIGEK---------GDVGPSG----IGVKGLK------GYQNAVGIKGRKGEKGLPGFPGRPGKVGDQGDKGPKG 4499
            +G +G  G   ++G IG PG  G KG P         GL G+ G KGVKG+ G  G  G  G  G  G  GD               G     G KG +G+VG LG++G  G +      G++G++G  G +G+PGS G+P      GEIGE+         GD+GP G     G KGL       GY  A G+ GRKGE G PGFPGRPG  G     G KG
Sbjct:  801 KGQRGVPGQEVIQGEIGPPGRSGIKGFPGDVGAPGQYGLAGRPGPKGVKGEQGPDGAVGQTGLPGNKGQRGDFLVGPPGPKGQPGRNGRQAPHGAKGQKGEVGSLGQNGQNGAKGSIGFSGRRGLLGNAGLQGLPGSPGIPGLPGMIGEIGERGEIGYNGRQGDIGPRGPNGEFGPKGLSGDDGPDGYPGANGLPGRKGETGNPGFPGRPGAKGVAAYSGIKG 1023          

HSP 7 Score: 77.7962 bits (190), Expect = 1.199e-13
Identity = 75/181 (41.44%), Postives = 98/181 (54.14%), Query Frame = 3
Query: 3993 RGLQGRKGSTGLRGNIGIPG---ERGDKGI---PGLQGKVGNKGVKGDIGDKGFSGNIGDKGYSGISGDKGSFG-----VKGDKGFQGDVGMLGKSGLQGDRGQKGIIGFRGTRGIPGSMGLPGEIGEK---GDVGPSGI-GVKGLKGYQNAVGIKGRKGEKGLPGFPGRPGKVGDQGDKG 4490
            +GL G  G  G  G  G+PG   E G+ G    PG +G     G+KGD G+ G +G IG  G  G  G +G  G     + G  G +G+VG  G +GL    G+ G+ G RG RG+PG  G PGE G K   G  G +GI G+KG  G+    G KG +GE G+ G  GR G++GDQG +G
Sbjct:  977 KGLSGDDGPDGYPGANGLPGRKGETGNPGFPGRPGAKGVAAYSGIKGDDGESGLTGPIGYPGAPGAKGQRGPVGDSQPALDGVAGRKGEVGSPGPNGLP---GRHGLKGQRGDRGLPGQQGRPGEPGAKGLGGYPGRNGINGLKGATGFPGPQGPKGPQGESGVVGLDGRNGQIGDQGPRG 1154          

HSP 8 Score: 76.6406 bits (187), Expect = 2.646e-13
Identity = 73/198 (36.87%), Postives = 99/198 (50.00%), Query Frame = 3
Query: 3996 GLQGRKGSTGLRGNIGIPGERGDKGIPGLQGKVGNKGVKGDIGDKGFSG------------------------NIGDKG-YSGISGDKGSFGVKGDKGFQGDVGMLGKSGLQGDRGQKGIIGFRGTRGIPGSMGLPGEIGEKGDVGPSGIGVKGLKGYQNAVGIKGRK------GEKGLPGFPGRPGKVGDQGDKGPK 4496
            G  GR G  GL+G  G PG +G KG  G  G VG  G  G IGD+G  G                        N+ D+  Y G +GD+G   ++G++G QGD+G +G  G  G +G++G IG+ G  G  G+ GL G  G++G  GP GI +   KG +   G+ GR       G+KG PG PG  G  G  G +GP+
Sbjct: 1106 GYPGRNGINGLKGATGFPGPQGPKGPQGESGVVGLDGRNGQIGDQGPRGLIGEQGEQGEQGDEGEVGIPGRLENLRDRSFYRGFTGDQG---LQGERGEQGDMGPIGFIGPPGAKGERGDIGYAGQLGFDGAEGLKGFQGDQGPRGPPGITLPAEKGDEGVAGLDGRAGRPGHFGQKGAPGPPGENGPNGAIGHRGPQ 1300          

HSP 9 Score: 76.2554 bits (186), Expect = 3.078e-13
Identity = 90/249 (36.14%), Postives = 113/249 (45.38%), Query Frame = 3
Query: 3990 IRGLQGRKGSTGLRGNIG--------IPGERGDKGIPGLQGKVGNKG---VKGDIGDKGFSGNIGDKGYSG------ISGDKGSFGVKGDKGFQGDVGMLGKSGLQGDRGQKGIIGFRGTRGIPGSMGLPGEIGEKGDV---------------GPSGIGVKGLKGYQNAVGIKGRKGEKGLPGFPGRPGKVGDQGDKGPKGMKNMNTXXXXXXXXXXXXXXXXXXXXXXXXXLPGDMGEIGPNGPIGY 4640
            ++G +G +G+ GLRG IG        IPG  G KG PG  G  G +G   + G  G+ G  G IG KG  G      I G+ G  G  G KGF GDVG  G+ GL G  G KG+ G +G  G  G  GLPG  G++GD                  +  G KG KG   ++G  G+ G KG  GF GR G +G+ G +G  G   +                          GLPG +GEIG  G IGY
Sbjct:  735 VKGAKGEQGAIGLRGEIGDRGPAGEVIPGPVGAKGYPGPTGDYGQQGAPGLPGRDGEPGLDGGIGYKGQRGVPGQEVIQGEIGPPGRSGIKGFPGDVGAPGQYGLAGRPGPKGVKGEQGPDGAVGQTGLPGNKGQRGDFLVGPPGPKGQPGRNGRQAPHGAKGQKGEVGSLGQNGQNGAKGSIGFSGRRGLLGNAGLQGLPGSPGI-------------------------PGLPGMIGEIGERGEIGY 958          

HSP 10 Score: 74.7146 bits (182), Expect = 9.274e-13
Identity = 67/166 (40.36%), Postives = 86/166 (51.81%), Query Frame = 3
Query: 4005 GRKGSTGLRGNIGIPGERGDKGIPGLQGKVGNKGVKGDIGDKGFSGNIGDKGYSGISGDKGSFGVKGDKGFQGDVGMLGKSGLQGDRGQKGIIGFRGTRGIPGSMGLPGEIGEKGDVG-PSGIGVKGLKGYQNAVGIKGRKGEKGLPGFPGRPGKVGDQGDKGPKG 4499
            GR+   G +G  G  G  G  G  G +G +G  G +G +G+ G  G  G  G  G+ G  G  G +G+ G+ G  G +G  G  G+ G KG+ G  G  G PG+ GLPG  GE G+ G P   G KG+  Y    GIKG  GE GL G  G PG  G +G +GP G
Sbjct:  888 GRQAPHGAKGQKGEVGSLGQNGQNGAKGSIGFSGRRGLLGNAGLQGLPGSPGIPGLPGMIGEIGERGEIGYNGRQGDIGPRGPNGEFGPKGLSGDDGPDGYPGANGLPGRKGETGNPGFPGRPGAKGVAAYS---GIKGDDGESGLTGPIGYPGAPGAKGQRGPVG 1050          

HSP 11 Score: 71.633 bits (174), Expect = 7.112e-12
Identity = 37/129 (28.68%), Postives = 58/129 (44.96%), Query Frame = 3
Query: 4983 QTKTTVMAFHSQKSDWQMTKCPYGWQKLWAGFSFPMAVQASRSGSNQPFSSPGSCLKHFRSLPFIECNNHN-SNCNHWRDGVSYYMTAVDSENQFVKAQGKVLKSQTDIMNSISKCVVCQRDMNIV*LK 5366
            +++  + A HSQ     + +CP     LW G+S    V ASR+   Q     GSC+  F ++P++ C+  N  +     D   +  TA          QG+      D+M  IS+CVVC+    I+ L 
Sbjct: 1512 KSRGFIFARHSQSV--HVPQCPANTNLLWEGYSLSGNVAASRA-VGQDLGQSGSCMMRFTTMPYMLCDITNVCHFAQNNDDSLWLSTAEPMPMTMTPIQGR------DLMKYISRCVVCETTTRIIALH 1631          

HSP 12 Score: 71.633 bits (174), Expect = 7.173e-12
Identity = 79/207 (38.16%), Postives = 106/207 (51.21%), Query Frame = 3
Query: 3987 SIRGLQGRKGSTG------LRGNIGIPGERGDKGIPGLQGKVGNKGVKGDIGDKGFSGNIGDKGYSGISGDKGSFGVKGDKGFQGDVGMLGKSGLQGDRGQKGIIGFRGT-------------------------RGIPGSMGLPGEIGEKGDVGPSG-IGVKGLKGYQNAVGIKGR---KGEKGLPGFPGRPGKVGDQGDKGPKGM 4502
            ++ G+ GRKG  G      L G  G+ G+RGD+G+PG QG+ G  G KG +G  G+ G  G  G  G +G  G  G KG +G  G VG+ G++G  GD+G +G+IG +G                          RG  G  GL GE GE+GD+GP G IG  G KG +  +G  G+    G +GL GF       GDQG +GP G+
Sbjct: 1055 ALDGVAGRKGEVGSPGPNGLPGRHGLKGQRGDRGLPGQQGRPGEPGAKG-LG--GYPGRNGINGLKGATGFPGPQGPKGPQGESGVVGLDGRNGQIGDQGPRGLIGEQGEQGEQGDEGEVGIPGRLENLRDRSFYRGFTGDQGLQGERGEQGDMGPIGFIGPPGAKGERGDIGYAGQLGFDGAEGLKGF------QGDQGPRGPPGI 1252          

HSP 13 Score: 64.3142 bits (155), Expect = 1.324e-9
Identity = 65/182 (35.71%), Postives = 88/182 (48.35%), Query Frame = 3
Query: 3990 IRGLQGRKGSTGLRGNIGIPGERGDKGIPGLQGKVGNKGVKGDIGDKGFSGNIGDKGYSGISGDKGSFGVKGDKGFQGDVGMLGKSG--LQGDRGQKGIIGFRGTRGIPGSMGL------PGEIGEKGDVGPSGIGVKGLKGYQNAVGIKGRKGEKGLPGFPGRPGKVGD---QGDKGPKGM 4502
            +  L+ R    G  G+ G+ GERG++G  G  G +G  G KG+ GD G++G +G  G  G+            KGFQGD G  G  G  L  ++G +G+ G  G  G PG  G       PGE G  G +G  G  ++G  G Q  VG  G  G  G  G  G  G++GD   QG++G  G 
Sbjct: 1177 LENLRDRSFYRGFTGDQGLQGERGEQGDMGPIGFIGPPGAKGERGDIGYAGQLGFDGAEGL------------KGFQGDQGPRGPPGITLPAEKGDEGVAGLDGRAGRPGHFGQKGAPGPPGENGPNGAIGHRGPQIQGPPGPQGDVGFPGAPGHNGRHGLIGPKGELGDMGRQGERGESGY 1346          

HSP 14 Score: 57.3806 bits (137), Expect = 1.577e-7
Identity = 73/209 (34.93%), Postives = 98/209 (46.89%), Query Frame = 3
Query: 3993 RGLQGRKGSTGLRGNIGIPGERGDKGIPGLQGK-----------VGNKGVKGDIGDKGFS------------GNIGDKGYSGISGDKGSFGVKGDKGFQGDVGMLGKSGLQGDRGQKGIIGFRGTRGIPGSM------------GLPGEIGEKGDVGPSGIGVKGLKGYQNAVG---IKGRKGEKGLPGFPGRPGKVGDQGDKGPKGMK 4505
            RG+ G  G  G++G  G PG+ G +G PG  G+           + +KG KG+ G+ G              G+ GD GY+G++G+KG  G+ G KG  G V  L  S          +IG  G +G PG              G  G +G +GD GP     +G  G Q AVG   + G +GE G PG  G+PGK G+ G  G KGMK
Sbjct:  119 RGIDGCDGRPGMQGPSGAPGQNGVRGPPGKPGQQGPPGEAGEGGINSKGTKGNRGETGQPGGVGPPGFDGDRGSKGDTGYAGLTGEKGDPGLPGPKGDTGAVSELPYS----------LIGPPGAKGEPGDSLSGVLKPDDTLKGYKGYVGLQGDEGP-----QGPTGEQGAVGRNGLPGARGEIGGPGERGKPGKDGEPGRFGDKGMK 312          

HSP 15 Score: 56.9954 bits (136), Expect = 2.154e-7
Identity = 58/160 (36.25%), Postives = 73/160 (45.62%), Query Frame = 3
Query: 3975 EVGESIRGLQGRKGSTGLRGNIGIPGERGDKGIPGLQGK---VGNKGVKGDIGDKGF--------------------------SGNIGDKGYSGISGDKGSFGVKGDKGFQGDVGMLGKSGLQGDRGQKGIIGFRGTRGIPGSMGLPGEIGEKGDVGPSG 4367
            E G +I G QG  G  G +G  G  G +G++G PGL GK   VG  G +G  GD G+                           G+ G+ G  G  G++G  G  G  GFQG  G +G  G QG+ G  G  G +G RG  G MGL G  G +G  GP G
Sbjct: 1343 ESGYAIVGRQGDIGDIGFQGEPGWDGAKGEQGYPGLPGKNGRVGAPGPRGPTGDAGWGGIDGMDGLVGPKGQPGVTYSYSMARPGDRGEPGLDGFQGEEGDGGAPGLIGFQGQRGAVGYRGDQGEVGYTGADGPQGQRGDKGYMGLTGAPGLRGLPGPQG 1502          

HSP 16 Score: 52.7582 bits (125), Expect = 4.763e-6
Identity = 69/185 (37.30%), Postives = 96/185 (51.89%), Query Frame = 3
Query: 4029 RGNIGIPGERGDKGIPGLQGKVGNKGVKGDIGDKGFSGNIGDKGYSGISGDKGSFGVKGDKGFQGDVGMLGKSGLQGDRGQKGIIGFRGTRGIPGSMGLPGE----------------IGEKGDVGPSGI----GVKGLKGYQNAV---GIKGRKGEKGLPGFPGRPGKVGDQGDKGPKGMKNMN 4514
            RG IG+ G+ GD G+ G +G  G +  +G+ GD GF G  G +G  G +G  G +G+ G+ G Q  VG  G+ GL G  G +G  G RG  G+PG  GLPGE                 G  GD G +G+    G KGL+G    V   G +G +G++G  G+PG  G  G  G  GP+G++ + 
Sbjct:  387 RGPIGLAGQSGDPGLNGSRGPPG-RSERGEAGDYGFIGPPGPQGPPGEAGLPGRYGLHGEPG-QNVVGPKGEPGLNGQPGLEGYRGDRGEVGLPGDKGLPGEGYNIVGPPGSQGPPGFRGLPGDDGYNGLRGLPGEKGLRGDDCPVCNAGPRGPRGQEGDTGYPGSHGNRGAIGLTGPRGVQGLQ 569          
BLAST of Collagen IV NC1 domain-containing protein vs. Ensembl Fly
Match: vkg (gene:FBgn0016075 transcript:FBtr0079036)

HSP 1 Score: 334.339 bits (856), Expect = 2.853e-92
Identity = 566/1607 (35.22%), Postives = 732/1607 (45.55%), Query Frame = 3
Query:   63 LLPKFKNSYHYLLLLIMVSQSYYAQDSDPDPFKCLRICTPDKCQCFGNKGRQGFPGPRGYQGVSGDKGDVGQFGMPGPKGYKGFTGAIGPQGRKGERGIPGSPGYPGKMGEMGFPGIRGDIGE------KGLTGCDGQ---QGDFGNPGMNGLVGRTGQPGERGDDGDRGLSIIPKYGLKGNKGSRGLLGRYGRKG---EKGFKGIKGYSGIFGIKGNKGYVGPMGRRGPKGDSLGTVIIQSEKGSKGDKGLKGQSGIPCKG-FQIEGRMYGRVGSDGPIGDKGIKGEKGLMGEIGQSGIDGARGLNGEKGLPGEAGPRGERGDRGNPGFPGDPGASGADGTRGRQGERGPKGVHGISGADGPRGSRGDKGPSGSLLSCPGRKGEKGFFGIPGIKGDIGNKGYQGHDGDIGEIGFKGEKGYEGPLGPSCSEVEQGFRGTKGESGFPGLRGAKGQRGYSGNKGIKGKPNFGTGINNP-GETGSYGNLGVPGEKGNKGFIGDTGEKGFSGTGKQ--------GPEGPRGDKGDDGVNGQVGMIGMPGIKGDKGSTYPICPFCEKGYKGIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEGRMGLLGSKGRQGYKGGKGFSGSMGDAGEIGYVTISGTTIPG---VKGEKGNQGPKGNKGEFGEAGSRGRKGYSGLKGFKGLIGERGTSFSSGDPGDKGLRGENGKDGVS----------------FAGIPGEKGLKGDKGNRGILGDV--GSLSNCATRPITSKGFKGPQGAKGTSGSPGSAGKTGIVGNKG-----------ENGYPGKRGIDGDNGIPGSKGEEGETGI------KGHAGRPGNL---------GKSGLQGLRGEYGVKGDLGIQGIPGRKGVMGDPGPNGYAMIGSKGDKGIKGLPGIYGAKGD--------------KGRPGYIGIPGFKGETGLIGRSGLKGDQGEIGEKGIKGFTFISNNPGDRGLLGNKGLKGFPGELGNKGQVGVCTVRGDQGLRGYSGLIGDMGMKG---EQGSKGIVGDYGA---ASRSGIMGRTGKIGNQGLPGDQXXXXXXXXXXXXXXXXYIGIPGFEGDRGEKGNKGFPGFPGDIGQPGRLGNPGISTEGVXXXXXXXXXXXXXXXXXXXXXXXXXXKQGDSGIS----------------IPGRQGIKGEDGTIGLPGEMGEPGPRGDFGQKGNIGITGEFGLQGNRG-------------------------------------DDGLKGDDGIPGLNGPRGFIG---------DIGF---VGFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXELGLDGSMGGKGDNGPRGFNGPTGIPGSKG--FEGDKGIRGDIG---VKGFQGQHGEIGFPGLKGVSGENGRQXXXXXXXXXXXXXXXXVCMQPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEVG-ESIRGLQGRKGSTGLRGNIGIPGERGDKG------IPGLQGKVGNKGV--------------KGDIGDKGFSGNIGDKGYSGISGDKGSFGVKGDKGFQGDVGMLGKSGLQGDRGQKGIIGFRGTRGIPGSMGLPGEIGE 4343
            +LP+       LL ++ +  S  +           +IC    C C G KGR G PGP G  G+ G  GD+G  G  GP G KG  G  G QG KG RG  G        GEMG+PGI G  GE      +G+ GCDG+   QG  G PG NG+ G  G+PG++G  G+ G   I   G KGN+G  G  G  G  G   ++G KG  GY+G+ G KG+ G  GP G  G   +   ++I        G  G KG+ G    G  + +  + G  G  G  GD+G +G  G  G +G++G+ GARG  G  G  G+ G  GE G  G+ G  G PG +GADG  G  GERG  G  G+ G  G  G  G   PS    S PG  G +G  G PG +G  G  G  G  G IG  G  G+ G  G  GP     E+G  G  G  G PG +G  G+ G  G  G+ G+P  G  +  P GE G  G  G+ G +G++G +G  G+KG  G G          GP G RG  GDDG NG  G+ G  G++GD       CP C  G +G +G+ G+ G  G++G  G  G  G        G  GL G+ GR G+KG  G +G  G+ G++G     G  I      KGE G+ G  G++G+ G+ G +GR G  G KG +G  G+RG    +G  G  G  G +G+DG                  + GI GE+G  GD G +G+ G+   G + +    P    G+ GP+G KG  G  G+ G  G +G++G             GYPG  G  G  G PG  G +GE G+      KG  G PG           G+SG++G  G+ G  G  G+ G PG KGV G+ GP+G          G  GLPG  G +GD               GR    G  G KGE G +G++G  G +G IG      F+      G RGLLGN GL+G PG  G  G  G+    G++G  GY+G  GD+G +G   E G KG+ GD G       +G+ GR G+ GN G PG           G KG   Y GI G +G+ G  G  G+PG PG  GQ G +G+   + +GV G  G  G PGP G PG  GL G   ++GD G+                  PGR GI G  G  G PG  G  GP+G+ G  G  G  G+ G QG RG                                     D GL+G+ G  G  GP GFIG         DIG+   +GF G++G +G +G++G RG     +   KG +G+ G  G  G  G  G KG  GP G NGP G  G +G   +G  G +GD+G     G  G+HG IG  G  G  G  G +G SG   +        +  Q                                 GE G +  +G QG  G  G  G +G PG RG  G      I G+ G VG KG               +G+ G  GF G  GD G  G+ G +G  G  G +G QG+VG  G  G QG RG KG +G  G    PG  GLPG  GE
Sbjct:    1 MLPRDLRHLSGLLGVVYLLGSLVSVT-----LADGKICNTTLCDCKGIKGRMGAPGPIGVPGLEGPAGDIGPPGRAGPLGEKGDVGEYGEQGEKGHRGDIGP------KGEMGYPGIMGKSGEPGTPGPRGIDGCDGRPGMQGPSGAPGQNGVRGPPGKPGQQGPPGEAGEGGINSKGTKGNRGETGQPGGVGPPGFDGDRGSKGDTGYAGLTGEKGDPGLPGPKGDTGAVSELPYSLI--------GPPGAKGEPGDSLSGVLKPDDTLKGYKGYVGLQGDEGPQGPTGEQGAVGRNGLPGARGEIGGPGERGKPGKDGEPGRFGDKGMKGAPGWTGADGLDGSPGERGEDGFTGMPGVQGGAGPPGIYDPS-LTKSLPGPIGSQGDIGPPGEQGPPGLPGKPGRRGPIGLAGQSGDPGLNGSRGPP-GRSERGEAGDYGFIGPPGPQGPPGEAGLPGRYGLHGEP--GQNVVGPKGEPGLNGQPGLEGYRGDRGEVGLPGDKGLPGEGYNIVGPPGSQGPPGFRGLPGDDGYNGLRGLPGEKGLRGDD------CPVCNAGPRGPRGQEGDTGYPGSHGNRGAIGLTGP------RGVQGLQGNPGRAGHKGLPGPAGIPGEPGKVGAAGPDGKAIEVGSLRKGEIGDTGDSGHRGDTGDDGEKGRDGSDGSKGERGETGQRGDYGDAGYQGRDGEPGRDGRDGAPGRNATTPKVYLIGEPGYDGIKGERGDDGDTGFKGVKGEPNPGQIYDNTGEP-GEDGYTGPKGVKGAKGEQGAIGLRGEIGDRGPAGEVIPGPVGAKGYPGPTGDYGQQGAPGLPGRDGEPGLDGGIGYKGQRGVPGQEVIQGEIGPPGRSGIKGFPGDVGAPGQYGLAGRPGPKGVKGEQGPDGAV--------GQTGLPGNKGQRGDFLVGPPGPKGQPGRNGRQAPHGAKGQKGEVGSLGQNGQNGAKGSIG------FS------GRRGLLGNAGLQGLPGSPGIPGLPGMIGEIGERGEIGYNGRQGDIGPRGPNGEFGPKGLSGDDGPDGYPGANGLPGRKGETGNPGFPG---------RPGAKGVAAYSGIKGDDGESGLTGPIGYPGAPGAKGQRGPVGDSQPALDGVAGRKGEVGSPGPNGLPGRHGLKG---QRGDRGLPGQQGRPGEPGAKGLGGYPGRNGINGLKGATGFPGPQGPKGPQGESGVVGLDGRNGQIGDQGPRGLIGEQGEQGEQGDEGEVGIPGRLENLRDRSFYRGFTGDQGLQGERGEQGDMGPIGFIGPPGAKGERGDIGYAGQLGFDGAEGLKGFQGDQGPRGPPGITLPAEKGDEGVAGLDGRAGRPGHFGQKGAPGPPGENGPNGAIGHRGPQIQGPPGPQGDVGFPGAPGHNGRHGLIGPKGELGDMGRQGERGESGYAIVGRQGDIGDIGFQ---------------------------------GEPGWDGAKGEQGYPGLPGKNGRVGAPGPRGPTGDAGWGGIDGMDGLVGPKGQPGVTYSYSMARPGDRGEPGLDGFQGEEGDGGAPGLIGFQGQRGAVGYRGDQGEVGYTGADGPQGQRGDKGYMGLTGA---PGLRGLPGPQGE 1503          

HSP 2 Score: 240.35 bits (612), Expect = 3.179e-63
Identity = 165/466 (35.41%), Postives = 230/466 (49.36%), Query Frame = 3
Query: 3996 GLQGRKGSTGLRGNIGIPGERGDKGIPGLQGKVGNK--GVKGDIGDKGFSGNIG------DKGYSGISGDKGSFGVKGDKGFQGDVG---MLGKSGLQGDRGQKGIIGFRGTRGIPGSMGLPGEIGEKGDVGPSGI-GVKGLKGYQNAVGIKGRKGEKGLPGFPGRPGKVGDQGDKGPKGMKNMNTXXXXXXXXXXXXXXXXXXXXXXXXXLPGDMGEIGPNGPIGYADNGFLYATHSQSKDFPPCHGGGSPLYNGYSLLAIHGDIDSVTMDLGTPGSCLKNFSTIPFVNCFLERNTFYGGRCHVNMRNSRSYWLSTLQSYMSSPQPPSKMD--DYISRCSVCQTKTTVMAFHSQKSDWQMTKCPYGWQKLWAGFSFPMAVQASRSGSNQPFSSPGSCLKHFRSLPFIECNNHNSNCNHWRDGVSYYMTAVDSENQFVKAQGKVLKSQTDIMNSISKCVVCQRDMN 5351
            G  G  G  G  G IG  GE GD G  G +G+ G    G +GDIGD GF G  G      ++GY G+ G  G  G  G +G  GD G   + G  GL G +GQ G+  +  +   PG  G PG  G +G+ G  G  G+ G +G + AVG +G +GE G  G  G  G+ GD+G  G  G   +                          GLPG  GE  P         GF++A HSQS   P C    + L+ GYSL        +V  DLG  GSC+  F+T+P++ C +         CH    N  S WLST +    +  P    D   YISRC VC+T T ++A HSQ     +  CP GW+++W G+S+ M+   +  G  Q   SPGSCL+ FR+ P IEC+ H   CN++    S+++T ++ ++QFV+ + + LK+  D  + IS+C VC+R  N
Sbjct: 1312 GFPGAPGHNGRHGLIGPKGELGDMGRQGERGESGYAIVGRQGDIGDIGFQGEPGWDGAKGEQGYPGLPGKNGRVGAPGPRGPTGDAGWGGIDGMDGLVGPKGQPGVT-YSYSMARPGDRGEPGLDGFQGEEGDGGAPGLIGFQGQRGAVGYRGDQGEVGYTGADGPQGQRGDKGYMGLTGAPGLR-------------------------GLPGPQGEPAPAP-PAPKSRGFIFARHSQSVHVPQCPANTNLLWEGYSLSGNVAASRAVGQDLGQSGSCMMRFTTMPYMLCDITN------VCHFAQNNDDSLWLSTAEPMPMTMTPIQGRDLMKYISRCVVCETTTRIIALHSQS--MSIPDCPGGWEEMWTGYSYFMSTLDNVGGVGQNLVSPGSCLEEFRAQPVIECHGH-GRCNYYDALASFWLTVIEEQDQFVQPRQQTLKA--DFTSKISRCTVCRRRGN 1739          

HSP 3 Score: 143.28 bits (360), Expect = 1.171e-33
Identity = 295/864 (34.14%), Postives = 377/864 (43.63%), Query Frame = 3
Query: 2196 CATRPITSKGFKGPQGAKGTSGSPGSAGKTGIVGNKGENGYPGKRGIDGDNGIPGSKGEEGETGIKGHAGRPGNLGKSGLQGL---RGEYGVKGDLGIQG---IPGRKGVMGDPGPNGY---------AMIGSKGDKGIKGLPGIYGA---------KGDKGRPGYIGIPGFKGETGLIGRSGLKGDQGEIGEKGIKGFTFISNNPGDRGLLGNKGLKGFPGELGNKGQVGVCTVRGDQGLRGYSGLIGDMGMKGEQGSKGIVGDYGAASRSGIMGRTGKIG---NQGLPGDQXXXXXXXXXXXXXXXXYIGIPGFEGDRGEKGNKGFPGFPGDIGQPGRLGNPGIS----TEGVXXXXXXXXXXXXXXXXXXXXXXXXXXKQGDSGISIPGRQGIKGEDGTIGLPGEMGEPGPRGDFGQKG---------NIGITGEFGLQGNRGDDGLKGDDGIPGLNGPRGFIGDIGFVGFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXELGLDGSMG--GKGDN-----------------GPRGFNGPTGIPGSKGFEGD---------KGIRGDIGVKGFQGQHGEIGFPGLKGVSGENGRQXXXXXXXXXXXXXXXXVCMQPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEVGESIRGLQGRKGSTGLRGNIGIPGERGDKGIPGLQGKVGNKGVKGDIGDKGFSGN------------------------IGDKGYSGISGDKGSFGVKGDKGFQGDVG---MLGKSGLQGDRGQKGIIGFRGTRGIPGSMGLPGEIGEKGDVGPSGIGVKGLKGYQNAVGIKGRKGEKGLPGFPGRPGKVGDQGDKGPKGM 4502
            C T     KG KG  GA G  G PG  G  G +G  G  G  G++G  G+ G  G KG  G+ G KG  G PG +GKSG  G    RG  G  G  G+QG    PG+ GV G PG  G            I SKG KG +G  G  G          +G KG  GY G+ G KG+ GL    G KGD G + E                 L+G  G KG PG+       GV  ++ D  L+GY G +G   ++G++G +G  G+ GA  R+G+ G  G+IG    +G PG  G PG  G KG KG+ G+ G  G +G  GE+G  GF G P   G  G  G PGI     T+ + G  G  G  GP GE G PGL GKPG++G  G++  G+ G  G +G+ G PG   E G  GD+G  G           G+ G +GL G  G + + G  G PGLNG  G  G  G  G                                      E+GL G  G  G+G N                 G  G+NG  G+PG KG  GD         +G RG  G  G+ G HG  G  GL G  G  G QG+ G  G  G  G  G+  +P          K                      EVG   +G  G  G +G RG+ G  GE+G  G  G +G+ G  G +GD GD G+ G                         IG+ GY GI G++G  G  G KG +G+     +   +G  G+ G  G  G +G +G  G++GL GEIG++G  G    G  G KGY    G  G++G  GLPG  G PG  G  G KG +G+
Sbjct:   33 CNTTLCDCKGIKGRMGAPGPIGVPGLEGPAGDIGPPGRAGPLGEKGDVGEYGEQGEKGHRGDIGPKGEMGYPGIMGKSGEPGTPGPRGIDGCDGRPGMQGPSGAPGQNGVRGPPGKPGQQGPPGEAGEGGINSKGTKGNRGETGQPGGVGPPGFDGDRGSKGDTGYAGLTGEKGDPGL---PGPKGDTGAVSELPYS-------------LIGPPGAKGEPGD----SLSGV--LKPDDTLKGYKGYVG---LQGDEGPQGPTGEQGAVGRNGLPGARGEIGGPGERGKPGKDGEPGRFGDKGMKGAPGWTGADGLDGSPGERGEDGFTGMP---GVQGGAGPPGIYDPSLTKSLPGPIGSQGDIGPPGEQGPPGLPGKPGRRGPIGLA--GQSGDPGLNGSRGPPGRS-ERGEAGDYGFIGPPGPQGPPGEAGLPGRYGLHGEPGQN-VVGPKGEPGLNGQPGLEGYRGDRG--------------------------------------EVGLPGDKGLPGEGYNIVGPPGSQGPPGFRGLPGDDGYNGLRGLPGEKGLRGDDCPVCNAGPRGPRGQEGDTGYPGSHGNRGAIGLTGPRGVQGLQGNPGRAGHKGLPGPAGIPGEPGKVGAAGPDGKAI--------------------EVGSLRKGEIGDTGDSGHRGDTGDDGEKGRDGSDGSKGERGETGQRGDYGDAGYQGRDGEPGRDGRDGAPGRNATTPKVYLIGEPGYDGIKGERGDDGDTGFKGVKGEPNPGQIYDNTGEPGEDGYTGPKGVKGAKGEQGAIGLRGEIGDRGPAGEVIPGPVGAKGYPGPTGDYGQQGAPGLPGRDGEPGLDGGIGYKGQRGV 806          

HSP 4 Score: 110.538 bits (275), Expect = 1.185e-23
Identity = 133/355 (37.46%), Postives = 170/355 (47.89%), Query Frame = 3
Query:  216 QGFPGPRGYQGVSGDKGDVGQFGMPGPKGYKGFTGAIGPQGRKGERGIPGSPGYPGKMGEMGFPGIRGDIGEKGLTGCDGQQGDFGNPGMNGLVGRTGQPGERGDDGDRGLSIIPKYGLKGNKGSRGLLGRYGRKGEKGFKGIKGYSGIFGIKGNKGYVGPMGRRGPKGDS----------LGTVIIQSEKGSKGDKGLKGQSGIPCKGFQIEGRMYGRVGSDGPIGDKG---IKGEKGLMGEIGQSGIDGARGLN--GEKGLPGEAGPRGERGDRGNPGFPGDPGASGADGTRGRQGERGPKGVHGISGADGPRGSRGDK---------------GPSGSLLSCPGRKGEKGFF 1190
            +GF G +G QG  G++GD+G  G  GP G KG  G IG  G+ G  G  G  G+ G  G  G PGI     EKG  G  G  G  G PG  G  G  G PGE G +G             G++G + + G  G +G+ GF G  G++G  G+ G KG +G MGR+G +G+S          +G +  Q E G  G KG +G  G+P K  ++     G  G  GP GD G   I G  GL+G  GQ G+  +  +   G++G PG  G +GE GD G PG  G  G  GA G RG QGE G       +GADGP+G RGDK               GP G     P     +GF 
Sbjct: 1187 RGFTGDQGLQGERGEQGDMGPIGFIGPPGAKGERGDIGYAGQLGFDGAEGLKGFQGDQGPRGPPGIT-LPAEKGDEGVAGLDGRAGRPGHFGQKGAPGPPGENGPNG-----------AIGHRGPQ-IQGPPGPQGDVGFPGAPGHNGRHGLIGPKGELGDMGRQGERGESGYAIVGRQGDIGDIGFQGEPGWDGAKGEQGYPGLPGKNGRV-----GAPGPRGPTGDAGWGGIDGMDGLVGPKGQPGVTYSYSMARPGDRGEPGLDGFQGEEGDGGAPGLIGFQGQRGAVGYRGDQGEVG------YTGADGPQGQRGDKGYMGLTGAPGLRGLPGPQGEPAPAPPAPKSRGFI 1517          

HSP 5 Score: 84.3445 bits (207), Expect = 1.030e-15
Identity = 74/184 (40.22%), Postives = 97/184 (52.72%), Query Frame = 3
Query: 3990 IRGLQGRKGSTGLRGNIGIPGERGDKGIPGLQGKVGNKGVKGDIGDKGFSGNIGDKGYSGISGDKGSFGVKGDKGFQGDVGMLGKSGLQGDRGQKGIIGFRGTRGIPGSMGLPGEIGEKGDVGPSGIGVKGLKGYQNAV---------GIKGRKGEKGLPGFPGRPGKVGDQGDKGPKGMKNMN 4514
            ++GL G  G  GL G IG  GERG+ G  G QG +G +G  G+ G KG SG+ G  GY G +G  G  G  G+ GF G  G  G +   G +G  G  G  G  G PG+ G  G+ G  GD  P+  GV G KG   +          G+KG++G++GLPG  GRPG+ G +G  G  G   +N
Sbjct:  931 LQGLPGSPGIPGLPGMIGEIGERGEIGYNGRQGDIGPRGPNGEFGPKGLSGDDGPDGYPGANGLPGRKGETGNPGFPGRPGAKGVAAYSGIKGDDGESGLTGPIGYPGAPGAKGQRGPVGDSQPALDGVAGRKGEVGSPGPNGLPGRHGLKGQRGDRGLPGQQGRPGEPGAKGLGGYPGRNGIN 1114          

HSP 6 Score: 79.337 bits (194), Expect = 3.567e-14
Identity = 86/223 (38.57%), Postives = 107/223 (47.98%), Query Frame = 3
Query: 3993 RGLQGRKGSTGLRGNIGIPGERGDKGIP---------GLQGKVGNKGVKGDIGDKGFSGNIGDKGYSGISGD--------------KGSFGVKGDKGFQGDVGMLGKSGLQGDR------GQKGIIGFRGTRGIPGSMGLP------GEIGEK---------GDVGPSG----IGVKGLK------GYQNAVGIKGRKGEKGLPGFPGRPGKVGDQGDKGPKG 4499
            +G +G  G   ++G IG PG  G KG P         GL G+ G KGVKG+ G  G  G  G  G  G  GD               G     G KG +G+VG LG++G  G +      G++G++G  G +G+PGS G+P      GEIGE+         GD+GP G     G KGL       GY  A G+ GRKGE G PGFPGRPG  G     G KG
Sbjct:  801 KGQRGVPGQEVIQGEIGPPGRSGIKGFPGDVGAPGQYGLAGRPGPKGVKGEQGPDGAVGQTGLPGNKGQRGDFLVGPPGPKGQPGRNGRQAPHGAKGQKGEVGSLGQNGQNGAKGSIGFSGRRGLLGNAGLQGLPGSPGIPGLPGMIGEIGERGEIGYNGRQGDIGPRGPNGEFGPKGLSGDDGPDGYPGANGLPGRKGETGNPGFPGRPGAKGVAAYSGIKG 1023          

HSP 7 Score: 77.7962 bits (190), Expect = 1.199e-13
Identity = 75/181 (41.44%), Postives = 98/181 (54.14%), Query Frame = 3
Query: 3993 RGLQGRKGSTGLRGNIGIPG---ERGDKGI---PGLQGKVGNKGVKGDIGDKGFSGNIGDKGYSGISGDKGSFG-----VKGDKGFQGDVGMLGKSGLQGDRGQKGIIGFRGTRGIPGSMGLPGEIGEK---GDVGPSGI-GVKGLKGYQNAVGIKGRKGEKGLPGFPGRPGKVGDQGDKG 4490
            +GL G  G  G  G  G+PG   E G+ G    PG +G     G+KGD G+ G +G IG  G  G  G +G  G     + G  G +G+VG  G +GL    G+ G+ G RG RG+PG  G PGE G K   G  G +GI G+KG  G+    G KG +GE G+ G  GR G++GDQG +G
Sbjct:  977 KGLSGDDGPDGYPGANGLPGRKGETGNPGFPGRPGAKGVAAYSGIKGDDGESGLTGPIGYPGAPGAKGQRGPVGDSQPALDGVAGRKGEVGSPGPNGLP---GRHGLKGQRGDRGLPGQQGRPGEPGAKGLGGYPGRNGINGLKGATGFPGPQGPKGPQGESGVVGLDGRNGQIGDQGPRG 1154          

HSP 8 Score: 76.6406 bits (187), Expect = 2.646e-13
Identity = 73/198 (36.87%), Postives = 99/198 (50.00%), Query Frame = 3
Query: 3996 GLQGRKGSTGLRGNIGIPGERGDKGIPGLQGKVGNKGVKGDIGDKGFSG------------------------NIGDKG-YSGISGDKGSFGVKGDKGFQGDVGMLGKSGLQGDRGQKGIIGFRGTRGIPGSMGLPGEIGEKGDVGPSGIGVKGLKGYQNAVGIKGRK------GEKGLPGFPGRPGKVGDQGDKGPK 4496
            G  GR G  GL+G  G PG +G KG  G  G VG  G  G IGD+G  G                        N+ D+  Y G +GD+G   ++G++G QGD+G +G  G  G +G++G IG+ G  G  G+ GL G  G++G  GP GI +   KG +   G+ GR       G+KG PG PG  G  G  G +GP+
Sbjct: 1106 GYPGRNGINGLKGATGFPGPQGPKGPQGESGVVGLDGRNGQIGDQGPRGLIGEQGEQGEQGDEGEVGIPGRLENLRDRSFYRGFTGDQG---LQGERGEQGDMGPIGFIGPPGAKGERGDIGYAGQLGFDGAEGLKGFQGDQGPRGPPGITLPAEKGDEGVAGLDGRAGRPGHFGQKGAPGPPGENGPNGAIGHRGPQ 1300          

HSP 9 Score: 76.2554 bits (186), Expect = 3.078e-13
Identity = 90/249 (36.14%), Postives = 113/249 (45.38%), Query Frame = 3
Query: 3990 IRGLQGRKGSTGLRGNIG--------IPGERGDKGIPGLQGKVGNKG---VKGDIGDKGFSGNIGDKGYSG------ISGDKGSFGVKGDKGFQGDVGMLGKSGLQGDRGQKGIIGFRGTRGIPGSMGLPGEIGEKGDV---------------GPSGIGVKGLKGYQNAVGIKGRKGEKGLPGFPGRPGKVGDQGDKGPKGMKNMNTXXXXXXXXXXXXXXXXXXXXXXXXXLPGDMGEIGPNGPIGY 4640
            ++G +G +G+ GLRG IG        IPG  G KG PG  G  G +G   + G  G+ G  G IG KG  G      I G+ G  G  G KGF GDVG  G+ GL G  G KG+ G +G  G  G  GLPG  G++GD                  +  G KG KG   ++G  G+ G KG  GF GR G +G+ G +G  G   +                          GLPG +GEIG  G IGY
Sbjct:  735 VKGAKGEQGAIGLRGEIGDRGPAGEVIPGPVGAKGYPGPTGDYGQQGAPGLPGRDGEPGLDGGIGYKGQRGVPGQEVIQGEIGPPGRSGIKGFPGDVGAPGQYGLAGRPGPKGVKGEQGPDGAVGQTGLPGNKGQRGDFLVGPPGPKGQPGRNGRQAPHGAKGQKGEVGSLGQNGQNGAKGSIGFSGRRGLLGNAGLQGLPGSPGI-------------------------PGLPGMIGEIGERGEIGY 958          

HSP 10 Score: 74.7146 bits (182), Expect = 9.274e-13
Identity = 67/166 (40.36%), Postives = 86/166 (51.81%), Query Frame = 3
Query: 4005 GRKGSTGLRGNIGIPGERGDKGIPGLQGKVGNKGVKGDIGDKGFSGNIGDKGYSGISGDKGSFGVKGDKGFQGDVGMLGKSGLQGDRGQKGIIGFRGTRGIPGSMGLPGEIGEKGDVG-PSGIGVKGLKGYQNAVGIKGRKGEKGLPGFPGRPGKVGDQGDKGPKG 4499
            GR+   G +G  G  G  G  G  G +G +G  G +G +G+ G  G  G  G  G+ G  G  G +G+ G+ G  G +G  G  G+ G KG+ G  G  G PG+ GLPG  GE G+ G P   G KG+  Y    GIKG  GE GL G  G PG  G +G +GP G
Sbjct:  888 GRQAPHGAKGQKGEVGSLGQNGQNGAKGSIGFSGRRGLLGNAGLQGLPGSPGIPGLPGMIGEIGERGEIGYNGRQGDIGPRGPNGEFGPKGLSGDDGPDGYPGANGLPGRKGETGNPGFPGRPGAKGVAAYS---GIKGDDGESGLTGPIGYPGAPGAKGQRGPVG 1050          

HSP 11 Score: 71.633 bits (174), Expect = 7.112e-12
Identity = 37/129 (28.68%), Postives = 58/129 (44.96%), Query Frame = 3
Query: 4983 QTKTTVMAFHSQKSDWQMTKCPYGWQKLWAGFSFPMAVQASRSGSNQPFSSPGSCLKHFRSLPFIECNNHN-SNCNHWRDGVSYYMTAVDSENQFVKAQGKVLKSQTDIMNSISKCVVCQRDMNIV*LK 5366
            +++  + A HSQ     + +CP     LW G+S    V ASR+   Q     GSC+  F ++P++ C+  N  +     D   +  TA          QG+      D+M  IS+CVVC+    I+ L 
Sbjct: 1512 KSRGFIFARHSQSV--HVPQCPANTNLLWEGYSLSGNVAASRA-VGQDLGQSGSCMMRFTTMPYMLCDITNVCHFAQNNDDSLWLSTAEPMPMTMTPIQGR------DLMKYISRCVVCETTTRIIALH 1631          

HSP 12 Score: 71.633 bits (174), Expect = 7.173e-12
Identity = 79/207 (38.16%), Postives = 106/207 (51.21%), Query Frame = 3
Query: 3987 SIRGLQGRKGSTG------LRGNIGIPGERGDKGIPGLQGKVGNKGVKGDIGDKGFSGNIGDKGYSGISGDKGSFGVKGDKGFQGDVGMLGKSGLQGDRGQKGIIGFRGT-------------------------RGIPGSMGLPGEIGEKGDVGPSG-IGVKGLKGYQNAVGIKGR---KGEKGLPGFPGRPGKVGDQGDKGPKGM 4502
            ++ G+ GRKG  G      L G  G+ G+RGD+G+PG QG+ G  G KG +G  G+ G  G  G  G +G  G  G KG +G  G VG+ G++G  GD+G +G+IG +G                          RG  G  GL GE GE+GD+GP G IG  G KG +  +G  G+    G +GL GF       GDQG +GP G+
Sbjct: 1055 ALDGVAGRKGEVGSPGPNGLPGRHGLKGQRGDRGLPGQQGRPGEPGAKG-LG--GYPGRNGINGLKGATGFPGPQGPKGPQGESGVVGLDGRNGQIGDQGPRGLIGEQGEQGEQGDEGEVGIPGRLENLRDRSFYRGFTGDQGLQGERGEQGDMGPIGFIGPPGAKGERGDIGYAGQLGFDGAEGLKGF------QGDQGPRGPPGI 1252          

HSP 13 Score: 64.3142 bits (155), Expect = 1.324e-9
Identity = 65/182 (35.71%), Postives = 88/182 (48.35%), Query Frame = 3
Query: 3990 IRGLQGRKGSTGLRGNIGIPGERGDKGIPGLQGKVGNKGVKGDIGDKGFSGNIGDKGYSGISGDKGSFGVKGDKGFQGDVGMLGKSG--LQGDRGQKGIIGFRGTRGIPGSMGL------PGEIGEKGDVGPSGIGVKGLKGYQNAVGIKGRKGEKGLPGFPGRPGKVGD---QGDKGPKGM 4502
            +  L+ R    G  G+ G+ GERG++G  G  G +G  G KG+ GD G++G +G  G  G+            KGFQGD G  G  G  L  ++G +G+ G  G  G PG  G       PGE G  G +G  G  ++G  G Q  VG  G  G  G  G  G  G++GD   QG++G  G 
Sbjct: 1177 LENLRDRSFYRGFTGDQGLQGERGEQGDMGPIGFIGPPGAKGERGDIGYAGQLGFDGAEGL------------KGFQGDQGPRGPPGITLPAEKGDEGVAGLDGRAGRPGHFGQKGAPGPPGENGPNGAIGHRGPQIQGPPGPQGDVGFPGAPGHNGRHGLIGPKGELGDMGRQGERGESGY 1346          

HSP 14 Score: 57.3806 bits (137), Expect = 1.577e-7
Identity = 73/209 (34.93%), Postives = 98/209 (46.89%), Query Frame = 3
Query: 3993 RGLQGRKGSTGLRGNIGIPGERGDKGIPGLQGK-----------VGNKGVKGDIGDKGFS------------GNIGDKGYSGISGDKGSFGVKGDKGFQGDVGMLGKSGLQGDRGQKGIIGFRGTRGIPGSM------------GLPGEIGEKGDVGPSGIGVKGLKGYQNAVG---IKGRKGEKGLPGFPGRPGKVGDQGDKGPKGMK 4505
            RG+ G  G  G++G  G PG+ G +G PG  G+           + +KG KG+ G+ G              G+ GD GY+G++G+KG  G+ G KG  G V  L  S          +IG  G +G PG              G  G +G +GD GP     +G  G Q AVG   + G +GE G PG  G+PGK G+ G  G KGMK
Sbjct:  119 RGIDGCDGRPGMQGPSGAPGQNGVRGPPGKPGQQGPPGEAGEGGINSKGTKGNRGETGQPGGVGPPGFDGDRGSKGDTGYAGLTGEKGDPGLPGPKGDTGAVSELPYS----------LIGPPGAKGEPGDSLSGVLKPDDTLKGYKGYVGLQGDEGP-----QGPTGEQGAVGRNGLPGARGEIGGPGERGKPGKDGEPGRFGDKGMK 312          

HSP 15 Score: 56.9954 bits (136), Expect = 2.154e-7
Identity = 58/160 (36.25%), Postives = 73/160 (45.62%), Query Frame = 3
Query: 3975 EVGESIRGLQGRKGSTGLRGNIGIPGERGDKGIPGLQGK---VGNKGVKGDIGDKGF--------------------------SGNIGDKGYSGISGDKGSFGVKGDKGFQGDVGMLGKSGLQGDRGQKGIIGFRGTRGIPGSMGLPGEIGEKGDVGPSG 4367
            E G +I G QG  G  G +G  G  G +G++G PGL GK   VG  G +G  GD G+                           G+ G+ G  G  G++G  G  G  GFQG  G +G  G QG+ G  G  G +G RG  G MGL G  G +G  GP G
Sbjct: 1343 ESGYAIVGRQGDIGDIGFQGEPGWDGAKGEQGYPGLPGKNGRVGAPGPRGPTGDAGWGGIDGMDGLVGPKGQPGVTYSYSMARPGDRGEPGLDGFQGEEGDGGAPGLIGFQGQRGAVGYRGDQGEVGYTGADGPQGQRGDKGYMGLTGAPGLRGLPGPQG 1502          

HSP 16 Score: 52.7582 bits (125), Expect = 4.763e-6
Identity = 69/185 (37.30%), Postives = 96/185 (51.89%), Query Frame = 3
Query: 4029 RGNIGIPGERGDKGIPGLQGKVGNKGVKGDIGDKGFSGNIGDKGYSGISGDKGSFGVKGDKGFQGDVGMLGKSGLQGDRGQKGIIGFRGTRGIPGSMGLPGE----------------IGEKGDVGPSGI----GVKGLKGYQNAV---GIKGRKGEKGLPGFPGRPGKVGDQGDKGPKGMKNMN 4514
            RG IG+ G+ GD G+ G +G  G +  +G+ GD GF G  G +G  G +G  G +G+ G+ G Q  VG  G+ GL G  G +G  G RG  G+PG  GLPGE                 G  GD G +G+    G KGL+G    V   G +G +G++G  G+PG  G  G  G  GP+G++ + 
Sbjct:  387 RGPIGLAGQSGDPGLNGSRGPPG-RSERGEAGDYGFIGPPGPQGPPGEAGLPGRYGLHGEPG-QNVVGPKGEPGLNGQPGLEGYRGDRGEVGLPGDKGLPGEGYNIVGPPGSQGPPGFRGLPGDDGYNGLRGLPGEKGLRGDDCPVCNAGPRGPRGQEGDTGYPGSHGNRGAIGLTGPRGVQGLQ 569          
BLAST of Collagen IV NC1 domain-containing protein vs. Ensembl Zebrafish
Match: col4a2 (collagen, type IV, alpha 2 [Source:ZFIN;Acc:ZDB-GENE-070725-3])

HSP 1 Score: 271.552 bits (693), Expect = 6.981e-73
Identity = 448/1406 (31.86%), Postives = 586/1406 (41.68%), Query Frame = 3
Query:   75 FKNSYHYLLLLIMVSQSYYAQDSDPDPFKCLRICTPDKCQCFGNKGRQGFPGPRGYQGVSGDKGDVGQFGMPGPKGYKGFTGAIGPQGRKGERGIPGSPGYPGKMGEMGFPGIRGDIGEKGLTGCDGQQGDFGNPGMNGL---VGRTGQPGERGDDGDRGLSIIPKYGLKGNKGSRGLLGRYGRKGEKGFKGIKGYSGIFGIKGNKGYVGPMGRRGPKGDSLGTVIIQSEKGSKGDKGLKGQSGIPCKGFQIEGRMYGRVGSDGPIGDKGIKGEKGLMGEIGQSGIDGARGLNGEKGLPGEAGPRGERGDRGNPGFPGDPGASGADGTRGR-------------------------QGERGPKGVHG-------------ISGADGPRGSRGDKGPSGS------------------LLSCPGRKG--EKGFFGIPGIKGDIGNKGYQGHDGDIG--EIGFKGEKGYEGPLGPSCSEVEQGFRGTKGESGFPGLRGAKGQRGYSGNKGI------KGKPNFGTGINNPGETGSYGNLGVPGEKGNKGFIGDTGEKGFSGTGKQGPEGPRGDKGDDGVNGQVGMIG--------------MPGIKGDKGSTYPICPFCEKGYKGIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEGRMGLLGSKGRQGY------KGGKGFSGSMGDA---------------------GEIGYVTISGTT-IPGVKGEKGNQGPKGNKGEFGEAGSRGRKGYSGLKGFKGLIGERGTSFSSGDPGDKGLRGENGKDGVS-FAGIPGEKGLKGDKGNRGILGDVGSLSNCATRPIT-------------------SKGFKGPQGAKGTSGSPGSAGKTGIVGNKGENGYPGK---------RGIDGDNGIPGSKGEEGETGIKGHAGRPGNLGKSGLQGLRGEYGV---KGDLGIQGIPGRKGVMGDPGPNGYAMIGSKGDKGIKGLPGIYGAKGDKGRPGYIGIPGFKGETGLIGRS----GLKGDQGEIGEKGIKGFTFISNNPGDRGLLGNKGLKGFPGELGNKGQVGVCTVRGDQGLRGYSGLIG-DMGMKGEQGSKGIVGDYGAASRSGIMGRTGKIGNQGLPGDQXXXXXXXXXXXXXXXXYIGIPGFEGDRGEKGNKGFPGFPGDIG---QPGRLGNPGISTEGVXXXXXXXXXXXXXXXXXXXXXXXXXXKQGDSGISIPGRQGIKGEDGTIGLPG-----EMGEPGPRGDFGQKG----NIGITGEFGLQGNRGDDGLKGDDGIPGLNGPRGFIGDIGFVGFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXELGLDGSMGGKGDNGPRGFNGPTGIPGSKGFEGDKGIRGDIGVKGFQGQHGEIGFPGLKGVSGENGRQ 3812
            F++    + ++I+ S ++        P    R C+   CQC+  KG +G PGP G QG +G KG  G+ G+ GPKG KG  G  G  G KG  G+ G PG+ G  G  G PG  G  G+ G  GC+G +GD G PG  GL    G  G PG +G+ GD     +     +G+ G  G  G  G  G+ G++G+ G+ G +G +G KG  G  G R        T I++  KG  G+ G  G  G+  +   I     G  G    +G KG KG+ G +    +SG+ G  G  G  GL G  GPRG   D G PGFPG+ G  G  G  G                           G +G KG  G             + G +GPRG +G  G +G                    +  PG KG  E+ F G PG +G  G+ G +G  GD G  E   K   G  GP G S      G  G +G+ G PG +GA G  G+ G +G+      KG+        + G+ G  G+ G PGE+G  G  G  GE GF G   +GP G  G KG  G  G+ G+IG              + G+ GD G T            G  G  G  G+  + G +         G PG  G  GL G +G +G+      KG  GFSG +GD                      G++GY    G    PG+ G+ G  G  G KGE GE         SG  G  GL G RG +  +GDPG  G  G  G  G++   G  G  GL+G++G  G  G  G                                G  G +G KG  G PG+ G TG +G  G+ G  G          +G  G  G+ G  G+ GE G+KG +G  G +G  G QG +G  G    KGD G+ G PG K V+         M GSKGD G  G PG  G +G KG PG   IPG +G+ G  G      G+KG  GE G +G KG       PG  GL G +G  G  G  GNKG  G     GD G++G+ G +G  + + G  G +G  G  G+    G+ G  G+ G+ GL G +G  G +G  G  G  G  G+ GF G +G KG  G PG  G  G   QPG+ G PG+                                       I G  G+KG+ G  G+PG     + G PG +G+ G+ G      G+ G  G +G  GD G KG+ G  G+ GP+   G  GF                                                  KG  G  GF G  GIPG  G  G  GI    G KG +G  G+ G  G KGV G+ G +
Sbjct:   12 FRSFTLIITVVILTSTTFSGVKKSTGPCGG-RDCS-GGCQCYPEKGARGLPGPLGPQGPTGPKGRQGEPGLQGPKGMKGEHGEAGFVGPKGSVGMEGVPGFNGADGVPGHPGPSGARGKAGPDGCNGTRGDSGMPGFPGLEGGQGTPGWPGMKGEKGDPLEVWVYMERFRGDPGPAGFPGIVGPTGDPGYRGLPGFQGPWGPQGLKGAKGQKGER--------TKILKGVKGELGEIGEPGPPGVFSQTSPIPSDWQGEKGK---MGSKGDKGDLGYLSTKAESGVSGFAGARGNPGLDGWPGPRG---DTGLPGFPGNNGRKGDVGEPGELVGSPFDDTGVGPPGPPGERGPVGNYGRKGAKGQPGPPGPPPYGQQTVELWGPEGPRGPKGASGETGEPGNPATQPGPPGPDGSPGSVGPPGPKGSLEEYFKGSPGHRGRPGSAGKKGPKGDHGLCECSVKPPPGPPGPPGDSGDPGMAGEWGQQGDQGDPGTKGANGLPGFPGTEGLPGPKGRKGELMEAVQKGSAGDPGDPGHSGFPGEQGRPGIDGRDGEPGFRGPPGEGPVGEPGAKGYSGPPGRSGLIGPKGNPGQVLGATKGLSGLPGDDGQTG---------PDGRTGPPGPPGDCSSRGGSQWSIPVECIGDPGPPGESGLPGPRGLEGFPGVPGPKGTAGFSGDLGDKGERGEPGRGGPPGPKGFTGPRGDLGYPGTKGVKGPPGLSGKPGLDGASGGKGEHGEV----FGASSGAPGDPGLPGHRGDTGLTGDPGLPGYFGMEGMPGMTGLKGESGPPGLQGEQGRPGPPGTFGFPGQTGYTGPPGPPGNIGEPGPSGRRGDQGEPGLIGARGVKGAIGDPGNIGVTGNIGPPGDQGETGGPGFFGLPGLKGSKGGQGMTGFPGKTGERGLKGFSGTKGEIGLPGHQGAKGAPGSPGQKGDRGLTGPPGDKPVIHITPHMKEVMKGSKGDHGNMGDPGFTGPRGTKGFPG---IPGGEGKDGHPGEPSVVKGVKGLPGEPGLEGPKGM------PGPTGLPGIEGFPGMSGPKGNKGSSGAYGRPGDSGIKGFKGDLGPTISLPGSTGLRGETGHPGSTGAKGLYGMPGERGSSGLDGIEGMKGYQGEPGTVGPPGSDGLQGFPGSQGHKGRSGDPGQTGTTGIQGQPGQKGFPGLK-------------------------------------GIFGLDGLKGQKGNQGVPGTDNWGQPGNPGTKGELGETGIPSTTTGVPGSLGHKGTTGDSGNKGEIGQRGVPGPQ---GQQGFSDI-----------------------------------------------KGTQGDYGFPGIKGIPGFPGTRGTPGIPSPFGAKGDRGNVGDFGLFGEKGVQGDRGEK 1292          

HSP 2 Score: 268.085 bits (684), Expect = 8.589e-72
Identity = 180/517 (34.82%), Postives = 244/517 (47.20%), Query Frame = 3
Query: 3978 VGESIRGLQGRKGSTGLRGNIGIPGERGDKGIPGLQGKVGNKGVKGDIGDKGFSGNIGDKGYSGISGDKG---SFGVKGDKGFQGDVGMLGKSGLQGDRGQKGIIGF------RGTRGIPGSMGLPGEIGEKGDVGPSG-----------------------------------IGVKGLKGYQNA------------VGIKGRKGEKGLPGFPGRPGKVGDQGDKGPKGMKNMNTXXXXXXXXXXXXXXXXXXXXXXXXXLPGDMGEIGPNGPIGYA----DNGFLYATHSQSKDFPPCHGGGSPLYNGYSLLAIHGDIDSVTMDLGTPGSCLKNFSTIPFVNCFLERNTFYGGRCHVNMRNSRSYWLSTLQSYMSSPQPPSKMDDYISRCSVCQTKTTVMAFHSQKSDWQMTKCPYGWQKLWAGFSFPMAVQASRSGSNQPFSSPGSCLKHFRSLPFIECNNHNSNCNHWRDGVSYYMTAVDSENQFVKAQGKVLKSQTDIMNSISKCVVCQRDM 5348
            +  +  G+ G  G  G  G+ G  GE G +G+PG QG+ G   +KG  GD GF G  G  G+ G  G  G    FG KGD+G  GD G+ G+ G+QGDRG+KG  G       +G +G PG MG PG  G +GD GP G                                   +G++G  G                VG  G KG  GLPG PG PG  G+ G  G  G++                               G  G  G  GP+G A    + G+L   HSQS++ P C  G S L+ GYSLL   G   +   DLG  GSCL  F+T+PF+ C        G  C+   RN +SYWLST Q     P   S++  YISRCSVC+  +  +A HSQ  D  +  CP GW+ LW G+SF M   A   G  Q  +SPGSCL+ FR+ PFIECN     C+++ +  S+++T++D   Q   +   +   Q  +++ IS+C VC +++
Sbjct: 1191 IPSTTTGVPGSLGHKGTTGDSGNKGEIGQRGVPGPQGQQGFSDIKGTQGDYGFPGIKGIPGFPGTRGTPGIPSPFGAKGDRGNVGDFGLFGEKGVQGDRGEKGSSGESGVSGRKGDKGEPGMMGFPGRRGFQGDRGPFGPKGDTGPPGFPGLPGAKGYPPVPQKLPGEQGPPGQMGIQGPSGRNGNPGPAGPPGDSGFVGPSGHKGMPGLPGIPGSPGFRGEPGSMGHSGLQGEQ----------------------------GTRGRPGMPGPLGMAGRSVNVGYLLVKHSQSEEIPMCPQGMSLLWMGYSLLYFEGQEKAHNQDLGLAGSCLPRFNTMPFLYCNP------GDICYYASRNDKSYWLSTTQPIPMMPVEESEIKPYISRCSVCEAPSVAIAVHSQ--DTTIPNCPVGWRSLWIGYSFLMHTAAGDEGGGQSLASPGSCLEDFRTTPFIECNGAKGTCHYFANKHSFWLTSIDESFQSSPSSETLKAGQ--LLSRISRCQVCMKNL 1669          

HSP 3 Score: 247.284 bits (630), Expect = 2.325e-65
Identity = 368/1094 (33.64%), Postives = 481/1094 (43.97%), Query Frame = 3
Query:  198 FGNKGRQGFPGPRGYQGVSGDKGDVGQFGMPGPKGYKG-FTGAIGPQGRKGERGIPGSPGYPGKMGEMGFPGIRGDIGEKGLTGCDGQQGDFGNPGMNGLVGRTGQPGERGDDGDRGLSIIPKYGLKGNKG---------------------SRG---------LLGRYGRKGEKGF---KGIKGYSGIFGIKGNKGYVGPMGRRGPKGDSLGTVIIQSEKGSKGDKGLKGQSGIPCKGFQIEGRMYGRVGSDGPIGDKGIKGEKGLMGEIGQSGIDGARGLNGE-----KGLPGEAGPRGERGDRG---NPGFPGDPGASGADGTRGRQGERGPKGVHGISGADGPRGSRGDKGPSGSLLSCP--------------GRKGEKGFFGIPGIKGDIGNKGYQGHDGDIGEIGFKGEKGYEGPLGPSCSEVEQGFRGTKGESGFPGLRGAKGQRGYSGNKGIKGKPNFGTGINNPGETGSYGNLGVPGEKGNKGFIGDTGEKGFSGTGKQ------GPEGPRGDKGDDGVNGQVGMIGMPGIKGDKGST-YPICPFCEKGYKGIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEGRMGLLGSKGRQGYKGGKGFSGSMGDAGEIGYVTISGTTIPGVKGEKGNQGPKGNKGEFGEAGSRGRKGYSGLKGFKGLIGERGTSFSSGDPGDKGLRGENGKDGVSFA----GIPGEKG---LKGDKGNRGILGDVGSLSNCATRPITSKGFKGPQGAKGTSGSPGSAGKTGIVGNKGENGYPGKRGIDGDNGIPGSKGEEGETGIKGHAGRPGNLGK-------------SGLQGLRGEYGVKGDLGIQGIPGRKGVMGDPGPNGYAMI-GSKGDKGIKGLPGIYGAKGDKGRPGYIGIPGFKGETGLIGRSGLKGDQGEIGEKGIKGFTFISNNPGDRGLLGNKGLKGFPGELGNKGQVGVCTVRGD-------------------QGLRGYSGLIGDMGMKGEQGSKGIVGDYGAASRSGIMGRTGKIGNQGLPGDQXXXXXXXXXXXXXXXXYIGIPGFEGD---------RGEKGNKGFPGFPGDIGQPGRLGN 3143
            +G +G QG PG +G  G+ G  G  G   +PGPKG KG    A+    +KG  G PG PG+ G  GE G PGI G  GE G  G  G+ G  G PG  G  G  G+ G  G  G+ G  +    GL G  G                     SRG          +G  G  GE G    +G++G+ G+ G KG  G+ G +G +       G        G KG  G +G  G P                    G KG+KG  GL G+ G  G  G +G +GE      G PG+ G  G RGD G   +PG PG  G  G  G  G +GE GP G+ G  G  GP G+ G  G +G                    G +GE G  G  G+KG IG+ G  G  G+IG  G +GE G  G          +G +G +G +GFPG  G +G +G+SG KG          I  PG  G+ G  G PG+KG++G  G  G+K              G +G  G+ GD G  G  G  G PGI G +G   +P  P   KG KG+                                        G  G +G KG  G  G              +PG++G  G  GPKGNKG    +G+ GR G SG+KGFKG +G      +   PG  GLRGE G  G + A    G+PGE+G   L G +G +G  G+ G++    +  +  +GF G QG KG SG PG  G TGI G  G+ G+PG +GI G +G+ G KG +G  G   + G+PGN G              +G+ G  G  G  GD G +G  G++GV G  G  G++ I G++GD G  G+ GI G  G +G PG     G KG+ G +G  GL G++G  G++G KG +  S   G +G  G  G+ GFPG  G +G  G    +GD                   Q L G  G  G MG++G  G  G  G  G    SG +G +G  G  GLPG                    G PGF G+         +GE+G +G PG PG +G  GR  N
Sbjct:  478 WGQQGDQGDPGTKGANGLPGFPGTEG---LPGPKGRKGELMEAV----QKGSAGDPGDPGHSGFPGEQGRPGIDGRDGEPGFRGPPGE-GPVGEPGAKGYSGPPGRSGLIGPKGNPGQVLGATKGLSGLPGDDGQTGPDGRTGPPGPPGDCSSRGGSQWSIPVECIGDPGPPGESGLPGPRGLEGFPGVPGPKGTAGFSGDLGDK----GERGEPGRGGPPGPKGFTGPRGDLGYP--------------------GTKGVKGPPGLSGKPGLDGASGGKGEHGEVFGASSGAPGDPGLPGHRGDTGLTGDPGLPGYFGMEGMPGMTGLKGESGPPGLQGEQGRPGPPGTFGFPGQTGYTGPPGPPGNIGEPGPSGRRGDQGEPGLIGARGVKGAIGDPGNIGVTGNIGPPGDQGETGGPGF---FGLPGLKGSKGGQGMTGFPGKTGERGLKGFSGTKGE---------IGLPGHQGAKGAPGSPGQKGDRGLTGPPGDKPVIHITPHMKEVMKGSKGDHGNMGDPGFTGPRGTKGFPGIPGGEGKDGHPGEPSVVKGVKGL---------------------------------------PGEPGLEGPKGMPGPTG--------------LPGIEGFPGMSGPKGNKGS---SGAYGRPGDSGIKGFKGDLGP-----TISLPGSTGLRGETGHPGSTGAKGLYGMPGERGSSGLDGIEGMKGYQGEPGTVGPPGSDGL--QGFPGSQGHKGRSGDPGQTGTTGIQGQPGQKGFPGLKGIFGLDGLKGQKGNQGVPGTD-NWGQPGNPGTKGELGETGIPSTTTGVPGSLGHKGTTGDSGNKGEIGQRGVPGPQGQQGFSDIKGTQGDYGFPGIKGIPGFPGTRGTPGIPSPFGAKGDRGNVGDFGLFGEKGVQGDRGEKGSSGESGVSGRKGDKGEPGMMGFPGRRGFQGDRGPFGPKGDTGPPGFPGLPGAKGYPPVPQKLPGEQGPPGQMGIQGPSGRNGNPGPAGPPGDSGFVGPSGHKGMPGLPG------------------IPGSPGFRGEPGSMGHSGLQGEQGTRGRPGMPGPLGMAGRSVN 1445          

HSP 4 Score: 235.343 bits (599), Expect = 1.151e-61
Identity = 463/1425 (32.49%), Postives = 571/1425 (40.07%), Query Frame = 3
Query:  180 PDKCQ-CFGNKGRQGFPGPRGYQGVSGDKGDVGQFGMP-----------GPKGYKGFTGAIGPQGRKGERGIPGSPGYPGKMGEMGFPGIRGDIGEKG--LTGCDGQQGDFGNPGMNGLVGRT-----------GQPGERGDDGDRG-LSIIPKYGLKGNKGSRGLLGRYGRKGEKGFKGIKGYSGIFGIKGNKGYVGPM-------------------------GRRGPKGDSLG---------TVIIQSEKGSKGDKGLKGQSGIP-----CKGFQIEGRMYGRVGSDGPIGD-----KGIKGEKGLMGEIGQSGIDGARGL-----------------------NGEKGLPGEAGPRGERGDRGNPGFPGDPGASGADGTRGRQGERGPKGVHGISGADGPRGSRGDKGPSGSLLSCPGRKGEKGFFGIPGIKGDIGNKGYQGHDGDIGEIGFKGEKGYEGPLGPSCSEVEQGFRGTKGESGFPGLRG------------------AKGQRGYSGNKGIKGKPNFGTGINNPGETGSYGNLGVPGEKGNKGFIGDTGEKGFSGT----------------GKQGPEGPRGDKGDDGVNGQVGMIGMPGIKGDKGSTYPICPFCEKGYKGIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEGRMGLLGSKGRQGYKGGKGFSGSMGDAGEIGYVTISGTTIPGVKGEKGNQGPKGNKGEFGEAGSRGRKGYSGLKGFKGLIGERGTSFSSGDPGDKGLRGENGKDGVSFAGIPGEKGLKGDKGNRGILGDVG-------SLSNCATRPITSKGFKGPQGAKGTSGSPGSAGKTGIVGNKGENGYPGKRGIDGDNGIPGSKGEEGETG-----------------IKGHAGRPGNLGKSGLQGLRGEYGVKGDLGIQGIPGRKGVMGDPGPNGYAMIGSKGDKGIKGLPGIYGAKGDKGRPGYIGIPGFKGETGLIGRSGLKGDQGEIG---EKGIKGF-------------TFISNNPGDRGLLGNKGLKGFPGELGNKGQVGVCTVRGDQGLRGYSGLIGDMGMKGEQGSKGIVGDYGAASRSGIMGRTGKIGNQGLPGDQXXXXXXXXXXXXXXXXYIGIPGFEGDRGEKGNKGFPGF-----PGDIGQPGRLGNPGI--STEGVXXXXXXXXXXXXXXXXXXXXXXXXXXKQGDSGIS----------IPGRQGIKGEDGTIGLPGEMGEPGPRGDFGQKGNIGITGEFGLQGNRGDD------------GLKGDDGIPGLNGPRGFIGDIGFVGFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXELGLDGSMGGKGDNG------------PRGFNGPTG---IPGSKGFEGDKGIRGD---IGVKGFQGQHGEIGFPGLKGVSGENGRQ 3812
            PD C    G+ G  GFPG  G QG  G  G  G+ G P           G  G  GF G +GP G  G RG+PG   + G  G  G  G +G  GE+   L G  G+ G+ G PG  G+  +T           G+ G +GD GD G LS   + G+ G  G+RG  G  G  G +G  G+ G+ G  G KG+ G  G +                         GR+G KG             TV +   +G +G KG  G++G P       G        G VG  GP G      KG  G +G  G  G+ G  G  GL                        GE G  G+ G  G +G  G PGFPG  G  G  G +G   E   KG  G  G  G  G  G++G  G      GR GE GF G PG +G +G  G +G+ G  G  G  G KG  G          Q    TKG SG PG  G                  ++G   +S      G P        PG  G  G  GVPG KG  GF GD G+KG  G                 G  G  G +G KG  G++G+ G+ G  G KG+ G  +                                                  G+ G  G  G +G +G  GD G  GY  + G  +PG+ G KG  GP G +GE G  G  G  G+ G  G+ G  G  G     G  G +G +GE G       G  G KG  GD GN G+ G++G       +           KG KG QG  G  G  G  G  G  G KGE G PG +G  G  G PG KG+ G TG                 +KG  G  GN+G  G  G RG  G        GIPG +G  G PG            KG+KGLPG  G +G KG PG  G+PG +G  G+ G  G KG  G  G   + GIKGF             T +    G  G  G KGL G PGE G+ G  G+      +G++GY G  G +G  G  G +G  G  G   RSG  G+TG  G QG PG +GFPG              GI G +G +G+KGN+G PG      PG+ G  G LG  GI  +T GV G  G  G  G  G  G  G  G PG QG  G S           PG +GI G  GT G PG     G +GD G  G+ G+ GE G+QG+RG+             G KG+ G+ G  G RGF GD G  G                                     GE G  G MG +G +G              GF GP+G   +PG  G  G  G RG+   +G  G QG+ G  G PG+ G  G  GR 
Sbjct:  131 PDGCNGTRGDSGMPGFPGLEGGQGTPGWPGMKGEKGDPLEVWVYMERFRGDPGPAGFPGIVGPTGDPGYRGLPG---FQGPWGPQGLKGAKGQKGERTKILKGVKGELGEIGEPGPPGVFSQTSPIPSDWQGEKGKMGSKGDKGDLGYLSTKAESGVSGFAGARGNPGLDGWPGPRGDTGLPGFPGNNGRKGDVGEPGELVGSPFDDTGVGPPGPPGERGPVGNYGRKGAKGQPGPPGPPPYGQQTVELWGPEGPRGPKGASGETGEPGNPATQPGPPGPDGSPGSVGPPGPKGSLEEYFKGSPGHRGRPGSAGKKGPKGDHGLCECSVKPPPGPPGPPGDSGDPGMAGEWGQQGDQGDPGTKGANGLPGFPGTEGLPGPKGRKGELMEAVQKGSAGDPGDPGHSGFPGEQGRPG----IDGRDGEPGFRGPPG-EGPVGEPGAKGYSGPPGRSGLIGPKGNPG----------QVLGATKGLSGLPGDDGQTGPDGRTGPPGPPGDCSSRGGSQWSIPVECIGDPGPPGESGLPGPRGLEGFPGVPGPKGTAGFSGDLGDKGERGEPGRGGPPGPKGFTGPRGDLGYPGTKGVKGPPGLSGKPGLDGASGGKGEHGEVFGAS----------------------------------------------SGAPGDPGLPGHRGDTGLTGDPGLPGYFGMEG--MPGMTGLKGESGPPGLQGEQGRPGPPGTFGFPGQTGYTGPPGPPGNIGEPGPSGRRGDQGEPG-----LIGARGVKGAIGDPGNIGVTGNIGPPGDQGETGGPGFFGLPGLKGSKGGQGMTGFPGKTGERGLKGFSGTKGEIGLPGHQGAKGAPGSPGQKGDRGLTGPPGDKPVIHITPHMKEVMKGSKGDHGNMGDPGFTGPRGTKG------FPGIPGGEGKDGHPGEPSVV-------KGVKGLPGEPGLEGPKGMPGPTGLPGIEGFPGMSGPKGNKGSSGAYGRPGDSGIKGFKGDLGPTISLPGSTGLRGETGHPGSTGAKGLYGMPGERGSSGLDGI------EGMKGYQGEPGTVGPPGSDGLQGFPGSQGHKGRSGDPGQTGTTGIQGQPGQKGFPG------------LKGIFGLDGLKGQKGNQGVPGTDNWGQPGNPGTKGELGETGIPSTTTGVPGSLGHKGTTGDSGNKGEIGQRGVPGPQGQQGFSDIKGTQGDYGFPGIKGIPGFPGTRGTPGIPSPFGAKGDRGNVGDFGLFGEKGVQGDRGEKGSSGESGVSGRKGDKGEPGMMGFPGRRGFQGDRGPFG----------PKGDTGPPGFPGLPGAKGYPPVPQKLPGEQGPPGQMGIQGPSGRNGNPGPAGPPGDSGFVGPSGHKGMPGLPGIPGSPGFRGEPGSMGHSGLQGEQGTRGRPGMPGPLGMAGRS 1443          

HSP 5 Score: 229.95 bits (585), Expect = 4.514e-60
Identity = 438/1315 (33.31%), Postives = 552/1315 (41.98%), Query Frame = 3
Query:  216 QGFPGPRGYQGVSGDKGDVGQFGMPGPKGYKGFTGAIGPQGRKGERG--IPGSPGYPGKMGEMGFPGIRGDI--------GEKGLTGCDGQQGDFG------NPGMNGLVGRTGQPGERGDDGDRGLSIIPKYGLKGNKGSRGLLGR----------------------------YGRKGEK----------------------GFKGIKGYSGIFGIKGNKGY-------------VGPMGRRGPKGDSL-GTVIIQSEKGSKGDKGLKGQSGIPCK-------------GFQIEGRMYGRVGSDGPIGDKGIKGEKGLMGEIGQSGIDGARGLNGEKGLPGEAGPRGERGDRGNPGFPGDPGASGADGTRGRQGERGPKG--------VHGISGADGPRGSRGDKGPSGSLLSCPGRKGEKGFFGIPGIKGDIGNKGYQGHDGDIGEIGFKGEKGYEGP---LGPSCSEVEQGFRGTKGESGFPGLRGAKGQRGYSGNKGIKGKPNFGTGINNPGETGS---YGNLGVPGEKGNKGFIGDTGEKGFSGT------------------GKQGPEGPRGDKG---DDGVNGQVGMIGMPGIKGDKGSTYPICPFCEKGYKGIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEGRMGLLGSKGRQGYKGGKGFSGSMGDAGEIGYVTISGTTIPGVKGE------------KGNQGPKGNKGEFGEAGSRGRKGYSGLKGFKGLIGERGTSFSSGDPGDKGLRGENGKDG---VSFAGIPGEKGLKGDKGNRGILGDVGSLSNCATR-----------------PITSKGFKG---------PQGAKGTSGSPGSAGKTGIVGNKGENGYPGKRGIDGDNGIPGSKGE-------EGETGIKGHAGRPGNLGKSGLQGLRGEYGVKGDLGIQGIPGRKGVMGDPGPNG----YAMIGSKGDKGIKGLPGIYGAKGDKGRPGYIGIPGFKGETGLIGRSGLKGDQG-----------------EIGEKGIKGFTFISNNPGDRGLLGNKGLKGFPGELGNKG------QVGVCTVRGDQGLRGYSGLIGDMGMKGEQGSKGIVGDYGAASRSGIMGRTGKIGNQGLPGDQXXXXXXXXXXXXXXXXYIGIPGFEGDRGEKGNKGFPGFPGDIGQPGRLGNPGISTEGVXXXXXXXXXXXXXXXXXXXXXXXXXXKQGDSGISIPGRQGIKGEDGTIGLPG------------EMGEPGPRGDFGQKGNIGITGEFGLQ---GNRGDDGLKGDDGI---PGLNGPRGFIGDIGFVGF 3497
            +G PGP G+ G+ G  GD G  G+PG +G  G  G  G +G+KGER   + G  G  G++GE G PG+            GEKG  G  G +GD G        G++G  G  G PG  G  G RG + +P  G  GN G +G +G                             YGRKG K                      G +G KG SG  G  GN                VGP G +G   +   G+   +   GS G KG KG  G+ C+             G   +  M G  G  G  GD G KG  GL G  G  G+ G +G  GE     + G  G+ GD G+ GFPG+ G  G DG  G  G RGP G          G SG  G  G  G KG  G +L        KG  G+PG  G  G  G  G  G  G+   +G   +  P   +G      E G  G +G  GFPG+ G KG  G+SG+ G KG+         PG  G     G+LG PG KG KG  G +G+ G  G                   G  G  G RGD G   D G+ G  GM GMPG+ G KG + P       G +G QG  G  G  G  G  G  G  G  G  G+ G  G  G +G  G  G +G  G++GD G IG     G   PG +GE            KG++G +G  G  G+ G RG KG+SG KG  GL G +G   + G PG KG RG  G  G   V       ++ +KG KG+ G +GD G      T+                 P   KG KG         P+G  G +G PG  G  G+ G KG  G  G  G  GD+GI G KG+        G TG++G  G PG+ G  GL G+ GE G  G  GI+G+ G +G  G  GP G        GS+G KG  G PG  G  G +G+PG  G PG KG  GL G  G KG+QG                 E+GE GI   T  +  PG  G  G  G  G  GE+G +G      Q G   ++G QG  G+ G+ G  G  G +G+ GI   +GA    G +G  G  G +G+ GD+G  GS G  G  G          +GD+GE G  GFPG  G  G  G  G  G +          A    P+ +                   +PG QG  G+ G  G  G            + G  GP G  G  G  GI G  G +   G+ G  GL+G+ G    PG+ GP G  G    VG+
Sbjct:  179 RGDPGPAGFPGIVGPTGDPGYRGLPGFQGPWGPQGLKGAKGQKGERTKILKGVKGELGEIGEPGPPGVFSQTSPIPSDWQGEKGKMGSKGDKGDLGYLSTKAESGVSGFAGARGNPGLDGWPGPRGDTGLP--GFPGNNGRKGDVGEPGELVGSPFDDTGVGPPGPPGERGPVGNYGRKGAKGQPGPPGPPPYGQQTVELWGPEGPRGPKGASGETGEPGNPATQPGPPGPDGSPGSVGPPGPKGSLEEYFKGSPGHRGRPGSAGKKGPKGDHGL-CECSVKPPPGPPGPPGDSGDPGMAGEWGQQGDQGDPGTKGANGLPGFPGTEGLPGPKGRKGELMEAVQKGSAGDPGDPGHSGFPGEQGRPGIDGRDGEPGFRGPPGEGPVGEPGAKGYSGPPGRSGLIGPKGNPGQVLGA-----TKGLSGLPGDDGQTGPDGRTGPPGPPGDCSSRGGSQWSIPVECIGDPGPPGESGLPGPRGLEGFPGVPGPKGTAGFSGDLGDKGERGEPGRGGPPGPKGFTGPRGDLGYPGTKGVKGPPGLSGKPGLDGASGGKGEHGEVFGASSGAPGDPGLPGHRGDTGLTGDPGLPGYFGMEGMPGMTGLKGESGP------PGLQGEQGRPGPPGTFGFPGQTGYTGPPGPPGNIGEPGPSGRRGDQGEPGLIGARGVKGAIGDPGNIGVTGNIGP--PGDQGETGGPGFFGLPGLKGSKGGQGMTGFPGKTGERGLKGFSGTKGEIGLPGHQGAKGAPGSPGQKGDRGLTGPPGDKPVIHITPHMKEVMKGSKGDHGNMGDPGFTGPRGTKGFPGIPGGEGKDGHPGEPSVVKGVKGLPGEPGLEGPKGMPGPTGLPGIEGFPGMSGPKGNKGSSGAYGRPGDSGIKGFKGDLGPTISLPGSTGLRGETGHPGSTGAKGLYGMPGERGSSGLDGIEGMKGYQGEPGTVGPPGSDGLQGFPGSQGHKGRSGDPGQTGTTGIQGQPGQKGFPGLKGIFGLDGLKGQKGNQGVPGTDNWGQPGNPGTKGELGETGIPSTT--TGVPGSLGHKGTTGDSGNKGEIGQRGVPGPQGQQGFSDIKGTQGDYGFPGIKGIPGFPGTRGTPGIPSPFGAKGDRGNVGDFGLFGEKGVQGDRGEKGSSGESGVSGR---------KGDKGEPGMMGFPGRRGFQGDRGPFGPKGDTGPPGFPGLPGAKGYPPVPQ------------------KLPGEQGPPGQMGIQGPSGRNGNPGPAGPPGDSGFVGPSGHKGMPGLPGIPGSPGFRGEPGSMGHSGLQGEQGTRGRPGMPGPLGMAGRSVNVGY 1448          

HSP 6 Score: 196.052 bits (497), Expect = 1.163e-49
Identity = 401/1248 (32.13%), Postives = 492/1248 (39.42%), Query Frame = 3
Query: 1269 KGEKGYEGPLGPSCSEVEQGFRGTKGESGFPGLRGAKGQRGYSGNKGIKGKPNFGTGINNPGETGSYGNLGVPGEKGNKGFIGDTGEKGFSGTGKQGPEGPRGDKGDDGVNGQVGM------IGMPGIKGDKGSTYPICPFCEKGYKGIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEGRMGLLGSKGRQGYKGGKGFSGSMGDAGEIGYVTISGT---TIPGVKGEKGNQGPKGNKGEFGEAGS-----RGRKGYSGLKGFKGLIGERGTSFSSGDPGDKGLRGENGKDGVSFAGIPGEKGLKGDKGNRGILGDVGSLSNCATRPITSKGFK--------------GPQGAKG-------------TSGSPGSAGKTGIVGNKGENGYPGKRGIDGDN----------GIPGSKG--EEGETGIKGHAGRPGNLGKSGLQG--------------------------LRGEYGVKGDLGIQGIPGRKGVMGDPG-PNGYAMIGSKGDKGIKGLPGIYGAKGDKGRPGYIGIPGFKGETGLIGRSGLKG-----DQGEIGEKGIKGFTFISNNPGDRGLLGNKGLKGFPGELGNKGQVGVCTVRGDQGLRGYSGLIGDMGMK-------------------GEQGSKGI--VGDYGAASRSGIMGRTGKIGNQGLPGDQXXXXXXXXXXXXXXXXYIGIPGFEGDRGEK---------------------GNKGFPGFPGDIGQPGRLGNPGISTEGVXXXXXXXXXXXXXXXXXXXXXXXXXXKQGDSGISIPGRQGIKGEDGTI-----GLPGEMGEPGPRGDFGQKGNIGITGEFGLQGNRGDDGLKGDDGIPGLNGPRGFIGDIGFVGFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX----XXXXXXELGLDGSMGGKGDNGPRGFNGPT------------GIPGSKGFEGDKGIRGDIGVKGFQGQHGEIGFPGLKGVSGENGRQXXXXXXXXXXXXXXXXVCMQPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEVGESIRGLQGRKGSTGLRGNIGIPGERGDKGIPGLQGKVGN-------KGVKGDIGDKGFSGNIGDKGYSGISGDKGSFGVKGDKGFQGDVGMLGKSGLQGDRGQKGII----------GFRGTRGIPGSMGLPGEIGEKGDVGPSGI-GVKGLKGYQNAVGIKGRKGEKGLPGFPGRPGKVGDQGDKGPKGMKNMN 4514
            KG +G  GPLGP      QG  G KG  G PGL+G KG +G  G  G  G              GS G  GVPG  G  G  G  G  G    GK GP+G  G +GD G+ G  G+       G PG+KG+KG    +  + E+ ++G                            PG  G  G++G  G  GY+G  GF G  G  G  G     G     + GVKGE G  G  G  G F +        +G KG  G KG KG +G   T   SG  G  G RG  G DG  + G  G+ GL G  GN G  GDVG        P    G                G +GAKG             T    G  G  G  G  GE G PG                  G PG KG  EE   G  GH GRPG+ GK G +G                          + GE+G +GD   QG PG KG  G PG P    + G KG KG        G+ GD G PG+ G PG +G  G+ GR G  G      +G +GE G KG+   S  PG  GL+G KG         N GQV   T       +G SGL GD G                     G Q S  +  +GD G    SG+ G  G  G  G+PG +                  G  GF GD G+K                     G+ G+PG  G  G PG  G PG+                                         G  G KGE G +     G PG+ G PG RGD G  G+ G+ G FG++G  G  GLKG+ G PGL G +G  G  G  GF G  G  G  G  G  G      +     +       G KG +G  G++G  G+ GP G  G T            G  G +G  G  G  G+ G+KGF G  GEIG PG +G  G  G  G  G +GL G  GDK V                                  +   + E ++G +G  G+ G  G  G  G +G  GIPG +GK G+       KGVKG  G+ G  G  G  G +G+ G +G  G+ G KG +G  G  G+ G  G +G KG +          G RG  G PGS G  G  G  G+ G SG+ G++G+KGYQ   G  G  G  GL GFPG  G  G  GD G  G   + 
Sbjct:   54 KGARGLPGPLGP------QGPTGPKGRQGEPGLQGPKGMKGEHGEAGFVGP------------KGSVGMEGVPGFNGADGVPGHPGPSG--ARGKAGPDGCNGTRGDSGMPGFPGLEGGQGTPGWPGMKGEKGDPLEVWVYMER-FRG---------------------------DPGPAGFPGIVGPTGDPGYRGLPGFQGPWGPQGLKGAKGQKGERTKILKGVKGELGEIGEPGPPGVFSQTSPIPSDWQGEKGKMGSKGDKGDLGYLSTKAESGVSGFAGARGNPGLDG--WPGPRGDTGLPGFPGNNGRKGDVGEPGELVGSPFDDTGVGPPGPPGERGPVGNYGRKGAKGQPGPPGPPPYGQQTVELWGPEGPRGPKGASGETGEPGNPATQPGPPGPDGSPGSVGPPGPKGSLEEYFKGSPGHRGRPGSAGKKGPKGDHGLCECSVKPPPGPPGPPGDSGDPGMAGEWGQQGD---QGDPGTKGANGLPGFPGTEGLPGPKGRKGELMEAVQKGSAGDPGDPGHSGFPGEQGRPGIDGRDGEPGFRGPPGEGPVGEPGAKGY---SGPPGRSGLIGPKG---------NPGQVLGAT-------KGLSGLPGDDGQTGPDGRTGPPGPPGDCSSRGGSQWSIPVECIGDPGPPGESGLPGPRGLEGFPGVPGPK------------------GTAGFSGDLGDKGERGEPGRGGPPGPKGFTGPRGDLGYPGTKGVKGPPGLSGKPGLD----------------------------------------GASGGKGEHGEVFGASSGAPGDPGLPGHRGDTGLTGDPGLPGYFGMEGMPGMTGLKGESGPPGLQGEQGRPGPPGTFGFPGQTGYTGPPGPPGNIGEPGPSGRRGDQGEPGLIGARGVKGAIGDPGNIGVTGNIGPPGDQGETGGPGFFGLPGLKGSKGGQGMTGFPGKTGERGLKGFSGTKGEIGLPGHQGAKGAPGSPGQKGDRGLTGPPGDKPVIH--------------------------------ITPHMKEVMKGSKGDHGNMGDPGFTGPRGTKGFPGIPGGEGKDGHPGEPSVVKGVKGLPGEPGLEGPKGMPGPTGLPGIEGFPGMSGPKGNKGSSGAYGRPGDSGIKGFKGDLGPTISLPGSTGLRGETGHPGSTGAKGLYGMPGERGSSGLDGIEGMKGYQGEPGTVGPPGSDGLQGFPGSQGHKGRSGDPGQTGTTGIQ 1139          

HSP 7 Score: 167.548 bits (423), Expect = 6.684e-41
Identity = 271/764 (35.47%), Postives = 349/764 (45.68%), Query Frame = 3
Query:  210 GRQGFPGPRGYQGVSGDKGDVGQFGMPGPKGYKGF---TGAIGPQGRKGERGIPGSPGYPGKMGEMGFPGIRGDIGEKGLTGCDGQQGDFGNPGMNGLVGRTGQPGERGDDGDRGLSIIPKYGLKGNKGSRGLLGRYGRKGEKGFKGIKGYSGIFGIKGNKGYVGPMGRRGPKGD-------------SLGTVIIQSEKGSKGDKGLKGQSGIP----CKGFQIEGRMYGRVGSDGPIGDKG-IKGEKGLMGEI---GQSGIDGARGLNGEKGLPGEAGPRGERGDRGNPGFPGDPGASGADGTRGRQGERGPKGVHGISGADGPRGSRGDKGPSGS--LLSCPGRKGEKGFFGIPGIKGDIGNKGYQGHDGDIGEIGFKGEKGYEGPLGPSCSEVEQGFRGTKGESGFPGLR---GAKGQRGYSGNKGIKGKPNFGTGINNPGETGSYG-------NLGVPGEKGNKGFIGDTGEKGFSGTGKQGPEGPRGDKGDDGVNGQVGMIGMPGIK------GDKGSTYPICPFCEKGYKGIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEGRMGLLGSKGRQGYKGGKGFSGSM------GDAGEIGYVTISGTTIPGVKGEKGNQGPKGNKGEFGEAGSRGRKGYSGLKGFKGLIGERGTSFSSGDPGDKGLRGENGKDGVS----------FAGIPGEK---GLKGDKGNRGILGDVGSLSNCATRPITSKGFKGPQGAKGTSGSPGSAGKTGIVGNKGENGY 2318
            G +G PG  G +G SG  G  G+ G PGP G  GF   TG  GP G              G +GE G  G RGD GE GL G  G +G  G+PG  G+ G  G PG++G+ G  G       GLKG+KG +G+ G  G+ GE+G KG  G  G  G+ G++G  G  G  G KGD              +   + +  KGSKGD G  G  G       KGF     + G  G DG  G+   +KG KGL GE    G  G+ G  GL G +G PG +GP+G +G  G  G PGD       G +G +G+ GP     + G+ G RG  G  G +G+  L   PG +G  G  GI G+KG  G  G  G  G  G  GF G +G++G  G        G +G  G+ GFPGL+   G  G +G  GN+G+ G  N+G    NPG  G  G         GVPG  G+KG  GD+G KG    G++G  GP+G +G   + G  G  G PGIK      G +G+     PF  KG +G                              + G  GL G KG QG +G KG SG        GD GE G +   G    G +G++G  GPKG+ G  G  G  G KGY  +   + L GE+G       PG  G++G +G++G            F G  G K   GL G  G+ G  G+ GS+           G  G QG +GT G PG  G  G+ G     GY
Sbjct:  764 GMEGMPGMTGLKGESGPPGLQGEQGRPGPPGTFGFPGQTGYTGPPGPP------------GNIGEPGPSGRRGDQGEPGLIGARGVKGAIGDPGNIGVTGNIGPPGDQGETGGPGFFG--LPGLKGSKGGQGMTGFPGKTGERGLKGFSGTKGEIGLPGHQGAKGAPGSPGQKGDRGLTGPPGDKPVIHITPHMKEVMKGSKGDHGNMGDPGFTGPRGTKGFP---GIPGGEGKDGHPGEPSVVKGVKGLPGEPGLEGPKGMPGPTGLPGIEGFPGMSGPKGNKGSSGAYGRPGD------SGIKGFKGDLGP--TISLPGSTGLRGETGHPGSTGAKGLYGMPGERGSSGLDGIEGMKGYQGEPGTVGPPGSDGLQGFPGSQGHKGRSGDPGQTGTTGIQGQPGQKGFPGLKGIFGLDGLKGQKGNQGVPGTDNWGQ-PGNPGTKGELGETGIPSTTTGVPGSLGHKGTTGDSGNKGE--IGQRGVPGPQGQQGFSDIKGTQGDYGFPGIKGIPGFPGTRGTPGIPSPFGAKGDRG------------------------------NVGDFGLFGEKGVQGDRGEKGSSGESGVSGRKGDKGEPGMMGFPGRR--GFQGDRGPFGPKGDTGPPGFPGLPGAKGYPPVP--QKLPGEQGP------PGQMGIQGPSGRNGNPGPAGPPGDSGFVGPSGHKGMPGLPGIPGSPGFRGEPGSM-----------GHSGLQGEQGTRGRPGMPGPLGMAGRSVNVGY 1448          

HSP 8 Score: 159.073 bits (401), Expect = 2.784e-38
Identity = 260/750 (34.67%), Postives = 323/750 (43.07%), Query Frame = 3
Query:  201 GNKGRQGFPGPRGYQGVSGDKGDVGQFGMPGP---------------------KGYKGFTGAIGPQGRKGERGIPGSPGY------PGKMGEM------------------GFPGIRGDIGEKGLTGCDGQQGDFGNPGMNGLVGRTGQPGERGD------DGDRGLSIIPKYGLKGNKGSRGLLGRYGRKGEKGFKGIKGYSGIFGIKGNKGYVG-PMGRRGPKGDSLGTVIIQSEKGSKGDKGLKGQSGIPCKGFQIEGRMYGRVGSDGPIGDKGIKGEKGLMGEIGQSGIDGARG-LNGEKGLPGEAGPRGERGDRGNPGFPGDPGASGADGTRGRQGERGPKGVHGISGADGPRGSRGDKGPSGS--LLSCPGRKGEKGFFGIP------GIKGDIGNKGYQGHDGDIGEIGFKGEKGYEGPLGPSCSEVEQGFRGTKGE----------SGFPGLRGAKGQRGYSGNKGIKGKPNFGTGINNPGETGSYGNLGVPGEKGNKGFIGDTGEKGFSGT-GKQGPEGPRGDKGDDGVNGQVGMIGMPGIKGDKGSTYPICPFCEKGYKGIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEGRMGLLGSKGRQGYKGGKGFSGSMGDAGEI---------GYVTISGTTIPGVKGEKGN---QGPKGNKGEFGEAGSRGRKGYSGLKGFKGLIGERGTSFSSGDPGDKGLRGENGKDGVSFAGIPGEKGLKGDKGNRGILGDVGSLSNC 2198
            G  G +G  GP G QG  G  G  G FG PG                      +G +G  G IG +G KG  G PG+ G       PG  GE                   G  G  G  GE+GL G  G +G+ G PG  G  G  G PG++GD       GD+ +  I  +  +  KGS+G  G  G  G  G +G KG+ GI G +G  G+ G P   +G KG       +  E G +G KG+ G +G+P           G  G  G  G KG KG  G  G  G SGI G +G L     LPG  G RGE          G PG++GA G  G  GERG  G+ GI G  G +G  G  GP GS  L   PG +G KG  G P      GI+G  G KG+ G  G  G  G KG+KG +G  G + +  + G  GTKGE          +G PG  G KG  G SGNKG  G+     G+  PG  G  G   + G +G+ GF G  G  GF GT G  G   P G KGD G  G  G+ G  G++GD+G           G KG                              D+G  G++G  GR+G++G +G  G  GD G           GY  +    +PG +G  G    QGP G  G  G AG  G  G+ G  G KG+ G  G       PG  G RGE G  G S  G+ GE+G +G  G  G LG  G   N 
Sbjct:  770 GMTGLKGESGPPGLQGEQGRPGPPGTFGFPGQTGYTGPPGPPGNIGEPGPSGRRGDQGEPGLIGARGVKGAIGDPGNIGVTGNIGPPGDQGETGGPGFFGLPGLKGSKGGQGMTGFPGKTGERGLKGFSGTKGEIGLPGHQGAKGAPGSPGQKGDRGLTGPPGDKPVIHITPHMKEVMKGSKGDHGNMGDPGFTGPRGTKGFPGIPGGEGKDGHPGEPSVVKGVKG-------LPGEPGLEGPKGMPGPTGLP-----------GIEGFPGMSGPKGNKGSSGAYGRPGDSGIKGFKGDLGPTISLPGSTGLRGET---------GHPGSTGAKGLYGMPGERGSSGLDGIEGMKGYQGEPGTVGPPGSDGLQGFPGSQGHKGRSGDPGQTGTTGIQGQPGQKGFPGLKGIFGLDGLKGQKGNQGVPG-TDNWGQPGNPGTKGELGETGIPSTTTGVPGSLGHKGTTGDSGNKGEIGQ----RGV--PGPQGQQGFSDIKGTQGDYGFPGIKGIPGFPGTRGTPGIPSPFGAKGDRGNVGDFGLFGEKGVQGDRGEKGSSGESGVSGRKG------------------------------DKGEPGMMGFPGRRGFQGDRGPFGPKGDTGPPGFPGLPGAKGYPPVP-QKLPGEQGPPGQMGIQGPSGRNGNPGPAGPPGDSGFVGPSGHKGMPGLPGI------PGSPGFRGEPGSMGHS--GLQGEQGTRGRPGMPGPLGMAGRSVNV 1446          

HSP 9 Score: 144.436 bits (363), Expect = 6.908e-34
Identity = 199/597 (33.33%), Postives = 268/597 (44.89%), Query Frame = 3
Query:  201 GNKGRQGFPGPRGYQGVSGDKGDVGQFGMPGPKGYKGFTGAIGPQGRKGERGIPGSPG-----------------YPGKMGEMGFPGIRGDIGEKGLTGCDGQQGDFGNPG----MNGLVGRTGQPGERGDDGDRGLSIIPKY----GLKGNKGSRGLLGRYGRKGEKGFKGIKGYSG-IFGIKGNKGYVGPMGRRGPKGDSLGTVIIQSEKGSKGDKGLKGQSGIPCKGFQIEGRMYGRVGSDGPIGDKGIKGEKGLMGEIGQSGIDGARGLNGEKGLPGEAG---PRGERGDRGNPGFPG--DPGASGADGTRGRQGERG-PKGVHGISGADGPRGSRGDKGPSGSL--LSCPGRKGEKGF---------FGIPGIKGDIGNKGYQGHDG------------DIGEIGFKGEKGYEGPLGPSCSEVEQGFRGTKGESGFPGLRGAKGQRGYSGNKG------------------IKGKPNFGTGINNPGETGSYGNLGVPGEKG------------NKGFIGDTGEKGFSGT----------------------GKQGPEGPRGDKGDDGVNGQVGMIGMPGIKGDKGSTYPICP 1670
            G +G  GFPG  G +G+ G  G  G+ G+PG   ++G  GA G  G+KG+RG+ G PG                   G  G MG PG  G  G KG  G  G +G  G+PG    + G+ G  G+PG  G  G  G + +P      G+ G KG++G  G YGR G+ G KG KG  G    + G+ G  G  G  G    S G   +    G +G  GL G  G+  KG+Q E    G  GSDG  G  G +G KG  G+ GQ+G  G +G  G+KG PG  G     G +G +GN G PG  + G  G  GT+G  GE G P    G+ G+ G +G+ GD G  G +     PG +G++GF         +G PGIKG  G  G +G  G            ++G+ G  GEKG +G  G   S  E G  G KG+ G PG+ G  G+RG+ G++G                   KG P     +  PGE G  G +G+ G  G            + GF+G +G KG  G                       G+QG  G  G  G  G+ G+   +G   +K  +    P+CP
Sbjct:  878 GGQGMTGFPGKTGERGLKGFSGTKGEIGLPG---HQGAKGAPGSPGQKGDRGLTGPPGDKPVIHITPHMKEVMKGSKGDHGNMGDPGFTGPRGTKGFPGIPGGEGKDGHPGEPSVVKGVKGLPGEPGLEGPKGMPGPTGLPGIEGFPGMSGPKGNKGSSGAYGRPGDSGIKGFKGDLGPTISLPGSTGLRGETGHPG----STGAKGLYGMPGERGSSGLDGIEGM--KGYQGEPGTVGPPGSDGLQGFPGSQGHKGRSGDPGQTGTTGIQGQPGQKGFPGLKGIFGLDGLKGQKGNQGVPGTDNWGQPGNPGTKGELGETGIPSTTTGVPGSLGHKGTTGDSGNKGEIGQRGVPGPQGQQGFSDIKGTQGDYGFPGIKGIPGFPGTRGTPGIPSPFGAKGDRGNVGDFGLFGEKGVQGDRGEKGSSGESGVSGRKGDKGEPGMMGFPGRRGFQGDRGPFGPKGDTGPPGFPGLPGAKGYPPVPQKL--PGEQGPPGQMGIQGPSGRNGNPGPAGPPGDSGFVGPSGHKGMPGLPGIPGSPGFRGEPGSMGHSGLQGEQGTRGRPGMPGPLGMAGRSVNVGYLLVKHSQSEEIPMCP 1463          

HSP 10 Score: 123.635 bits (309), Expect = 1.395e-27
Identity = 151/418 (36.12%), Postives = 189/418 (45.22%), Query Frame = 3
Query:  171 ICTPDKCQCFGNKGRQGFPGPRGYQGVSGDKGDVGQFGMPGPKGYKGFTGAIGPQGRKGERGIPGSPGYPGKMGEMGFPGIRGDIGEKGLTGCDGQQGDFGNPGMNGLVGRTGQPGERGDDGDRGLSIIPKYGLKGNKGSRGLLGRYG-RKGEKGFKGIKGYSGIFGIKGNKGYVGPMGRRGPKGDSLGTVIIQSEKGSKGDKGLKGQSGIPCKGFQIEGRMYGRVGSDGPIGDKGIKGEKGLMGEIGQSGIDGARGLNGEKGLPGEAGPRGERGDRGNPGFPGDPGASGADGTRGRQGERG----------------PKGVHGISGADGPRGSRGDKGPSGS--------------LLSCPGRKGEKGFFGIPGIKGDIGNKGYQGHDGDIGEIGFKGEKGYEGPLGPSCSEVEQGF 1331
            I  P      G  G  G  G +G  G+ G++G  G  G+ G KGY+G  G +GP G  G +G PGS G+ G+          GD G+ G TG  GQ G  G PG+ G+ G  G  G++G+ G  G      +G  GN G++G LG  G      G  G  G+ G  G  GNKG +G  G  GP+G    + I    KG++GD G  G  GIP  GF       G  G   P G KG +G  G  G  G+ G+ G R   GEKG  GE+G  G +GD+G PG  G PG  G  G RG  G +G                P     + G  GP G  G +GPSG                +   G KG  G  GIPG  G  G  G  GH G  GE G +G  G  GPLG +   V  G+
Sbjct: 1055 ISLPGSTGLRGETGHPGSTGAKGLYGMPGERGSSGLDGIEGMKGYQGEPGTVGPPGSDGLQGFPGSQGHKGR---------SGDPGQTGTTGIQGQPGQKGFPGLKGIFGLDGLKGQKGNQGVPGTD---NWGQPGNPGTKGELGETGIPSTTTGVPGSLGHKGTTGDSGNKGEIGQRGVPGPQGQQGFSDI----KGTQGDYGFPGIKGIP--GFP---GTRGTPGIPSPFGAKGDRGNVGDFGLFGEKGVQGDR---GEKGSSGESGVSGRKGDKGEPGMMGFPGRRGFQGDRGPFGPKGDTGPPGFPGLPGAKGYPPVPQKLPGEQGPPGQMGIQGPSGRNGNPGPAGPPGDSGFVGPSGHKGMPGLPGIPGSPGFRGEPGSMGHSGLQGEQGTRGRPGMPGPLGMAGRSVNVGY 1448          

HSP 11 Score: 82.4185 bits (202), Expect = 5.852e-15
Identity = 77/188 (40.96%), Postives = 102/188 (54.26%), Query Frame = 3
Query: 3990 IRGLQGRKGSTGLRGNIGIPGERGDKGIPGLQGKVGNKGVKGDIGD------KGFSGNIGDKGYSGISGDKGSFGVKGDKGFQGDVGMLGKSGLQGDRGQKGIIGFRGT--RGIPGSMGLPGEIGEKGDVGPSGIGVKGLKGYQNAVGIKGRKGEKGLPGFPGRPGKV------GDQGDKGPKGMKNM 4511
            +RG  G  GSTG +G  G+PGERG  G+ G++G  G +G  G +G       +GF G+ G KG SG  G  G+ G++G  G +G  G+ G  GL G +GQKG  G  GT   G PG+ G  GE+GE G +  +  GV G  G++   G  G KGE G  G PG  G+       G QGD G  G+K +
Sbjct: 1063 LRGETGHPGSTGAKGLYGMPGERGSSGLDGIEGMKGYQGEPGTVGPPGSDGLQGFPGSQGHKGRSGDPGQTGTTGIQGQPGQKGFPGLKGIFGLDGLKGQKGNQGVPGTDNWGQPGNPGTKGELGETG-IPSTTTGVPGSLGHKGTTGDSGNKGEIGQRGVPGPQGQQGFSDIKGTQGDYGFPGIKGI 1249          

HSP 12 Score: 80.4925 bits (197), Expect = 1.920e-14
Identity = 77/207 (37.20%), Postives = 106/207 (51.21%), Query Frame = 3
Query: 3990 IRGLQGRKGSTGLRGNIGIPGERGDKGI---PGLQGKVGNKGVK------GDIGDKGFSGNI-------------GDKGYSGISGDKGSFGVKGDKGFQGDVGMLGKSGLQGDRGQKGIIGFRGTRGIPGSMGLPGEIGEKGDVGPSGI-------GVKGLKGYQNAVGIKGRKGEKGLPGFP--GRPGKVGDQGDKGPKGMKNMNT 4517
            ++G++G  G  GL G  G+PG  G  GI   PG+ G  GNKG        GD G KGF G++             G+ G+ G +G KG +G+ G++G  G  G+ G  G QG+ G  G  G  G +G PGS G  G  G+ G  G +GI       G  GLKG     G+KG+KG +G+PG    G+PG  G +G+ G  G+ +  T
Sbjct:  990 VKGVKGLPGEPGLEGPKGMPGPTGLPGIEGFPGMSGPKGNKGSSGAYGRPGDSGIKGFKGDLGPTISLPGSTGLRGETGHPGSTGAKGLYGMPGERGSSGLDGIEGMKGYQGEPGTVGPPGSDGLQGFPGSQGHKGRSGDPGQTGTTGIQGQPGQKGFPGLKGIFGLDGLKGQKGNQGVPGTDNWGQPGNPGTKGELGETGIPSTTT 1196          

HSP 13 Score: 80.4925 bits (197), Expect = 2.020e-14
Identity = 83/197 (42.13%), Postives = 107/197 (54.31%), Query Frame = 3
Query: 3990 IRGLQGRKGSTGLRGNIGI---PGERGDKGIPGLQ--GKVGNKGVKGDIGDKGFS-------GNIGDKGYSGISGDKGSFGVKGDKGFQGDVGMLGKSGLQGDRGQKGIIGFRGTRGIPGSMGLPG---EIGEKGDVGPSG-IGVKGLKGYQNAVGIK---------GRKGEKGLPGFPGRPGKVGDQGDKGPKGMK 4505
            I+G  G+KG  GL+G  G+    G++G++G+PG    G+ GN G KG++G+ G         G++G KG +G SG+KG  G +G  G QG  G     G QGD G  GI   +G  G PG+ G PG     G KGD G  G  G+ G KG Q   G K         GRKG+KG PG  G PG+ G QGD+GP G K
Sbjct: 1138 IQGQPGQKGFPGLKGIFGLDGLKGQKGNQGVPGTDNWGQPGNPGTKGELGETGIPSTTTGVPGSLGHKGTTGDSGNKGEIGQRGVPGPQGQQGFSDIKGTQGDYGFPGI---KGIPGFPGTRGTPGIPSPFGAKGDRGNVGDFGLFGEKGVQGDRGEKGSSGESGVSGRKGDKGEPGMMGFPGRRGFQGDRGPFGPK 1331          

HSP 14 Score: 74.7146 bits (182), Expect = 1.265e-12
Identity = 73/176 (41.48%), Postives = 85/176 (48.30%), Query Frame = 3
Query: 4008 RKGSTGLRGNIGIPGERGDKGIPGLQGKVGNKGVKGDIGDKGFSGNIGDKGYSGISGDKGSFGVKGDKGFQGDVGMLGKSGLQGDRGQKGIIGFRGTRGIPGSMGLPGEIGEKGDVGPSGI------GVKGLKGYQNAVGIKGRKGEKGLPGFPGRPGKVGDQGDKGPKGMKNMNT 4517
             KG+ GL G +G  G  G KG  G  G  G KG+KG+ G+ GF G  G  G  G+ G  G+ GV G  G  G  G  G  G  G RG  G+ GF G  G  G+ G PG  GEKGD     +      G  G  G+   VG  G  G +GLPGF    G  G QG KG KG K   T
Sbjct:   53 EKGARGLPGPLGPQGPTGPKGRQGEPGLQGPKGMKGEHGEAGFVGPKGSVGMEGVPGFNGADGVPGHPGPSGARGKAGPDGCNGTRGDSGMPGFPGLEGGQGTPGWPGMKGEKGDPLEVWVYMERFRGDPGPAGFPGIVGPTGDPGYRGLPGF---QGPWGPQGLKGAKGQKGERT 225          

HSP 15 Score: 65.0846 bits (157), Expect = 1.078e-9
Identity = 69/182 (37.91%), Postives = 85/182 (46.70%), Query Frame = 3
Query: 3996 GLQGRKGSTGLRG-------NIGIPGERGDKGIPGLQGKVGNKGVKGDIGDKGFSGNIGDKGYSGISGDKGSFGVKGDKGFQGDVGMLGKSGLQGDRGQKGIIGFR---GTRGIPGSMGLPGEIGEKGDVGPSGIGVKGLKGYQNAVGIKGRKGEKGLP----GFPGRPGKVGDQGDKGPKG 4499
            G  GR G +G++G        I +PG  G +G  G  G  G KG+ G  G++G SG  G +G  G  G+ G+ G  G  G QG  G  G  G  GD GQ G  G +   G +G PG  G+ G  G KG  G  G+      G     G KG  GE G+P    G PG  G  G  GD G KG
Sbjct: 1034 GAYGRPGDSGIKGFKGDLGPTISLPGSTGLRGETGHPGSTGAKGLYGMPGERGSSGLDGIEGMKGYQGEPGTVGPPGSDGLQGFPGSQGHKGRSGDPGQTGTTGIQGQPGQKGFPGLKGIFGLDGLKGQKGNQGVPGTDNWGQPGNPGTKGELGETGIPSTTTGVPGSLGHKGTTGDSGNKG 1215          
BLAST of Collagen IV NC1 domain-containing protein vs. Ensembl Zebrafish
Match: col4a2 (collagen, type IV, alpha 2 [Source:ZFIN;Acc:ZDB-GENE-070725-3])

HSP 1 Score: 265.388 bits (677), Expect = 2.830e-72
Identity = 178/511 (34.83%), Postives = 245/511 (47.95%), Query Frame = 3
Query: 3978 VGESIRGLQGRKGSTGLRGNIGIPGERGDKGIPGLQGKVGNKGVKGDIGDKGFSGNIGDKGYSGISGDKG---SFGVKGDKGFQGDVGMLGKSGLQGDRGQKGIIGF------RGTRGIPGSMGLPGEIGEKGDVGPSGI-----------------------GVKGLKGYQNAVGIKG------------------RKGEKGLPGFPGRPGKVGDQGDKGPKGMKNMNTXXXXXXXXXXXXXXXXXXXXXXXXXLPGDMGEIGPNGPIGYA----DNGFLYATHSQSKDFPPCHGGGSPLYNGYSLLAIHGDIDSVTMDLGTPGSCLKNFSTIPFVNCFLERNTFYGGRCHVNMRNSRSYWLSTLQSYMSSPQPPSKMDDYISRCSVCQTKTTVMAFHSQKSDWQMTKCPYGWQKLWAGFSFPMAVQASRSGSNQPFSSPGSCLKHFRSLPFIECNNHNSNCNHWRDGVSYYMTAVDSENQFVKAQGKVLKSQTDIMNSISKCVVCQRDM 5348
            +  +  G+ G  G  G  G+ G  GE G +G+PG QG+ G   +KG  GD GF G  G  G+ G  G  G    FG KGD+G  GD G+ G+ G+QGDRG+KG  G       +G +G PG MG PG  G +GD GP G                         + G +G    +GI+G                    G KG+PG PG PG  G +G+ G  G   +   +                         G  G  G  GP+G A    + G+L   HSQS++ P C  G S L+ GYSLL   G   +   DLG  GSCL  F+T+PF+ C        G  C+   RN +SYWLST Q     P   S++  YISRCSVC+  +  +A HSQ  D  +  CP GW+ LW G+SF M   A   G  Q  +SPGSCL+ FR+ PFIECN     C+++ +  S+++T++D   Q   +   +   Q  +++ IS+C VC +++
Sbjct:  562 IPSTTTGVPGSLGHKGTTGDSGNKGEIGQRGVPGPQGQQGFSDIKGTQGDYGFPGIKGIPGFPGTRGTPGIPSPFGAKGDRGNVGDFGLFGEKGVQGDRGEKGSSGESGVSGRKGDKGEPGMMGFPGRRGFQGDRGPFGPKGDTGPPGFPGLPGAKGYPPVPQKLPGEQGPPGQMGIQGPSGRNGNPGPAGPPGDSGPSGHKGMPGLPGIPGSPGFRGEPGSMGHSGLQGEQ-------------------------GTRGRPGMPGPLGMAGRSVNVGYLLVKHSQSEEIPMCPQGMSLLWMGYSLLYFEGQEKAHNQDLGLAGSCLPRFNTMPFLYCNP------GDICYYASRNDKSYWLSTTQPIPMMPVEESEIKPYISRCSVCEAPSVAIAVHSQ--DTTIPNCPVGWRSLWIGYSFLMHTAAGDEGGGQSLASPGSCLEDFRTTPFIECNGAKGTCHYFANKHSFWLTSIDESFQSSPSSETLKAGQ--LLSRISRCQVCMKNL 1037          

HSP 2 Score: 205.682 bits (522), Expect = 4.070e-53
Identity = 287/842 (34.09%), Postives = 377/842 (44.77%), Query Frame = 3
Query:  864 GDKGIKGEKGLMGEIGQSGIDGARGLNGE-----KGLPGEAGPRGERGDRG---NPGFPGDPGASGADGTRGRQGERGPKGVHGISGADGPRGSRGDKGPSGSLLSCP--------------GRKGEKGFFGIPGIKGDIGNKGYQGHDGDIGEIGFKGEKGYEGPLGPSCSEVEQGFRGTKGESGFPGLRGAKGQRGYSGNKGIKGKPNFGTGINNPGETGSYGNLGVPGEKGNKGFIGDTGEKGFSGTGKQ------GPEGPRGDKGDDGVNGQVGMIGMPGIKGDKGST-YPICPFCEKGYKGIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEGRMGLLGSKGRQGYKGGKGFSGSMGDAGEIGYVTISGTTIPGVKGEKGNQGPK----GNKGEFGEAGSRGRKGYSGLKGFKGLIGERGTSFSSGDPGDKGLRGENGKDGVSFA----GIPGEKG---LKGDKGNRGILGDVGSLSNCATRPITSKGFKGPQGAKGTSGSPGSAGKTGIVGNKGENGYPGKRGIDGDNGIPGSKGEEGETGIKGHAGRPGNLGK-------------SGLQGLRGEYGVKGDLGIQGIPGRKGVMGDPGPNGYAMI-GSKGDKGIKGLPGIYGAKGDKGRPGYIGIPGFKGETGLIGRSGLKGDQGEIGEKGIKGFTFISNNPGDRGLLGNKGLKGFPGELGNKGQVGVCTVRGD-------------------QGLRGYSGLIGDMGMKGEQGSKGIVGDYGAASRSGIMGRTGKIGNQGLPGDQXXXXXXXXXXXXXXXXYIGIPGFEGD---------RGEKGNKGFPGFPGDIGQPGRLGN 3143
            G KG+KG  GL G+ G  G  G +G +GE      G PG+ G  G RGD G   +PG PG  G  G  G  G +GE GP G+ G  G  GP G+ G  G +G                    G +GE G  G  G+KG IG+ G  G  G+IG  G +GE G  G          +G +G +G +GFPG  G +G +G+SG KG          I  PG  G+ G  G PG+KG++G  G  G+K              G +G  G+ GD G  G  G  G PGI G +G   +P  P   KG KG+                                        G  G +G KG  G  G              +PG++G  G  GPK    GNKG    +G+ GR G SG+KGFKG +G      +   PG  GLRGE G  G + A    G+PGE+G   L G +G +G  G+ G++    +  +  +GF G QG KG SG PG  G TGI G  G+ G+PG +GI G +G+ G KG +G  G   + G+PGN G              +G+ G  G  G  GD G +G  G++GV G  G  G++ I G++GD G  G+ GI G  G +G PG     G KG+ G +G  GL G++G  G++G KG +  S   G +G  G  G+ GFPG  G +G  G    +GD                   Q L G  G  G MG++G  G  G  G  G    SG  G  G  G  G+PG                      PGF G+         +GE+G +G PG PG +G  GR  N
Sbjct:   69 GTKGVKGPPGLSGKPGLDGASGGKGEHGEVFGASSGAPGDPGLPGHRGDTGLTGDPGLPGYFGMEGMPGMTGLKGESGPPGLQGEQGRPGPPGTFGFPGQTGYTGPPGPPGNIGEPGPSGRRGDQGEPGLIGARGVKGAIGDPGNIGVTGNIGPPGDQGETGGPGF---FGLPGLKGSKGGQGMTGFPGKTGERGLKGFSGTKGE---------IGLPGHQGAKGAPGSPGQKGDRGLTGPPGDKPVIHITPHMKEVMKGSKGDHGNMGDPGFTGPRGTKGFPGIPGGEGKDGHPGEPSVVKGVKGL---------------------------------------PGEPGLEGPKGMPGPTG--------------LPGIEGFPGMSGPKLIFQGNKGS---SGAYGRPGDSGIKGFKGDLGP-----TISLPGSTGLRGETGHPGSTGAKGLYGMPGERGSSGLDGIEGMKGYQGEPGTVGPPGSDGL--QGFPGSQGHKGRSGDPGQTGTTGIQGQPGQKGFPGLKGIFGLDGLKGQKGNQGVPGTD-NWGQPGNPGTKGELGETGIPSTTTGVPGSLGHKGTTGDSGNKGEIGQRGVPGPQGQQGFSDIKGTQGDYGFPGIKGIPGFPGTRGTPGIPSPFGAKGDRGNVGDFGLFGEKGVQGDRGEKGSSGESGVSGRKGDKGEPGMMGFPGRRGFQGDRGPFGPKGDTGPPGFPGLPGAKGYPPVPQKLPGEQGPPGQMGIQGPSGRNGNPGPAGPPGDSGPSGHKGMPGLPGIPGS---------------------PGFRGEPGSMGHSGLQGEQGTRGRPGMPGPLGMAGRSVN 813          

HSP 3 Score: 201.445 bits (511), Expect = 7.824e-52
Identity = 296/916 (32.31%), Postives = 385/916 (42.03%), Query Frame = 3
Query:  492 LVGRTGQPGERGDDGDRGLSIIPKYGLKGNKGSRGLLGRYGRK---------------------GEKGFKGIKGYSGIFGIKGNKGYVGPMGRRGPKGDSLGTVIIQSEKGSKGDKGLKGQSGIPCKGFQIEGRMYGRVGSDGPIGDKGIKGEKGLMGEIGQSGIDGARGLNGEKGLPGEAGPRGERGDRGNPGFP------------------------GDPGASGADGTRGRQGERGPKGVHGISGADGPRGSRGD------------KGPSG--SLLSCPGRKGEKGFFGIPGIKGDIGNKGYQGHDGDIGEIGFKGEKGYEGPLG--------PSCSEVEQGFRGTKGESGFPGLRGAKGQRGYSGNKGIKGKPNFGTGINNPGET----GSYGNLGVPGEKGNKGFIGDTGEKGFSG-TGKQGPEGP-RGDKGDDGVNGQVGMIGMPGIKGDKGSTYPICPFCEKGYKGIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEGRMGLLGSKGRQGYKGGKGFSGSMGDAGEIGYVTISGTTIPGVKGEKGNQGPKGNKGEFGEAGSRGRKGYSGLKGFKGLIGERGTSFSSGDPGDKGLRGENGKDGVS-FAGIPGEKGLKGDKGNRGILG--DVGSLSNCATR--------PITSKGFKGPQGAKGT---SGSPGSAGKTGIVGNKGENGYPGKRGIDGDNGIPGSKGEEGETGIKGHAGRPGNLGKSGLQGLRGEYGVKGDLGIQGIPG------------RKGVMGDPGPNGYAMIGSKGDKGIKGLPGIYGAKGDK---------GRPGYIGIPG-FKGETGLIGRSGLKGDQGEIGEKGIKGFTFISNNPGDRGLLGNKGLKGFPGELGNKGQVGVCTVRGDQGLRGYSGLIGDMGMKGEQGSKGIV 2912
             +G  G PGE G  G RGL   P  G+ G KG+ G  G  G K                     G+ G+ G KG  G  G+ G  G  G  G +G  G+  G     +  G+ GD GL G  G                       D G+ G+ GL G  G  G+ G  GL GE G PG  G +G  G  G  GFP                        GD G  G  G RG +G  G  G  G++G  GP G +G+            KG  G   +   PG+ GE+G  G  G KG+IG  G+QG  G  G  G KG++G  GP G        P   EV +G +G  G  G PG  G +G +G+ G  G +GK        +PGE     G  G  G PG +G KG  G TG  G  G  G  GP+   +G+KG  G  G+ G  G+ G KGD G T  +                                          G  GL G  G  G  G KG  G                 +PG +G  G  G +G KG  GE G+ G  G  GL+GF G  G +G S   G  G  G++G+ G+ G     GI G  GLKG KGN+G+ G  + G   N  T+        P T+ G  G  G KGT   SG+ G  G+ G+ G +G+ G+   +G  GD G PG KG  G  G +G  G P   G  G +G  G++G+ G+ G+QG  G            RKG  G+PG     M+G  G +G +G  G +G KGD          G  GY  +P    GE G  G+ G++G  G  G  G  G    S   G +G+ G  G+ G PG  G  G +G   ++G+QG RG  G+ G +GM G   + G +
Sbjct:    1 CIGDPGPPGESGLPGPRGLEGFP--GVPGPKGTAGFSGDLGDKGERGEPGRGGPPGPKGFTGPRGDLGYPGTKGVKGPPGLSGKPGLDGASGGKGEHGEVFG-----ASSGAPGDPGLPGHRG-----------------------DTGLTGDPGLPGYFGMEGMPGMTGLKGESGPPGLQGEQGRPGPPGTFGFPGQTGYTGPPGPPGNIGEPGPSGRRGDQGEPGLIGARGVKGAIGDPGNIGVTGNIGPPGDQGETGGPGFFGLPGLKGSKGGQGMTGFPGKTGERGLKGFSGTKGEIGLPGHQGAKGAPGSPGQKGDRGLTGPPGDKPVIHITPHMKEVMKGSKGDHGNMGDPGFTGPRGTKGFPGIPGGEGK------DGHPGEPSVVKGVKGLPGEPGLEGPKGMPGPTGLPGIEGFPGMSGPKLIFQGNKGSSGAYGRPGDSGIKGFKGDLGPTISL-----------------------------------------PGSTGLRGETGHPGSTGAKGLYG-----------------MPGERGSSGLDGIEGMKGYQGEPGTVGPPGSDGLQGFPGSQGHKGRSGDPGQTGTTGIQGQPGQKGFPGLKGIFGLDGLKGQKGNQGVPGTDNWGQPGNPGTKGELGETGIPSTTTGVPGSLGHKGTTGDSGNKGEIGQRGVPGPQGQQGFSDIKGTQGDYGFPGIKGIPGFPGTRGTPGIPSPFGAKGDRGNVGDFGLFGEKGVQGDRGEKGSSGESGVSGRKGDKGEPG-----MMGFPGRRGFQGDRGPFGPKGDTGPPGFPGLPGAKGYPPVPQKLPGEQGPPGQMGIQGPSGRNGNPGPAGPPGDSGPSGHKGMPGLPGIPGSPGFRGEPGSMGHSGLQGEQGTRGRPGMPGPLGMAGRSVNVGYL 817          

HSP 4 Score: 192.971 bits (489), Expect = 4.160e-49
Identity = 292/807 (36.18%), Postives = 365/807 (45.23%), Query Frame = 3
Query:  201 GNKGRQGFPGPRGYQGVSGDKGDVGQFGMPGPKGYKGFTGAIGPQGRKGERGIPGSPG---YPGKMGEMGF------------PGIRGDIGEKGLTGCDGQQGDFGNPGMNGLVGRTGQPGERGDDGDRGLSIIPKYGLKGNKGSRGLLGRYGRKGEKGFKGIKGYSGIFGIKGNKGYVGPMGRRGPKGDSLGTVIIQSEKGSKGDKGLKGQSGIPCKGFQIEGRMYGRVGSDGPIGDKGIKGEKGLMGEIGQSGIDGARGLNGEKGLPGEAGPRGERGDRGNPGFPGDPGASGADGTRGRQGERGPKGVHGISGADGPRGSRGDKGPSGS--LLSCPGRKGEKGFF----GIPGIKGDIGNKGYQGHDGDIG-EIGFKGEKGYEGPLGPSCSEVEQGFRGTKGESGFPGLRGAKGQRGYSGNKGIKGKPNFGTGINNPGETGSYGNLGVPGEKGNKGFIGDTGEKGFSGT-GKQGPEGPRGDKGDDGVNG--QVGMIGMPGIKGDKGSTYPICPFCEKGYKGIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEGRMGLLGSKGRQGYKGGKGFSGSMGDAGEIGYVTISGTTIPGVKGEKGNQGPKGNKGEFGEAGSRGRKGYSGLKGFKGLIGERGTSFSSGDPGDKGLRGENGKDGVSFAGIPGEKGLKGDKGNRGILGDVGSLSNCATRPITSKGFKG-PQGAKGTSGSPGSAGKTGIVGNKGENGYPGKRGIDGDNGIPGSKGEEGETGIKGHAGRPGNLGKSGLQGLRGEYGVKGDLGIQGIPGRKGVMGDPGPNGYAMI 2543
            G  G  G PG RG  G++GD G  G FGM G  G  G  G  GP G +GE+G PG PG   +PG+ G  G              G RGD GE GL G  G +G  G+PG  G+ G  G PG++G+ G  G       GLKG+KG +G+ G  G+ GE+G KG  G  G  G+ G++G  G  G                  G KGD+GL G                       P GDK +      M E+    + G++G +G  G PG  GPRG +G      FPG PG  G DG  G       KGV G+ G  G  G +G  GP+G   +   PG  G K  F    G  G  G  G+ G +G  GD+G  I   G  G  G  G   S   +G  G  GE G  GL G +G +GY G  G  G P        PG  G  G  G PG+ G  G  G  G+KGF G  G  G +G +G KG+ GV G    G  G PG KG+ G T    P    G  G                     + G+KG  GD G  G +G +G  G +G +GFS   G  G+ G+  I G  IPG  G +G     G    FG  G RG  G  GL G KG+ G+RG   SSG+ G  G +G+ G+ G+   G PG +G +GD+G  G  GD G           +KG+   PQ   G  G PG   + GI G  G NG PG  G  GD+G  G KG  G  GI G  G  G  G  G  GL+GE G +G     G+PG  G+ G     GY ++
Sbjct:  104 GAPGDPGLPGHRGDTGLTGDPGLPGYFGMEGMPGMTGLKGESGPPGLQGEQGRPGPPGTFGFPGQTGYTGPPGPPGNIGEPGPSGRRGDQGEPGLIGARGVKGAIGDPGNIGVTGNIGPPGDQGETGGPGFFG--LPGLKGSKGGQGMTGFPGKTGERGLKGFSGTKGEIGLPGHQGAKGAPG----------------SPGQKGDRGLTG-----------------------PPGDKPVIHITPHMKEV----MKGSKGDHGNMGDPGFTGPRGTKG------FPGIPGGEGKDGHPGEPSVV--KGVKGLPGEPGLEGPKGMPGPTGLPGIEGFPGMSGPKLIFQGNKGSSGAYGRPGDSGIKGFKGDLGPTISLPGSTGLRGETGHPGSTGAKGLYGMPGERGSSGLDGIEGMKGYQGEPGTVGPPGSDGLQGFPGSQGHKGRSGDPGQTGTTGIQGQPGQKGFPGLKGIFGLDGLKGQKGNQGVPGTDNWGQPGNPGTKGELGETG--IPSTTTGVPG---------------------SLGHKGTTGDSGNKGEIGQRGVPGPQGQQGFSDIKGTQGDYGFPGIKG--IPGFPGTRGT---PGIPSPFGAKGDRGNVGDFGLFGEKGVQGDRGEKGSSGESGVSGRKGDKGEPGM--MGFPGRRGFQGDRGPFGPKGDTGPPGFPGLP--GAKGYPPVPQKLPGEQGPPG---QMGIQGPSGRNGNPGPAGPPGDSGPSGHKGMPGLPGIPGSPGFRGEPGSMGHSGLQGEQGTRGR---PGMPGPLGMAGRSVNVGYLLV 819          

HSP 5 Score: 189.119 bits (479), Expect = 5.993e-48
Identity = 307/940 (32.66%), Postives = 402/940 (42.77%), Query Frame = 3
Query:  900 GEIGQSGIDGARGLNGEKGLPGEAGPRGERGDRGNPGFPGDPGAS------------GADGTRGRQGERGPKGVHGISGADGPRGSRGDKGPS-GSLLSCPGRKGEKGFFGIPGIKGDIGNKGYQGHDGDIGEIGFKGEKGYEGPLGPSCSEVEQGFRGTKGESGFPGL---------------------RGAKGQRGYSGNKGIKGKPNFGTGINNPGETGSYGNLGVPGEKGNK---------------------GFIGDTGE---KGFSGT-GKQGPEGPRGDKGDDGVNGQVGMIGMPGIKGDKGSTYPICPFCEKGYKGIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEGRMGLLGSKGRQGYKGGKGFSGSMGDAGEIGYVTISGTTIPGVKGEKGNQGPKGNKGEFGEAGSRGRKGYSGLKGFKGLI-GERGTSFSSGDPGDKGLRGENGKDGVSFAGIPGEKGLKGDKGNRGILGDVGSLSNCATRPITSKGFKGPQGAKGTSGSPGSAGKTGIVGNKGENGYPGKRGIDGDNGIPGSKGEEGETGIKGHAGRPGNLGKSGLQGLRGEYG---VKGDLGIQGIPGRKGVMGDPGPNGYAMIGSKGDKGIKGLPGIYGAKGDKGRPGYIGIPGFKGETGLIGRSGLKGDQGEIGEKGIKGFTFISNNPGDRGLLGNKGLKGFPGELGNKGQVGVCTVRGDQGLRGYSGLIGDMGMKGEQGSKGIVGDYGAASRSGIMGRTGKIGNQGLPGDQXXXXXXXXXXXXXXXXYIGIPGFEGDRGEKG---------------NKGFPG----FPGDIGQPGRLGNPGISTEGVXXXXXXXXXXXXXXXXXXXXXXXXXXKQGDSGISIPGRQGIKGEDGTIGLPGEMGEPGPRGDFGQKGNIGITGEFGLQGNRGDDGLKGDDGIPGLNGPRGFI 3473
            G  G+SG+ G RGL G  G+PG  G  G  GD G+ G  G+PG              G  G  G +G +GP G+ G  G DG  G +G+ G   G+    PG  G  G  G  G+ GD G  GY G +G  G  G KGE G      P   + EQG  G  G  GFPG                      RG +G+ G  G +G+KG       I +PG  G  GN+G PG++G                       GF G TGE   KGFSGT G+ G  G +G KG  G  GQ G  G+ G  GDK   + I P  ++  KG +G                           D G MG  G  G +G KG  G  G  G  G  G  ++    + GVKG  G  G +G KG  G  G  G +G+ G+ G K +  G +G+S + G PGD G++G  G  G + + +PG  GL+G+ G+ G  G                       AKG  G PG  G +G+ G +G  GY G+ G  G  G  G +G  G  G KG +G PG  G +G+QG  G+ G   +KG  G+ G+ G+KG  G PG + +   G+ G KG  G  GI       G PG +G    KG TG  G  G  G +G  G +G +GF+ I    GD G  G KG+ GFPG  G  G       +GD+G  G  GL G+ G++G++G KG  G+ G + R G  G  G +G                        + G  GF+GDRG  G                KG+P      PG+ G PG++G  G S                                       PG  G  G  G  GLPG  G PG RG+ G  G+ G+ GE   QG RG  G+ G  G+ G +   G++
Sbjct:    6 GPPGESGLPGPRGLEGFPGVPGPKGTAGFSGDLGDKGERGEPGRGGPPGPKGFTGPRGDLGYPGTKGVKGPPGLSGKPGLDGASGGKGEHGEVFGASSGAPGDPGLPGHRGDTGLTGDPGLPGYFGMEGMPGMTGLKGESG------PPGLQGEQGRPGPPGTFGFPGQTGYTGPPGPPGNIGEPGPSGRRGDQGEPGLIGARGVKGA------IGDPGNIGVTGNIGPPGDQGETGGPGFFGLPGLKGSKGGQGMTGFPGKTGERGLKGFSGTKGEIGLPGHQGAKGAPGSPGQKGDRGLTGPPGDKPVIH-ITPHMKEVMKGSKG---------------------------DHGNMGDPGFTGPRGTKGFPGIPGGEGKDGHPGEPSV----VKGVKGLPGEPGLEGPKGMPGPTGLPGIEGFPGMSGPKLIFQGNKGSSGAYGRPGDSGIKGFKGDLGPTIS-LPGSTGLRGETGHPGSTG-----------------------AKGLYGMPGERGSSGLDGIEGMKGYQGEPGTVGPPGSDGLQGFPGSQGHKGRSGDPGQTGTTGIQGQPGQKGFPGLKGIFGLDGLKGQKGNQGVPGTDNWGQPGNPGTKGELGETGIPSTT--TGVPGSLG---HKGTTGDSGNKGEIGQRGVPGPQGQQGFSDIKGTQGDYGFPGIKGIPGFPGTRGTPGIPSPFGAKGDRGNVGDFGLFGEKGVQGDRGEKGSSGESGVSGRKGDKGEPGMMG------------------------FPGRRGFQGDRGPFGPKGDTGPPGFPGLPGAKGYPPVPQKLPGEQGPPGQMGIQGPS----------------------------GRNGNPGPAGPPGDSGPSGHKGMPGLPGIPGSPGFRGEPGSMGHSGLQGE---QGTRGRPGMPGPLGMAGRSVNVGYL 817          

HSP 6 Score: 183.341 bits (464), Expect = 4.304e-46
Identity = 322/944 (34.11%), Postives = 407/944 (43.11%), Query Frame = 3
Query: 1125 GDKGPSGSLLSCPGRKGEKGFFGIPGIKGDIGNKGYQGHDGDIGEIGFKGEKGYEGPLGPSCSEVEQGFRGTKGESGFPGLRGAKGQRGYSGNKGIKGKPNFGTGINNPGETGSYGNLGVPGEKGNKGFIGDTGEKGFSGTGKQGPEGPRGDKGDDGVNGQVGMIGMPGIKGDKGSTYPICPFCEKGYKGIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEGRMGLLGSKGRQGYKGGKGFSGSMGDAGEIGYVTISGTTIPGVKGE------------KGNQGPKGNKGEFGEAGSRGRKGYSGLKGFKGLIGERGTSFSSGDPG---DKGLRGENGKDGVSFAGIPGEKGLKGDKGNRGILGDVGSLSNCATRPITSKGFKGPQGAKGTSGSPGSAGKTGIVGN----KGENGYPGKRGIDGDNGIPGSKGEEGETGIKGHAGRPGNLGKSGLQGLRGEYGVKGDLGIQGIPGRKGVMGDPGPNGYAMIGSKGDKGIKGLPGIYGAKGDKGRPGYIGIPGFKGETGLIGRSGLKGDQGEIGEKGIKGFTFISNNPGDRGLLGNKGLKGFPGELGNKGQVGVCTVRGDQGLRGYSGLIGDMGMKGEQGSKGIVGDYGAAS--RSGIMGRTGKIGNQGLPGDQXXXXXXXXXXXXXXXXYIGIPGFEGDRGEKGNKGFPGFPGDIGQPGRLGNPGISTEGVXXXXXXXXXXXXXXXXXXXXXXXXXXKQGDSGISIPGRQGIKGEDGTIGLPGEMGEPGPRGDFGQKGNIGITGEFGLQGNRGDD------------GLKGDDGIPGLNGPRGFIGDIGFVGFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXELGLDGSMGGKGDNG---------------P---RGFNGPTGIPGSKGFEGDKGIRGDIGVKGFQGQHGEIGFPGLKGVSGEN 3803
            GD GP G     PG +G +GF G+PG KG     G+ G  GD GE G  G  G  GP G +    + G+ GTKG  G PGL G  G  G SG KG  G+  FG        +G+ G+ G+PG +G+ G  GD G  G+                        GM GMPG+ G KG + P       G +G QG  G  G  G  G  G  G  G  G  G+ G  G  G +G  G  G +G  G++GD G IG     G   PG +GE            KG++G +G  G  G+ G RG KG+SG KG  GL G +G   + G PG   D+GL G  G   V       ++ +KG KG+ G +GD               GF GP+G KG  G PG  GK G  G     KG  G PG+ G++G  G+PG  G  G  G  G +G    L   G +G  G YG  GD GI      KG  GD GP   ++ GS G +G  G PG  GAKG        G+PG +G +GL G  G+KG QGE G  G          PG  GL G  G +G  G  G+ GQ G   ++G  G +G+ GL G  G+ G +G KG  G  G  +  + G  G  G++G  G+P                     G+PG  G +G  G+ G  G  G  G PG  G  G S                             G QGD G   PG +GI G  GT G PG     G +GD G  G+ G+ GE G+QG+RG+             G KG+ G+ G  G RGF GD G  G                                     GE G  G MG +G +G               P   +G  G  GIPGS GF G+ G  G  G++G QG  G  G PG  G++G +
Sbjct:    3 GDPGPPGES-GLPGPRGLEGFPGVPGPKG---TAGFSGDLGDKGERGEPGRGGPPGPKGFTGPRGDLGYPGTKGVKGPPGLSGKPGLDGASGGKGEHGE-VFGA------SSGAPGDPGLPGHRGDTGLTGDPGLPGY-----------------------FGMEGMPGMTGLKGESGP------PGLQGEQGRPGPPGTFGFPGQTGYTGPPGPPGNIGEPGPSGRRGDQGEPGLIGARGVKGAIGDPGNIGVTGNIGP--PGDQGETGGPGFFGLPGLKGSKGGQGMTGFPGKTGERGLKGFSGTKGEIGLPGHQGAKGAPGSPGQKGDRGLTGPPGDKPVIHITPHMKEVMKGSKGDHGNMGD--------------PGFTGPRGTKGFPGIPGGEGKDGHPGEPSVVKGVKGLPGEPGLEGPKGMPGPTGLPGIEGFPGMSGP--KLIFQGNKGSSGAYGRPGDSGI------KGFKGDLGPT-ISLPGSTGLRGETGHPGSTGAKG------LYGMPGERGSSGLDGIEGMKGYQGEPGTVG---------PPGSDGLQGFPGSQGHKGRSGDPGQTGTTGIQGQPGQKGFPGLKGIFGLDGLKGQKGNQGVPGTDNWGQPGNPGTKGELGETGIP-----------------STTTGVPGSLGHKGTTGDSGNKGEIGQRGVPGPQGQQGFSD--------------------------IKGTQGDYGF--PGIKGIPGFPGTRGTPGIPSPFGAKGDRGNVGDFGLFGEKGVQGDRGEKGSSGESGVSGRKGDKGEPGMMGFPGRRGFQGDRGPFG----------PKGDTGPPGFPGLPGAKGYPPVPQKLPGEQGPPGQMGIQGPSGRNGNPGPAGPPGDSGPSGHKGMPGLPGIPGSPGFRGEPGSMGHSGLQGEQGTRGRPGMPGPLGMAGRS 811          

HSP 7 Score: 181.415 bits (459), Expect = 1.590e-45
Identity = 282/851 (33.14%), Postives = 364/851 (42.77%), Query Frame = 3
Query: 2058 GDPGDKGLRGENGKDGVSFAGIPGEKGLKGDKGNRGILGD-------VGSLSNCATRPITSKGFKGPQGAKGTSGSPGSAGKTGI---VGNKGENG--YPGKRGIDGDNGIPGSKGEEGETGIKGHAGRPGNLGKSGLQGLRGEYGVKGDLGIQGIPGRKGVMGDPGPNGYAMIGSKGDKGIKGLPGIYGAKGDKGRPGYIGIPGFKGETGLIGRSGLKGDQGEIGEKGIKGFTFISNNPGDRGLLGNKGLKGFPGELGNKGQVGVCTVRGDQGLRGYSGLIGDMGMKGEQGSKGIVGDYGAASRSGIMGRTGKIGNQGLPGDQXXXXXXXXXXXXXXXXYIGIPGFEGDRGEKGNKGFPGFPGDIGQPGRLGNPGISTEGVXXXXXXXXXXXXXXXXXXXXXXXXXXKQGDSGISIPGRQGIKGEDGTIGLPGEMGEPGPRGDFGQKGNIGITG-EFGLQGNRGDDGLKGDDGIPGLNGPRGFIGDIGFVGFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXELGLDGSMGGKGDNGPRGFNGPTGIPGSKGFEGDKGIRGDIGVKGFQGQHGEIGFPGLKGVSGENGRQXXXXXXXXXXXXXXXXVCMQPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEVGESIRGLQGRKGSTGLRGNIGIPGERGDKGIPGLQ--GKVGNKGVKGDIGDKGF-------SGNIGDKGYSGISGDKGSFGVKGDKGFQGDVGMLGKSGLQGDR---GQKGIIGFRGTRGIPGSMGLPGEIGEKGDVGPSG-IGVKGLKGYQNAVGIK---------GRKGEKGLPGFPGRPGKVGDQGDKGPKGMK 4505
            G PG+ GL G  G +G  F G+PG KG  G  G+   LGD                     +G  G  G KG  G PG +GK G+    G KGE+G  +    G  GD G+PG +G+ G TG  G  G  G  G  G+ GL+GE G  G  G QG PG  G  G PG  GY           +   G  G +GD+G PG IG  G KG  G  G  G+ G+ G  G++G  G       PG +G  G +G+ GFPG+ G +G  G    +G+ GL G+ G  G  G  G++G +G+ G  G      I     ++  +G  GD G                +G PGF G RG    KGFPG PG  G+ G  G P +                                           +G+KG  G  GL G  G PGP G  G +G  G++G +   QGN+G  G  G    PG +G +GF GD+G                                          + L GS G +G+ G  G  G  G+ G  G  G  G+ G  G+KG+QG+ G +G PG  G+ G  G QG  G  G  G  G  G+  QP                                        G +G  G  G+ G  G+ G++G++G+PG    G+ GN G KG++G+ G         G++G KG +G SG+KG  G +G  G QG  G     G QGD    G KGI GF GTRG P   G+P   G KGD G  G  G+ G KG Q   G K         GRKG+KG PG  G PG+ G QGD+GP G K
Sbjct:    6 GPPGESGLPGPRGLEG--FPGVPGPKGTAGFSGD---LGDKGERGEPGRGGPPGPKGFTGPRGDLGYPGTKGVKGPPGLSGKPGLDGASGGKGEHGEVFGASSGAPGDPGLPGHRGDTGLTGDPGLPGYFGMEGMPGMTGLKGESGPPGLQGEQGRPGPPGTFGFPGQTGYTGPPGPPGNIGEP--GPSGRRGDQGEPGLIGARGVKGAIGDPGNIGVTGNIGPPGDQGETGGPGFFGLPGLKGSKGGQGMTGFPGKTGERGLKGFSGTKGEIGLPGHQGAKGAPGSPGQKGDRGLTGPPGDKPVIHITPHMKEV-MKGSKGDHGN---------------MGDPGFTGPRG---TKGFPGIPGGEGKDGHPGEPSVV------------------------------------------KGVKGLPGEPGLEGPKGMPGPTGLPGIEGFPGMSGPKLIFQGNKGSSGAYGR---PGDSGIKGFKGDLG----------------------------------------PTISLPGSTGLRGETGHPGSTGAKGLYGMPGERGSSGLDGIEGMKGYQGEPGTVGPPGSDGLQGFPGSQGHKGRSGDPGQTGTTGIQGQP----------------------------------------GQKGFPGLKGIFGLDGLKGQKGNQGVPGTDNWGQPGNPGTKGELGETGIPSTTTGVPGSLGHKGTTGDSGNKGEIGQRGVPGPQGQQGFSDIKGTQGDYGFPGIKGIPGFPGTRGTP---GIPSPFGAKGDRGNVGDFGLFGEKGVQGDRGEKGSSGESGVSGRKGDKGEPGMMGFPGRRGFQGDRGPFGPK 702          

HSP 8 Score: 167.933 bits (424), Expect = 2.515e-41
Identity = 282/858 (32.87%), Postives = 358/858 (41.72%), Query Frame = 3
Query:  201 GNKGRQGFPGPRGYQGVSGDKGD---------------------VGQFGMPGPKGYK---------GFTGAIGPQGRKGE-----RGIPGSPGYPGKMGEMGF---PGIRGDIGEKGLTGCDGQQGDFGNPGMNGLVGRTGQP---------------------------GERGDDGDRGLSIIPKYGLKGNKGSRGLLGRYGR---------------------KGEKGFKGIKGYSGIFGIKGNKGYVGPMGRRGPKGDSLGTVIIQSEKGSKGDKGLKGQSG---IPCKGFQIEGRMYGRVGSDGPIGDKGIKGEKGLMGEIGQSGIDGARGLNGE-------KGLPGEA---GPRGERGDRGNPGFPGDPGASGADGTRGRQGERGPKGVHGISGADGPRGSRGDKGPSGSL---------LSCPGRKGEKGFFGIPGIKGDI------GNKGYQGHDGDIGEI------GFKGEKGYEGPLGPSCSEVEQGFRGTKGESGFPGLR---GAKGQRGYSGNKGIKGKPNFGTGINNPGETGSYG-------NLGVPGEKGNKGFIGDTGEKGFSGTGKQGPEGPRGDKGDDGVNGQVGMIGMPGIK------GDKGSTYPICPFCEKGYKGIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEGRMGLLGSKGRQGYKGGKGFSGSM------GDAGEIGYVTISGTTIPGVKGEKGNQGPKGNKGEFGEAGSRGRKGYSGLKGFKGLIGERGTSFSSGDPGDKGLRGENGKD----------GVSFAGIPGEKGLKGDKGNRGILGDVGSLSNCATRPITSKGFKGPQGAKGTSGSPGSAGKTGIVGNKGENGY 2318
            G +G  G PGP+G  G SGD GD                      G  G PG KG K         G  GA G +G  GE      G PG PG PG  G+ G    PG+ G  G +G+ G  G +G+ G PG+ G  GR G P                           G RGD G+ GL  I   G+KG  G  G +G  G                      KG KG +G+ G+ G  G +G KG+ G  G  G  G   G        G KGD+GL G  G   +      ++  M G  G  G +GD G  G +G  G  G  G +G  G  GE       KGLPGE    GP+G  G  G PG  G PG SG       QG +G  G +G  G  G +G +GD GP+ SL            PG  G KG +G+PG +G        G KGYQG  G +G        GF G +G++G  G        G +G  G+ GFPGL+   G  G +G  GN+G+ G  N+G    NPG  G  G         GVPG  G+KG  GD+G KG    G++G  GP+G +G   + G  G  G PGIK      G +G+     PF  KG +G                              + G  GL G KG QG +G KG SG        GD GE G +   G    G +G++G  GPKG+ G  G  G  G KGY  +   + L GE+G       PG  G++G +G++              +G  G  GL G  G+ G  G+ GS+           G  G QG +GT G PG  G  G+ G     GY
Sbjct:   18 GLEGFPGVPGPKGTAGFSGDLGDKGERGEPGRGGPPGPKGFTGPRGDLGYPGTKGVKGPPGLSGKPGLDGASGGKGEHGEVFGASSGAPGDPGLPGHRGDTGLTGDPGLPGYFGMEGMPGMTGLKGESGPPGLQGEQGRPGPPGTFGFPGQTGYTGPPGPPGNIGEPGPSGRRGDQGEPGL--IGARGVKGAIGDPGNIGVTGNIGPPGDQGETGGPGFFGLPGLKGSKGGQGMTGFPGKTGERGLKGFSGTKGEIGLPGHQ-GAKGAPGSPGQKGDRGLTGPPGDKPVIHITPHMKEVMKGSKGDHGNMGDPGFTGPRGTKGFPGIPGGEGKDGHPGEPSVVKGVKGLPGEPGLEGPKGMPGPTGLPGIEGFPGMSGPKLI--FQGNKGSSGAYGRPGDSGIKGFKGDLGPTISLPGSTGLRGETGHPGSTGAKGLYGMPGERGSSGLDGIEGMKGYQGEPGTVGPPGSDGLQGFPGSQGHKGRSGDPGQTGTTGIQGQPGQKGFPGLKGIFGLDGLKGQKGNQGVPGTDNWGQ-PGNPGTKGELGETGIPSTTTGVPGSLGHKGTTGDSGNKGE--IGQRGVPGPQGQQGFSDIKGTQGDYGFPGIKGIPGFPGTRGTPGIPSPFGAKGDRG------------------------------NVGDFGLFGEKGVQGDRGEKGSSGESGVSGRKGDKGEPGMMGFPGRR--GFQGDRGPFGPKGDTGPPGFPGLPGAKGYPPVP--QKLPGEQGP------PGQMGIQGPSGRNGNPGPAGPPGDSGPSGHKGMPGLPGIPGSPGFRGEPGSM-----------GHSGLQGEQGTRGRPGMPGPLGMAGRSVNVGY 816          

HSP 9 Score: 152.525 bits (384), Expect = 1.455e-36
Identity = 278/886 (31.38%), Postives = 347/886 (39.16%), Query Frame = 3
Query: 1449 PGETGSYGNLGVPGEKGNKGFIGDTGEKGFSGT----------------GKQGPEGPRGDKGDDGVNGQVGMIGMPGIKGDKGSTYPICPFCEKGYKGIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEGRMGLLGSKGRQGYKGGKGFSGSMGDAGEIGYVTISGTTIPGVKGEKGNQGPKGNKGEFGEAGSRGRKGYSGLKGFKGLIGERGTSFSSGDPGDKGLRGENGKDGVSFAGIPGEKGLKGDKGNRGILGDVG-------SLSNCATRPITSKGFKGPQGAKGTSGSPGSAGKTGIVGNKGENGYPGKRGIDGDNGIPGSKGEEGETG-----------------IKGHAGRPGNLGKSGLQGLRGEYGVKGDLGIQGIPGRKGVMGDPGPNGYAMIGSKGDKGIKGLPGIYGAKGDKGRPGYIGIPGFKGETGLIG-------RSGLKGDQGEIGEKGIKGF-------------TFISNNPGDRGLLGNKGLKGFPGELGNKGQVGVCTVRGDQGLRGYSGLIGDMGMKGEQGSKGIVGDYGAASRSGIMGRTGKIGNQGLPGDQXXXXXXXXXXXXXXXXYIGIPGFEGDRGEKGNKGFPGF-----PGDIGQPGRLGNPGISTEGVXXXXXXXXXXXXXXXXXXXXXXXXXXKQGDSGISIPGRQGIKGEDGTIGLPGEMGE---PGPRGDFGQKGNIGITGEFGLQGNRGDDGLKGDDGIPGLNGPRGFIGDIGFVGFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXELGLDGSMGGKGDNGPR---------------GFNGPTGIPGSKGFEGDKGI---RGDIGV---------KGF----QGQHGEIGFPGLKGVSGENGR 3809
            PG  G  G  GVPG KG  GF GD G+KG  G                 G  G  G +G KG  G++G+ G+ G  G KG+ G  +                                                  G+ G  G  G +G +G  GD G  GY  + G  +PG+ G KG  GP G +GE G  G  G  G+ G  G+ G  G  G     G  G +G +GE G       G  G KG  GD GN G+ G++G       +           KG KG QG  G  G  G  G  G  G KGE G PG +G  G  G PG KG+ G TG                 +KG  G  GN+G  G  G RG  G        GIPG +G  G PG            KG+KGLPG  G +G KG PG  G+PG +G  G+ G         G  G  G  G+ GIKGF             T +    G  G  G KGL G PGE G+ G  G+      +G++GY G  G +G  G  G +G  G  G   RSG  G+TG  G QG PG +GFPG              GI G +G +G+KGN+G PG      PG+ G  G LG  GI +                                 +   +PG  G KG  G  G  GE+G+   PGP+G  G     G  G++G  G +G  G  G  G PG+  P G  GD G VG                                      + GL G  G +GD G +               G  G  G PG +GF+GD+G    +GD G          KG+    Q   GE G PG  G+ G +GR
Sbjct:   14 PGPRGLEGFPGVPGPKGTAGFSGDLGDKGERGEPGRGGPPGPKGFTGPRGDLGYPGTKGVKGPPGLSGKPGLDGASGGKGEHGEVFGAS----------------------------------------------SGAPGDPGLPGHRGDTGLTGDPGLPGYFGMEG--MPGMTGLKGESGPPGLQGEQGRPGPPGTFGFPGQTGYTGPPGPPGNIGEPGPSGRRGDQGEPG-----LIGARGVKGAIGDPGNIGVTGNIGPPGDQGETGGPGFFGLPGLKGSKGGQGMTGFPGKTGERGLKGFSGTKGEIGLPGHQGAKGAPGSPGQKGDRGLTGPPGDKPVIHITPHMKEVMKGSKGDHGNMGDPGFTGPRGTKG------FPGIPGGEGKDGHPGEPSVV-------KGVKGLPGEPGLEGPKGMPGPTGLPGIEGFPGMSGPKLIFQGNKGSSGAYGRPGDSGIKGFKGDLGPTISLPGSTGLRGETGHPGSTGAKGLYGMPGERGSSGLDGI------EGMKGYQGEPGTVGPPGSDGLQGFPGSQGHKGRSGDPGQTGTTGIQGQPGQKGFPG------------LKGIFGLDGLKGQKGNQGVPGTDNWGQPGNPGTKGELGETGIPS---------------------------------TTTGVPGSLGHKGTTGDSGNKGEIGQRGVPGPQGQQGFSDIKGTQGDYGFPGIKGIPGFPGTRGTPGIPSPFGAKGDRGNVG--------------------------------------DFGLFGEKGVQGDRGEKGSSGESGVSGRKGDKGEPGMMGFPGRRGFQGDRGPFGPKGDTGPPGFPGLPGAKGYPPVPQKLPGEQGPPGQMGIQGPSGR 744          

HSP 10 Score: 145.206 bits (365), Expect = 2.728e-34
Identity = 204/601 (33.94%), Postives = 271/601 (45.09%), Query Frame = 3
Query:  201 GNKGRQGFPGPRGYQGVSGDKGDVGQFGMPGPKGYKGFTGAIGPQGRKGERGIPG-----------------SPGYPGKMGEMGFPGIRGDIGEKGLTGCDGQQGDFGNP----GMNGLVGRTGQPGERGDDGDRGLSII--------PKYGLKGNKGSRGLLGRYGRKGEKGFKGIKGYS----GIFGIKGNKGYVGPMGRRGPKGDSLGTVIIQSEKGSKGDKGLKGQSGIPCKGFQIEGRMYGRVGSDGPIGDKGIKGEKGLMGEIGQSGIDGARGLNGEKGLPGEAG---PRGERGDRGNPGFPG--DPGASGADGTRGRQGERG-PKGVHGISGADGPRGSRGDKGPSGSL--LSCPGRKGEKGF---------FGIPGIKGDIGNKGYQGHDG------------DIGEIGFKGEKGYEGPLGPSCSEVEQGFRGTKGESGFPGLRGAKGQRGYSGNKG------------------IKGKPNFGTGINNPGETGSYGNLGV------------------------------PGEKGNKGFIGDTGEKGFSGT-GKQGPEGPRGDKGDDGVNGQVGMIGMPGIKGDKGSTYPICP 1670
            G +G  GFPG  G +G+ G  G  G+ G+PG +G KG  G+ G +G +G  G PG                 S G  G MG+ GF G RG  G  G+ G +G+ G  G P    G+ GL G  G  G +G  G  GL  I        PK   +GNKGS G  GR G  G KGFKG  G +    G  G++G  G+ G  G +G  G       +  E+GS G  G++G      KG+Q E    G  GSDG  G  G +G KG  G+ GQ+G  G +G  G+KG PG  G     G +G +GN G PG  + G  G  GT+G  GE G P    G+ G+ G +G+ GD G  G +     PG +G++GF         +G PGIKG  G  G +G  G            ++G+ G  GEKG +G  G   S  E G  G KG+ G PG+ G  G+RG+ G++G                   KG P     +  PGE G  G +G+                              PG  G+ GF G+ G  G SG  G+QG  G  G  G  G+ G+   +G   +K  +    P+CP
Sbjct:  245 GGQGMTGFPGKTGERGLKGFSGTKGEIGLPGHQGAKGAPGSPGQKGDRGLTGPPGDKPVIHITPHMKEVMKGSKGDHGNMGDPGFTGPRGTKGFPGIPGGEGKDGHPGEPSVVKGVKGLPGEPGLEGPKGMPGPTGLPGIEGFPGMSGPKLIFQGNKGSSGAYGRPGDSGIKGFKGDLGPTISLPGSTGLRGETGHPGSTGAKGLYG-------MPGERGSSGLDGIEGM-----KGYQGEPGTVGPPGSDGLQGFPGSQGHKGRSGDPGQTGTTGIQGQPGQKGFPGLKGIFGLDGLKGQKGNQGVPGTDNWGQPGNPGTKGELGETGIPSTTTGVPGSLGHKGTTGDSGNKGEIGQRGVPGPQGQQGFSDIKGTQGDYGFPGIKGIPGFPGTRGTPGIPSPFGAKGDRGNVGDFGLFGEKGVQGDRGEKGSSGESGVSGRKGDKGEPGMMGFPGRRGFQGDRGPFGPKGDTGPPGFPGLPGAKGYPPVPQKL--PGEQGPPGQMGIQGPSGRNGNPGPAGPPGDSGPSGHKGMPGLPGIPGSPGFRGEPGSMGHSGLQGEQGTRGRPGMPGPLGMAGRSVNVGYLLVKHSQSEEIPMCP 831          

HSP 11 Score: 123.25 bits (308), Expect = 1.506e-27
Identity = 154/425 (36.24%), Postives = 191/425 (44.94%), Query Frame = 3
Query:  171 ICTPDKCQCFGNKGRQGFPGPRGYQGVSGDKGDVGQFGMPGPKGYKGFTGAIGPQGRKGERGIPGSPGYPGKMGEMGFPGIRGDIGEKGLTGCDGQQGDFGNPGMNGLVGRTGQPGERGDDGDRGLSIIPKYGLKGNKGSRGLLGRYG-RKGEKGFKGIKGYSGIFGIKGNKGYVGPMGRRGPKGDSLGTVIIQSEKGSKGDKGLKGQSGIPCKGFQIEGRMYGRVGSDGPIGDKGIKGEKGLMGEIGQSGIDGARGLNGEKGLPGEAGPRGERGDRGNPGFPGDPGASGADGTRGRQGERGPKGVHG----------------------ISGADGPRGSRGDKGPSG-----------SLLSCPGRKGEKGFFGIPGIKGDIGNKGYQGHDGDIGEIGFKGEKGYEGPLGPSCSEVEQGFRGTK 1343
            I  P      G  G  G  G +G  G+ G++G  G  G+ G KGY+G  G +GP G  G +G PGS G+ G+          GD G+ G TG  GQ G  G PG+ G+ G  G  G++G+ G  G      +G  GN G++G LG  G      G  G  G+ G  G  GNKG +G  G  GP+G    + I    KG++GD G  G  GIP  GF       G  G   P G KG +G  G  G  G+ G+ G RG   EKG  GE+G  G +GD+G PG  G PG       RG QG+RGP G  G                      + G  GP G  G +GPSG                 G KG  G  GIPG  G  G  G  GH G  GE G +G  G  GPLG +   V  G+   K
Sbjct:  426 ISLPGSTGLRGETGHPGSTGAKGLYGMPGERGSSGLDGIEGMKGYQGEPGTVGPPGSDGLQGFPGSQGHKGR---------SGDPGQTGTTGIQGQPGQKGFPGLKGIFGLDGLKGQKGNQGVPGTD---NWGQPGNPGTKGELGETGIPSTTTGVPGSLGHKGTTGDSGNKGEIGQRGVPGPQGQQGFSDI----KGTQGDYGFPGIKGIP--GFP---GTRGTPGIPSPFGAKGDRGNVGDFGLFGEKGVQGDRG---EKGSSGESGVSGRKGDKGEPGMMGFPG------RRGFQGDRGPFGPKGDTGPPGFPGLPGAKGYPPVPQKLPGEQGPPGQMGIQGPSGRNGNPGPAGPPGDSGPSGHKGMPGLPGIPGSPGFRGEPGSMGHSGLQGEQGTRGRPGMPGPLGMAGRSVNVGYLLVK 820          

HSP 12 Score: 98.2117 bits (243), Expect = 6.347e-20
Identity = 162/456 (35.53%), Postives = 202/456 (44.30%), Query Frame = 3
Query: 3276 GRQGIKGEDGTI-----GLPGEMGEPGPRGDFGQKGNIGITGEFGLQGNRGDDGLKGDDGIPGLNGPRGFIGDIGFVGFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX----XXXXXXELGLDGSMGGKGDNGPRGFNGPT------------GIPGSKGFEGDKGIRGDIGVKGFQGQHGEIGFPGLKGVSGENGRQXXXXXXXXXXXXXXXXVCMQPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEVGESIRGLQGRKGSTGLRGNIGIPGERGDKGIPGLQGKVGN-------KGVKGDIGDKGFSGNIGDKGYSGISGDKGSFGVKGDKG-FQGDVGMLGKSGLQGDRGQKGIIGFRG-TRGIPGSMGLPGEIGEKGDVGPSGI-------------GVKGLKGYQNAVGIKGRKGEKGLPGFPGRPGKVGDQGDKGPKGMKNMN 4514
            G  G KGE G +     G PG+ G PG RGD G  G+ G+ G FG++G  G  GLKG+ G PGL G +G  G  G  GF G  G  G  G  G  G      +     +       G KG +G  G++G  G+ GP G  G T            G  G +G  G  G  G+ G+KGF G  GEIG PG +G  G  G  G  G +GL G  GDK V                                  +   + E ++G +G  G+ G  G  G  G +G  GIPG +GK G+       KGVKG  G+ G  G  G  G +G+ G +G  G+ G K  FQG+ G  G  G  GD G KG  G  G T  +PGS GL GE G  G  G  G+             G++G+KGYQ   G  G  G  GL GFPG  G  G  GD G  G   + 
Sbjct:   87 GASGGKGEHGEVFGASSGAPGDPGLPGHRGDTGLTGDPGLPGYFGMEGMPGMTGLKGESGPPGLQGEQGRPGPPGTFGFPGQTGYTGPPGPPGNIGEPGPSGRRGDQGEPGLIGARGVKGAIGDPGNIGVTGNIGPPGDQGETGGPGFFGLPGLKGSKGGQGMTGFPGKTGERGLKGFSGTKGEIGLPGHQGAKGAPGSPGQKGDRGLTGPPGDKPVIH--------------------------------ITPHMKEVMKGSKGDHGNMGDPGFTGPRGTKGFPGIPGGEGKDGHPGEPSVVKGVKGLPGEPGLEGPKGMPGPTGLPGIEGFPGMSGPKLIFQGNKGSSGAYGRPGDSGIKGFKGDLGPTISLPGSTGLRGETGHPGSTGAKGLYGMPGERGSSGLDGIEGMKGYQGEPGTVGPPGSDGLQGFPGSQGHKGRSGDPGQTGTTGIQ 510          

HSP 13 Score: 89.7373 bits (221), Expect = 2.889e-17
Identity = 170/474 (35.86%), Postives = 205/474 (43.25%), Query Frame = 3
Query: 2541 IGSKGDKGIKGLPGIYGAKGDKGRPGYIGIPGFKGETG---------------LIGRSGLKGDQGEIGEKGIKGFTFISNNPGDRGLLGNKGLKG--FPGELGNKGQVGVCTVRGDQGLRGYSGLIGDMGMKGEQGSKGIVGDYGAASRSGIMGRTGKIGNQGLPGDQXXXXXXXXXXXXXXXXYIGIPGFEGDR---GEKGNKGFPGFPGDIGQPGRLGNPGISTEGVXXXXXXXXXXXXXXXXXXXXXXXXXXKQGDSGISIPGRQGIKGEDGTIGLPGEMGEPGPRGDFGQKGNIGITGEFG--------------LQGNRGDDGLKGDDGIPGLNGPRGFIGDIGFVGFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXELGLDGSMGGKGDNGPRGFNGPTGIPGSKGFEGDKGIR----------------GDIGVKGFQGQHG-EIGFPGLKGVSGENGR 3809
            IG  G  G  GLPG  G +G  G PG  G  GF G+ G                 G +G +GD G  G KG+KG   +S  PG  G  G KG  G  F    G  G  G+   RGD GL G  GL G  GM+G  G  G+ G+ G     G  GR G  G  G PG  G+ G  G  G  G  G  G  G +G+    G +G KG  G PG+IG  G +G PG   +G  G PG  GLPG  G  G  G+ G PGK G+ G+     +G  G  G IGLPG  G  G  G  GQKG+ G+TG  G              ++G++GD G  GD   PG  GPRG  G  G  G                         G              G+ G  G  G  GP+G  GPTG+PG +GF G  G +                GD G+KGF+G  G  I  PG  G+ GE G 
Sbjct:    2 IGDPGPPGESGLPGPRGLEGFPGVPGPKGTAGFSGDLGDKGERGEPGRGGPPGPKGFTGPRGDLGYPGTKGVKGPPGLSGKPGLDGASGGKGEHGEVFGASSGAPGDPGLPGHRGDTGLTGDPGLPGYFGMEGMPGMTGLKGESGPPGLQGEQGRPGPPGTFGFPGQTGYTGPPGPPGNIGEPGPSGRRGDQGEPGLIGARGVKGAIGDPGNIGVTGNIGPPG--DQGETGGPGFFGLPGLKGSKGGQGMTGFPGKTGERGL-----KGFSGTKGEIGLPGHQGAKGAPGSPGQKGDRGLTGPPGDKPVIHITPHMKEVMKGSKGDHGNMGD---PGFTGPRGTKGFPGIPG-------------------------GEGKDGHPGEPSVVKGVKGLPGEPGLEGPKGMPGPTGLPGIEGFPGMSGPKLIFQGNKGSSGAYGRPGDSGIKGFKGDLGPTISLPGSTGLRGETGH 440          

HSP 14 Score: 82.4185 bits (202), Expect = 4.901e-15
Identity = 77/188 (40.96%), Postives = 102/188 (54.26%), Query Frame = 3
Query: 3990 IRGLQGRKGSTGLRGNIGIPGERGDKGIPGLQGKVGNKGVKGDIGD------KGFSGNIGDKGYSGISGDKGSFGVKGDKGFQGDVGMLGKSGLQGDRGQKGIIGFRGT--RGIPGSMGLPGEIGEKGDVGPSGIGVKGLKGYQNAVGIKGRKGEKGLPGFPGRPGKV------GDQGDKGPKGMKNM 4511
            +RG  G  GSTG +G  G+PGERG  G+ G++G  G +G  G +G       +GF G+ G KG SG  G  G+ G++G  G +G  G+ G  GL G +GQKG  G  GT   G PG+ G  GE+GE G +  +  GV G  G++   G  G KGE G  G PG  G+       G QGD G  G+K +
Sbjct:  434 LRGETGHPGSTGAKGLYGMPGERGSSGLDGIEGMKGYQGEPGTVGPPGSDGLQGFPGSQGHKGRSGDPGQTGTTGIQGQPGQKGFPGLKGIFGLDGLKGQKGNQGVPGTDNWGQPGNPGTKGELGETG-IPSTTTGVPGSLGHKGTTGDSGNKGEIGQRGVPGPQGQQGFSDIKGTQGDYGFPGIKGI 620          

HSP 15 Score: 74.7146 bits (182), Expect = 9.173e-13
Identity = 77/211 (36.49%), Postives = 106/211 (50.24%), Query Frame = 3
Query: 3990 IRGLQGRKGSTGLRGNIGIPGERGDKGI---PGLQGK----VGNKGVK------GDIGDKGFSGNI-------------GDKGYSGISGDKGSFGVKGDKGFQGDVGMLGKSGLQGDRGQKGIIGFRGTRGIPGSMGLPGEIGEKGDVGPSGI-------GVKGLKGYQNAVGIKGRKGEKGLPGFP--GRPGKVGDQGDKGPKGMKNMNT 4517
            ++G++G  G  GL G  G+PG  G  GI   PG+ G      GNKG        GD G KGF G++             G+ G+ G +G KG +G+ G++G  G  G+ G  G QG+ G  G  G  G +G PGS G  G  G+ G  G +GI       G  GLKG     G+KG+KG +G+PG    G+PG  G +G+ G  G+ +  T
Sbjct:  357 VKGVKGLPGEPGLEGPKGMPGPTGLPGIEGFPGMSGPKLIFQGNKGSSGAYGRPGDSGIKGFKGDLGPTISLPGSTGLRGETGHPGSTGAKGLYGMPGERGSSGLDGIEGMKGYQGEPGTVGPPGSDGLQGFPGSQGHKGRSGDPGQTGTTGIQGQPGQKGFPGLKGIFGLDGLKGQKGNQGVPGTDNWGQPGNPGTKGELGETGIPSTTT 567          

HSP 16 Score: 66.2402 bits (160), Expect = 3.790e-10
Identity = 69/162 (42.59%), Postives = 83/162 (51.23%), Query Frame = 3
Query: 4014 GSTGLRGNIGIPGERGDKGIPGLQGKVGNKGVKGDIGDK---GFSGNIGDKGYSGISGDKGSFGVKGDKGFQGDVGMLGKSGLQGDRGQKGIIG--FRGTRGIPGSMGLPGEIGEKGDVGPSGI-GVKGLKGYQNAVGIKGRKGEKGLPGFPGRPGKVGDQG 4481
            G  G  G  G+PG RG +G PG+ G  G  G  GD+GDK   G  G  G  G  G +G +G  G  G KG +G  G+ GK GL G  G KG  G  F  + G PG  GLPG  G+ G  G  G+ G  G++G     G+KG  G  GL G  GRPG  G  G
Sbjct:    3 GDPGPPGESGLPGPRGLEGFPGVPGPKGTAGFSGDLGDKGERGEPGRGGPPGPKGFTGPRGDLGYPGTKGVKGPPGLSGKPGLDGASGGKGEHGEVFGASSGAPGDPGLPGHRGDTGLTGDPGLPGYFGMEGMPGMTGLKGESGPPGLQGEQGRPGPPGTFG 164          
BLAST of Collagen IV NC1 domain-containing protein vs. Ensembl Zebrafish
Match: col4a1 (collagen, type IV, alpha 1 [Source:ZFIN;Acc:ZDB-GENE-081105-114])

HSP 1 Score: 265.388 bits (677), Expect = 5.552e-71
Identity = 182/505 (36.04%), Postives = 243/505 (48.12%), Query Frame = 3
Query: 3990 IRGLQGRKGSTGLRGNIGIPGERGDKGIPGLQGKVGNKGVKGDIGDKGFSGNIGDKGYSGISGDKGSFGVKGDKGFQGD------------VGMLGKSGLQGDRGQKGIIGFRGTRGIPGSMGLPGEIGEKGDVGPSGI--------------------------------------GVKGLKGYQNAVGIKGRKGEKGLPGFPGRPGKVGDQGDKGPKGMKNMNTXXXXXXXXXXXXXXXXXXXXXXXXXLPGDMGEIGPNGPIGYADNGFLYATHSQSKDFPPCHGGGSPLYNGYSLLAIHGDIDSVTMDLGTPGSCLKNFSTIPFVNCFLERNTFYGGRCHVNMRNSRSYWLSTLQSYMSSPQPPS--KMDDYISRCSVCQTKTTVMAFHSQKSDWQMTKCPYGWQKLWAGFSFPMAVQASRSGSNQPFSSPGSCLKHFRSLPFIECNNHNSNCNHWRDGVSYYMTAVDSENQFVKAQGKVLKSQTDIMNSISKCVVCQRDM 5348
            I G +G KG +GL G+ G PGERG   +PG Q   G KG +GD G  G  G  G++G  GI G  GS G KGD GFQG             +G+ G+ GL G  G KG +G +G  G PG+ G  G IG KG+ G  G                                       G  G KG Q  +G++G KG  G PG+ G PG  G+ G  GP G +                                  G IGP GP    D+GFL   HSQ+ D P C  G +P+Y+GYSLL + G+  S   DLGT GSCL+ FS +PF+ C +         C+   RN  SYWL+T +    S  P +   +  +ISRC+VC+    V+A HSQ    Q+  CP GW  LW G+SF M   A   GS Q  +SPGSCL+ FRS PFIEC+   + CN++ +  S+++  ++  + F K     LK+ + +   IS+C VC + +
Sbjct: 1116 IPGTKGDKGLSGLPGDQGRPGERG---LPG-QAMEGPKGDRGDQGQPGERGATGEQGPPGIPGSAGSKGEKGDVGFQGAPGSRGYKGDKGFIGVSGEPGLPGYNGPKGEMGPQGVPGFPGTKGEQGVIGSKGEGGDRGFPGLKGSEGPPGPPGPHTYVKGDPGPPGPQGPQGLVGIQGFPGAKGQQGVMGLQGLKGSDGTPGYNGHPGAKGEPGQTGPPGPRGYPGPPGPDG----------------------IPGHIGPPGPS-SMDHGFLVTRHSQTIDVPHCPQGTTPIYDGYSLLYVQGNERSHGQDLGTAGSCLRKFSPMPFLFCNINN------VCNFASRNDYSYWLTTPEPMPMSMAPVTGESIKPFISRCAVCEAPAMVIAVHSQT--IQIPNCPDGWASLWIGYSFVMHTSAGAEGSGQALASPGSCLEEFRSAPFIECHGRGT-CNYYANSYSFWLATIEDTDMFTKPVPATLKAGS-LRTHISRCQVCMKRV 1583          

HSP 2 Score: 252.677 bits (644), Expect = 4.942e-67
Identity = 360/1009 (35.68%), Postives = 446/1009 (44.20%), Query Frame = 3
Query:  168 RICTPDKCQCFGNKGRQGFPGPRGYQGVSGDKGDVGQFGMPGPKGYKGFTGAIGPQGRKGERGIPGSPG----YPGKMGEMGFPGIRGDIGEKGLTGCDGQQGDFGNPGMNGLVGRTGQPGERGDDGDRGLSIIPKYGLKGNKGSRGLLGRYGRKGEKGFKGIKGYSGIFGIKGNKGYV----GPMGRRGPKGDSLGTVIIQSEKGSKGDKGLKGQSGIPCKGFQIEGRMYGRVGSDGPIGDKGIKGEKGLMGEIGQSGIDGARGLNGEKGLPGE--AGPRGERGDRGNPGFPGDPGASGADGTRGRQGERGPKGVHGISGADGPRGS-----------------------------------RGDKG----PSGSLLSCPGRKGEKGFFGIPGIKGDIGNKGYQGHDGDIGEIGFKGEKGYEGPLGPSCSEVEQGFRGTKGESGFPGLRGAKGQRGYSGNKGIKGKPNFGTGINN---------PGETGSYGNLGVPGEKGNKGFIGDTGEKGFSGT-GKQGPEGPRGDKGDDGVNGQVGMIGMPGIKGDKGST-YPICPFCEKGYKGIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEGRMGLLGSKGRQGYK--------------------GGKGFSGSMGDAGEIGYVTISGTTIPGVKGEKGNQGPKGNKGE------------FGEAGSRGRKGYSGLKGFKGLIGERGTSFSSGDPGDKGLRGENGKDGVSFAGIPGEKGLKGDKGNRGILGDVGSLSNCATRPITSKGFKGPQGAKGTSGSPGSAGKTGIVGNKGENGYPGKRGIDGDNGIPGSKGEEGETGIKGHAGRPGNLGKSGLQGLRGEYGVKGDLGIQGIPGRKGVMGDPGPNGYAMIGSKGDKGIKGLPGIYGAKGDKGRPGYIGIPGFKGETGLIGRSGLKGDQGEIGEKGIK-------GFTFISNNPGDRGLLGNKGLKGFPGELGNKGQVGVCTVRGDQGLRGYSGLIGDMGMKGEQG 2897
              CT  +C  FG  G  G  GP+G QG  G  G  G+ G+PGP G  G  G  G  G  G+ G  G PG     PG  G+ G PG  GD   +G  G DG  G  G PG  G     G+PG+RG DGD G+   P       +   G  G+ G KG  GF G  G  G+ G KG  G V    GP G  GP+G+S G   +Q ++G  G++G+ G  G           + G  G  G  G  G  G  G  GE GQ G+ G  G  G+KG PG    GP+G  G  G PGFPG+ G +G  G  G +G  GP G  G+ G  GP G                                    +GDKG    P   +   PG +G  G  G+PG KG  G  G  G DG  GE G KGE G  G  GP   +   G  G  G+ G PG+ G +G  G  G KG +G+P       N          G+ G  G+ G PG  G KGF G +G+ G  G  G  G  G  GDKGD G+ G+ G IG PG  G +G   YP      KG KG+                            G  G  G  G+ G +G K                    G  GF G  G+ G+ G + ++GT  PG +G KG+QG  G+ G+             GE G+ GR G  GL+G  G  GE+G S   G PG  G RGE G  G    G  GE G KGDKGN G+                        G  G+ G PG+ G  G+ G  G+ G PG+RG+ G   + G KG+ G+ G  G  G  G  G  G+ G  G  G KGD+G QG PG +G  GD G      IG  G+    GLPG  G KG+ G  G  G PG KGE G+IG  G  GD+G  G KG +         T++  +PG  G  G +GL G  G  G KGQ GV  ++G +G  G  G  G  G KGE G
Sbjct:  388 ETCT--ECNAFGPPGLPGPQGPKGLQGFPGPAGIKGEKGLPGPSGPAGNAGFNGAPGLMGKPGAQGEPGDIFVAPGLKGDKGLPGTTGD---RGFPGVDGLPGKDGRPGYPGT---KGEPGDRGPDGDFGVPGPPGERGPPGEPGIGRPGQPGDKGSAGFPGAPGRPGLQGAKGEAGKVISLPGPQGAPGPRGES-GRPGLQGDRGFPGERGVPGFPGDKGDPGLPGIGLPGPPGPKGYSGIPGPSGIPGESGEPGQDGLPGRAGTPGQKGEPGRGLPGPKGTTGLPGVPGFPGEKGNTGMPGVPGTEGRTGPPGPQGLKGNPGPPGVHGALGPPGPPGLGEPGAPGPMGPPGGPGPIGQSGIKGDKGYQGLPGLDMPGPPGDRGSPGVPGLPGSKGLPGQPGVPGKDGFPGERGPKGEIGIMGMAGPPGFQGLVGNPGDPGQKGDPGMPGIRGDFGDLGTKGERGEPGLQGPPGNMSDVDMEHMKGDKGDIGDRGDPGPTGEKGFPGTSGDPGMPGKDGMPGSPGQPGDKGDPGIIGKPGSIGEPGDTGARGDMGYPGS-MGPKGAKGV---------------------------GGSPGHPGFKGTDGSKGDKGDPGEPGIGIPGPPGTKGNIGSPGFPGEPGEKGQKGTMGMTGT--PGTQGHKGDQGSIGSPGKPGEKGVGGLPGSPGEPGTPGRPGEPGLQGPPGPHGEKGQSGQDGIPGFTGERGEPGVPGRGLPGSRGEPGGKGDKGNPGL-----------------------PGIPGSPGIPGTKGDKGLSGLPGDQGRPGERGLPG-QAMEGPKGDRGDQGQPGERGATGEQGPPGIPGSAGSKGEKGDVGFQGAPGSRGYKGDKG-----FIGVSGE---PGLPGYNGPKGEMGPQGVPGFPGTKGEQGVIGSKGEGGDRGFPGLKGSEGPPGPPGPHTYVKGDPGPPGPQGPQGLVGIQGFPGAKGQQGVMGLQGLKGSDGTPGYNGHPGAKGEPG 1325          

HSP 3 Score: 241.121 bits (614), Expect = 1.892e-63
Identity = 349/1002 (34.83%), Postives = 436/1002 (43.51%), Query Frame = 3
Query:  216 QGFPGPRGYQGVSGDKGDVGQFGMPGPKGYKGFTGAIGPQGRKGERGIPGSPGY-PGKMGEMGFPGIRGDIGEKGLTGCDGQQGDFGNPGMNGLVGRTGQPGERGDDGDRGLSIIPKYGLKGNKGSRGLLGRYGRKGEKGFKGIKGYSGIFGIKGNKGYV----GPMGRRGPKGDSLGTVIIQSEKGSKGDKGLKGQSGIPCKGFQIEGRMYGRVGSDGPIGDKGIKGEKGLMGEIGQSGIDGARGLNGEKGLPGE--AGPRGERGDRGNPGFPGDPGASGADGTRGRQGERGPKGVHGISGADGPRGSRGDKGPSGSLLSCPGR-------------------KGEKGFFGIPGIKGDIGNKGYQGHDGDIGEIGFKGEKGYEGPLGPSCSEVEQGFRGTKGESGFPGLRGAKGQRGYSGNKGIKGKPNFGTGINNPGETGSYGNLGVPGEKGNKGFIGDTGEKGFSGTGKQGPEGPRGDKGDDGVNGQVGMIGMPGIKGDKGSTYPICPFCEKGYKGIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEGRMGLLGSKGRQGYKGGKGFSGSMGDAGEIGYVTISGTTIPGVKGEKGNQGPKGNKGEFGEAGSRGRKGYSGLKGFKG-----------LIGERGTSFSSGDPGDKGLRGENGKDGVSFAGIPGEKGLKGDKGNRGILGD-----VGSLSNCATRPIT-----SKGFKGPQGAKGTSGSPGSAGKTGIVGNKGENGYPGKRGIDGDNGIPGSKGEEGETGIKGHAGRPGNLGKSGLQGLRGEYGVKGDLGIQGIPGRKGVMGDPGPNGYAMIGSKGDKGIKGLPGIYGAKGDKGRPGYIGIPGFKGETGLIGRSGLKGDQGEIGEKGIKGFTFISNNPGDRGLLGNKGLKGFPGELGNKGQVGVCTVRGDQGLRGYSGL----------------------------------------------IGDMGMKGEQGSKGIVGDYGAASRSG 2942
            QGFPGP G       KG+ G  G  GP G  GF GA G  G+ G +G PG     PG  G+ G PG  GD   +G  G DG  G  G PG  G     G+PG+RG DGD G+   P       +   G  G+ G KG  GF G  G  G+ G KG  G V    GP G  GP+G+S G   +Q ++G  G++G+ G  G           + G  G  G  G  G  G  G  GE GQ G+ G  G  G+KG PG    GP+G  G  G PGFPG+ G +G  G  G +G  GP G  G+ G  GP G  G  GP G                           KG+KG+ G+PG+       G  G  G  G  G  G KG  G              G  G+ GFPG RG KG+ G     G+ G P F   + NPG+ G  G+ G+PG +G+ G +G  GE+G  G      +GP G+  D      V M  M G KGD G      P  EKG+ G  G+ G                          G+ G+ GS G+ G KG  G  G  G  GE G     G       G  G+ GPKG KG  G  G  G KG  G KG KG             G +G   S G PG+ G +G+ G  G++  G PG +G KGD+G+ G  G      VG L      P T       G +GP G  G  G  G  G  G  G +GE G PG+       G+PGS+GE G  G KG+ G PG  G  G+ G +G+ G+ G  G QG PG +G+       G AM G KGD+G +G PG  GA G++G PG  G  G KGE G +G  G  G +G  G+KG  G +     PG  G  G  G +G PG  G KG+ GV   +G+ G RG+ GL                                              +G  G+KG  G+ G  G  GA    G
Sbjct:  411 QGFPGPAGI------KGEKGLPGPSGPAGNAGFNGAPGLMGKPGAQGEPGDIFVAPGLKGDKGLPGTTGD---RGFPGVDGLPGKDGRPGYPGT---KGEPGDRGPDGDFGVPGPPGERGPPGEPGIGRPGQPGDKGSAGFPGAPGRPGLQGAKGEAGKVISLPGPQGAPGPRGES-GRPGLQGDRGFPGERGVPGFPGDKGDPGLPGIGLPGPPGPKGYSGIPGPSGIPGESGEPGQDGLPGRAGTPGQKGEPGRGLPGPKGTTGLPGVPGFPGEKGNTGMPGVPGTEGRTGPPGPQGLKGNPGPPGVHGALGPPGPPGLGEPGAPGPMGPPGGPGPIGQSGIKGDKGYQGLPGLD----MPGPPGDRGSPGVPGLPGSKGLPG------------QPGVPGKDGFPGERGPKGEIGI---MGMAGPPGFQGLVGNPGDPGQKGDPGMPGIRGDFGDLGTKGERGEPGL-----QGPPGNMSD------VDMEHMKGDKGDIGDRGDPGPTGEKGFPGTSGDPGM------------------------PGKDGMPGSPGQPGDKGDPGIIGKPGSIGEPGDTGARGDM-----GYPGSMGPKGAKGVGGSPGHPGFKGTDGSKGDKGDPGEPGIGIPGPPGTKGNIGSPGFPGEPGEKGQKGTMGMT--GTPGTQGHKGDQGSIGSPGKPGEKGVGGLPGSPGEPGTPGRPGEPGLQGPPGPHGEKGQSGQDGIPGFTGERGEPGVPGR-------GLPGSRGEPGGKGDKGNPGLPGIPGSPGIPGTKGDKGLSGLPGDQGRPGERGL------PGQAMEGPKGDRGDQGQPGERGATGEQGPPGIPGSAGSKGEKGDVGFQGAPGSRGYKGDKGFIGVSGEPGLPGYNGPKGEMGPQGVPGFPGTKGEQGVIGSKGEGGDRGFPGLKGSEGPPGPPGPHTYVKGDPGPPGPQGPQGLVGIQGFPGAKGQQGVMGLQGLKGSDGTPGYNGHPGAKGEPG 1325          

HSP 4 Score: 234.572 bits (597), Expect = 1.933e-61
Identity = 390/1059 (36.83%), Postives = 487/1059 (45.99%), Query Frame = 3
Query:  744 IQSEKGSKGDKGLKGQSGIPCKGFQIEGRMYGRVGS--DGPIGDKGIKGEKGLMGEIGQSGIDGARGLNGEKGLPGEAGPRGERGD-RGNPGFPGDPGASGADGTRGRQGERGPKGVHGISGADGPRGSRGDKGPSGSL----------------LSCPGRKGEKGFFGIPGIKGDIGNKGYQGHDGDIGEIGFKGEKGYEGPLGPSCSEVEQGFRGTKGESGFPGLRGAKGQRGYSGNKGIKGKPNFG-TGINNPGETGSYGNLGVPGEKGNKGFIGDTGEKGFSGTGKQGPEGPRGDKGDDGVNGQVGMIGMPGIKGDKGSTYPICPFCEKGYKGIQ--XXXXXXXXXXXXXXXXXXXXXXXXXXXXDEGRMGLLGSKGRQGYKGGKGFSGSMGDAGEIGYVTISGTTIPGVKGEKGNQGPKGNKGEFGEAGSRGRKGYSGLKGFKGLIGERGTSFSSGDPGDKGLRGENGKDGVSFAGIPGEKGLKGDKGNRGILGDVGSLSNCATRPITSKGFKGPQGAKGTSGSPGSAGKTGIVGNKGENGYPGKRGIDGDNGIPGSKGEEGETGIKGHAGRPGNLGKSGLQGLRGEYGVKGDLGIQGIPGRKGVMGDPGPNGYA-MIGSKGDKG-----IKGLPGIYGAKGDKGRPGYIGIPGFKGETGLIGRSGLKGDQGEIGEKGIKGFTFISNNPGDRGLLGNKGLKGFPGELGNKGQVGVCTVRGDQGLRGYSGLIGDMGMKGEQGSKGIVGDYGAASRSGIMGRTGKIGNQGLPGDQXXXXXXXXXXXXXXXXYIGIPGFEGDRGEKGNKGFPGFPGDIGQPGRLGNPGISTEGVXXXXXXXXXXXXXXXXXXXXXXXXXXKQGDSGISIPGRQGIKGEDGTIGLPGEMGEPGPRGDFGQKGNIGITGEFGL---QGNRGDDGLKGDDGIPGLNGPRGFIG------DIGFVGFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXELGLDGSMGGKGDNGPRGFNGPTGIPGSKGFEGDKGIRGDIGVKGFQGQHGEIGFPGLKGVSGENGR 3809
            +Q E G KGD+G   ++   C  F   G    +      G  G  GIKGEKGL G    SG  G  G NG  GL G+ G +GE GD    PG  GD G  G  G RG  G  G  G  G  G  G +G  GD+GP G                  +  PG+ G+KG  G PG  G  G +G +G  G +  I   G +G  GP G S     QG RG  GE G PG  G KG  G  G          G +GI  PG +G  G  G PG+ G  G  G  G+KG  G G  GP+G  G  G  G  G+ G  GMPG+ G +G T P  P   KG  G                G  G  G  G  G PG  G+ G+ G KG QG  G     G  GD G  G   + G+   G+ G+ G  G  G  GE G  G  G  G +G  GF+GL+G  G     GDPG  G+RG+ G           + G KG++G  G+ G  G++S+     +  +  KG +G  G  G PG  G+ G  G  G+ G PGK      +G+PGS G+ G+ G  G  G+PG++G+ G  G RG+ G  G +G +G    KGV G PG  G+    GSKGDKG       G+PG  G KG+ G PG+ G PG KG+ G +G +G  G QG  G++G  G       PG++G+ G  G  G PG  G  G+ G+    G  G +G SG  G  G  GE+G  G+ G     SR G  G  G  GN GLPG                     IPG  G  G KG+KG  G PGD G+PG  G PG + EG  GD G  G PG  G  G         +QG  GI  PG  G KGE G +G     G PG RG  G KG IG++GE GL    G +G+ G +G  G PG  G +G IG      D GF G +GS+G  G  G                                    KGD GP G  GP G+ G +GF G KG +G +G++G +G  G  G+ G  G  GE G+
Sbjct:  376 LQGEVGQKGDQG---ETCTECNAFGPPGLPGPQGPKGLQGFPGPAGIKGEKGLPGP---SGPAGNAGFNGAPGLMGKPGAQGEPGDIFVAPGLKGDKGLPGTTGDRGFPGVDGLPGKDGRPGYPGTKGEPGDRGPDGDFGVPGPPGERGPPGEPGIGRPGQPGDKGSAGFPGAPGRPGLQGAKGEAGKV--ISLPGPQGAPGPRGESGRPGLQGDRGFPGERGVPGFPGDKGDPGLPGIGLPGPPGPKGYSGI--PGPSGIPGESGEPGQDGLPGRAGTPGQKGEPGRGLPGPKGTTGLPGVPGFPGEKGNTGMPGVPGTEGRTGPPGPQGLKGNPGPPGVHGALGPPGPPGLGEPGAPGPMGPPGGPGPIGQSGIKGDKGYQGLPG-LDMPGPPGDRGSPGVPGLPGSK--GLPGQPGVPGKDGFPGERGPKGEIGIMGMAGPPGFQGLVGNPGDPGQKGDPGMPGIRGDFG-----------DLGTKGERGEPGLQGPPGNMSD-----VDMEHMKGDKGDIGDRGDPGPTGEKGFPGTSGDPGMPGK------DGMPGSPGQPGDKGDPGIIGKPGSIGEPGDTGARGDMGYPGSMGPKGA---KGVGGSPGHPGFKGTDGSKGDKGDPGEPGIGIPGPPGTKGNIGSPGFPGEPGEKGQKGTMGMTGTPGTQGHKGDQGSIG---SPGKPGEKGVGGLPGSPGEPGTPGRPGEPGLQGPPGPHGEKGQSGQDGIPGFTGERGEPGVPGRGLPGSR-GEPGGKGDKGNPGLPG---------------------IPGSPGIPGTKGDKGLSGLPGDQGRPGERGLPGQAMEGPKGDRGDQGQPGERGATG---------EQGPPGI--PGSAGSKGEKGDVGF---QGAPGSRGYKGDKGFIGVSGEPGLPGYNGPKGEMGPQGVPGFPGTKGEQGVIGSKGEGGDRGFPGLKGSEGPPGPPGPHTYV-------------------------------KGDPGPPGPQGPQGLVGIQGFPGAKGQQGVMGLQGLKGSDGTPGYNGHPGAKGEPGQ 1326          

HSP 5 Score: 222.246 bits (565), Expect = 1.041e-57
Identity = 348/993 (35.05%), Postives = 431/993 (43.40%), Query Frame = 3
Query:  759 GSKGDKGLKGQSGIP-CKGFQIEGRMYGRVGSDGPIGD----KGIKGEKGLMGEIGQSGIDGARGLNGEKGLPGEAGPRGERGDRG-----------------------NPGFPGDPGASGADGTRGRQGERGPKG-------VHGISGADGPRGSRGDKGPSGSL-----LSCPGRKGEKG-----------------FFGIPGIKGDIGNKGYQGHDGDIGEIGFKGEKG-----YEGPLGPSCSEVEQGFRGTKGESGFPGLRGAKGQRGYSGNKGIKGKPNFGTGINNPGETGSYGNLGVPGEKGNKG--------------------FIGDTGEKGFSGTGKQGPEGPRGDKGDDGVNGQVGMIGMPGIKGDKGSTYPICPFCEKGYKGIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEGRMGLLGSKGRQGYKGGKGFSGSMGDAGEIGYVTISGTTIPGVKGEKGNQGPKGN---------KGEFGEAGSRGRKGYSGLKGFKGLIGERGTSFSSGDPGDKGLRGENGKDGVSFAGIPGEKGLKGDKGNRGILGDVGSLSNCATRPITSKGFKGPQGAKGTSGSPGSAGKTGIVGNKGENG-----------YPGKRGIDGDNGIPGSKGEEGETGIKGHAGRPGNLGKSGLQGLRGEYGVKGDLGIQGIPGRKGVMGDPGPNGYAMIGSKGDKGIKGLPGIYGAKGDKGRPGYIGIPGFKGETGLIGRSGLKGDQGEIG---EKGIKGFTFISNNPGDRGLLGNKGLKGFPGELGNKGQVGVC--TVRGDQGLRGYSGLIGDMGMKGEQGSKGIVGDYGAASRSGIMGRTGKIGNQGLPGDQXXXXXXXXXXXXXXXXYIGIPGFEGDRGEKGNKGFPGFPGDIGQPGRLGN---------PGI--STEGVXXXXXXXXXXXXXXXXXXXXXXXXXXKQGDSGISIPGRQGIKGEDGTIGLPGEMGEPGPRGDFGQKGNIGIT 3383
            G KG+KGL G SG     GF     + G+ G+ G  GD     G+KG+KGL G  G  G  G  GL G+ G PG  G +GE GDRG                        PG PGD G++G  G  GR G +G KG       + G  GA GPRG  G  G  G          PG  G+KG                 + GIPG  G  G  G  G DG  G  G  G+KG       GP G +      GF G KG +G PG+ G +G+ G  G +G+KG         NPG  G +G LG PG  G                         GD G +G  G    GP G RG  G  G+ G  G+ G PG+ G  G      P  E G  G+ G                             G  GL+G+ G  G KG  G  G  GD G++G          G +GE G QGP GN         KG+ G+ G RG  G +G KGF G  G+ G     G PG  G  G+ G  G+   G PG  G  GD G RG +G  GS+              GP+GAKG  GSPG  G  G  G+KG+ G            PG +G  G  G PG  GE+G+ G  G  G PG  G  G QG  G  G  G+ G+ G+PG  G  G PG          G+ G++G PG +G KG  G+ G  G  G +GE G+ GR GL G +GE G   +KG  G   I  +PG  G  G+KGL G PG+ G  G+ G+    + G +G RG  G  G+ G  GEQG  GI G  G+    G +G  G  G++G  GD+GF G  G           G+PG+ G +GE G +G PGFPG  G+ G +G+         PG+  S            + G  G PG  G  G  G QG      PG +G +G  G  GL G  G PG  G  G KG  G T
Sbjct:  418 GIKGEKGLPGPSGPAGNAGFNGAPGLMGKPGAQGEPGDIFVAPGLKGDKGLPGTTGDRGFPGVDGLPGKDGRPGYPGTKGEPGDRGPDGDFGVPGPPGERGPPGEPGIGRPGQPGDKGSAGFPGAPGRPGLQGAKGEAGKVISLPGPQGAPGPRGESGRPGLQGDRGFPGERGVPGFPGDKGDPGLPGIGLPGPPGPKGYSGIPGPSGIPGESGEPGQDGLPGRAGTPGQKGEPGRGLPGPKGTTGLPGVPGFPGEKGNTGMPGVPGTEGRTGPPGPQGLKG---------NPGPPGVHGALGPPGPPGLGEPGAPGPMGPPGGPGPIGQSGIKGDKGYQGLPGLDMPGPPGDRGSPGVPGLPGSKGLPGQPGVPGKDGFPGERGPKGEIGIMGMAG---------------------------PPGFQGLVGNPGDPGQKGDPGMPGIRGDFGDLGTK--------GERGEPGLQGPPGNMSDVDMEHMKGDKGDIGDRGDPGPTGEKGFPGTSGDPGMPGKDGMPGSPGQPGDKGDPGI--IGKPGSIGEPGDTGARGDMGYPGSM--------------GPKGAKGVGGSPGHPGFKGTDGSKGDKGDPGEPGIGIPGPPGTKGNIGSPGFPGEPGEKGQKGTMGMTGTPGTQGHKGDQGSIGSPGKPGEKGVGGLPGSPGEPGTPG--------RPGEPGLQGPPGPHGEKGQSGQDGIPGFTGERGEPGVPGR-GLPGSRGEPGGKGDKGNPGLPGIPGSPGIPGTKGDKGLSGLPGDQGRPGERGLPGQAMEGPKGDRGDQGQPGERGATGEQGPPGIPGSAGSKGEKGDVGFQGAPGSRGYKGDKGFIGVSGEP---------GLPGYNGPKGEMGPQGVPGFPGTKGEQGVIGSKGEGGDRGFPGLKGSEGPPGPPGPHTYVKGDPGPPGPQGPQGLVGIQG-----FPGAKGQQGVMGLQGLKGSDGTPGYNGHPGAKGEPGQT 1327          

HSP 6 Score: 208.379 bits (529), Expect = 1.896e-53
Identity = 335/937 (35.75%), Postives = 408/937 (43.54%), Query Frame = 3
Query:  201 GNKGRQGFPGPRGYQGVSGDKGDVGQFGMPGPKGYKGFTGAIGPQGRKGERGIPGSPGYPGKMGEMGFPGIRGDIGEKG--------------------LTGCDGQQGDFGNPGMNGLVGRTGQPGERGDDGDRGLSIIPKYGLKGNKGSRGLLGRYGRKGEKGFKGIKGYSGIFGIKGN-----------------KGYVGPMGRRGPKGDS--------LGTVIIQSEKGSKGDKGLKGQSGIP-CKGFQIEGRMYGRVGSDGPIGDKGIKGEKGLMGEIGQSGIDGA--------------------------------RGLNGEKGLPG--EAGPRGERGDRGNPGFPGD---PGASGADGTRGRQGERGPKGVHGISGADGPRGSRGDKGPSGSLLSCPGRKGEKGFFGIPGIKGDIGNKGYQGHDGDIGEIG------------FKGEKGYEGPLGPSCSEVEQGFRGTKGESGFPG---LRGAKGQRGYSGNKGIKGKPNFGTGINNPGETGSYGNLGVPGE---KGNKGFIGDTGEKGFSGTGKQGPEGPRGDKGD--------------DGVNGQVGMIGMPGIKGDKGSTYPICPFCEKGYKGIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEGRMGLLGSKGRQGYKGGKGFSGSMGDAGEIGYVTISGTTIPGVKGEKGNQGPKGNKGEFGEAGS------RGRKGYSGLKGFKGLIGERGTSFSS-----GDPGDKGLRGENGKDGVS-FAGIPGEKGLKGDKGNRGILGDVGSLSNCATRPITSKGFKGPQGAKGTSGSPGSAGKTGIVGNKGENGYPGKRGIDGDNGIPGSKGEEGE-------------------------------------TGIKGHAGRPGNLGKSGLQGLRGEYGVKGDLGIQGIPGRKGVMGDP 2519
            GN G  G PG  G  G  G+ GD+  F  PG KG KG  G  G      +RG PG  G PGK G  G+PG +G+ G++G                      G  GQ GD G+ G  G  GR G  G +G+ G     +I   G +G  G RG  GR G +G++GF G +G  G  G KG+                  G  GP G  G  G+          GT   + E G +G  G KG +G+P   GF  E    G  G  G  G  G  G +GL G  G  G+ GA                                +G  G +GLPG    GP G+RG  G PG PG    PG  G  G  G  GERGPKG  GI G  GP G +G       L+  PG  G+KG  G+PGI+GD G+ G +G  G+ G  G             KG+KG  G  G      E+GF GT G+ G PG   + G+ GQ G  G+ GI GKP     I  PG+TG+ G++G PG    KG KG  G  G  GF GT     +G +GDKGD               G  G  G  G PG KG KG+         +G+KG QG +G  G+ G  G+ GL G+ G  G PG  G  GL G  G  G KG  G  G  G  GE G   + G  +PG +GE G +G KGN G  G  GS      +G KG SGL G +G  GERG    +     GD GD+G  GE G  G     GIPG  G KG+KG+ G  G  GS           +G+KG +G  G SG PG  G  G  G  G  G PG  G  G+ G+ GSKGE G+                                      GI+G  G  G  G  GLQGL+G  G  G  G  G  G  G  G P
Sbjct:  433 GNAGFNGAPGLMGKPGAQGEPGDI--FVAPGLKGDKGLPGTTG------DRGFPGVDGLPGKDGRPGYPGTKGEPGDRGPDGDFGVPGPPGERGPPGEPGIGRPGQPGDKGSAGFPGAPGRPGLQGAKGEAG----KVISLPGPQGAPGPRGESGRPGLQGDRGFPGERGVPGFPGDKGDPGLPGIGLPGPPGPKGYSGIPGPSGIPGESGEPGQDGLPGRAGTPGQKGEPG-RGLPGPKGTTGLPGVPGFPGEKGNTGMPGVPGTEGRTGPPGPQGLKGNPGPPGVHGALGPPGPPGLGEPGAPGPMGPPGGPGPIGQSGIKGDKGYQGLPGLDMPGPPGDRGSPGVPGLPGSKGLPGQPGVPGKDGFPGERGPKGEIGIMGMAGPPGFQG-------LVGNPGDPGQKGDPGMPGIRGDFGDLGTKGERGEPGLQGPPGNMSDVDMEHMKGDKGDIGDRGDPGPTGEKGFPGTSGDPGMPGKDGMPGSPGQPGDKGDPGIIGKPGS---IGEPGDTGARGDMGYPGSMGPKGAKGVGGSPGHPGFKGT-----DGSKGDKGDPGEPGIGIPGPPGTKGNIGSPGFPGEPGEKGQKGTMGMTGTPGTQGHKGDQGSIGSPGKPGEKGVGGLPGSPGEPGTPGRPGEPGLQGPPGPHGEKGQSGQDGIPGFTGERGEPGVPGRGLPGSRGEPGGKGDKGNPGLPGIPGSPGIPGTKGDKGLSGLPGDQGRPGERGLPGQAMEGPKGDRGDQGQPGERGATGEQGPPGIPGSAGSKGEKGDVGFQGAPGS-----------RGYKGDKGFIGVSGEPGLPGYNGPKGEMGPQGVPGFPGTKGEQGVIGSKGEGGDRGFPGLKGSEGPPGPPGPHTYVKGDPGPPGPQGPQGLVGIQGFPGAKGQQGVMGLQGLKGSDGTPGYNGHPGAKGEPGQTGPP 1330          

HSP 7 Score: 186.422 bits (472), Expect = 9.758e-47
Identity = 331/976 (33.91%), Postives = 432/976 (44.26%), Query Frame = 3
Query: 1785 DEGRMGLLGSKGRQGYKGGKGFSGSMGDAGEIGYVTISGTTIPGVKGEKGNQGPKGNKGEFGEAGSRGRKGYSGLKGFKGLIGERGTSFS--------------------SGDPGDKGLRGENGKDGVSFAGIPGEKGLKGDKGNRGILGDVGSLSNCATRPITSKGFKGPQGAKGTSGSPGSAGKTGIVGNKGENGYPGKRG--------------------IDGDNGIPGSKGEEGETGIKGHAGRPGNLGK-----------SGLQGLRGEYGVKGDLGIQGIPGRKGVMGDPGPNGY---------------------------------------AMIGSKGDKGIKGLPGI--YGAKGDKGRPGYIGIPGFKGETGLIGRSGLKGDQGEIGEKGIKGFTFISNNPGDRGLLGN------KGLKGFPGELGNKGQVGVCTVRGDQGLRGYSGLIGDMGMKGEQGSKGIVGDYGAASRSGIMGRTGKIGNQGLPGDQXXXXXXXXXXXXXXXXYIGIPGFEGDRGEKGNKGFPGFPGDIGQPGRLGNPG-ISTEGVXXXXXXXXXXXXXXXXXXXXXXXXXXKQGDSGISIPGRQGIKGEDGTIGLPGEMGEPGPRGDFGQKGNIGITGEFGLQGNRGDDGLKGDDGIPGLNGPRGFIGDIGFVGFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEL---GLDGSMGGKGDNGPRGFNGPTGIPGSKGFEGDKGIRGDIGVKGFQGQHGEIGFPG--LKGVSGENGRQXXXXXXXXXXXXXXXXVCMQPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEVG-ESIRGLQGRKGSTG---LRGNIGIPGERGDKGIPGLQGKVGNKGVKGDIGDKGFSGNIGDKGYSGISGDKGSFGVKGDKGF----------QGDVGMLGKSGLQGDRGQKGIIGFRGTRGIPGSMGLPGEIGEKGDVG 4358
            ++G  G  G  G  G+ G  G  G  G  GE G + ++    PG+KG+KG  G  G++G  G  G  G+ G  G  G KG  G+RG                         G PGDKG  G        F G PG  GL+G KG  G +             I+  G +G  G +G SG PG  G  G  G +G  G+PG +G                    I G +GIPG  GE G+ G+ G AG PG  G+           +GL G+ G  G KG+ G+ G+PG +G  G PGP G                                           G KGDKG +GLPG+   G  GD+G PG  G+PG KG  G  G  G  G  GE G KG  G   ++  PG +GL+GN      KG  G PG  G+ G +G    RG+ GL+G  G + D+ M+  +G KG +GD G    +G  G  G  G+ G+PG                    G+PG  G  G+KG+ G  G PG IG+PG  G  G +   G +G  G  G+ G  G PG  G  G  G +GD G    G  G  G  G IG PG  GEPG   + GQKG +G+TG  G QG++GD G  G  G PG  G  G  G  G  G  G  G  G +G  G  G + +  +           +  +   GL GS G  G  G +G  G  GIPGS G  G KG +G  G+ G QG+ GE G PG  ++G  G+ G QG  G +G  G+ G  G+                           G  G+KG KG+VG +   G +G KG  G   + G  G+PG  G KG  G QG  G  G KG+ G  G  G  GD+G+ G+ G +G  G  G   +          QG  G++G  G  G +GQ+G++G +G +G  G+ G  G  G KG+ G
Sbjct:  422 EKGLPGPSGPAGNAGFNGAPGLMGKPGAQGEPGDIFVA----PGLKGDKGLPGTTGDRGFPGVDGLPGKDGRPGYPGTKGEPGDRGPDGDFGVPGPPGERGPPGEPGIGRPGQPGDKGSAG--------FPGAPGRPGLQGAKGEAGKV-------------ISLPGPQGAPGPRGESGRPGLQGDRGFPGERGVPGFPGDKGDPGLPGIGLPGPPGPKGYSGIPGPSGIPGESGEPGQDGLPGRAGTPGQKGEPGRGLPGPKGTTGLPGVPGFPGEKGNTGMPGVPGTEGRTGPPGPQGLKGNPGPPGVHGALGPPGPPGLGEPGAPGPMGPPGGPGPIGQSGIKGDKGYQGLPGLDMPGPPGDRGSPGVPGLPGSKGLPGQPGVPGKDGFPGERGPKGEIGIMGMAGPPGFQGLVGNPGDPGQKGDPGMPGIRGDFGDLGTKGERGEPGLQGPPGNMSDVDMEHMKGDKGDIGDRGDPGPTGEKGFPGTSGDPGMPGKD------------------GMPGSPGQPGDKGDPGIIGKPGSIGEPGDTGARGDMGYPGSMGPKGAKGVGGSPGHPGFKGTDGSKGDKGDPGEPGIGIPGPPGTKGNIGSPGFPGEPG---EKGQKGTMGMTGTPGTQGHKGDQGSIGSPGKPGEKGVGGLPGSPGEPGTPGRPGEPGLQGPPGPHGEKGQSGQDGIPGFTGERGEPGVPGRGLPGSRGEPGGKGDKGNPGLPGIPGSPGIPGTKGDKGLSGLPGDQGRPGERGLPGQAMEGPKGDRGDQGQPGERGATGEQGPPGI--------------------------PGSAGSKGEKGDVGFQGAPGSRGYKGDKGFIGVSGEPGLPGYNGPKGEMGPQGVPGFPGTKGEQGVIGSKGEGGDRGFPGLKGSEGPPGPPGPHTYVKGDPGPPGPQGPQGLVGIQGFPGAKGQQGVMGLQGLKGSDGTPGYNGHPGAKGEPG 1325          

HSP 8 Score: 163.31 bits (412), Expect = 1.079e-39
Identity = 314/885 (35.48%), Postives = 379/885 (42.82%), Query Frame = 3
Query: 2082 RGENGKDGVSFAGIPGEKG------------------LKGDKGNRGILGDVGSLSNC--------ATRPITSKGFKGPQGAKGTSGSPGSAGKTGIVGNKGENGYPGKRGIDGDNGIPGSKGEEGET----GIKGHAGRPGNLGKSGLQGLRGEYGVKGDLGIQGIPGRKGVMGDPGPNG------YAMIGSKGDKGIKGLPGIYGAKGDKGRPGYIGIPGFKGETGLIGRS-GLKGDQGEIGEKGIKGFTFISNNPGDRGLLGNKGLKGFPGELGNKGQVGVCTVRGDQGLRGYSGLIGDMGMKGEQGSKGIVGDYGAASRSGIMGRTGKIGNQGLPGDQXXXXXXXXXXXXXXXXYIGIPGFEGDRGEKGNKGFPGFPGDIGQPGRLGNPGISTEGVXXXXXXXXXXXXXXXXXXXXXXXXXXKQGDSGISIPGRQGIKGEDGTIGLPGEMGEPGPRGDFGQKGNIGITGEFGLQGNRGDDGLKGDDGIPGLNGPRGFIGDIGFVGFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXELGLDGSMGGKGDNGPRGFNGPTGIPGSKGFEGDKGIRGDIGVKGFQGQHGEIGFPGLKGVSGENGRQXXXXXXXXXXXXXXXXVCMQPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEVGESIRGLQGRKGSTGLRGNIGIPGERGDKGI---------PGLQGKVGNKGVKGD-----------------IGDKGFSGNIGDKGYSGISGDKGSFGVKGDKGFQGDVGMLGKSGLQGDRGQKGIIGFRGTRGIPGSMGL---PGEIGEKGDVGPSGI----------GV--KGLKGYQNAVGIKGRKGEKGLPGFPGRPGKVGDQGDKGPKGM 4502
            +GE G DG SF G  G  G                  L+G+ G +G  G+  +  N            P   +GF GP G KG  G PG +G     GN G NG PG  G       PG++GE G+     G+KG  G PG  G  G  G+ G   + G  G  G PG KG  GD GP+G               +   G PG  G KG  G PG  G PG +G  G  G+   L G QG  G +G  G   +    GDRG  G +G+ GFPG+ G+ G  G+           YSG+ G  G+ GE G  G     G   R+G  G+ G+ G +GLPG +G                 G+PG  G  GEKGN G PG PG  G+ G  G  G+  +G  G PG+ G  GP G PGL             G    G+ GIKG+ G  GLPG +  PGP GD G  G  G+ G  GL G     G+ G DG PG  GP+G IG +G  G                    + G  G  G KG  G  G  G  G +G KG+ G  G  GP G       E  KG +GDIG +G  G  GE GFPG  G  G  G+ G  G  G  GD GD G+  +P                                        G  G  G TG RG++G PG  G KG          PG +G  G+KG KGD                 IG  GF G  G+KG  G  G  G+ G +G KG QG +G  GK G +G  G  G  G  GT G PG  GL   PG  GEKG  G  GI          GV  +GL G +   G KG KG  GLPG PG PG  G +GDKG  G+
Sbjct:  339 KGEKGADGRSFPGPKGTDGQPGPPGPPGPISPPGPPGLQGEVGQKGDQGETCTECNAFGPPGLPGPQGPKGLQGFPGPAGIKGEKGLPGPSGP---AGNAGFNGAPGLMGK------PGAQGEPGDIFVAPGLKGDKGLPGTTGDRGFPGVDG---LPGKDGRPGYPGTKGEPGDRGPDGDFGVPGPPGERGPPGEPGIGRPGQPGDKGSAGFPGAPGRPGLQGAKGEAGKVISLPGPQGAPGPRGESGRPGLQ---GDRGFPGERGVPGFPGDKGDPGLPGIGLPGPPGPKG-YSGIPGPSGIPGESGEPG---QDGLPGRAGTPGQKGEPG-RGLPGPKG---------------TTGLPGVPGFPGEKGNTGMPGVPGTEGRTGPPGPQGL--KGNPGPPGVHGALGPPGPPGLGEPGAPGPMGPPGGPGPIGQSGIKGDKGYQGLPG-LDMPGPPGDRGSPGVPGLPGSKGLPGQ---PGVPGKDGFPGERGPKGEIGIMGMAG--------------PPGFQGLVGNPGDPGQKGDPGMPGIRGDFGDLGTKGERGEPGLQGPPGNMSDVDMEHMKGDKGDIGDRGDPGPTGEKGFPGTSGDPGMPGKDGMPGSPGQPGDKGDPGIIGKP----------------------------------------GSIGEPGDTGARGDMGYPGSMGPKGAKGVGGSPGHPGFKGTDGSKGDKGDPGEPGIGIPGPPGTKGNIGSPGFPGEPGEKGQKGTMGMTGTPGTQGHKGDQGSIGSPGKPGEKGVGGLPGSPGEPGTPGRPGEPGLQGPPGPHGEKGQSGQDGIPGFTGERGEPGVPGRGLPGSRGEPGGKGDKGNPGLPGIPGSPGIPGTKGDKGLSGL 1128          

HSP 9 Score: 87.4261 bits (215), Expect = 1.788e-16
Identity = 77/175 (44.00%), Postives = 96/175 (54.86%), Query Frame = 3
Query: 3996 GLQGRKGSTGLRGNIGIPGERGDKGIPG--LQGKVGNKGVKGDIGDKGFSGNIGDKGYSGISGDKGSFGVKGDKGFQGDVGMLGKS--GLQGDRGQKGIIGFRGTRGIPGSMGLPGEIGEKGDVGPSGI-GVKGLKGYQNAVGIKGRKGEKGLPGFPGRPGKVGDQGDKGPKGMK 4505
            G  G KG +G  G  G  GERG+ G+PG  L G  G  G KGD G+ G  G  G  G  G  GDKG  G+ GD+G  G+ G+ G++  G +GDRG +G  G RG  G  G  G+PG  G KG+ G  G  G  G +GY+   G  G  GE GLPG+ G  G++G QG  G  G K
Sbjct: 1059 GPHGEKGQSGQDGIPGFTGERGEPGVPGRGLPGSRGEPGGKGDKGNPGLPGIPGSPGIPGTKGDKGLSGLPGDQGRPGERGLPGQAMEGPKGDRGDQGQPGERGATGEQGPPGIPGSAGSKGEKGDVGFQGAPGSRGYKGDKGFIGVSGEPGLPGYNGPKGEMGPQGVPGFPGTK 1233          

HSP 10 Score: 82.8037 bits (203), Expect = 3.784e-15
Identity = 80/176 (45.45%), Postives = 93/176 (52.84%), Query Frame = 3
Query: 3996 GLQGRKGSTGLRGNIGIPGERGDKGIPGLQGKVGNKGVKGDIGDKGFSGNIGDKGYSGISG-----DKGSFGVKGDKGFQGDVGMLGKSGLQGDRGQKGIIGFRGTRGIPGSMGLPGEI--GEKGDVGPSG-IGVKGLKGYQNAVGI---KGRKGEKGLPGFPGRPGKVGDQGDKG 4490
            G  G KG  GL G+ G PG  G  G PGLQG  G  G KG  G  G  G  G++G  G+ G      +G  G KGDKG  G  G+ G  G+ G +G KG+ G  G +G PG  GLPG+   G KGD G  G  G +G  G Q   GI    G KGEKG  GF G PG  G +GDKG
Sbjct: 1026 GKPGEKGVGGLPGSPGEPGTPGRPGEPGLQGPPGPHGEKGQSGQDGIPGFTGERGEPGVPGRGLPGSRGEPGGKGDKGNPGLPGIPGSPGIPGTKGDKGLSGLPGDQGRPGERGLPGQAMEGPKGDRGDQGQPGERGATGEQGPPGIPGSAGSKGEKGDVGFQGAPGSRGYKGDKG 1201          

HSP 11 Score: 79.7221 bits (195), Expect = 3.220e-14
Identity = 78/190 (41.05%), Postives = 95/190 (50.00%), Query Frame = 3
Query: 4011 KGSTGLRGNIGIPGERGDKGIPGLQGKVGNKGVKGDIGDKGFSGNIGDKGYSGISGDKGSFGVKGDKGFQGDVGMLGKSGLQGDRGQKGIIGFRGT--------RGIPGSMGLPGEIGEKGDVGPSGI-------GVKGLKGYQNAVGIKGRKGEKGLPGFP-----------GRPGKVGDQGDKGPKGM 4502
            KG+ G  G  G PGE+G KG  G+ G  G +G KGD G  G  G  G+KG  G+ G  G  G  G  G  G  G  G  G +G  GQ GI GF G         RG+PGS G PG  G+KG+ G  GI       G KG KG     G +GR GE+GLPG             G+PG+ G  G++GP G+
Sbjct:  983 KGNIGSPGFPGEPGEKGQKGTMGMTGTPGTQGHKGDQGSIGSPGKPGEKGVGGLPGSPGEPGTPGRPGEPGLQGPPGPHGEKGQSGQDGIPGFTGERGEPGVPGRGLPGSRGEPGGKGDKGNPGLPGIPGSPGIPGTKGDKGLSGLPGDQGRPGERGLPGQAMEGPKGDRGDQGQPGERGATGEQGPPGI 1172          

HSP 12 Score: 77.411 bits (189), Expect = 1.939e-13
Identity = 82/214 (38.32%), Postives = 103/214 (48.13%), Query Frame = 3
Query: 3990 IRGLQGRKGSTGLRGNIGIPGERGDKGIPGLQGKVGNKGVKGDIGDKGFSGNIGDKGYSGISGDKGSFGVKGDKGFQGDVGMLGKSGLQGDR---GQKGIIGFRG-----------------------TRGIPGSMGLPGEIGEKGDVGPSGI----GVKGLKGYQNAVGIKGRKGEKGL---------PGFPGRPGKVGDQGDKGPKGMKNMN 4514
            +  ++G KG  G RG+   PG  G+KG PG     G+ G+ G  G  G  G  GDKG  GI G  GS G  GD G +GD+G  G  G +G +   G  G  GF+G                       T+G  GS G PGE GEKG  G  G+    G +G KG Q ++G  G+ GEKG+         PG PGRPG+ G QG  GP G K  +
Sbjct:  860 MEHMKGDKGDIGDRGD---PGPTGEKGFPGTS---GDPGMPGKDGMPGSPGQPGDKGDPGIIGKPGSIGEPGDTGARGDMGYPGSMGPKGAKGVGGSPGHPGFKGTDGSKGDKGDPGEPGIGIPGPPGTKGNIGSPGFPGEPGEKGQKGTMGMTGTPGTQGHKGDQGSIGSPGKPGEKGVGGLPGSPGEPGTPGRPGEPGLQGPPGPHGEKGQS 1067          

HSP 13 Score: 77.0258 bits (188), Expect = 2.354e-13
Identity = 80/204 (39.22%), Postives = 102/204 (50.00%), Query Frame = 3
Query: 3975 EVGESIRGLQGRKGSTGLRGNIGIPGERGDKGIPGLQGKVGNKGVKGDIGDKGFSGNIGDKGYSGISGDKGSFG-----------------------VKGDKGFQGDVGMLGKSGLQGDRGQKGIIGFRGTRGIPGSMGLPGEIGEKGDVGPSG----IGVKGLKGYQNAVGIKGRKGEKGLPGFPGRPGKVGDQGDKGPKGMK 4505
            + GE  RGL G KG+TGL G  G PGE+G+ G+PG+ G    +G  G  G +G  GN G  G  G  G  G  G                       +KGDKG+QG  G L   G  GDRG  G+ G  G++G+PG  G+PG+ G  G+ GP G    +G+ G  G+Q  VG  G  G+KG PG P      G +GD G  G K
Sbjct:  647 QKGEPGRGLPGPKGTTGLPGVPGFPGEKGNTGMPGVPG---TEGRTGPPGPQGLKGNPGPPGVHGALGPPGPPGLGEPGAPGPMGPPGGPGPIGQSGIKGDKGYQGLPG-LDMPGPPGDRGSPGVPGLPGSKGLPGQPGVPGKDGFPGERGPKGEIGIMGMAGPPGFQGLVGNPGDPGQKGDPGMP------GIRGDFGDLGTK 840          

HSP 14 Score: 70.4774 bits (171), Expect = 2.212e-11
Identity = 67/174 (38.51%), Postives = 85/174 (48.85%), Query Frame = 3
Query: 4038 IGIPGERGDKGIPGLQGKVGNKGVKGDIGDKGFSGNI-GDKGYSGISGDKGSFGVKGDKGFQGDVGMLGKSGLQGD-----------------RGQKGIIGFRGTRGIPGSMGLPGEIGEKGDVGPSGIGVKGLKGYQNAVGIKGRKGEKGLPGFPGRPGKVGDQGDKGPKGMK 4505
            IG PG+ GDKG  G  G  G  G++G  G+ G   ++ G +G  G  G+ G  G++GD+GF G+ G+ G  G +GD                  G  G  G  G  G PG  GLPG  G  G  G  G G+ G KG     G+ G  GEKG  G PG PG  G  G  GP+G+K
Sbjct:  525 IGRPGQPGDKGSAGFPGAPGRPGLQGAKGEAGKVISLPGPQGAPGPRGESGRPGLQGDRGFPGERGVPGFPGDKGDPGLPGIGLPGPPGPKGYSGIPGPSGIPGESGEPGQDGLPGRAGTPGQKGEPGRGLPGPKGTTGLPGVPGFPGEKGNTGMPGVPGTEGRTGPPGPQGLK 698          

HSP 15 Score: 67.781 bits (164), Expect = 1.700e-10
Identity = 80/234 (34.19%), Postives = 103/234 (44.02%), Query Frame = 3
Query: 3993 RGLQGRKGSTGLRGNIGIPGERGDKGIPGLQGKVGNKGVKGDI-----------------------GDKGFSGNIGDKGYSGISGDKGSFG----VKGDKGFQGDVGMLGKSGLQGDRG---QKGIIGFRGTRG--------------------IPGSMGLPGEIGEKGDVG-PSGIGVKGLKGYQNAVGIKGRKGEKGLPGFPGRPGK---------VGDQGDKGPKGMKNMN 4514
            +GL G  G  G  G  G+PG+ G  G PG +G+ G++G  GD                        GDKG +G  G  G  G+ G KG  G    + G +G  G  G  G+ GLQGDRG   ++G+ GF G +G                    IPG  G+PGE GE G  G P   G  G KG +   G+ G KG  GLPG PG PG+          G +G  GP G + + 
Sbjct:  466 KGLPGTTGDRGFPGVDGLPGKDGRPGYPGTKGEPGDRGPDGDFGVPGPPGERGPPGEPGIGRPGQPGDKGSAGFPGAPGRPGLQGAKGEAGKVISLPGPQGAPGPRGESGRPGLQGDRGFPGERGVPGFPGDKGDPGLPGIGLPGPPGPKGYSGIPGPSGIPGESGEPGQDGLPGRAGTPGQKG-EPGRGLPGPKGTTGLPGVPGFPGEKGNTGMPGVPGTEGRTGPPGPQGLK 698          

HSP 16 Score: 64.6994 bits (156), Expect = 1.221e-9
Identity = 108/278 (38.85%), Postives = 137/278 (49.28%), Query Frame = 3
Query:  237 GYQGVSGDKGDVGQFGMPGPKGYKGFTGAIGPQGRKGERGIPGSPGYPGKMGEMGFPGIRGDIGEKGLTGCDGQQGDFGNPGMNGLVGRTGQPGERGD------DGDRGLSIIPKYGLKGNKGSRGLLGRYGRKGEKGFKGIKGYSGIFGIKGNKGYVGPMGRRGPKGDSLGTVIIQSEKGSK-------GDKGLKGQSGIPCKGFQIEG-----RMYGRVGSDGPIGDKGIK----GEKGLMGEIGQSGIDGARGLNGEKGLPGEAGPRGERGDRGN 1004
            G  G+ G  G  G  G PG  G KG  G IG  G KG RG+PG  G+PG+ G  G PG+ G  G +G+ GC+G +G+ G  G+ G+ G  G P  R +       GD G  I     LKG+   RGL G++G  G+KG  G +G  G  G  G  G  G  G++G  GD L  +  + EK S        G +GL G  G P +  + EG      + G  G  G  GDKG K    GE G  G IG+ G DG  G  GE G PG  G  G +GD+G 
Sbjct:    7 GLMGLVGFPGMQGHEGPPGSMGPKGDRGEIGAPGIKGSRGLPGQAGFPGRPGIPGLPGLEGAPGPQGIPGCNGTKGERGFDGIPGITGLLGPPVLREERYGTCSKGDPGGVIGLPIPLKGD---RGLPGQHGFPGQKGNAGQQGPVGPPGPYGPPGRPGDPGQKGEPGDKLTFIGEKGEKVSSRFSYSIVGQRGLTGPPGPPGRSEEYEGPATTLYLPGPPGETGSTGDKGDKHGIKGEPGPPGPIGKPGKDGQSGEKGEIGFPGNPGLDGFKGDKGE 281          

HSP 17 Score: 58.151 bits (139), Expect = 1.225e-7
Identity = 60/152 (39.47%), Postives = 75/152 (49.34%), Query Frame = 3
Query: 4059 GDKGIPGLQGKVGNKGVKGDIGDKGFSGNIGDKGYSGISGDKGSFGVKGDKGFQGDVGMLGKSGLQGDRGQKGIIGFRGTRGIPGSMGLPGEIG---------------EKGDVGPSGIGVKGLKGYQNAVGIKGRKGEKGLPGFPGRPGKV 4469
            G+ G+PGL G VG  G++G  G  G  G  GD+G  G  G KGS G+ G  GF G  G+ G  GL+G  G +GI G  GT+G  G  G+PG  G                KGD G    GV GL      + +KG +G  G  GFPG+ G  
Sbjct:    1 GEVGLPGLMGLVGFPGMQGHEGPPGSMGPKGDRGEIGAPGIKGSRGLPGQAGFPGRPGIPGLPGLEGAPGPQGIPGCNGTKGERGFDGIPGITGLLGPPVLREERYGTCSKGDPG----GVIGL-----PIPLKGDRGLPGQHGFPGQKGNA 143          

HSP 18 Score: 57.7658 bits (138), Expect = 1.716e-7
Identity = 61/146 (41.78%), Postives = 70/146 (47.95%), Query Frame = 3
Query: 2250 GTSGSPGSAGKTGIVGNKGENGYPGKRGIDGDNGIPGSKGEEGETGIKGHAGRPGNLGKSGLQGLRGE---------YGVKGDLGIQGIPGRKGVMGDP--GPNGYAMIGSKGDK-GIKGLPGIYGAKGDKGRPGYIGIPGFKGET 2651
            G  G PG  G  G  G +G  G PG  G  GD G  G+ G +G  G+ G AG PG  G  GL GL G           G KG+ G  GIPG  G++G P      Y    SKGD  G+ GLP     KGD+G PG  G PG KG  
Sbjct:    1 GEVGLPGLMGLVGFPGMQGHEGPPGSMGPKGDRGEIGAPGIKGSRGLPGQAGFPGRPGIPGLPGLEGAPGPQGIPGCNGTKGERGFDGIPGITGLLGPPVLREERYGTC-SKGDPGGVIGLP--IPLKGDRGLPGQHGFPGQKGNA 143          

HSP 19 Score: 54.299 bits (129), Expect = 2.148e-6
Identity = 52/145 (35.86%), Postives = 70/145 (48.28%), Query Frame = 3
Query: 2571 GLPGIYGAKGDKGRPGYIGIPGFKGETGLIGRSGLKGDQGEIGEKGIKGFTFISNNPGDRGLLGNKGLKGFPGELGNKGQVGVCTVRGDQGLRGYSGLIGDMGMKGEQGSKGIVGDYGAASR---SGIMGRTGKI-GNQGLPGDQ 2993
            GLPG+ G          +G PG +G  G  G  G KGD+GEIG  GIKG   +   PG  G  G  G+ G PG  G  G  G+    G +G RG+ G+ G  G+ G    +     YG  S+    G++G    + G++GLPG  
Sbjct:    4 GLPGLMG---------LVGFPGMQGHEGPPGSMGPKGDRGEIGAPGIKGSRGL---PGQAGFPGRPGIPGLPGLEGAPGPQGIPGCNGTKGERGFDGIPGITGLLGPPVLR--EERYGTCSKGDPGGVIGLPIPLKGDRGLPGQH 134          
BLAST of Collagen IV NC1 domain-containing protein vs. Ensembl Zebrafish
Match: col4a1 (collagen, type IV, alpha 1 [Source:ZFIN;Acc:ZDB-GENE-081105-114])

HSP 1 Score: 263.848 bits (673), Expect = 6.481e-71
Identity = 182/505 (36.04%), Postives = 243/505 (48.12%), Query Frame = 3
Query: 3990 IRGLQGRKGSTGLRGNIGIPGERGDKGIPGLQGKVGNKGVKGDIGDKGFSGNIGDKGYSGISGDKGSFGVKGDKGFQGD------------VGMLGKSGLQGDRGQKGIIGFRGTRGIPGSMGLPGEIGEKGDVGPSGI--------------------------------------GVKGLKGYQNAVGIKGRKGEKGLPGFPGRPGKVGDQGDKGPKGMKNMNTXXXXXXXXXXXXXXXXXXXXXXXXXLPGDMGEIGPNGPIGYADNGFLYATHSQSKDFPPCHGGGSPLYNGYSLLAIHGDIDSVTMDLGTPGSCLKNFSTIPFVNCFLERNTFYGGRCHVNMRNSRSYWLSTLQSYMSSPQPPS--KMDDYISRCSVCQTKTTVMAFHSQKSDWQMTKCPYGWQKLWAGFSFPMAVQASRSGSNQPFSSPGSCLKHFRSLPFIECNNHNSNCNHWRDGVSYYMTAVDSENQFVKAQGKVLKSQTDIMNSISKCVVCQRDM 5348
            I G +G KG +GL G+ G PGERG   +PG Q   G KG +GD G  G  G  G++G  GI G  GS G KGD GFQG             +G+ G+ GL G  G KG +G +G  G PG+ G  G IG KG+ G  G                                       G  G KG Q  +G++G KG  G PG+ G PG  G+ G  GP G +                                  G IGP GP    D+GFL   HSQ+ D P C  G +P+Y+GYSLL + G+  S   DLGT GSCL+ FS +PF+ C +         C+   RN  SYWL+T +    S  P +   +  +ISRC+VC+    V+A HSQ    Q+  CP GW  LW G+SF M   A   GS Q  +SPGSCL+ FRS PFIEC+   + CN++ +  S+++  ++  + F K     LK+ + +   IS+C VC + +
Sbjct:  850 IPGTKGDKGLSGLPGDQGRPGERG---LPG-QAMEGPKGDRGDQGQPGERGATGEQGPPGIPGSAGSKGEKGDVGFQGAPGSRGYKGDKGFIGVSGEPGLPGYNGPKGEMGPQGVPGFPGTKGEQGVIGSKGEGGDRGFPGLKGSEGPPGPPGPHTYVKGDPGPPGPQGPQGLVGIQGFPGAKGQQGVMGLQGLKGSDGTPGYNGHPGAKGEPGQTGPPGPRGYPGPPGPDG----------------------IPGHIGPPGPS-SMDHGFLVTRHSQTIDVPHCPQGTTPIYDGYSLLYVQGNERSHGQDLGTAGSCLRKFSPMPFLFCNINN------VCNFASRNDYSYWLTTPEPMPMSMAPVTGESIKPFISRCAVCEAPAMVIAVHSQT--IQIPNCPDGWASLWIGYSFVMHTSAGAEGSGQALASPGSCLEEFRSAPFIECHGRGT-CNYYANSYSFWLATIEDTDMFTKPVPATLKAGS-LRTHISRCQVCMKRV 1317          

HSP 2 Score: 252.677 bits (644), Expect = 2.236e-67
Identity = 352/967 (36.40%), Postives = 436/967 (45.09%), Query Frame = 3
Query:  216 QGFPGPRGYQGVSGDKGDVGQFGMPGPKGYKGFTGAIGPQGRKGE----RGIPGSPGYPGKMGEMGFPGIRGDIGEKGLTGCDGQQGDFGNPGMNGLVGRTGQPGERGDDGDRGLSIIPKYGLKGNKGSRGLLGRYGRKGEKGFKGIKGYSGIFGIKGNKGYV----GPMGRRGPKGDSLGTVIIQSEKGSKGDKGLKGQSGIPCKGFQIEGRMYGRVGSDGPIGDKGIKGEKGLMGEIGQSGIDGARGLNGEKGLPGE--AGPRGERGDRGNPGFPGDPGASGADGTRGRQGERGPKGVHGISGADGPRGS-----------------------------------RGDKG----PSGSLLSCPGRKGEKGFFGIPGIKGDIGNKGYQGHDGDIGEIGFKGEKGYEGPLGPSCSEVEQGFRGTKGESGFPGLRGAKGQRGYSGNKGIKGKPNFGTGINN---------PGETGSYGNLGVPGEKGNKGFIGDTGEKGFSGT-GKQGPEGPRGDKGDDGVNGQVGMIGMPGIKGDKGST-YPICPFCEKGYKGI-----QXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEGRMGLLGSKGRQGYKGGKGFSGSMGDAGEIGYVTISGTT-IPGVKGEKGNQGPKGNKGEFGEAGSRGRKGYSGLKGFKGLIGERGTSFSSGDPGDKGLRGENGKDGVSFAGIPGEKGLKGDKGNRGILGDVGSLSNCATRPITSKGFKGPQGAKGTSGSPGSAGKTGIVGNKGENGYPGKRGIDGDNGIPGSKGEEGETGIKGHAGRPGNLGKSGLQGLRGEYGVKGDLGIQGIPGRKGVMGDPGPNGYAMIGSKGDKGIKGLPGIYGAKGDKGRPGYIGIPGFKGETGLIGRSGLKGDQGEIGEKGIK-------GFTFISNNPGDRGLLGNKGLKGFPGELGNKGQVGVCTVRGDQGLRGYSGLIGDMGMKGEQG 2897
            QGFPGP G +G  G  G  G  G  G  G  G  G  G QG  G+     G+ G  G PG  G+ GFPG+       GL G DG+    G PG  G   + G  G+RG DGD G+   P       +   G  G+ G KG  GF G  G  G+ G KG  G V    GP G  GP+G+S G   +Q ++G  G++G+ G  G           + G  G  G  G  G  G  G  GE GQ G+ G  G  G+KG PG    GP+G  G  G PGFPG+ G +G  G  G +G  GP G  G+ G  GP G                                    +GDKG    P   +   PG +G  G  G+PG KG  G  G  G DG  GE G KGE G  G  GP   +   G  G  G+ G PG+ G +G  G  G KG +G+P       N          G+ G  G+ G PG  G KGF G +G+ G  G  G  G  G  GDKGD G+ G+ G IG PG  G +G   YP      KG KG+              +  +  +  +   G  G PG +G +G  G  G  G KG KG  G  G  G  G+    G+   PG  G+ G +G  G  G  GE G+ GR G  GL+G  G  GE+G S   G PG  G RGE G  G    G  GE G KGDKGN G+                        G  G+ G PG+ G  G+ G  G+ G PG+RG+ G   + G KG+ G+ G  G  G  G  G  G+ G  G  G KGD+G QG PG +G  GD G      IG  G+    GLPG  G KG+ G  G  G PG KGE G+IG  G  GD+G  G KG +         T++  +PG  G  G +GL G  G  G KGQ GV  ++G +G  G  G  G  G KGE G
Sbjct:  136 QGFPGPAGIKGEKGLPGPSGPAGNAGFNGAPGLMGKPGAQGEPGDIFVAPGLKGDKGLPGTTGDRGFPGV------DGLPGKDGRP---GYPGTKGEPAKFGIKGDRGPDGDFGVPGPPGERGPPGEPGIGRPGQPGDKGSAGFPGAPGRPGLQGAKGEAGKVISLPGPQGAPGPRGES-GRPGLQGDRGFPGERGVPGFPGDKGDPGLPGIGLPGPPGPKGYSGIPGPSGIPGESGEPGQDGLPGRAGTPGQKGEPGRGLPGPKGTTGLPGVPGFPGEKGNTGMPGVPGTEGRTGPPGPQGLKGNPGPPGVHGALGPPGPPGLGEPGAPGPMGPPGGPGPIGQSGIKGDKGYQGLPGLDMPGPPGDRGSPGVPGLPGSKGLPGQPGVPGKDGFPGERGPKGEIGIMGMAGPPGFQGLVGNPGDPGQKGDPGMPGIRGDFGDLGTKGERGEPGLQGPPGNMSDVDMEHMKGDKGDIGDRGDPGPTGEKGFPGTSGDPGMPGKDGMPGSPGQPGDKGDPGIIGKPGSIGEPGDTGARGDMGYPGS-MGPKGAKGVGGSPGHPGFKGTDGSKGDKGDPGEPGIGIPGPPGTKGNIGSPGFPGEPGEKGQKGTMGMTGTPGTQGHKGDQGSIGYPGSPGKPGEKGVGGLPGSPGEPGTPGRPGEPGLQGPPGPHGEKGQSGQDGIPGFTGERGEPGVPGRGLPGSRGEPGGKGDKGNPGL-----------------------PGIPGSPGIPGTKGDKGLSGLPGDQGRPGERGLPG-QAMEGPKGDRGDQGQPGERGATGEQGPPGIPGSAGSKGEKGDVGFQGAPGSRGYKGDKG-----FIGVSGE---PGLPGYNGPKGEMGPQGVPGFPGTKGEQGVIGSKGEGGDRGFPGLKGSEGPPGPPGPHTYVKGDPGPPGPQGPQGLVGIQGFPGAKGQQGVMGLQGLKGSDGTPGYNGHPGAKGEPG 1059          

HSP 3 Score: 251.521 bits (641), Expect = 4.640e-67
Identity = 370/1063 (34.81%), Postives = 474/1063 (44.59%), Query Frame = 3
Query:  756 KGSKGDKGLKGQSGIPCKGFQIEGRMYGRVGSDGPIGDKGIKGEKGLMGEIGQSGIDG----ARGLNGEKGLPGEAGPRGERGDRGNPGFPGDPGASGADGTRGRQGERGPKGVHGISGADG----PRGSRGDKGPSGSLLSCPGRKGEKGFFGIPGIKGDIGNKGYQGHDGDIGEIGFKGEKGYEGPLGPSCSEVEQGFRGTKGESGFPGLRGAKGQRGYSGNKGIKGKPNFG-TGINNPGETGSYGNLGVPGEKGNKGFIGDTGEKGFSGTGKQGPEGPRGDKGDDGVNGQVGMIGMPGIKGDKGSTYPICPFCEKGYKGIQ--XXXXXXXXXXXXXXXXXXXXXXXXXXXXDEGRMGLLGSKGRQGYKGGKGFSGSMGDAGEIGYVTISGTTIPGVKGEKGNQGPKGNKGEFGEAGSRGRKGYSGLKGFKGLIGERGTSFSSGDPGDKGLRGENGKDGVSFAGIPGEKGLKGDKGNRGILGDVGSLSNCATRPITSKGFKGPQGAKGTSGSPGSAGKTGIVGNKGENGYPGKRGIDGDNGIPGSKGEEGETGIKGHAGRPGNLGKSGLQGLRGEYGVKGDLGIQGIPGRKGVMGDPGPNGYA-MIGSKGDKG-----IKGLPGIYGAKGDKGRPGYIGIPGFKGETGLIGRSGLKGDQGEIGEKGIKGFTFISNNPGDRGLLGNKGLKGFPGELGNKGQVGVCTVRGDQGLRGYSGLIGDMGMKGEQGSKGIVGDYGAASRSGIMGRTGKIGNQGLPGDQXXXXXXXXXXXXXXXXYIGIPGFEGDRGEKGNKGFPGFPGDIGQPGRLGNPGISTEGVXXXXXXXXXXXXXXXXXXXXXXXXXXKQGDSGISIPGRQGIKGEDGTIGLPGEMGEPGPRGDFGQKGNIGITGEFGLQGNRGDDGLKGDDGIPGLNGPRGFIGDIGFVGFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXELGLDGSMGGKGDNGPRGFNGPTG----------------------------IPGSKGFEGDKGIRGDIGVKGFQGQHGEIGFPGLKGVSGENGR 3809
            +G  G  G+KG+ G+P              G  GP G+ G  G  GLMG+ G  G  G    A GL G+KGLPG  G      DRG PG  G PG  G  G  G +GE    G+ G  G DG    P        P    +  PG+ G+KG  G PG  G  G +G +G  G +  I   G +G  GP G S     QG RG  GE G PG  G KG  G  G          G +GI  PG +G  G  G PG+ G  G  G  G+KG  G G  GP+G  G  G  G  G+ G  GMPG+ G +G T P  P   KG  G                G  G  G  G  G PG  G+ G+ G KG QG  G     G  GD G  G   + G+   G+ G+ G  G  G  GE G  G  G  G +G  GF+GL+G  G     GDPG  G+RG+ G           + G KG++G  G+ G  G++S+     +  +  KG +G  G  G PG  G+ G  G  G+ G PGK      +G+PGS G+ G+ G  G  G+PG++G+ G  G RG+ G  G +G +G    KGV G PG  G+    GSKGDKG       G+PG  G KG+ G PG+ G PG KG+ G +G +G  G QG  G++G  G+      PG++G+ G  G  G PG  G  G+ G+    G  G +G SG  G  G  GE+G  G+ G     SR G  G  G  GN GLPG                     IPG  G  G KG+KG  G PGD G+PG  G PG + EG  G                         +GD G   PG +G  GE G  G+PG  G  G +GD G +G     G  G +G++G  G+ G+ G+PG NGP+G +G  G  GF G+K                                   G  G +G KG+ G RGF G  G                            + G +GF G KG +G +G++G +G  G  G+ G  G  GE G+
Sbjct:  136 QGFPGPAGIKGEKGLP--------------GPSGPAGNAGFNGAPGLMGKPGAQGEPGDIFVAPGLKGDKGLPGTTG------DRGFPGVDGLPGKDGRPGYPGTKGEPAKFGIKGDRGPDGDFGVPGPPGERGPPGEPGIGRPGQPGDKGSAGFPGAPGRPGLQGAKGEAGKV--ISLPGPQGAPGPRGESGRPGLQGDRGFPGERGVPGFPGDKGDPGLPGIGLPGPPGPKGYSGI--PGPSGIPGESGEPGQDGLPGRAGTPGQKGEPGRGLPGPKGTTGLPGVPGFPGEKGNTGMPGVPGTEGRTGPPGPQGLKGNPGPPGVHGALGPPGPPGLGEPGAPGPMGPPGGPGPIGQSGIKGDKGYQGLPG-LDMPGPPGDRGSPGVPGLPGSK--GLPGQPGVPGKDGFPGERGPKGEIGIMGMAGPPGFQGLVGNPGDPGQKGDPGMPGIRGDFG-----------DLGTKGERGEPGLQGPPGNMSD-----VDMEHMKGDKGDIGDRGDPGPTGEKGFPGTSGDPGMPGK------DGMPGSPGQPGDKGDPGIIGKPGSIGEPGDTGARGDMGYPGSMGPKGA---KGVGGSPGHPGFKGTDGSKGDKGDPGEPGIGIPGPPGTKGNIGSPGFPGEPGEKGQKGTMGMTGTPGTQGHKGDQGSIGYPGSPGKPGEKGVGGLPGSPGEPGTPGRPGEPGLQGPPGPHGEKGQSGQDGIPGFTGERGEPGVPGRGLPGSR-GEPGGKGDKGNPGLPG---------------------IPGSPGIPGTKGDKGLSGLPGDQGRPGERGLPGQAMEGPKG------------------------DRGDQGQ--PGERGATGEQGPPGIPGSAGSKGEKGDVGFQG---APGSRGYKGDKGFIGVSGEPGLPGYNGPKGEMGPQGVPGFPGTK-----------------------------------GEQGVIGSKGEGGDRGFPGLKGSEGPPGPPGPHTYVKGDPGPPGPQGPQGLVGIQGFPGAKGQQGVMGLQGLKGSDGTPGYNGHPGAKGEPGQ 1060          

HSP 4 Score: 224.557 bits (571), Expect = 1.427e-58
Identity = 370/1060 (34.91%), Postives = 445/1060 (41.98%), Query Frame = 3
Query:  591 RGLLGRYGRKGEKGFKGIKGYSGIFGIKGNKGYVGPMGRRGPKGDSLGTVIIQSEKGSKGDKGLKGQSGIPCKGFQIEGRMYGRVGSDGPIGDKGIKGEKGLMGEIGQSGIDGARGLNGE-----------KGLPGEAGPRGERGDRGNPGFPGDPGASGADGTRGRQGE----RGPKGVHGISGADGPRGSRGDKGPSGSLLSCPGRKGEKG-----------------FFGIPGIKGDIGNKGYQGHDGDIGEIGFKGEKG-----YEGPLGPSCSEVEQGFRGTKGESGFPGLRGAKGQRGYSGNKGIKGKPNFGTGINNPGETGSYGNLGVPGEKGNKG--------------------FIGDTGEKGFSGTGKQGPEGPRGDKGDDGVNGQVGMIGMPGIKGDKGSTYPICPFCEKGYKGIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEGRMGLLGSKGRQGYKGGKGFSGSMGDAGEIGYVTISGTTIPGVKGEKGNQGPKGNKGEFGEAGSRGRKGYSGLKGFKGLIGERGTSFSSGDPGDKGLRGENGKDGVSFAGIPGEKGLKGDKGNRGILGDVGSLSNCATRPITSKGFKGPQGAKGTSGSPGSAGKTGIVGNKGENGYPGKRGIDGDNGIPGSKGEEGETGIKGHAGRPGNLGKSGLQGLRGEYGVKGDLGIQGIPGRKGVMGDPGPNGYA-MIGSKGDKGIKGLPGIYGAKGDKGRPGYIGI---PGFKGETGLIGRSGLKGDQGEIGEKGIKGFTFISNNPGDRGLLGNKGLKGFPGELGNKGQVGVCTVRGDQGLRGYSGLIGDMGMKGEQGSKG--IVGDYGAASRSGIMGRTGKIGNQGLPGDQXXXXXXXXXXXXXXXXYIGIPGFEGDRGEKGNKGFPGFPGDIGQPGRLGNPGISTEGVXXXXXXXXXXXXXXXXXXXXXXXXXXKQGDSGIS-IPGRQGIKGEDGTIGLPGEMGEPGPRGDFGQKGN-------------------------------IGITGEFGLQGNRGDDGLKGDDGIPGLNGPRGFIGDIG 3485
            +G  G  G KGEKG  G  G +G  G  G  G +G  G +G  GD      I    G KGDKGL G +G   +GF          G DG  G  G  G  G  GE  + GI G RG +G+                  G  G+ GD+G+ GFPG PG  G  G +G  G+     GP+G  G  G  G  G +GD+G  G     PG  G+KG                 + GIPG  G  G  G  G DG  G  G  G+KG       GP G +      GF G KG +G PG+ G +G+ G  G +G+KG         NPG  G +G LG PG  G                         GD G +G  G    GP G RG  G  G+ G  G+ G PG+ G  G      P  E G  G+                            G  G  GL+G+ G  G KG  G  G  GD G++G          G +GE G QGP GN  +      +G KG  G +G  G  GE+G   +SGDPG        GKDG     +PG  G  GDKG+ GI+G  GS+           G  G  GA+G  G PGS G  G  G  G  G+PG +G DG  G  G  GE G         + GN+G  G  G  GE G KG +G+ G PG +G  GD G  GY    G  G+KG+ GLPG  G  G  GRPG  G+   PG  GE G  G+ G+ G  GE GE G+ G       PG RG  G KG KG PG  G  G  G+   +GD+GL   SGL GD G  GE+G  G  + G  G     G  G  G  G QG PG                     IPG  G +GEKG+ GF G PG  G  G  G  G+S E                    PGL G  G +G+ G   +PG  G KGE G IG  GE G+   RG  G KG+                                G  G  G QG  G  GLKG DG PG NG  G  G+ G
Sbjct:  136 QGFPGPAGIKGEKGLPGPSGPAGNAGFNGAPGLMGKPGAQGEPGD------IFVAPGLKGDKGLPGTTGD--RGFP---------GVDGLPGKDGRPGYPGTKGEPAKFGIKGDRGPDGDFGVPGPPGERGPPGEPGIGRPGQPGDKGSAGFPGAPGRPGLQGAKGEAGKVISLPGPQGAPGPRGESGRPGLQGDRGFPGER-GVPGFPGDKGDPGLPGIGLPGPPGPKGYSGIPGPSGIPGESGEPGQDGLPGRAGTPGQKGEPGRGLPGPKGTTGLPGVPGFPGEKGNTGMPGVPGTEGRTGPPGPQGLKG---------NPGPPGVHGALGPPGPPGLGEPGAPGPMGPPGGPGPIGQSGIKGDKGYQGLPGLDMPGPPGDRGSPGVPGLPGSKGLPGQPGVPGKDGFPGERGPKGEIGIMGM---------------------------AGPPGFQGLVGNPGDPGQKGDPGMPGIRGDFGDLGTK--------GERGEPGLQGPPGNMSDVDMEHMKGDKGDIGDRGDPGPTGEKGFPGTSGDPG------MPGKDG-----MPGSPGQPGDKGDPGIIGKPGSI-----------GEPGDTGARGDMGYPGSMGPKGAKGVGGSPGHPGFKGTDGSKGDKGDPGEPGIGIPGPPGTK-GNIGSPGFPGEPGEKGQKGTMGMTGTPGTQGHKGDQGSIGYPGSPGKPGEKGVGGLPGSPGEPGTPGRPGEPGLQGPPGPHGEKGQSGQDGIPGFTGERGEPGVPGRGL----PGSRGEPGGKGDKGNPGLPGIPGSPGIPGTKGDKGL---SGLPGDQGRPGERGLPGQAMEGPKGDRGDQGQPGERGATGEQGPPG---------------------IPGSAGSKGEKGDVGFQGAPGSRGYKGDKGFIGVSGE--------------------PGLPGYNGPKGEMGPQGVPGFPGTKGEQGVIGSKGEGGD---RGFPGLKGSEGPPGPPGPHTYVKGDPGPPGPQGPQGLVGIQGFPGAKGQQGVMGLQGLKGSDGTPGYNGHPGAKGEPG 1059          

HSP 5 Score: 189.889 bits (481), Expect = 6.245e-48
Identity = 303/930 (32.58%), Postives = 392/930 (42.15%), Query Frame = 3
Query:  201 GNKGRQGFPGPRGYQGVSGDKGDVGQ-FGMPGPKGYKGFTGAIGPQGRKGERGIPGSPGYPGKMGEMGFPGIRGDIGE--------------KGLTGCDGQQGDFGNPGMNGLVGRTGQPGERGDDG--------DRGLSIIPKY-GLKGNKGSRGLLGRYGR-----------------------------------------------------KGEKGFKGI-----------KGYSGIFGIKGNKGYVGPMGRRGPKGDSLGTVIIQSEKGSKGDKGLKGQSGIPCKGFQIEGRMYGRVGSDGPIGDKGIKGEKGLMGEIGQSGIDGARGLNGEKGLPGEA---------GPRGERGDRGNP------GFP---GDPGASGADGTRGRQGERGPKGVHGISGADGPRGSRGDKGPSGSLLSCPGRKGEKGFFGI------PGIKGDIGNKGYQGH--------------DGDIGEIGF---KGEKGYEGPLGPSCSEVEQGFRGTKGESGFPGLRGAKGQRGYSGNKGIKGKPNFGTGINNPGETGSYGNLGVPGEKGNK------GFIGDTGEKGFSGTGKQGPEGPRGDKGDDGVNGQVGMIGMPGIKGDKGSTYPICPFCEKGYKGIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEGRMGLLGSKGRQGYKGGKGFSGSMGDAGEIGYVTISGTTIPGVKGEKGNQGPKGNKGEFGEAGSRGRKGYSGLKGFKGLIGERGTSFSSGDPGDKGLRGENGKDGVSFAGIPGEKGLKGDKGNRGILGDVGSLSNCATRPITSKGFKGPQGAKGTSGSPGSAGKTGIVGNKGENGYPGKRGIDGDNGIPGSKGEE-------GETGIKGHAGRPGNLGKSGLQGLRGEYGVKGDLGIQGIPGRKGVMGDPGPNGYAMIGSKGDKG 2564
            G+KG  GFPG  G  G+ G KG+ G+   +PGP+G      A GP+G  G  G+ G  G+PG+ G  GFPG +GD G                G+ G  G  G+ G PG +GL GR G PG++G+ G          GL  +P + G KGN G  G+ G  GR                                                     KG+KG++G+           +G  G+ G+ G+KG  G  G  G  G          E+G KG+ G+ G +G P  GFQ      G VG+ G  G KG  G  G+ G+ G  G  G RG  G +G PG           G +G+ GDRG+P      GFP   GDPG  G DG  G  G+ G KG  GI G  G  G  GD G  G  +  PG  G KG  G+      PG KG  G+KG +G                G+IG  GF    GEKG +G +G + +   QG +G +G  G+PG  G  G++G  G  G  G+P        PGE G  G  G  GEKG        GF G+ GE G  G G  G  G  G KGD G  G  G+ G PGI G KG                                             D+G  GL G +GR G +G                  + G  + G KG++G+QG  G +G  GE G  G  G +G KG KG +G +G       PG +G +G+ G     F G+ GE GL G  G +G +                       G +G  G PG+ G+ G++G+KGE          GD G PG KG E         T +KG  G PG  G  GL G++G  G KG  G+ G+ G KG  G PG NG+   G+KG+ G
Sbjct:  263 GDKGSAGFPGAPGRPGLQGAKGEAGKVISLPGPQG------APGPRGESGRPGLQGDRGFPGERGVPGFPGDKGDPGLPGIGLPGPPGPKGYSGIPGPSGIPGESGEPGQDGLPGRAGTPGQKGEPGRGLPGPKGTTGLPGVPGFPGEKGNTGMPGVPGTEGRTGPPGPQGLKGNPGPPGVHGALGPPGPPGLGEPGAPGPMGPPGGPGPIGQSGIKGDKGYQGLPGLDMPGPPGDRGSPGVPGLPGSKGLPGQPGVPGKDG-------FPGERGPKGEIGIMGMAGPP--GFQ------GLVGNPGDPGQKGDPGMPGIRGDFGDLGTKGERGEPGLQGPPGNMSDVDMEHMKGDKGDIGDRGDPGPTGEKGFPGTSGDPGMPGKDGMPGSPGQPGDKGDPGIIGKPGSIGEPGDTGARGD-MGYPGSMGPKGAKGVGGSPGHPGFKGTDGSKGDKGDPGEPGIGIPGPPGTKGNIGSPGFPGEPGEKGQKGTMGMTGTPGTQGHKGDQGSIGYPGSPGKPGEKGVGGLPGSPGEPGT---PGRPGEPGLQGPPGPHGEKGQSGQDGIPGFTGERGEPGVPGRGLPGSRGEPGGKGDKGNPGLPGIPGSPGIPGTKG---------------------------------------------DKGLSGLPGDQGRPGERG------------------LPGQAMEGPKGDRGDQGQPGERGATGEQGPPGIPGSAGSKGEKGDVGFQGA------PGSRGYKGDKG-----FIGVSGEPGLPGYNGPKGEM-----------------------GPQGVPGFPGTKGEQGVIGSKGEG---------GDRGFPGLKGSEGPPGPPGPHTYVKGDPGPPGPQGPQGLVGIQGFPGAKGQQGVMGLQGLKGSDGTPGYNGHP--GAKGEPG 1059          

HSP 6 Score: 165.236 bits (417), Expect = 2.278e-40
Identity = 179/453 (39.51%), Postives = 219/453 (48.34%), Query Frame = 3
Query:  198 FGNKGRQGFPGPRGYQG---------VSGDKGDVGQFGMPGPKGYKGFTGAIGPQGRKGERGIPGSPGYPG------------KMGEMGFPGIRGDIGEKGLTGCDGQQGDFGNPGMNGLVGRTGQPGERGDDGDRGLSIIPKYGLKGNKGSRGLLGRYGRKGEKGFKGIKGYSGIFGIKGNKGYVGPMGRRGPKGDSLGTVIIQSEKGSKGDKGLKGQSGIPCKGFQIEGRMYGRVGSDGPIGDKGIKGEKGLMGEIGQSGIDGARGLNGE--------KGLPGEAGPRGERGDRGNPGFPGDPGASGADGTR------------GRQGER--------GPKGVHGISGADGPRGSRGDKGPSGSLLSCPGRKGEKGFFGIPGIKGDIGNKGYQGHDGDIGEIGFKGEKGYEGPLGPSCSEVEQGFRGTKGESGFPGLRGAKGQRGYSGNKG 1409
             G KG +G PG +G  G         + GDKGD+G  G PGP G KGF G  G  G  G+ G+PGSPG PG             +GE G  G RGD+G  G  G  G +G  G+PG  G  G  G  G++GD G+ G+ I    G KGN GS G  G  G KG+KG  G+ G  G  G KG++G +G                     G  G+KG+ G  G P           G  G+ G  G+ G++G  G  GE GQSG DG  G  GE        +GLPG  G  G +GD+GNPG PG PG+ G  GT+            GR GER        GPKG  G  G  G RG+ G++GP G     PG  G KG  G  G +G  G++GY+G  G IG  G  G  GY GP G    +   GF GTKGE G  G +G  G RG+ G KG
Sbjct:  568 LGTKGERGEPGLQGPPGNMSDVDMEHMKGDKGDIGDRGDPGPTGEKGFPGTSGDPGMPGKDGMPGSPGQPGDKGDPGIIGKPGSIGEPGDTGARGDMGYPGSMGPKGAKGVGGSPGHPGFKGTDGSKGDKGDPGEPGIGIPGPPGTKGNIGSPGFPGEPGEKGQKGTMGMTGTPGTQGHKGDQGSIG----------------YPGSPGKPGEKGVGGLPGSP-----------GEPGTPGRPGEPGLQGPPGPHGEKGQSGQDGIPGFTGERGEPGVPGRGLPGSRGEPGGKGDKGNPGLPGIPGSPGIPGTKGDKGLSGLPGDQGRPGERGLPGQAMEGPKGDRGDQGQPGERGATGEQGPPG----IPGSAGSKGEKGDVGFQGAPGSRGYKGDKGFIGVSGEPGLPGYNGPKGEMGPQGVPGFPGTKGEQGVIGSKGEGGDRGFPGLKG 989          

HSP 7 Score: 164.081 bits (414), Expect = 5.801e-40
Identity = 292/819 (35.65%), Postives = 362/819 (44.20%), Query Frame = 3
Query: 2220 KGFKGPQGAKGTSGSPGSAGKTGIVGNKGENGYPGKRGIDGDNGIPGSKGEEGET----GIKGHAGRPGNLGK---SGLQGLRGEYGVKGDLGIQGIPGRKGVMGDPGPNG------YAMIGSKGDKGIKGLPGIYGAKGDKGRPGYIGIPGFKGETGLIGRS-GLKGDQGEIGEKGIKGFTFISNNPGDRGLLGNKGLKGFPGELGNKGQVGVCTVRGDQGLRGYSGLIGDMGMKGEQGSKGIVGDYGAASRSGIMGRTGKIGNQGLPGDQXXXXXXXXXXXXXXXXYIGIPGFEGDRGEKGNKGFPGFPGDIGQPGRLGNPGISTEGVXXXXXXXXXXXXXXXXXXXXXXXXXXKQGDSGISIPGRQGIKGEDGTIGLPGEMGEPGPRGDFGQKGNIGITGEFGLQGNRGDDGLKGDDGIPGLNGPRGFIGDIGFVGFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXELGLDGSMGGKGDNGPRGFNGPTGIPGSKGFEGDKGIRGDIGVKGFQGQHGEIGFPGLKGVSGENGRQXXXXXXXXXXXXXXXXVCMQPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEVGESIRGLQGRKGSTGLRGNIGIPGERGDKGIPGLQGKVGNKGVKGDIGDKG-----------------FSGNIGDKGYSGISGDKGS------FGVKGDKGFQGDVGMLGKSGLQGDRGQKGIIGFRGTRGIPGSMGLPGEIGEKGDVGPSGI-------GVKGLKGYQNAVGIKGR--------------KGEKGLPGFPGRPGKVGDQGDKGPKGM 4502
            +GF GP G KG  G PG +G     GN G NG PG  G       PG++GE G+     G+KG  G PG  G     G+ GL G+ G  G  G +G P + G+ GD GP+G               +   G PG  G KG  G PG  G PG +G  G  G+   L G QG  G +G  G   +    GDRG  G +G+ GFPG+ G+ G  G+  + G  G +GYSG+ G  G+ GE G  G     G   R+G  G+ G+ G +GLPG +G                 G+PG  G  GEKGN G PG PG  G+ G  G  G+  +G  G PG+ G  GP G PGL             G    G+ GIKG+ G  GLPG +  PGP GD G  G  G+ G  GL G     G+ G DG PG  GP+G IG +G  G                    + G  G  G KG  G  G  G  G +G KG+ G  G  GP G       E  KG +GDIG +G  G  GE GFPG  G  G  G+ G  G  G  GD GD G+  +P                                        G  G  G TG RG++G PG  G KG  G+ G  G+ G KG  G KG                   GNIG  G+ G  G+KG        G  G +G +GD G +G  G  G  G+KG+ G  G+ G PG+ G PGE G +G  GP G        G+ G  G +   G+ GR              KG  GLPG PG PG  G +GDKG  G+
Sbjct:  136 QGFPGPAGIKGEKGLPGPSGP---AGNAGFNGAPGLMGK------PGAQGEPGDIFVAPGLKGDKGLPGTTGDRGFPGVDGLPGKDGRPGYPGTKGEPAKFGIKGDRGPDGDFGVPGPPGERGPPGEPGIGRPGQPGDKGSAGFPGAPGRPGLQGAKGEAGKVISLPGPQGAPGPRGESGRPGLQ---GDRGFPGERGVPGFPGDKGDPGLPGI-GLPGPPGPKGYSGIPGPSGIPGESGEPG---QDGLPGRAGTPGQKGEPG-RGLPGPKG---------------TTGLPGVPGFPGEKGNTGMPGVPGTEGRTGPPGPQGL--KGNPGPPGVHGALGPPGPPGLGEPGAPGPMGPPGGPGPIGQSGIKGDKGYQGLPG-LDMPGPPGDRGSPGVPGLPGSKGLPGQ---PGVPGKDGFPGERGPKGEIGIMGMAG--------------PPGFQGLVGNPGDPGQKGDPGMPGIRGDFGDLGTKGERGEPGLQGPPGNMSDVDMEHMKGDKGDIGDRGDPGPTGEKGFPGTSGDPGMPGKDGMPGSPGQPGDKGDPGIIGKP----------------------------------------GSIGEPGDTGARGDMGYPGSMGPKGAKGVGGSPGHPGFKGTDGSKGDKGDPGEPGIGIPGPPGTKGNIGSPGFPGEPGEKGQKGTMGMTGTPGTQGHKGDQGSIGYPGSPGKPGEKGVGGLPGSPGEPGTPGRPGEPGLQGPPGPHGEKGQSGQDGIPGFTGERGEPGVPGRGLPGSRGEPGGKGDKGNPGLPGIPGSPGIPGTKGDKGLSGL 862          

HSP 8 Score: 156.762 bits (395), Expect = 1.086e-37
Identity = 242/753 (32.14%), Postives = 310/753 (41.17%), Query Frame = 3
Query: 1803 LLGSKGRQGYKGGKGFSGSMGDAGEIGYVTISGTTIPGVKGEKGNQGPKGN-------KGEFGEAGSRGRKGYSGLKGFKGLIGERGTSFSSGDPGDKGLRGENGKDG------------------VSFAGIPGEKGLKGDKGNRGILGDVGSLSNCATRPITSKGFKGPQGAKGTSGSPGSAGKTGIVGNKGENGYPGKRG--------------------IDGDNGIPGSKGEEGETGIKGHAGRPGNLGKSGLQGLRGEYGVKGDLGIQGIPGRKGVMGDPG-PNGYAMIGSKGDKGIKGLPGIYGA-----------------------------------KGDKGRPGYIGIPGFKGETGLIGRSGLKGDQGEIGEKGIKGFTFISNNPGDRGLLGNKGLKG---FPGELGNKGQVGVCTVRGDQGLRGYSGLIGDMGMKGEQGSKGIVGDYGAASRSGIMGRTGKIGNQGLPGDQXXXXXXXXXXXXXXXXYIGIPGFEGDRGEKGNKGFPGFPGDIGQPGRLGNPGISTEGVXXXXXXXXXXXXXXXXXXXXXXXXXXKQGDSGISIPGRQGIKGEDGTIGLPGEMGEPGPRGDFGQKGNIGITGEFGLQGNRGDDGLKGDDGIPGLNGPRGFIGDIGFVGFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXELGLDGSMGGKGDNGPRGFNGPTGIPGSKGFEGDKGIRGDIGVKGFQGQHGEIGFPGLKGVSGENGR 3809
            L G  G  G KG KG  G  G AG  G+        PG+ G+ G QG  G+       KG+ G  G+ G +G+ G+ G  G  G  G   + G+P   G++G+ G DG                  +   G PG+KG  G  G  G  G  G+    A + I+  G +G  G +G SG PG  G  G  G +G  G+PG +G                    I G +GIPG  GE G+ G+ G AG PG  G+ G +GL G  G  G  G+ G PG KG  G PG P      G  G +G+KG PG  G                                    KGDKG   Y G+PG            + G  G+ G  G+ G       PG +GL G  G+ G   FPGE G KG++G+  + G  G +G  G  GD G KG+ G  GI GD+G     G  G  G+ G QG PG+      +  KG K      G  G  GD G  G KGFPG  GD G PG+ G PG                                         PG+ G KG+ G IG PG +GEPG   D G +G++G  G  G +G +G  G  G  G  G +G +G  GD                             +   G  G  G KG +G  G  G  G+ G +G  G TG PG++G +GD+G  G  G  G  G+ G  G PG  G  G  GR
Sbjct:  135 LQGFPGPAGIKGEKGLPGPSGPAGNAGF-----NGAPGLMGKPGAQGEPGDIFVAPGLKGDKGLPGTTGDRGFPGVDGLPGKDGRPGYPGTKGEPAKFGIKGDRGPDGDFGVPGPPGERGPPGEPGIGRPGQPGDKGSAGFPGAPGRPGLQGAKGE-AGKVISLPGPQGAPGPRGESGRPGLQGDRGFPGERGVPGFPGDKGDPGLPGIGLPGPPGPKGYSGIPGPSGIPGESGEPGQDGLPGRAGTPGQKGEPG-RGLPGPKGTTGLPGVPGFPGEKGNTGMPGVPGTEGRTGPPGPQGLKGNPGPPGVHGALGPPGPPGLGEPGAPGPMGPPGGPGPIGQSGIKGDKG---YQGLPGLD----------MPGPPGDRGSPGVPGL------PGSKGLPGQPGVPGKDGFPGERGPKGEIGIMGMAGPPGFQGLVGNPGDPGQKGDPGMPGIRGDFGDL---GTKGERGEPGLQGPPGNMSDVDMEHMKGDK------GDIGDRGDPGPTGEKGFPGTSGDPGMPGKDGMPGS----------------------------------------PGQPGDKGDPGIIGKPGSIGEPG---DTGARGDMGYPGSMGPKGAKGVGGSPGHPGFKGTDGSKGDKGD---------------------------PGEPGIGIPGPPGTKGNIGSPGFPGEPGEKGQKGTMGMTGTPGTQGHKGDQGSIGYPGSPGKPGEKGVGGLPGSPGEPGTPGR 782          

HSP 9 Score: 96.6709 bits (239), Expect = 2.171e-19
Identity = 111/296 (37.50%), Postives = 141/296 (47.64%), Query Frame = 3
Query:  201 GNKGRQGFPGPRGYQGVSGDKGDVGQFGMPGPKGYKGFTGAIGPQGRKGERGIPG------SPGYPGKMGEMGFPGIRGDIGEKGLTGCDGQQGDFGNPGM-----NGLVGRTGQPGERGDDGDRGLSIIPKYGLKGNKGSRGLLGRYGRKGEKGFKGIKGYSGIFGIKGNKGYVGPMGRRGPKGD-----SLGTVIIQSEKGSKGDKGLKGQSGIPCKGFQIEGRMYGRVGSDGPIGDKG--IKGEKGLMGEIGQSGIDGARGLNGEKGLPGEAGPRGERGDRGNPGFPGDPGAS 1034
            G  GR G PG +G  G  G+KG  GQ G+PG  G +G  G  G +G  G RG PG      +PG PG  G  G PG +GD G  GL G  G+ G+ G PG       G  G  GQPGERG  G++G   IP  G  G+KG +G +G  G  G +G+KG KG+ G+ G  G  GY GP G  GP+G      + G   +   KG  GD+G  G  G            Y +     P       + G +G  G  GQ G+ G +GL G  G PG           G+PG  G+PG +
Sbjct:  778 GTPGRPGEPGLQGPPGPHGEKGQSGQDGIPGFTGERGEPGVPG-RGLPGSRGEPGGKGDKGNPGLPGIPGSPGIPGTKGDKGLSGLPGDQGRPGERGLPGQAMEGPKGDRGDQGQPGERGATGEQGPPGIP--GSAGSKGEKGDVGFQGAPGSRGYKGDKGFIGVSGEPGLPGYNGPKGEMGPQGVPGFPGTKGEQGVIGSKGEGGDRGFPGLKGSEGPPGPPGPHTYVKGDPGPPGPQGPQGLVGIQGFPGAKGQQGVMGLQGLKGSDGTPGY---------NGHPGAKGEPGQT 1061          

HSP 10 Score: 87.8113 bits (216), Expect = 1.216e-16
Identity = 77/175 (44.00%), Postives = 96/175 (54.86%), Query Frame = 3
Query: 3996 GLQGRKGSTGLRGNIGIPGERGDKGIPG--LQGKVGNKGVKGDIGDKGFSGNIGDKGYSGISGDKGSFGVKGDKGFQGDVGMLGKS--GLQGDRGQKGIIGFRGTRGIPGSMGLPGEIGEKGDVGPSGI-GVKGLKGYQNAVGIKGRKGEKGLPGFPGRPGKVGDQGDKGPKGMK 4505
            G  G KG +G  G  G  GERG+ G+PG  L G  G  G KGD G+ G  G  G  G  G  GDKG  G+ GD+G  G+ G+ G++  G +GDRG +G  G RG  G  G  G+PG  G KG+ G  G  G  G +GY+   G  G  GE GLPG+ G  G++G QG  G  G K
Sbjct:  793 GPHGEKGQSGQDGIPGFTGERGEPGVPGRGLPGSRGEPGGKGDKGNPGLPGIPGSPGIPGTKGDKGLSGLPGDQGRPGERGLPGQAMEGPKGDRGDQGQPGERGATGEQGPPGIPGSAGSKGEKGDVGFQGAPGSRGYKGDKGFIGVSGEPGLPGYNGPKGEMGPQGVPGFPGTK 967          

HSP 11 Score: 83.1889 bits (204), Expect = 2.607e-15
Identity = 80/176 (45.45%), Postives = 93/176 (52.84%), Query Frame = 3
Query: 3996 GLQGRKGSTGLRGNIGIPGERGDKGIPGLQGKVGNKGVKGDIGDKGFSGNIGDKGYSGISG-----DKGSFGVKGDKGFQGDVGMLGKSGLQGDRGQKGIIGFRGTRGIPGSMGLPGEI--GEKGDVGPSG-IGVKGLKGYQNAVGI---KGRKGEKGLPGFPGRPGKVGDQGDKG 4490
            G  G KG  GL G+ G PG  G  G PGLQG  G  G KG  G  G  G  G++G  G+ G      +G  G KGDKG  G  G+ G  G+ G +G KG+ G  G +G PG  GLPG+   G KGD G  G  G +G  G Q   GI    G KGEKG  GF G PG  G +GDKG
Sbjct:  760 GKPGEKGVGGLPGSPGEPGTPGRPGEPGLQGPPGPHGEKGQSGQDGIPGFTGERGEPGVPGRGLPGSRGEPGGKGDKGNPGLPGIPGSPGIPGTKGDKGLSGLPGDQGRPGERGLPGQAMEGPKGDRGDQGQPGERGATGEQGPPGIPGSAGSKGEKGDVGFQGAPGSRGYKGDKG 935          

HSP 12 Score: 80.1073 bits (196), Expect = 2.485e-14
Identity = 78/193 (40.41%), Postives = 99/193 (51.30%), Query Frame = 3
Query: 4011 KGSTGLRGNIGIPGERGDKGIPGLQGKVGNKGVKGDIGDKGFSGNIGDKGYSGISGDKGSFGVKGDKGFQGDVGMLGKSGLQGDRGQK---GIIGFRGT--------RGIPGSMGLPGEIGEKGDVGPSGI-------GVKGLKGYQNAVGIKGRKGEKGLPGFP-----------GRPGKVGDQGDKGPKGM 4502
            KG+ G  G  G PGE+G KG  G+ G  G +G KGD G  G+ G+ G  G  G+ G  GS G  G  G  G+ G+ G  G  G++GQ    GI GF G         RG+PGS G PG  G+KG+ G  GI       G KG KG     G +GR GE+GLPG             G+PG+ G  G++GP G+
Sbjct:  714 KGNIGSPGFPGEPGEKGQKGTMGMTGTPGTQGHKGDQGSIGYPGSPGKPGEKGVGGLPGSPGEPGTPGRPGEPGLQGPPGPHGEKGQSGQDGIPGFTGERGEPGVPGRGLPGSRGEPGGKGDKGNPGLPGIPGSPGIPGTKGDKGLSGLPGDQGRPGERGLPGQAMEGPKGDRGDQGQPGERGATGEQGPPGI 906          

HSP 13 Score: 77.411 bits (189), Expect = 1.565e-13
Identity = 80/204 (39.22%), Postives = 102/204 (50.00%), Query Frame = 3
Query: 3975 EVGESIRGLQGRKGSTGLRGNIGIPGERGDKGIPGLQGKVGNKGVKGDIGDKGFSGNIGDKGYSGISGDKGSFG-----------------------VKGDKGFQGDVGMLGKSGLQGDRGQKGIIGFRGTRGIPGSMGLPGEIGEKGDVGPSG----IGVKGLKGYQNAVGIKGRKGEKGLPGFPGRPGKVGDQGDKGPKGMK 4505
            + GE  RGL G KG+TGL G  G PGE+G+ G+PG+ G    +G  G  G +G  GN G  G  G  G  G  G                       +KGDKG+QG  G L   G  GDRG  G+ G  G++G+PG  G+PG+ G  G+ GP G    +G+ G  G+Q  VG  G  G+KG PG P      G +GD G  G K
Sbjct:  378 QKGEPGRGLPGPKGTTGLPGVPGFPGEKGNTGMPGVPG---TEGRTGPPGPQGLKGNPGPPGVHGALGPPGPPGLGEPGAPGPMGPPGGPGPIGQSGIKGDKGYQGLPG-LDMPGPPGDRGSPGVPGLPGSKGLPGQPGVPGKDGFPGERGPKGEIGIMGMAGPPGFQGLVGNPGDPGQKGDPGMP------GIRGDFGDLGTK 571          

HSP 14 Score: 72.7886 bits (177), Expect = 4.542e-12
Identity = 82/217 (37.79%), Postives = 103/217 (47.47%), Query Frame = 3
Query: 3990 IRGLQGRKGSTGLRGNIGIPGERGDKGIPGLQGKVGNKGVKGDIGDKGFSGNIGDKGYSGISGDKGSFGVKGDKGFQGDVGMLGKSGLQGDR---GQKGIIGFRG-----------------------TRGIPGSMGLPGEIGEKGDVGPSGI----GVKGLKGYQNAVGI---KGRKGEKGL---------PGFPGRPGKVGDQGDKGPKGMKNMN 4514
            +  ++G KG  G RG+   PG  G+KG PG     G+ G+ G  G  G  G  GDKG  GI G  GS G  GD G +GD+G  G  G +G +   G  G  GF+G                       T+G  GS G PGE GEKG  G  G+    G +G KG Q ++G     G+ GEKG+         PG PGRPG+ G QG  GP G K  +
Sbjct:  591 MEHMKGDKGDIGDRGD---PGPTGEKGFPGTS---GDPGMPGKDGMPGSPGQPGDKGDPGIIGKPGSIGEPGDTGARGDMGYPGSMGPKGAKGVGGSPGHPGFKGTDGSKGDKGDPGEPGIGIPGPPGTKGNIGSPGFPGEPGEKGQKGTMGMTGTPGTQGHKGDQGSIGYPGSPGKPGEKGVGGLPGSPGEPGTPGRPGEPGLQGPPGPHGEKGQS 801          

HSP 15 Score: 70.8626 bits (172), Expect = 1.544e-11
Identity = 67/174 (38.51%), Postives = 85/174 (48.85%), Query Frame = 3
Query: 4038 IGIPGERGDKGIPGLQGKVGNKGVKGDIGDKGFSGNI-GDKGYSGISGDKGSFGVKGDKGFQGDVGMLGKSGLQGD-----------------RGQKGIIGFRGTRGIPGSMGLPGEIGEKGDVGPSGIGVKGLKGYQNAVGIKGRKGEKGLPGFPGRPGKVGDQGDKGPKGMK 4505
            IG PG+ GDKG  G  G  G  G++G  G+ G   ++ G +G  G  G+ G  G++GD+GF G+ G+ G  G +GD                  G  G  G  G  G PG  GLPG  G  G  G  G G+ G KG     G+ G  GEKG  G PG PG  G  G  GP+G+K
Sbjct:  256 IGRPGQPGDKGSAGFPGAPGRPGLQGAKGEAGKVISLPGPQGAPGPRGESGRPGLQGDRGFPGERGVPGFPGDKGDPGLPGIGLPGPPGPKGYSGIPGPSGIPGESGEPGQDGLPGRAGTPGQKGEPGRGLPGPKGTTGLPGVPGFPGEKGNTGMPGVPGTEGRTGPPGPQGLK 429          

HSP 16 Score: 68.5514 bits (166), Expect = 8.280e-11
Identity = 75/197 (38.07%), Postives = 96/197 (48.73%), Query Frame = 3
Query: 3999 LQGRKGSTGLRGNIGIPGERGD------KGIPGLQGKVGNKGVKGDI-------GDKGFSGNIGDK---------------GYSGISGDKGSFGVKGDKGFQGDVGMLGKSGLQGDR-----GQKGIIGFRGTRGIPGSMGLPGEIGEKGDVGP--SGIGVKGLKGYQNAVGIKGRKGEKGLPGFPGRPGKVGDQGD 4484
            LQG  G  G++G  G+PG  G        G PGL GK G +G  GDI       GDKG  G  GD+               GY G  G+   FG+KGD+G  GD G+ G  G +G       G+ G  G +G+ G PG+ G PG  G KG+ G   S  G +G  G +   G  G +G++G PG  G PG  GD+GD
Sbjct:  135 LQGFPGPAGIKGEKGLPGPSGPAGNAGFNGAPGLMGKPGAQGEPGDIFVAPGLKGDKGLPGTTGDRGFPGVDGLPGKDGRPGYPGTKGEPAKFGIKGDRGPDGDFGVPGPPGERGPPGEPGIGRPGQPGDKGSAGFPGAPGRPGLQGAKGEAGKVISLPGPQGAPGPRGESGRPGLQGDRGFPGERGVPGFPGDKGD 331          

HSP 17 Score: 65.855 bits (159), Expect = 6.326e-10
Identity = 81/240 (33.75%), Postives = 102/240 (42.50%), Query Frame = 3
Query: 3993 RGLQGRKGSTGLRGNIGIPGERGDKGIPGLQGKVGNKGVKGDIGDKG--------------------FSGNIGDKGYSGISGDKGSFGVKGDKGFQGDV-------------GMLGKSGLQGDRG---QKGIIGFRGTRG--------------------IPGSMGLPGEIGEKGDVG-PSGIGVKGLKGYQNAVGIKGRKGEKGLPGFPGRPGK---------VGDQGDKGPKGMKNMN 4514
            +GL G  G  G  G  G+PG+ G  G PG +G+    G+KGD G  G                      G  GDKG +G  G  G  G++G KG  G V             G  G+ GLQGDRG   ++G+ GF G +G                    IPG  G+PGE GE G  G P   G  G KG +   G+ G KG  GLPG PG PG+          G +G  GP G + + 
Sbjct:  191 KGLPGTTGDRGFPGVDGLPGKDGRPGYPGTKGEPAKFGIKGDRGPDGDFGVPGPPGERGPPGEPGIGRPGQPGDKGSAGFPGAPGRPGLQGAKGEAGKVISLPGPQGAPGPRGESGRPGLQGDRGFPGERGVPGFPGDKGDPGLPGIGLPGPPGPKGYSGIPGPSGIPGESGEPGQDGLPGRAGTPGQKG-EPGRGLPGPKGTTGLPGVPGFPGEKGNTGMPGVPGTEGRTGPPGPQGLK 429          

HSP 18 Score: 58.5362 bits (140), Expect = 9.573e-8
Identity = 61/154 (39.61%), Postives = 78/154 (50.65%), Query Frame = 3
Query: 4059 GDKGIPGLQGKVGNKGVKGDIGDKGFSGNIGDKGYSGISGDKGSFGVKGD----KGFQGDVGMLGKSGLQGDRGQKGIIGFRGTRGIPGSMGLPGEIGEKGDVGPSG------IGVKGLKGYQNAVGIKGRKGEKGLPGFPGRPGKVGDQGDKG 4490
            G KG+ G  G  G KG KG  G  G +GN G  G  G+ G  G+ G  GD     G +GD G+ G +G +G  G  G+ G  G  G PG+ G P + G KGD GP G         +     +  +G  G+ G+KG  GFPG PG+ G QG KG
Sbjct:  131 GPKGLQGFPGPAGIKGEKGLPGPSGPAGNAGFNGAPGLMGKPGAQGEPGDIFVAPGLKGDKGLPGTTGDRGFPGVDGLPGKDGRPGYPGTKGEPAKFGIKGDRGPDGDFGVPGPPGERGPPGEPGIGRPGQPGDKGSAGFPGAPGRPGLQGAKG 284          
BLAST of Collagen IV NC1 domain-containing protein vs. Ensembl Zebrafish
Match: col4a6 (collagen, type IV, alpha 6 [Source:ZFIN;Acc:ZDB-GENE-101001-2])

HSP 1 Score: 253.447 bits (646), Expect = 2.830e-67
Identity = 167/458 (36.46%), Postives = 215/458 (46.94%), Query Frame = 3
Query: 3999 LQGRKGSTGLRGNIGIPGERGDKG---IPGLQGKVGNKGVKGDIGDKGFSGNIGDKGYSGISGDKGSFGVKGDKGFQGDVGMLGKSGL-----QGDRGQKGIIGFRGTRGIPGSMGLPGEIGEKGDVGPSGIGVKGLKGYQNAVGIKGRKGEKGLPGFPGRPGKVGDQGDKGPKGMKNMNTXXXXXXXXXXXXXXXXXXXXXXXXXLPGDMGEIGPNGPIGYADNGFLYATHSQSKDFPPCHGGGSPLYNGYSLLAIHGDIDSVTMDLGTPGSCLKNFSTIPFVNCFLERNTFYGGRCHVNMRNSRSYWLSTLQSYMSSPQPPSKMDDYISRCSVCQTKTTVMAFHSQKSDWQMTKCPYGWQKLWAGFSFPMAVQASRSGSNQPFSSPGSCLKHFRSLPFIECNNHNSNCNHWRDGVSYYMTAVDSENQFVKAQGKVLKSQTDIMNSISKCVVCQRDM 5348
            +QG +G  G  G  GI G RG+ G    PGLQG  G KG +G+ G  G  G  G  G  G  G  G  G+KG  G  G+ G +  S +      GD GQ G+ GF G  GIPG  G PG  G KG              ++  VG  G  G  G PGF G PG  G QG  G +G +                            GLPG      P  P      G+    HSQS   P C  G + L+ GYSLL + G   +   DLG PGSCL +FSTIPF+ C           C+   RN +SYWLST  +    P    ++  YISRCSVC+  +  +A HSQ  D  +  CP GW+ LW G+SF M   A   G  Q   SPGSCL+ FR+ PFIECN     C+++ +  S+++T VD   QFV+   +         + +S+C VC + +
Sbjct: 1261 VQGDRGDPGFPGRPGIIGPRGEPGGFGAPGLQGNPGFKGQRGEPGFSGVPGRPGSPGEPGDYGRSGPRGLKGTSGPVGNPGFVFASNITARMPSGDPGQPGLDGFAGQPGIPGLPGSPGNPGPKG--------------FRGQVGRLGPVGLAGSPGFTGDPGPSGIQGPTGLQGPRGK-------------------------PGLPGI-----PAPPTRSTGIGYTLVKHSQSTRVPMCPEGMTRLWEGYSLLYVEGQEKAHNQDLGLPGSCLPHFSTIPFLYCTANE------ICYYASRNDKSYWLSTTAAIPMMPVANQEISPYISRCSVCEVPSQPIAVHSQ--DLTIPTCPQGWRSLWIGYSFLMHTGAGGEGGGQSLMSPGSCLEDFRATPFIECNGARGTCHYFANKYSFWLTTVDVNEQFVQGPTQETLKGDQFRSRLSRCQVCMKIL 1666          

HSP 2 Score: 211.46 bits (537), Expect = 2.300e-54
Identity = 510/1512 (33.73%), Postives = 618/1512 (40.87%), Query Frame = 3
Query:   87 YHYLLLLIMVSQSYYAQDSDPDPFKCL-RICTPDKCQCFGNKGRQGFPGPRGYQGVSGDKGDVGQFGMPGPKGYKGFTGAIGPQGRKGERGIPGSPGYPGKMGEMGFPGIRGDIGEKGLTGCDGQQGDFGNPGMNG---LVGRTGQPGERGDDGDRGLSIIPKYGL--KGNKGSRGLLGRYGRKGEKGFKGIKGYSGIF-----------GIKGNKGYVGPMGRRG-PKGDSLGTVIIQSEKGSKGDKGLKGQSGIPCKGFQIEGRMYGRVGSDGPIGDKGIKGEKGLM---------------------GEIGQSGIDGARGLNGEKGLPGEAGP------------RGERGDRGNPGFPGDPG-------------------ASGADGTRGRQGERGPKGVHGISGADGPRGSRGDKGPSGS-----------------------LLSCPGRKGEKGFFGIPGIKGDIGNKGYQGHDGDI-----------------------------GEIGFKGEKGYEGPLGPSCSEVEQGFRGTKGESGFPGLRGAKGQRGYSGNKGIKGKPNFGTGINNPGETGSYGNLGVPGEKGNKGFIGDTGEKGFSGT-GKQGPEGPRGDKGD--DGVNGQVGMIG------------------------MPGIKGDKGSTYPICPFC-----EKGYKGIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEGRMGLLGSK--GRQGYKGGKGFSGSMGDAGEIGYVTISGTTIPGVKGEKGNQGPKGNKGEFGEAGSRGRKGYSGLKGFKGLIGERGTSFSSGDPGDKGLRGE---------------NGKDGVSFAGIPGEKGLKGD---------KGNRGILGDVGSLSNCATRPITSKGFKGPQGAKGTSGSPGSAGKTGIVGNKGENGY---------------------PGKRGIDGDNGIPGSKGEEG-----------------ETGIKGHAGRPGNLGKSGLQGLRGEYGVKGDLG-------------IQGIPGRKGVMGDPGPNGYAMIGSKGDKGIKGLPGIYGAKGDKGRPGYIGIPGFKGETGLIGR-------SGLKGDQGEIGEKGIKGFTFISNNPGDRG---LLGNKGLKGFPGELGNKGQVGVCTVRGDQGLRGYSGLIGDMGMKGEQGSKGIVGDYGAASRSGIMGRTGKIGNQGLPGDQXXXXXXXXXXXXXXXXYIGIPGFEGDRGEKGNK--GFPGFPGDIGQ---------------------------PGRLGNPGISTEGVXXXXXXXXXXXXXXXXXXXXXXXXXXKQGDSGIS-IPGRQGI---KGEDGTIGLPGEMGEPGPRGDFGQKGNIGITGEFGLQGNRGDDGLKGDDGIPGLNGPRGFIGDIGFVGFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXELGLDGSMGGKGDNGPRGFN------GPTGIPGSKGFEGDKGIRGDIGVKGFQGQHGEIGFPGL 3782
            Y ++L   + S S     +  +P  C  R C+   C CF  KG +G PG  G  G  G +G  G  G  GPK  +G  G  GP G+ G++G  G PGYPG  G  G PG  G  G  GL GC+G QGD G  G++G   + G  G PG +G  G+     IP   +  +G  G +G  G  G +G  GF G+ G  G             G  G KG VGP G RG P        I    KG KGDKG  G  G+P           GR G   P    G  GEKG++                     G  G  G  G  GLNG KG  G+ GP            +G +GDRG PG+PG PG                    +G  G  G  G RGPKG  G  G D    S G +G  GS                       L   PG+ G +G FG  GIKG      ++G +GD                              GEIG  G +G  GP GP     ++GF G KGE G       KGQ+G  G +G  G   F    N+PG  GS G  G PG  G  GF G TG+KGF G  G +G  G  G+ G    GV G  GM G                        +PGI+GDKG  +P  P         G  G+ G  G  G  G  G  G  G  G +G PG  G  GL G+   G QG  G  GF GS G  GE G V       PG  G +G  G  G+KG+ G  G  G  G  G  GF G+ GERG +   G  G  G  GE                G DG    G PG KG++GD         KG +GI G  GS           +GF+GP G  G +   G  G+ GI G KG  G                      PG RG DG  G  G +G  G                 E  +KG  G PG +G  G  G RG+ G  G  G              +G+PG+ G+ G PG +G+   G KG  G+ G PG  G KGD G PG  G PG +G  G  G        SG  G +G IG  G  G       PGD G   +LG +G KGFPG+ G  G VG     G +GL GY GL G  G  G  G  G+ GD G     G+ G  G  G++G PG                 G +G PG  G +GE+G    G PG PG+ G                            PG LG+PG+         GL G  GP G PGLPG  G    QGD G    PGR GI   +GE G  G PG  G PG +G  G+ G  G+ G  G  G  GD G  G  G+ G +GP   +G+ GFV                      +   G  G  G+ GF G+ G+ G  G  G+ GP+GF       GP G+ GS GF GD G  G  G  G QG  G+ G PG+
Sbjct:    4 YSFILPFEVYSASALKGSTLQEP--CAGRDCS-GPCPCFPLKGGRGQPGELGPVGSGGPEGFYGGPGPVGPKAEQGHIGRKGPPGQNGDKGPMGVPGYPGNDGVPGHPGQEGPRGPPGLDGCNGTQGDTGYSGLDGYSGIPGSPGFPGLKGQKGEPSYLNIPSQNILTQGPPGPQGYPGPIGPRGPDGFDGLPGLPGPPGPPGSPGQGYKGEPGEKGDVGPQGVRGNPSVQFNAPAISTINKGEKGDKGYAGNPGLP-----------GRQGPVNPFRYPGEVGEKGILGLPGGRGPPGLNGPPGLPGRKGFTGSEGFPGQPGLNGPKGDIGDPGPPGPIVDSPVFEIKGSKGDRGFPGYPGFPGDTGYGGLPGQPGAPGPPAFFTGRPGAPGFPGSRGPKGQRGNPGRD----SYGSEGLPGSQGLSGPPGLPGPPGTSSNFIVTPLPGFPGQPGPRGPFGSQGIKG------FKGENGDCNCLGGGTIGAQGPPGPPGFPGFIGLNGLKGEIGDNGYQGLPGPQGPQGRRGDRGFNGRKGEKGNAFFPQGKGQKGDLGQQGPPGPLGFS---NSPGRDGSPGFPGQPGLPGEPGF-GLTGDKGFPGIPGSKGRPGASGEPGIGYPGVAGFKGMQGEPGFNGLPGPPGPPGSKGTPLPCRLPGIQGDKG--FPGRPGVPGPKGRVGSAGLNGRPGFDGSKGERGEPGSGGRPGPQGFPGPRGDAGLPGTTNIGLQGSPGRDGFPGSPGPKGEPGAVL---GATPGDLGRQGRPGEPGDKGQPGVPGFPGNPGVDGRNGFPGIKGERGVNGLPGPVGPIGPPGELPQGGIPGPRGPPGAKGFDGP--PGFPGLKGMRGDPGPPGPGGIKGIQGIPGIPGS-----------QGFRGPPGPTGFTERDGIPGRPGIKGEKGSLGLLGFQGLPGSPGIPGGPGIKGLPGFRGQDGLIGRDGPRGPRGDRGEPGPPGPSTPPIPVERLVKGEPGEPGIVGGPGFTGQRGDKGFPGPPGRPGFPGPPGFADQAKGLPGQPGIPGVPGSSGFP--GPKGFPGVMGFPGFSGVKGDNGVPGVPGFPGAQGPPGAKGEKGDSYASSGPTGPKGNIGNSGFPGGPGRPGEPGDSGFPGVLGYQGQKGFPGDPGIPGFVGSSGPPGPRGLPGYPGLRGRDGDPGRPGGPGLPGDKGFPGSPGLDGLNGLPGSRGPPG----------VPGVIEGGRVGPPGVNGQKGERGTSQPGVPGRPGEKGVRGDTGARGLRGYPGNPGPPGQPSLSNIPGPLGDPGLP--------GLDGREGPFGPPGLPGPPGPGTVQGDRGDPGFPGRPGIIGPRGEPGGFGAPGLQGNPGFKGQRGEPGFSGVPGRPGSPGEPGDYGRSGPRGLKGTSGP---VGNPGFV---------------FASNITARMPSGDPGQPGLDGFAGQPGIPGLPGSPGNPGPKGFRGQVGRLGPVGLAGSPGFTGDPGPSGIQGPTGLQGPRGKPGLPGI 1431          

HSP 3 Score: 172.555 bits (436), Expect = 2.059e-42
Identity = 355/1003 (35.39%), Postives = 446/1003 (44.47%), Query Frame = 3
Query:  198 FGNKGRQGFPGPRGYQGVSGD---------------------KGDVGQFGMPGPKGYKGFTGAIGPQGRKGERGIPGSPGYPGKMGEMGFPGIRGD-----------IGEKGLTGCDGQQGDFGN---------------------PGMNG---LVGRTGQPGERGDDGDRGLSIIPKYGLKGNKGSRGLLGRYGRKGEKGFKGIKGYSGI-----FGIKGNKGYVGPMGRRGPKGDSLGTVIIQS-----EKGSKGDKGLKGQSGIPCKGFQIEGRMYGRVGSDGPIGDKGIKGEKGLMGEIGQSGIDGARGLNGEKGLPGEAGPRGERGDRGNPGFPGDPGASGADGTRGRQGERGPKGVHGISGADGPRGSRGDKGPSG-----SLLSCPGRKGEKGFFGIPGIKGDIGNKGYQGHDGDIGEIGFKGEKGY---EGPLGPSCSEVEQGF-----------RGTKGESGFPGLRGAKGQRGYSGNKGIKGKPNFGTGINN----------PGETGSYGNLGVPGEKGNKGFIGDTGEKGFSGTGKQGPEGPRGDKGDDGVNGQVGMIGMPGIKGDKGSTYPIC-PFCEKGYKGIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEGRMGLLGSKGRQGYKGGKGFSGSMGDAGEIGYVTISGTT-IPGVKGEKGNQGPKGNKGEFGEAGSRGRKGYSGLKGFKGLIGERGTSF--SSGDPGDKGLRGENGKDGVSFAGIPGEKGLKGDKGNRGI--------LGDVGSLSNCATRPITSKGFKGPQGAKGTSGSPGSAGKTG---IVGNKGENGYPGKRGIDGDNGIP---GSKGEEGETGIKGHAGRPGNLGKSGLQGLRGEYGVKGDLGIQGIPGRKGVMGDPGPNGYAMIGSKGDKGIKGLPGIYGAKGDKGRPGYIGIP------GFKGETGLIGRSGLKGDQGEIGEKGIKGFTFISNNPGDRGLLGNKGLKGFPGELGNKGQVGVCTVRGDQGLR 2849
             G+ G QG PGP+G QG  GD                     KGD+GQ G PGP G+    G  G  G  G+ G+PG PG+ G  G+ GFPGI G            IG  G+ G  G QG+ G                      PG+ G     GR G PG +G  G  GL+  P  G  G+KG RG  G  GR G +GF G +G +G+      G++G+ G  G  G  GPKG+  G V+  +      +G  G+ G KGQ G+P  GF       G  G DG  G  GIKGE+G+ G  G  G  G  G   + G+PG  GP G +G  G PGFPG     G  G  G  G  G KG+ GI G  G +G RG  GP+G      +   PG KGEKG  G+ G +G  G+ G  G  G  G  GF+G+ G    +GP GP     E G            R  KGE G PG+ G  G  G  G+KG  G P                  PG+ G  G  G  G  G KGF G  G  GFSG         +GD G  GV G  G  G PG KG+KG +Y    P   KG  G                +G  G  G  G PGD G  G+LG +G++G+ G  G  G +G +G  G   + G   + G  G+ G  G  G  G+ G  GS G  G +GL G +G  G  G       G PG  G +GE G       G PGEKG++GD G RG+             SLSN    P+   G  G  G +G  G PG  G  G   + G++G+ G+PG+ GI G  G P   G+ G +G  G KG  G PG  G  G  G  GE G  G  G +G+ G  G +G+PG    + I ++   G  G PG+ G  G  G PG  G P      GF+G+ G +G  GL G  G  G+ G  G   I    G +G  G  GL G P        +G   V+  Q  R
Sbjct:  493 IGDNGYQGLPGPQGPQGRRGDRGFNGRKGEKGNAFFPQGKGQKGDLGQQGPPGPLGFSNSPGRDGSPGFPGQPGLPGEPGF-GLTGDKGFPGIPGSKGRPGASGEPGIGYPGVAGFKGMQGEPGFNGLPGPPGPPGSKGTPLPCRLPGIQGDKGFPGRPGVPGPKGRVGSAGLNGRP--GFDGSKGERGEPGSGGRPGPQGFPGPRGDAGLPGTTNIGLQGSPGRDGFPGSPGPKGEP-GAVLGATPGDLGRQGRPGEPGDKGQPGVP--GFP------GNPGVDGRNGFPGIKGERGVNGLPGPVGPIGPPGELPQGGIPGPRGPPGAKGFDGPPGFPG---LKGMRGDPGPPGPGGIKGIQGIPGIPGSQGFRGPPGPTGFTERDGIPGRPGIKGEKGSLGLLGFQGLPGSPGIPGGPGIKGLPGFRGQDGLIGRDGPRGPRGDRGEPGPPGPSTPPIPVERLVKGEPGEPGIVGGPGFTGQRGDKGFPGPPGRPGFPGPPGFADQAKGLPGQPGIPGVPGSSGFPGPKGFPGVMGFPGFSGV--------KGDNGVPGVPGFPGAQGPPGAKGEKGDSYASSGPTGPKGNIG---------------NSGFPGGPGRPGEPGDSGFPGVLGYQGQKGFPGDPGIPGFVGSSGPPGPRGLPGYPGLRGRDGDPGRPGGPGLPGDKGFPGSPGLDGLNGLPGSRGPPGVPGVIEGGRVGPPGVNGQKGERGTSQPGVPGRPGEKGVRGDTGARGLRGYPGNPGPPGQPSLSNIPG-PLGDPGLPGLDGREGPFGPPGLPGPPGPGTVQGDRGDPGFPGRPGIIGPRGEPGGFGAPGLQGNPGFKGQRGEPGFSGVPGRPGSPGEPGDYGRSGPRGLKGTSGPVGNPGFVFASNITARMPSGDPGQPGLDGFAGQPGIPGLPGSPGNPGPKGFRGQVGRLGPVGLAGSPGFTGDPGPSG---IQGPTGLQGPRGKPGLPGIPAPPTRSTGIGYTLVKHSQSTR 1453          

HSP 4 Score: 169.474 bits (428), Expect = 1.652e-41
Identity = 344/1079 (31.88%), Postives = 440/1079 (40.78%), Query Frame = 3
Query:  249 VSGDKGDVGQFGMPGPKGYKGFTGAIGPQGRKGERGIPGSPGYPGKMGEMGFPGIRGDIGEKGLTGCDGQQGDFGNPGMNGLVGRTGQPGERGDDGDRGLSIIPKYGLKGNKGSRGLLGRYGRKGEKGFKGIKGYSGIFGIKGNKGYVGPMGRRGPKGDSLGTV--IIQSEKGSKGDKGLKGQSGIPCKGFQIEGRMYGRVGSDGPIGDKGIKGEKGLMGEIGQSGIDGARGLNGEKGLPGEAGPRGERGDRGNPGFPGDPGASGADGTRGRQGERGPKGVHGISGADGPRGSRGDKGPSGSLL-SCPGRKGEKGFFGIPGIKGDIGNKGYQGHDGDIGEIGFKGEKGYEG------------------PLGPSCSEVEQGFRGTKGESGFPGLRGAKGQRGYSGNKGIKGKPNFGTGINNPGETGSYGNLGVPGEKGNKGFIGDTGEKGFSGTGKQGPEGPRGDKGDDGVNGQVGMIGMPGIKGDKGSTYPICPFCEKGYKGIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEGRMGLLGSKGRQGYKGGKGFSGSMGDAGEIGYVTISGTTIPGVKGEKGNQGPKGNKGEFGEAGSRGRKGYSGLKGFKGLIGERGTSFSSGDPGDKGLRGENGKDGVS-FAGIPGEKGLKGDKGNR----GILGDVGSLSNCATRPIT-------SKGFKGPQGAKGTSGSPGSAGKTGIVGNKGENG------------------------------YPGKRGIDGDNGIPGSKGEEGETGIKGHAGRPGNLGKSGLQGLRGEYGVKGDLGIQGIPGRKGVMGDPGPNGYA----------------MIGSKGDKGIKGLPG------------------IYGAKGDKGRPGYIGIPGFKGETGLIGRSGLKGDQGEIGEKGIKGFTFISN------NPGDRGLLGNKGLKGFPGELGNKGQVGVCTVR-----GDQGLRGYSGLIGDMGMKGEQGSKGIVGDYGAASRSGIMGRTGKIGNQGLPGDQXXXXXXXXXXXXXXXXYIGIPGFEGDRGEKGNKGFPGFPGDIGQPGRLGNPGISTE 3161
            ++G KG++G        GY+G  G  GPQGR+G+RG  G  G   + G   FP  +G  G+ G  G  G  G   +PG +G  G  GQPG  G+         P +GL G+KG  G+ G  GR G  G  GI GY G+ G KG +G  G  G  GP G        +     G +GDKG  G+ G+P                       G KG  G  G  G+ G DG++G  GE G  G  GP+G  G RG+ G PG                    G+ G  G DG  GS G KG  G++L + PG  G +G  G PG KG  G  G+ G+ G  G  GF G KG  G                    G        G +G  G  GFPGL+G +G  G  G  GIKG                    G+PG  G++GF G  G  GF+       +G  G  G  G  G +G++G  G+ G  G           G++G  G +G  G  G  G  G  G  G    P    R+ + G  G  G  GG GF+G  GD G  G     G   P    ++     KG  G+ G  G  G  G+ G KGF G++G          PG  G++G+NG  GV  F G  G  G KG+KG+     G  G  G++ N                GF G  G +G  G PG  G  G VG+ G  G                              +PG  G+DG NG+PGS+G  G  G+    GR   +G  G+ G +GE G     G+ G PG KGV GD G  G                  + G  GD G+ GL G                  + G +GD G PG  GI G +GE G  G  GL+G+ G  G++G  GF+ +         PGD G  G +GLKG  G +GN G V    +      GD G  G  G  G  G+ G  GS G  G        G  G+ G++G  GL                      G PGF GD G  G +G  G  G  G+PG  G P   T 
Sbjct:  486 LNGLKGEIGD------NGYQGLPGPQGPQGRRGDRGFNGRKG---EKGNAFFPQGKGQKGDLGQQGPPGPLGFSNSPGRDGSPGFPGQPGLPGE---------PGFGLTGDKGFPGIPGSKGRPGASGEPGI-GYPGVAGFKGMQGEPGFNGLPGPPGPPGSKGTPLPCRLPGIQGDKGFPGRPGVP-----------------------GPKGRVGSAGLNGRPGFDGSKGERGEPGSGGRPGPQGFPGPRGDAGLPGTTNI----------------GLQGSPGRDGFPGSPGPKGEPGAVLGATPGDLGRQGRPGEPGDKGQPGVPGFPGNPGVDGRNGFPGIKGERGVNGLPGPVGPIGPPGELPQGGIPGPRGPPGAKGFDGPPGFPGLKGMRGDPGPPGPGGIKGI------------------QGIPGIPGSQGFRGPPGPTGFTER-----DGIPGRPGIKGEKGSLGLLGFQGLPGSPGIPGGPGIKGLPGFRGQDGLIGRDGPRGPRGDRGEPGPPGPSTPPIPVERL-VKGEPGEPGIVGGPGFTGQRGDKGFPGPPGRPGFPGPPGFADQA----KGLPGQPGIPGVPGSSGFPGPKGFPGVMGF---------PGFSGVKGDNGVPGVPGFPGAQGPPGAKGEKGDSYASSGPTGPKGNIGNSGFPGGPGRPGEPGDSGFPGVLGYQGQKGFPGDPGIPGFVGSSGPPGPRGLPGYPGLRGRDGDPGRPGGPGLPGDKGFPGSPGLDGLNGLPGSRGPPGVPGVI-EGGR---VGPPGVNGQKGERGTS-QPGVPGRPGEKGVRGDTGARGLRGYPGNPGPPGQPSLSNIPGPLGDPGLPGLDGREGPFGPPGLPGPPGPGTVQGDRGDPGFPGRPGIIGPRGEPGGFGAPGLQGNPGFKGQRGEPGFSGVPGRPGSPGEPGDYGRSGPRGLKGTSGPVGNPGFVFASNITARMPSGDPGQPGLDGFAGQPGIPGLPGSPGNPGP------KGFRGQVGRLGPVGL---------------------AGSPGFTGDPGPSGIQGPTGLQGPRGKPGLPGIPAPPTR 1437          

HSP 5 Score: 116.701 bits (291), Expect = 1.848e-25
Identity = 354/1051 (33.68%), Postives = 425/1051 (40.44%), Query Frame = 3
Query:  987 RGDRGNPGFPGDPGASGADGTRGRQGERGPKGVHGISGADGPRGSRGDKGPSGSLLSCPGRKGEKGFFGIPGIKGDIGNKGYQGHDGDIGEIGFKGEKGYEGPLGPSCSEVEQGFRGTKGESGFPGLRGAKGQRGY----SGNKGIKGKPNFGTGINNPGETGSYG-----------------NLGVPGEKGNKGFIGDTGEKGFSGTGKQGPEGPRGDKGDDGVNGQVGMIGMPGIKGDKGSTYPICPFC---EKGYKGIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEGRMGLLGSKGRQGYKGGKGFSGSMGDAGEIGYVTISGTTIPGVKGEKGNQGPKGNKGEFGEAGSRGRKG----------YSGLKGFKGLIGERGTSFSSGDPG-----DKGLRGENGKDG----------------VSFAGIPGEKGLKGDKGNRGILGDVGSLSNCATRPITSKGFKGPQGAKGTSGSPGSAGKTGIVGNKGENGYPGKRGIDGDNGIPGSKGEEGETGIKGHA------GRPGNLGKSGLQGLRGEYGVKGDLGIQGIPGRKGVMGDPGPNGYAMIGSKGDKGIKGLPGIYGAKGDKGRPGYIGIPGFKGETGLIGRSGLKGDQGEIGEKGIKGFTFISNNPGDRGLLGNKGLKGFPGELGNKGQVGVCTVRGDQGLRGYSGLIGDMGMKGEQGSKGIVGDYGAASRSGI--MGRTGKIGNQGLPGDQXXXXXXXXXXXXXXXXYIGIPGFEGDRGEKGNKGFPGFPGDIGQPGRLGNPGISTE-GVXXXXXXXXXXXXXXXXXXXXXXXXXXKQGDSGIS----IPGRQG------------IKGEDGTIGLPGEMGEPGPRGDFGQKGNIGITGEFGLQGNRGDDGLKG---------------DDGIPGLNGPRGFIGDIGFVGFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXELGLDGSMGGKGDNGPRGFNGPTGIPGSKGF----------------EGDKGIRGDIGVKGFQGQHGEIGFPGLKGVSGENG 3806
            +G RG PG  G  G+ G +G  G  G  GPK   G  G  GP G  GDKGP G     PG  G  G  G PG +G  G  G  G +G  G+ G+ G  GY G                 G  GFPGL+G KG+  Y    S N   +G P         G  G  G                   G  GE G KG +G  G +G        P     +KG+ G  G  G  G+PG +G      P+ PF    E G KGI G  G RG  G NG  G              GR G  GS+G  G  G  G  G +GD G  G +  S   +  +KG KG++G  G  G  G+ G  G  G          ++G  G  G  G RG     G+PG      +GL G  G  G                    G PG+ G +G  G++GI G  G   +C        G  G QG  G  G PG  G  G+ G  G+NGY G  G  G  G  G +G  G  G KG+A      G+ G+LG+ G  G  G     G  G  G PG+ G+ G+PG       G  GDKG  G+PG  G  G  G PG IG PG  G  G+ G  G  G  G  G  G KG       PG   + G+KG  G PG  G KG+VG   + G  G  G  G  G+ G  G  G +G  G  G A   G   +G  G  G  G PG  G  G  G          +G  G  G+ G+KG  G PGFPG+ G  GR G PGI  E GV G PG  G  GP GE    G+ G  G  G  G       PG +G            IKG  G  G+PG  G  GP G  G     GI G  G++G +G  GL G                 G+PG  G  G IG  G  G             +G+RG                  KGE G  G +GG G  G RG  G  G PG  GF                 G  G+ G  G  G +G  G +GFPG  GV G+NG
Sbjct:   42 KGGRGQPGELGPVGSGGPEGFYGGPGPVGPKAEQGHIGRKGPPGQNGDKGPMG----VPGYPGNDGVPGHPGQEGPRGPPGLDGCNGTQGDTGYSGLDGYSG---------------IPGSPGFPGLKGQKGEPSYLNIPSQNILTQGPPGPQGYPGPIGPRGPDGFDGLPGLPGPPGPPGSPGQGYKGEPGEKGDVGPQGVRGNPSVQFNAPAISTINKGEKGDKGYAGNPGLPGRQG------PVNPFRYPGEVGEKGILGLPGGRGPPGLNGPPG------------LPGRKGFTGSEGFPGQPGLNGPKGDIGDPGPPGPIVDS--PVFEIKGSKGDRGFPGYPGFPGDTGYGGLPGQPGAPGPPAFFTGRPGAPGFPGSRGPKGQRGNPGRDSYGSEGLPGSQGLSGPPGLPGPPGTSSNFIVTPLPGFPGQPGPRGPFGSQGIKGFKGENGDCN---CLGGGTIGAQGPPGPPGFPGFIGLNGLKGEIGDNGYQGLPGPQGPQGRRGDRGFNGRKGEKGNAFFPQGKGQKGDLGQQGPPGPLGFSNSPGRDGSPGFPGQPGLPGEPG------FGLTGDKGFPGIPGSKGRPGASGEPG-IGYPGVAGFKGMQGEPGFNGLPGPPGPPGSKGTPLPCRLPG---IQGDKGFPGRPGVPGPKGRVGSAGLNGRPGFDGSKGERGEPGSGGRPGPQGFPGPRGDAGLPGTTNIGLQGSPGRDGFPGSPGPKGEPGAVLGATPGD-LGRQGRPGEPGDKGQPGVPGFPGNPGVDGRNGFPGIKGERGVNGLPGPVGPIGPPGELPQGGIPGPRGPPGAKGFDGPPGFPGLKGMRGDPGPPGPGGIKGIQGIPGIPGSQGFRGPPGPTGFTERDGIPGRPGIKGEKGSLGLLGFQGLPGSPGIPGGPGIKGLPGFRGQDGLIGRDGPRG------------PRGDRGEPGPPGPSTPPIPVERLVKGEPGEPGIVGGPGFTGQRGDKGFPGPPGRPGFPGPPGFADQAKGLPGQPGIPGVPGSSGFPGPKGFPGVMGFPGFSGVKGDNG 1027          

HSP 6 Score: 115.546 bits (288), Expect = 4.636e-25
Identity = 288/910 (31.65%), Postives = 360/910 (39.56%), Query Frame = 3
Query: 2247 KGTSGSPGSAGKTGIVGNKGENGYPGKRGIDGDNGIPGSKGEEGETGIKGHAGRPGNLGKSGLQGLRGEYGVKGDLGIQGIPGRKGVMGDPGPNGYAMIGSKGDKGIKGLPGIYGAKGDKGRPGYIGIPG-------------------FKGETGL-----------------IGRSGLKGDQGEIGEKGIKGFTFIS-NNPG----DRGLLGNKGLKGFPGELGNKGQVGVCTVRGDQGLRGYSGLIGDMGMKGEQGS------KGIVGDYGAASRSGIMGRTGKIGNQGLPGDQXXXXXXXXXXXXXXXXYIGIPGFEGDRGE----------------KGNKGFPGFPGDIGQPGRLGNPGISTEGVXXXXXXXXXXXXXXXXXXXXXXXXXXKQGDSGISIPGRQGIKGEDGTIGLPGEMGEPGPRGDFGQKGNIGITGEFG--------------------------LQGNRGDDGLKGDDGIPGLNGPRGFIGDIGFVGFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXELGLDGSMGGKGDNGPRGFNGPTGIPGSKGF--EGDKGIRGDIGVKGFQGQHGE--IGFPGL---KGVSGENGRQXXXXXXXXXXXXXXXXVCMQPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEVGESIRGLQGRKGSTGLRGNIGIPGERGDKGIPGLQGKVGNKGVKGDIGDKGFSG--NIGDKGYSGISGDKGSFGVKGDKG-----FQGDVGMLGKSGLQGDRGQKGIIGFRGTRGIPGSMGLPGEIGEKGDVGPSGIGVKGLKGYQ-------NAVGIKGRKGEKGLPGFPGRPGKVGDQGDKGPKGMKNMNTXXXXXXXXXXXXXXXXXXXXXXXXXLPGDMGEIGPNGPIGYAD 4646
            KG  G PG  G  G  G +G  G PG  G   + G  G KG  G+ G KG  G PG  G  G+ G  G+ G +G  G+ G  G +G  G  G +GY+        GI G PG  G KG KG P Y+ IP                     +G  G                   G  G  G++G++G +G++G   +  N P     ++G  G+KG  G PG  G +G V      G+ G +G  GL G  G  G  G       KG  G  G   + G+ G  G IG+ G PG          KG KG +G+ G PGF GD G                  G  G PGFPG  G  G+ GNPG  + G       +           P  +  P     + I  P             LPG  G+PGPRG FG +G  G  GE G                          L G +G+ G  G  G+PG  GP+G  GD GF G            +  +        KG KG  G  G  G LG   S    G +G  GF G  G+PG  GF   GDKG  G  G KG  G  GE  IG+PG+   KG+ GE G  G  G  G  G  G    C  P +        +                           + G +GR GS GL G  G  G +G++G PG  G+ G +G  G  GD G  G  NIG +G  G  G  GS G KG+ G       GD+G  G+ G  GD+GQ G+ GF G  G+ G  G PG  GE+G  G  G         +          G  G KG  G PGFPG  G  GD G  GP G+K +                       G  G+PG  G  GP GP G+ +
Sbjct:   42 KGGRGQPGELGPVGSGGPEGFYGGPGPVGPKAEQGHIGRKGPPGQNGDKGPMGVPGYPGNDGVPGHPGQEGPRGPPGLDGCNGTQGDTGYSGLDGYS--------GIPGSPGFPGLKGQKGEPSYLNIPSQNILTQGPPGPQGYPGPIGPRGPDGFDGLPGLPGPPGPPGSPGQGYKGEPGEKGDVGPQGVRGNPSVQFNAPAISTINKGEKGDKGYAGNPGLPGRQGPVNPFRYPGEVGEKGILGLPGGRGPPGLNGPPGLPGRKGFTGSEGFPGQPGLNGPKGDIGDPGPPGPIVDSPVFEIKGSKGDRGFPGYPGFPGDTGYGGLPGQPGAPGPPAFFTGRPGAPGFPGSRGPKGQRGNPGRDSYG-------SEGLPGSQGLSGPPGLPGPPGTSSNFIVTP-------------LPGFPGQPGPRGPFGSQGIKGFKGENGDCNCLGGGTIGAQGPPGPPGFPGFIGLNGLKGEIGDNGYQGLPGPQGPQGRRGDRGFNG-----------RKGEKGNAFFPQGKGQKGDLGQQGPPGPLGFSNS---PGRDGSPGFPGQPGLPGEPGFGLTGDKGFPGIPGSKGRPGASGEPGIGYPGVAGFKGMQGEPGFNGLPGPPGPPGSKGTPLPCRLPGIQGDKGFPGR-------------------------PGVPGPKGRVGSAGLNGRPGFDGSKGERGEPGSGGRPGPQGFPGPRGDAGLPGTTNIGLQGSPGRDGFPGSPGPKGEPGAVLGATPGDLGRQGRPGEPGDKGQPGVPGFPGNPGVDGRNGFPGIKGERGVNGLPGPVGPIGPPGELPQGGIPGPRGPPGAKGFDGPPGFPGLKGMRGDPGPPGPGGIKGIQ----------------------GIPGIPGSQGFRGPPGPTGFTE 862          

HSP 7 Score: 70.8626 bits (172), Expect = 1.611e-11
Identity = 73/192 (38.02%), Postives = 95/192 (49.48%), Query Frame = 3
Query: 4014 GSTGLRGNIGIPGERGDKGIPGLQ--GKVGNKGVKGDIGDKGFS--GNIGDKGYSGISGDKGSFGVKGDKGFQGDVGMLGKSGLQGDRGQKGIIGF---------------------RGTRGIPGSMGLPGEIGEKGDVGPSGIGVKGLKGYQNAVGIKGRKGEKGLPGFPGRPGKVGDQGDKGPKGMKNMN 4514
            GS GL G  G+PG RG  G+PG+   G+VG  GV G  G++G S  G  G  G  G+ GD G+ G++G  G  G  G    S + G  G  G+ G                      +G RG PG  G PG IG +G+  P G G  GL+G     G +G  G  G+PG PG PG+ GD G  GP+G+K  +
Sbjct: 1145 GSPGLDGLNGLPGSRGPPGVPGVIEGGRVGPPGVNGQKGERGTSQPGVPGRPGEKGVRGDTGARGLRGYPGNPGPPGQPSLSNIPGPLGDPGLPGLDGREGPFGPPGLPGPPGPGTVQGDRGDPGFPGRPGIIGPRGE--PGGFGAPGLQGNPGFKGQRGEPGFSGVPGRPGSPGEPGDYGRSGPRGLKGTS 1334          

HSP 8 Score: 58.9214 bits (141), Expect = 7.908e-8
Identity = 73/231 (31.60%), Postives = 104/231 (45.02%), Query Frame = 3
Query: 3984 ESIRGLQGRKGSTGLRGNIGIPGERGDKGIPGLQGKVGNKGVKGDIGDKGFSGNIGDKGYSGISGDKG-SFGVKGDKGFQGDVG------MLGKSGLQGDRGQKGIIGFRGTRGIPGSMGLPGEIGEKGDVG-------------------------------PSGIGVKGLKGYQNA-----------------VGIKGRKGEKGL--PGFPGRPGKVGDQGDKGPKGMK 4505
            +  +GL G+ G  G+ G+ G PG +   G PG+ G  G  GVKGD G  G  G  G +G  G  G+KG S+   G  G +G++G        G+ G  GD G  G++G++G +G PG  G+PG +G  G  G                               P   G+ GL G   +                  G+ G+KGE+G   PG PGRPG+ G +GD G +G++
Sbjct:  984 DQAKGLPGQPGIPGVPGSSGFPGPK---GFPGVMGFPGFSGVKGDNGVPGVPGFPGAQGPPGAKGEKGDSYASSGPTGPKGNIGNSGFPGGPGRPGEPGDSGFPGVLGYQGQKGFPGDPGIPGFVGSSGPPGPRGLPGYPGLRGRDGDPGRPGGPGLPGDKGFPGSPGLDGLNGLPGSRGPPGVPGVIEGGRVGPPGVNGQKGERGTSQPGVPGRPGEKGVRGDTGARGLR 1211          

HSP 9 Score: 53.1434 bits (126), Expect = 3.805e-6
Identity = 74/237 (31.22%), Postives = 99/237 (41.77%), Query Frame = 3
Query: 3996 GLQGRKGSTGLRGNIGIPGERGDKGIPGLQGKVGNKGVKGDIGDKGFSGNIGDKGYSGISGDKGSFGVKGDK------------------GFQGDVGMLGKSGLQGDR--------------------------GQKGII---GFRGTR-------------------------GIPGSMGLPGEIGEKGDVGPSGIGVKGLKGYQNAVGIKGRKGEKGLPGFPGRPGKVGDQGDKG 4490
            G  G  G  G+RG+ G PG  G KGI G+ G  G++G +G  G  GF+   G  G  GI G+KGS G+ G +                  GF+G  G++G+ G +G R                          G+ GI+   GF G R                         G+PG  G+PG  G  G  GP G    G+ G+    G+KG  G  G+PGFPG  G  G +G+KG
Sbjct:  814 GPPGFPGLKGMRGDPGPPGPGGIKGIQGIPGIPGSQGFRGPPGPTGFTERDGIPGRPGIKGEKGSLGLLGFQGLPGSPGIPGGPGIKGLPGFRGQDGLIGRDGPRGPRGDRGEPGPPGPSTPPIPVERLVKGEPGEPGIVGGPGFTGQRGDKGFPGPPGRPGFPGPPGFADQAKGLPGQPGIPGVPGSSGFPGPKGF--PGVMGFPGFSGVKGDNGVPGVPGFPGAQGPPGAKGEKG 1048          
BLAST of Collagen IV NC1 domain-containing protein vs. Ensembl Xenopus
Match: COL4A1 (collagen, type IV, alpha 1 [Source:NCBI gene;Acc:100124870])

HSP 1 Score: 439.884 bits (1130), Expect = 9.910e-127
Identity = 621/1837 (33.81%), Postives = 789/1837 (42.95%), Query Frame = 3
Query:  333 QGRKGERGIPGSPGYPGKMGEMGFPGIRGDIGEKGLTGCDGQQGDFGNPGMNGLVGRTGQPGERGDDGDRGLSIIPKYGLKGNKGSRGLLGRYGRKGEKGFKGIKGYSGIFGIKGNKGYVGPMGRRGPKGDSLGTVIIQSEKGSKGDKGLKGQSGIPCKGFQIEGRMYGRVGSDGPIGDKGIKGEKGLMGEIGQSGIDGARGLNGEKGLPGEAGPRGERGDRGNPGFPGDPGASGADGTRGRQGERGPKGVHGISGADGPRGSRGDKGPSGSLLSCPGRKGEKGFFGI---PGIKGDIGNKGYQGHDGDIGEIG------FKGEKGYEGPLGP-----SCSEVEQGFRGTKGESGFPGLRGAKGQRGYSGNKGIKGKPNFGTGINNPGETGSYGNLGVPGEKGNKGFIGDTGEKGFSGTGKQGPEGPRGDKGDDGVNGQVGMIGMPGIKGDKGSTYPICPFCEKGYKGIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEGRMGLLGSKGRQGYKGGKGFSGSMGDAGEIGYVTIS----------------GTTIPGVKGEKGNQGPKGNKGEFGEAGSRGRKGYSGLKGFKG-------LIGERGTSFSSGDPGDKGLRGENGKDGVSFAGIPGEKGLKGD---KGNRGILGDVGSLSNCATRPITSKGFKGPQGAKGTSGSPGSAGKTGIVGNKGENGYPGK-------------------------RGIDGDNGIPGSKGEEGETGIKGHAGRPGNLGKSGLQGLRGEYGVKGDLGIQGIPGRKGVMGDPGPNGYAMIGSKGDKGIKGLPGIYGAKGDKGRPGYIGIPGFKGETGLIGRSGLKGDQGEIGEKGIKGFTFISNNPG--DRGLLGNKGLKGFPGELGNKGQVGVCTVRGDQGLRGYSGLIGDMGMKGEQGSKGIVGDYGAASRSGIMGRTGKIGNQGLPGDQXXXXXXXXXXXXXXXXYIGIPGFEGDRGEKGN---------KGFPGFPGDIGQPGRLGNPGISTEGVXXXXXXXXXXXXXXXXXXXXXXXXXXKQGDSGISIPGRQGIKGEDGTIGLPGEMGEPGPRGDFGQKGNIGITGEFGLQGNRGDDGLKGDDGIPGLNGPRGFIGDIGFVGFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXELGLDGSMGGKGD---NGP------RGFNGPTGIPGSKGFEGDKGIRGDIGV---------KGFQGQHGEIGFPGLKGVSGENGRQXXXXXXXXXXXXXXXXVCMQPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEVGESIRGLQGR---KGSTGLRGNIGIPGERGDKGIPGLQGKVG-----------------------NKGVKGDIGDKGFSGNIG------DKGYSGISGDKGSFGVKGDKGFQGDVGMLGKSGLQGDRGQKGIIGFRGTRG---------IPGSMGLPGEIGEKGDVGPSG----IGVKGLKGYQNAVGIKGRKGEKGLPGFPGRPGKVGDQGDKGPKGMKNMNTXXXXXXXXXXXXXXXXXXXXXXXXXLPGDMGEIGPNGPIGYA-----------------------DNGFLYATHSQSKDFPPCHGGGSPLYNGYSLLAIHGDIDSVTMDLGTPGSCLKNFSTIPFVNCFLERNTFYGGRCHVNMRNSRSYWLSTLQSYMSSPQPPS--KMDDYISRCSVCQTKTTVMAFHSQKSDWQMTKCPYGWQKLWAGFSFPMAVQASRSGSNQPFSSPGSCLKHFRSLPFIECNNHNSNCNHWRDGVSYYMTAVDSENQFVKAQGKVLKSQTDIMNSISKCVVCQRDMN 5351
            +G+KGERG+PG PG       MGF    G  G +G  G  GQ+GD G PG+ G  G  G PG  G  G+ GL  IP        G  G  G  G  G  G KG +G  G  G+ G  GY G  G+ GPKG+  G +        KG+KG  G +GIP                                G  G  G  GA G  GE G+    GP+GERGDRG PG P  P ++   G+   Q   G KG  G+ G +G RG  G         S  G KGE G  G    PG  GD G KG QG  G  G  G       KGEKG  GP GP     S  E+E   +G +G  GFPG +G KG +G  G  GI                   G+ GVP         G TG  GF G         RG+KG  G+ G         ++G KG                                    +   +   G  G  GL G+ G+ G++G +G  G  GDA     +                    + +PG+KG++G+ G  G  G  G  GS G  G  G KG  G       L G++G S   G PG  G  G  G DG    G+PG KG+ G    KG +G+ GD GS  N   R        G  G  G  G PG  G  GI G  G  G PGK                         +G  G  G PGS+GE+GE G+ G  G PG  G+ G QG+ G  G  G  G QG+ G  G+ GDPGP G   +G  G KG++G PG  G  GDKG PG  G+PG +G +G+ G  G KG+ G +G  GI+G   +        +G  G +GL GFPG  G KG+            RGY+G  G + M G +G KG +G  G    +GI G+ G  G +GLPG  G  G  G  G  GS G  G PG  G  GEKG+          G+PG  G+ G+ G  G PG  +E                                   ++ G +G KGE G IG+ GE G     GDFG  G  G  G+ G+QG  G  G KG  GI G  G +G  G IG +G  G  G +G+ G  G  G    G    +           +G+ G  G KGD   +GP      RG  G  GIPG  GF G KG  G  G+         KG +G HG +G PG KG++G++G QG  G  G  G+ G  G+   P                                 E G   RGL G     G  G +G+IG PG  G  G+PG++G  G                        KG KG  G  G+ G+ G        G  GI G+KG  G  G  GFQG  G  G  G  GD G  GI G +G  G         + GS+G+ GE G++GD G +G    +G  G  G          KGE G PG  G  G  G QG  GPKG K +           G+ G  G  G  G  G PG  GE GP+GP G                          +GFL   HSQ+ + P C  G + +Y+GYSLL + G+  +   DLG  GSCL+ FST+PF+ C +         C+   RN  SYWLST +    S  P +   +  +ISRC+VC+    VMA HSQ    Q+ +CP GW  LW G+SF M   A   GS Q  +SPGSCL+ FRS+PFIEC+   + CN++ +  S+++  ++    F K     LK+  D+   +S+C VC R  +
Sbjct:   25 KGQKGERGLPGLPGL------MGF---PGLQGPEGPPGPLGQKGDTGEPGLPGTKGTRGPPGSHGFPGNPGLPGIP--------GQDGPPGPSGIPGCNGTKGDRGPLGPPGLPGIIGYPGSPGQPGPKGEP-GDITGIDVSMIKGEKGFPGINGIPGTPGLPGTPGPMGPIGP--------------PGSAGPPGSHGAPGPKGEMGI-SFYGPKGERGDRGPPGAPCKP-STEPQGSENEQVYYGEKGEKGMPGENGERGQPGQ--------SFKGEKGEPGPLGPRGKPGKDGDQGEKGLQGVPGIPGFPGPPGFGGTKGEKGESGPQGPPGIVVSNGEIEVCEKGDRGLPGFPGSKGDKGLKGAQGFPGIP------------------GSPGVP-------LPGSTGPPGFPGE--------RGEKGQHGLPGLA-------LQGPKGRDG-------------------FPGPPGLPGPPGAIDTSIECKSGQPGDPGLPGNPGQNGFQGERGQKGDKGDACPSCDLVPPGLPGPPGPQGPPGDQGASGVPGIKGDRGHPGYDGPPGAPGPQGSAGLMGSPGAKGEPGEVFFEPRLKGDKGESGLPGHPGAPGREGRPGIDGQQ--GLPGSKGVAGTIGAKGEQGLPGDRGSPGNPGERGFPGPAGTGTSGLPGEKGEPGVPGFVGIPGTPGAKGEPGKAIIKTGPPGPMGGAGIPGFPGDQGEKGSPGHPGRPGSQGEKGEPGLPG-VGYPGPSGEKGFQGMPGTPGQAGFPGPQGVDGLPGLRGDPGPKGEPGLGLPGPKGVQGPPGPVGIPGDKGNPGASGVPGEQGFSGVPGHPGHKGEAGIVGVPGIQGPPGVPGMGPKGQQGSSGPQGLSGFPGPAGVKGE------------RGYAGFPG-LDMPGPKGDKGNIGSPGPTGATGIPGQPGAPGKEGLPGFPGPKGEMGVMGMPGSIGQPGAPGSPGALGEKGDAGPFGPPGISGYPGTKGEKGEEGLRGEPGKMSE-------------------------------TDKETMKGSKGEKGERGEIGISGEKGS---LGDFGSPGTPGKDGQQGVQGESGPKGEKGSQGIKGSQGLQGQKGSIGEMGLPGPTGEKGQHGISGSPGSPGLGGIKGEKGLKGEVGLPGIGIPGVPGVKGDAGRDGPHGLPGERGDKGDVGIPGMPGFPGSKGATGHAGIPGSPGLPGEKGAKGTHGLVGIPGQKGLTGDSGVQGPPGHSGEKGEPGYDGIPGSPGEKG-----------------------------EAGIPGRGLPGHPGEHGEKGSKGDIGFPGAPGISGVPGIKGDQGLPGFQGPQGPPGFPGPSGIPMEGPKGEKGQPGQAGYPGSPGPVGLPGHTGQDGIKGEKGERGWPGAPGFQGFKGDTGNQGPSGDAGPSGITGQKGDTGPPGIPGFPGLKGSLGISGEKGDRGDQGITGPKGDLGPPGPAGTHTVT-----KGESGEPGPQGPSGPRGIQGLPGPKGDKGVT----------GASGLPGPSGIPGIHGTPGQKGETGPSGPTGQTGYPGPPGSDGLPGPIGLPGSPSMAHGFLVTRHSQTTETPQCPFGTTAVYSGYSLLYVQGNERAHGQDLGASGSCLRKFSTMPFLFCNINN------VCNFASRNDYSYWLSTPEPMPMSMAPITGDGIKPFISRCTVCEVPAMVMAVHSQT--IQIPQCPDGWISLWIGYSFVMQTSAGAEGSGQALASPGSCLEEFRSVPFIECHGRGT-CNYYANTYSFWLATIEKNEMFKKPTPSTLKA-GDLRTHVSRCQVCMRRTS 1656          

HSP 2 Score: 280.026 bits (715), Expect = 2.457e-75
Identity = 454/1338 (33.93%), Postives = 567/1338 (42.38%), Query Frame = 3
Query:  216 QGFPGPRGYQGVS--GDKGDVGQFGMPG--------PKG------YKGFTGAIGPQGRKGERGIPGSP-----GYPGKMGEMGFPGIRGDIGEKGLTG---------------CDGQQGDFGNPGMNGLVGRTGQPGERGDDGDRGLSIIPKYGLKGNKGSRGLLGRYGRKGEKGF-----KGIKGYSGIFGIKGNKGYVGPMGRRGPKGDSLGT-------------VIIQSEKGSKGDKGLKGQSGIPCKGFQIEGRMYGRVGSDGPIGD------------------------KGIKGEKGLMGEIGQSGID------GARGLNGEKGLPGEA--GPR--GERGDRGNPGFPGDPGASGADGTRGRQGERGPKGVHGISGADGPRGSRGDKGPSGSLLSCPGRKGEKGFFGIPGIKGDIGNKGYQGHDGDIGEIGFKGEKGYEGPLGPSCSEVEQGFRGTKGESG-FPGLRGAKGQRGYSG---NKGIKGKPNFGTGINNPGETGSYGNLGVPGEKGNKGFIG------------DTGEKGFSGTGKQGPEG------------PRGDKGDDGVNGQVGMIGMPGIKGDKGSTYPICPFCEKGYKGIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEGRMGLLGSKGRQGYKGGKGFSGSMGDAGEIGYVTISGTTIPGVKGEKGN---QGPKGNKGEFGEAGSRGRKGYSGLKGFKGLIGERGTSFSSGDPGDKGLRGENGKDGVS----FAGIPGEKGLKGDKGNRGILGDVGSLSNCATRPITSKGFKGPQGAKGTSGSPGSAGKTGIVGNKGENGYPGKRGIDGDNGIPGSKGEEGETGIKGHAGRPGNLGKSGLQGLRGEYGVKGDLGI------------QGIPGRKGVMGDPGPNGYAMIGSKGDKGIKGLPGIYGAKGDKGRPGYIGIPGFKGETGLIGRSGLKGDQGEIGEKGIKGFTFISNNPGDRGLLGNKGLKGFPGELGNKGQVGVCTVRGDQGLRGYSGLIGD--MGMKGEQGSKGIVGDYGAASRSGIMGRTGKIGNQGLPGDQXXXXXXXXXXXXXXXXYIGIPGFEGDRGEKGNKGFPGFPGDIGQPGRLGNPGISTEGVXXXXXXXXXXXXXXXXXXXXXXXXXXKQGDSGIS-IPGRQGIKGEDGTIGLPGEMGEPGPRGDFGQKGNI---GITGEFGLQGNRGDDGLKGDDGIPGLNGPRGFIGDIGFVGFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXELGLDGSMGGKGDNGPRGFNGPTGIPGSKGFEGDKGIRGDIGVKGFQGQHGEIGFPGLKGVSGENG 3806
             G PGP+G  G+S  G KG+ G  G PG        P+G      Y G  G  G  G  GERG PG       G PG +G  G PG  GD GEKGL G                 G++G+ G  G  G+V   G+  E  + GDRGL   P  G KG+KG +G  G  G  G  G       G  G+ G  G KG  G  G +  +GPKG                    I+ + G  GD GL G  G    GFQ E    G  G   P  D                         GIKG++G  G  G  G        G  G  G KG PGE    PR  G++G+ G PG PG PG  G  G  G+QG  G KGV G  GA G +G  GD+G        PG  GE+GF G P   G  G  G +G  G  G +G  G  G +G  G +  +              FPG +G KG  G+ G   ++G KG+P    G+  PG +G  G  G+PG  G  GF G            D G KG  G G  GP+G             +G+ G  GV G+ G  G+PG  G KG    +      G  GIQG                               MG  G +G  G +G  GF G  G  GE GY    G  +PG KG+KGN    GP G  G  G+ G+ G++G  G  G KG +G  G   S G PG  G  G  G+ G +      GI G  G KG+KG  G+ G+ G +S         +  KG +G KG  G  G +G+ G +G+ G  G PGK G  G  G  G KGE+G  GIKG  G  G  G  G  GL G  G KG  GI            +G  G KG +G PG     + G KGD G  G  G+ G +GDKG  G  G+PGF G  G  G +G+ G  G  GEKG KG   +   PG +GL G+ G++G PG  G KG+ G   + G  G +G +G+ G    G  GE G KG  GD G     GI G  G  G+QGL                     I + G +G++G+ G  G+PG PG +G PG  G  GI  E                             +G+ G    PG QG KG+ G     G  G+ GP G  GQKG+    GI G  GL+G+ G  G KGD G  G+ GP+G +G  G  G                                            + G  G+ GP+G +GP GI G  G +GDKG+ G  G+ G  G  G  G PG KG +G +G
Sbjct:  190 HGAPGPKGEMGISFYGPKGERGDRGPPGAPCKPSTEPQGSENEQVYYGEKGEKGMPGENGERGQPGQSFKGEKGEPGPLGPRGKPGKDGDQGEKGLQGVPGIPGFPGPPGFGGTKGEKGESGPQGPPGIVVSNGE-IEVCEKGDRGLPGFP--GSKGDKGLKGAQGFPGIPGSPGVPLPGSTGPPGFPGERGEKGQHGLPG-LALQGPKGRDGFPGPPGLPGPPGAIDTSIECKSGQPGDPGLPGNPGQ--NGFQGERGQKGDKGDACPSCDLVPPGLPGPPGPQGPPGDQGASGVPGIKGDRGHPGYDGPPGAPGPQGSAGLMGSPGAKGEPGEVFFEPRLKGDKGESGLPGHPGAPGREGRPGIDGQQGLPGSKGVAGTIGAKGEQGLPGDRG-------SPGNPGERGFPG-PAGTGTSGLPGEKGEPGVPGFVGIPGTPGAKGEPGKAIIKTGPPGPMGGAGIPGFPGDQGEKGSPGHPGRPGSQGEKGEPGL-PGVGYPGPSGEKGFQGMPGTPGQAGFPGPQGVDGLPGLRGDPGPKGEPGLGLPGPKGVQGPPGPVGIPGDKGNPGASGVPGEQGFSGVPGHPGHKGEAGIV------GVPGIQGPP-------------------------GVPGMGPKGQQGSSGPQGLSGFPGPAGVKGERGYAGFPGLDMPGPKGDKGNIGSPGPTGATGIPGQPGAPGKEGLPGFPGPKGEMGVMGMPGSIGQPGAPGSPGALGEKGDAGPFGPPGISGYPGTKGEKGEEGLRGEPGKMSE-----TDKETMKGSKGEKGERGEIGISGEKGSLGDFGSPGTPGKDGQQGVQGESGPKGEKGSQGIKGSQGLQGQKGSIGEMGLPGPTGEKGQHGISGSPGSPGLGGIKGEKGLKGEVGLPGIGIPGVPGVKGDAGRDGPHGLPGERGDKGDVGIPGMPGFPGSKGATGHAGIPGSPGLPGEKGAKGTHGLVGIPGQKGLTGDSGVQGPPGHSGEKGEPGYDGIPGSPGEKGEAGIPGRGLPGHPGEHGEKGSKGDIGFPGAPGISGVPGIKGDQGL----PGFQGPQGPPGFPGPSGIPMEGPKGEKGQPGQAGYPGSPGPVGLPGHTGQDGIKGE-----------------------------KGERGWPGAPGFQGFKGDTGNQ---GPSGDAGPSGITGQKGDTGPPGIPGFPGLKGSLGISGEKGDRGDQGITGPKGDLGPPGPAGTHTV----------------------------------------TKGESGEPGPQGPSGPRGIQGLPGPKGDKGVTGASGLPGPSGIPGIHGTPGQKGETGPSG 1400          

HSP 3 Score: 277.715 bits (709), Expect = 1.245e-74
Identity = 399/1153 (34.61%), Postives = 507/1153 (43.97%), Query Frame = 3
Query:  201 GNKGRQGFPGPRGYQGVSGDKGDVGQFGMPGPKGYKGFTGAIG-----PQGR--------------------KGERGIPGSPGYPGKMGEMGFPGIRGDIGEKG--LTGCD----------------GQQGDFGNPGMNG------------------LVGRTGQPGERGDDGDRGLSIIPKYGLKGNKGSRGLLGRYGRKGEKGFKGIKGYSGIFGIKGNKGYVGPMGRRGPKGDSLGTVIIQSEKGSKGDKGLKGQSGIPCKGFQIEGRMYGRVGSDGPIGDKGIKGEKGLMGEIGQSGIDGAR-------------GLNGEKGLPGEAGPRGERGDRGNPGFPGD--PGASGADGTRGRQGERGPKGVHGISGADGPRGSRGDKGPSGSL-LSCPGRKG------------EKGFFGIPGIKGDIGNKGYQGHDGDIGEIGFKGEKGYEGPLGPSCSEV--EQGFRGTKGESGFPGLRGAKGQRGYSGNKGIKGKPNFGTGINNPGETGSYGNLGVPGEKGNKGFIGDTGEKGFSG-TGKQGPEGPRGDKGDDGVNGQVGMIGMPGIKGDKGSTYPICPFCEKGYKGIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEGRMGLLGSKGRQGYKGGKGFSGSMGDAGEIGYVTISGTT-------IPGVKGEKGNQGPKGNKGEFGEAGSRGRKGYSGLKGFKGLIGERGTSFSSGDPG------------------DKGLRGENGKDGVSFAGIPGEKGLKGDKGNRGILGDVGSLSNCATRPITSKGFKGPQGAKGTSGSPGSAGKTGIVGNKGENGY---PGKRGIDGDNGI---PGSKGEEGETGIKGHAGRPGNLGKSG-----LQGLRGEYGVKGDLGIQGIPGRKGVMGDPGPNGYAMIGSKGDKGIKG---------------LPGIYGAKGDKGRPGYIGIPGFKGETGL---IGRSGLKGDQGEIGEKGIKGFTFISNNPGDRGLLGNKGLKGFPGELGN------------KGQVGVCTVRGDQGLRGYSGLIGDMGMKGEQGSKGIVGDYGAASRSGIMGRTGKIGNQGLPGDQXXXXXXXXXXXXXXXXYIGIPGFEGDRGEK---------GNKGFPGFPGDIGQPGRLGNPGIST 3158
            G KG QGFPG  G  GV    G  G  G PG +G KG  G  G     P+GR                    + + G PG PG PG  G+ GF G RG  G+KG     CD                G QG  G PG+ G                    G  G PG +G+ G+  +   P+  LKG+KG  GL G  G  G +G  GI G  G+ G KG  G +G  G +G  GD       +   G+ G++G  G +G    G      + G  G  G  G  GI G  G  GE G++ I                 G  GEKG PG  G  G +G++G PG PG   PG SG  G +G  G  G  G  G  G DG  G RGD GP G   L  PG KG            +KG  G  G+ G+ G  G  GH G  GE G  G  G +GP G        +QG  G +G SGFPG  G KG+RGY+G            G++ PG  G  GN+G PG  G  G  G  G  G  G  G  GP+G  G  G  G  GQ G  G PG  G+KG   P  P    GY G +G                           ++G  GL G  G+      +   GS G+ GE G + ISG          PG  G+ G QG +G  G  GE GS+G KG  GL+G KG IGE G    +G+ G                  +KGL+GE G  G+   G+PG KG  G  G  G+ G+ G   +     +   GF G +GA G +G PGS G  G  G KG +G    PG++G+ GD+G+   PG  GE+GE G  G  G PG  G++G     L G  GE+G KG  G  G PG  G+ G PG         KGD+G+ G               +P + G KG+KG+PG  G PG  G  GL    G+ G+KG++GE G  G  GF     + G++G  G+ G  G  G+ G+            KG +G+   +GD+G +G +G  GD+G  G  G+  +    G +   G  G +G  G QGLPG +G  G  G  G  G     GIPG  G  G+K         G  G+PG PG  G PG +G PG  +
Sbjct:  346 GLKGAQGFPGIPGSPGVP-LPGSTGPPGFPGERGEKGQHGLPGLALQGPKGRDGFPGPPGLPGPPGAIDTSIECKSGQPGDPGLPGNPGQNGFQGERGQKGDKGDACPSCDLVPPGLPGPPGPQGPPGDQGASGVPGIKGDRGHPGYDGPPGAPGPQGSAGLMGSPGAKGEPGE--VFFEPR--LKGDKGESGLPGHPGAPGREGRPGIDGQQGLPGSKGVAGTIGAKGEQGLPGD-------RGSPGNPGERGFPGPAGTGTSG------LPGEKGEPGVPGFVGIPGTPGAKGEPGKAIIKTGPPGPMGGAGIPGFPGDQGEKGSPGHPGRPGSQGEKGEPGLPGVGYPGPSGEKGFQGMPGTPGQAGFPGPQGVDGLPGLRGDPGPKGEPGLGLPGPKGVQGPPGPVGIPGDKGNPGASGVPGEQGFSGVPGHPGHKGEAGIVGVPGIQGPPGVPGMGPKGQQGSSGPQGLSGFPGPAGVKGERGYAGF----------PGLDMPGPKGDKGNIGSPGPTGATGIPGQPGAPGKEGLPGFPGPKGEMGVMGMPGSIGQPGAPGSPGALGEKGDAGPFGPPGISGYPGTKG---------------------------EKGEEGLRGEPGKMSETDKETMKGSKGEKGERGEIGISGEKGSLGDFGSPGTPGKDGQQGVQGESGPKGEKGSQGIKGSQGLQGQKGSIGEMGLPGPTGEKGQHGISGSPGSPGLGGIKGEKGLKGEVGLPGIGIPGVPGVKGDAGRDGPHGLPGERGDKGDVGIPGMP--GFPGSKGATGHAGIPGSPGLPGEKGAKGTHGLVGIPGQKGLTGDSGVQGPPGHSGEKGEPGYDGIPGSPGEKGEAGIPGRGLPGHPGEHGEKGSKGDIGFPGAPGISGVPG--------IKGDQGLPGFQGPQGPPGFPGPSGIP-MEGPKGEKGQPGQAGYPGSPGPVGLPGHTGQDGIKGEKGERGWPGAPGFQGFKGDTGNQGPSGDAGPSGITGQKGDTGPPGIPGFPGLKGSLGISGEKGDRGDQGITGPKGDLGPPGPAGTHTVT--KGESGEPGPQGPSGPRGIQGLPGPKGDKGVTGASGLPGPS---GIPGIHGTPGQKGETGPSGPTGQTGYPGPPGSDGLPGPIGLPGSPS 1427          

HSP 4 Score: 259.996 bits (663), Expect = 3.803e-69
Identity = 473/1399 (33.81%), Postives = 600/1399 (42.89%), Query Frame = 3
Query:  159 KCLRICTPDKCQCFGNKGRQGFPGPRGYQGVSGDKGDVGQFGMPGPKGYKGFTGAIGPQGRKGERGIPGSPGYPGKMGEMGFPGIRGDIGEKGLTGCDGQQGD------FGNPGMNGLVGRTGQPGERGDDGDRGLSIIPKYGLKGNKGSRGLLG---------------------------RYGRKGEKGFKGIKGYSGIFGIKGNKGYVGPMGRR-GPKGDSLGTVIIQSEKGSKGDKGLKGQS---GIPCKGFQIEGRMYGRVGSDGPIGDKGIKGEKGLM------------------GEIGQSGIDGARGL-----------NGEKGLPGEAGPRGERGDRGNPGFPGDPGA-----SGADGTRGRQGERGPKGVHGISG--ADGPRGSRGDKGPSG---------SLLSCPGRKGEKGFFGIPGIKGDIGNKGYQGHDGDIGEI------------------------------GFKGEKGY---------------EGPLGPSCSEVEQG-------FRGTKGESGFPGLRGAKGQRGYSGNKGIKGKPNFGTGINNPGETGSYGNLGVPGEK---GNKGFIGDTGEKGFSGTGKQGPEGPRGDKGDDGVNGQVGMIGMPGIKGDKGSTYPICPFCEKGYKGIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEGRMGLLGSKGRQGYKGGKGFSGSMGDAGEIGYVTISGTTIPGVKGEKGNQGPKGNKGEFGEAGSRGRKGYSGLKGFKGLIGERGTSFS-----------------SGDPGDKGLRGENGKDGVSFAGIPGEKGLKGDKGNRGILGDVGSLSNCATRPITSKGFKGPQGAKGTSGSPGSAGKTGIVGNKGENGYPGKRGID-----GDNGIPGSKGEEGETGIKGHAGRPGNLGKSGLQGLRGEYGVKGDLGIQGIPGRKGVMGDPGPNGYAMIGSKGDKGIKGLPGIY---GAKGDKGRPGYIGIPGFKGETGLIGRSGLKGDQGEIGEKGIKGFTFISNNPGDRGLLGNKGLKGFPGELGNKGQVGVCTVRGDQGLRGYSGLIGDMGM---KGEQGSKGIVGDYGAASRSGIMGRTGKIGNQGLPGDQXXXXXXXXXXXXXXXXYIGIPGFEGDRGEKGNKGFPGFPGDIGQPGRLGNPGISTEGVXXXXXXXXXXXXXXXXXXXXXXXXXXKQGDSGIS----IPGRQGIKGEDGTIGLPGEMGEPGPRGDFGQKGNIGITGEFGLQGNRGDDGLKGDDGIPGL--------NGPRGFIGDIGFVGFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXELGLDGSMGGKGDNGPRGF---NGPTGIPGSK---GFEGDKGIRGDIGVKGFQGQHGEIGFPGLKGVSGENG 3806
            K    C   KC C G KG++G  G  G  G+ G  G  G  G PGP G KG TG  G  G KG RG PGS G+PG  G  G PG  G  G  G+ GC+G +GD       G PG+ G  G  GQPG +G+ GD  ++ I    +KG KG  G+ G                            +G  G KG  GI      +G KG +G  GP G    P  +  G+   Q   G KG+KG+ G++   G P + F+ E    G +G  G  G  G +GEKGL                   GE G+SG  G  G+            G++GLPG  G +G++G +G  GFPG PG+      G+ G  G  GERG KG HG+ G    GP+G  G  GP G         + + C  + G+ G  G+PG  G  G +G +G  GD G+                               G KG++G+                G +G   ++ E G        +G KGESG PG  GA G+ G  G  G +G          PG  G  G +G  GE+   G++G  G+ GE+GF G    G  G  G+KG+ GV G VG+ G PG KG+ G                                      G  G  G  G  G  G +G +G  G  G  GS G+ GE G   + G   PG  GEKG QG  G  G+ G  G +G  G  GL+G  G  GE G                      G+PG  G+ GE G     F+G+PG  G KG+ G  G+ G  G        P   +G  GPQ   G SG PG AG       KGE GY G  G+D     GD G  GS G  G TGI G  G PG       +GL G  G KG++G+ G+PG  G  G PG  G   +G KGD G  G PGI    G KG+KG  G  G PG   ET      G KG++GE GE GI G      + G  G  G  G +G  GE G KG+ G   ++G QGL+G  G IG+MG+    GE+G  GI G  G+    GI G  G  G  GLPG                   IGIPG  G +G+ G  G  G PG+ G  G +G PG+                        G  G  G  G +GI     +PG +G KG  G +G+PG+ G  G  G  G  G+ G  GE G  G  G  G KG+ GIPG         +G +G  GDIGF G        G  G  G +G +                   + ++G  G KG  G  G+    GP G+PG     G +G+KG RG  G  GFQG  G+ G  G  G +G +G
Sbjct:    9 KACSGCGTSKCDCSGVKGQKGERGLPGLPGLMGFPGLQGPEGPPGPLGQKGDTGEPGLPGTKGTRGPPGSHGFPGNPGLPGIPGQDGPPGPSGIPGCNGTKGDRGPLGPPGLPGIIGYPGSPGQPGPKGEPGD--ITGIDVSMIKGEKGFPGINGIPGTPGLPGTPGPMGPIGPPGSAGPPGSHGAPGPKGEMGIS----FYGPKGERGDRGPPGAPCKPSTEPQGSENEQVYYGEKGEKGMPGENGERGQPGQSFKGEKGEPGPLGPRGKPGKDGDQGEKGLQGVPGIPGFPGPPGFGGTKGEKGESGPQGPPGIVVSNGEIEVCEKGDRGLPGFPGSKGDKGLKGAQGFPGIPGSPGVPLPGSTGPPGFPGERGEKGQHGLPGLALQGPKGRDGFPGPPGLPGPPGAIDTSIEC--KSGQPGDPGLPGNPGQNGFQGERGQKGDKGDACPSCDLVPPGLPGPPGPQGPPGDQGASGVPGIKGDRGHPGYDGPPGAPGPQGSAGLMGSPGAKGEPGEVFFEPRLKGDKGESGLPGHPGAPGREGRPGIDGQQGL---------PGSKGVAGTIGAKGEQGLPGDRGSPGNPGERGFPGPAGTGTSGLPGEKGEPGVPGFVGIPGTPGAKGEPGKAI--------------------------------IKTGPPGPMGGAGIPGFPGDQGEKGSPGHPGRPGSQGEKGEPG---LPGVGYPGPSGEKGFQGMPGTPGQAGFPGPQGVDGLPGLRGDPGPKGEPGLGLPGPKGVQGPPGPVGIPGDKGNPGASGVPGEQG-----FSGVPGHPGHKGEAGIVGVPGIQGPPGVPGMGPKGQQGSSGPQ---GLSGFPGPAGV------KGERGYAGFPGLDMPGPKGDKGNIGSPGPTGATGIPGQPGAPGK------EGLPGFPGPKGEMGVMGMPGSIGQPGAPGSPG--ALGEKGDAGPFGPPGISGYPGTKGEKGEEGLRGEPGKMSETDKETMKGSKGEKGERGEIGISGEKGSLGDFGSPGTPGKDGQQGVQGESGPKGEKGSQGIKGSQGLQGQKGSIGEMGLPGPTGEKGQHGISGSPGSPGLGGIKGEKGLKGEVGLPG-------------------IGIPGVPGVKGDAGRDGPHGLPGERGDKGDVGIPGMP-----------------------GFPGSKGATGHAGIPGSPGLPGEKGAKGTHGLVGIPGQKGLTGDSGVQGPPGHSGEKGEPGYDGIPGSPGEKGEAGIPGRGLPGHPGEHGEKGSKGDIGFPG------APGISGVPGIKGDQGLPGFQGPQGPPGFPGPSGIPMEGPKGEKGQPGQAGYPGSPGPVGLPGHTGQDGIKGEKGERGWPGAPGFQGFKGDTGNQGPSGDAGPSG 1285          

HSP 5 Score: 175.637 bits (444), Expect = 2.967e-43
Identity = 219/588 (37.24%), Postives = 272/588 (46.26%), Query Frame = 3
Query:  168 RICTPDKCQCFGNKGRQGFPGPRGYQGVSGDKGDVGQFGMPGP---KGYKGFTGAIGPQGRKGERGIPGSPGYPGKMGEMGFPGIRGDIGEKGLTGCDGQQGDFGNPGMNGLVGRTGQPGERGDDGDRGLSIIPKYGLKGNKGSRGLLGRYGRKGEKGFKGIKGYSGIFGIKGNKGYVGPMGRRGPKGDSLGTVIIQSEKGS-----KGDKGLKGQSGIPCKGFQIEGRMYGRVGSDGPIGDKGIKGEKGLMGEIGQSGIDGARGLNGEKGLPGEAGPRGERGDRGNPGFPGDPGASGADGTRGRQGERGPKGVHGISGADGPRGSRGDKGPSG----SLLSCPGRKGEK------GFFGIPGIKGDIGNKGYQG--------------------HDGDIGEIGFKGEKGY---EGPLGPSCSEVEQGFRGTKGESGFPGLRGAKGQRGYSGNKGIKGKPNFGTGINNPGETGS---------YGNLGVPGEKGNKGFIGDTGEKGFSG-----------------TGKQGPEGPR------GDKGDDGVNGQVGMI---GMPGIK---GDKGSTYPICPFCEKGYKG 1694
             I +P      G  G+ G PG  G  G  G KG++G  GMPG     G  G  GA+G +G  G  G PG  GYPG  GE G  G+RG+ G+   T  +  +G  G  G  G +G +G+ G  GD G  G          G  G +G+ G  G KGEKG +GIKG     G++G KG +G MG  GP G+     I  S         KG+KGLKG+ G+P  G      + G  G DGP G  G +G+KG +G  G  G  G++G  G  G+PG  G  GE+G +G  G  G PG  G  G  G QG  G  G  G  G DG  GS G+KG +G     L   PG  GEK      GF G PGI G  G KG QG                     +G  GE G  G+ GY    GP+G      + G +G KGE G+PG  G +G +G +GN+G  G           G+TG           G+LG+ GEKG++G  G TG KG  G                  G QGP GPR      G KGD GV G  G+    G+PGI    G KG T P  P  + GY G
Sbjct:  833 NIGSPGPTGATGIPGQPGAPGKEGLPGFPGPKGEMGVMGMPGSIGQPGAPGSPGALGEKGDAGPFGPPGISGYPGTKGEKGEEGLRGEPGKMSETDKETMKGSKGEKGERGEIGISGEKGSLGDFGSPGTP--------GKDGQQGVQGESGPKGEKGSQGIKGSQ---GLQGQKGSIGEMGLPGPTGEKGQHGISGSPGSPGLGGIKGEKGLKGEVGLPGIGIPGVPGVKGDAGRDGPHGLPGERGDKGDVGIPGMPGFPGSKGATGHAGIPGSPGLPGEKGAKGTHGLVGIPGQKGLTGDSGVQGPPGHSGEKGEPGYDGIPGSPGEKGEAGIPGRGLPGHPGEHGEKGSKGDIGFPGAPGISGVPGIKGDQGLPGFQGPQGPPGFPGPSGIPMEGPKGEKGQPGQAGYPGSPGPVGLPGHTGQDGIKGEKGERGWPGAPGFQGFKGDTGNQGPSGDAGPSGITGQKGDTGPPGIPGFPGLKGSLGISGEKGDRGDQGITGPKGDLGPPGPAGTHTVTKGESGEPGPQGPSGPRGIQGLPGPKGDKGVTGASGLPGPSGIPGIHGTPGQKGETGPSGPTGQTGYPG 1409          

HSP 6 Score: 169.859 bits (429), Expect = 2.011e-41
Identity = 204/568 (35.92%), Postives = 261/568 (45.95%), Query Frame = 3
Query:  168 RICTPDKCQCFGNKGRQGFPGPRGYQGVSGDKGDVGQFG---MPGPKGYKGFTGAIGPQGRKGERGIPGSPGYPGK---MGEMGFPGIRGDIGEKGLT------------GCDGQQGDFGNPGM-----------NGLVGRTGQPGERGDDGDRGLSIIPKYGLKGNKGSRGLLGRYGRKGEKGFKGIKGYSGIFGIKGNKGYVGPMGRRGPKGDSLGTVIIQSEKGSKGDKGLKGQSGIPCKGFQIEGRMYGRVGSDGPIGDKGIKGEKGLMGEIGQSGIDGARGLNGEKGL------------------PGEAGPRGERGDRGNPGFPGDPGASGADGTRGRQGERGPKGVHGISGADGPRGSRGDKGPSGSLLSCPGRKGEKGFFGIPGIKGDI------------GNKGYQGHDGDIGEIGFKGEKGYEGPLGPSCSEVEQGFRGTKGESGFPGLRGAKGQRGYSGNKGIKGKPNFGTGINNPGETGSYGNLGVPGEKGNKGFIGDTGEKGFSGTGKQGPEGPRGDKGDDGVNGQVGMIGMPGI-------KGDKGSTYPICPF 1673
            ++   DK    G+KG +G    RG  G+SG+KG +G FG    PG  G +G  G  GP+G KG +GI GS G  G+   +GEMG PG  G+ G+ G++            G  G +G+ G PG+            G  G  G PGERGD GD G+  +P  G  G+KG+ G  G  G  G  G KG KG  G+ GI G KG  G  G +GP G S G        G  G  G KG++GIP +G              G  G+ G KG KG +G  G  GI G  G+ G++GL                  P E GP+GE+G  G  G+PG PG  G  G  G+ G +G KG  G  GA G +G +GD G  G         G+ G  GI G KGD             G+ G  G  GD G+ G  G KG  GP GP+ +        TKGESG PG +G  G RG  G  G KG          PG +G  G  G PG+KG  G  G TG+ G+ G             G DG+ G +G+ G P +       +  + +  P CPF
Sbjct:  923 KMSETDKETMKGSKGEKGE---RGEIGISGEKGSLGDFGSPGTPGKDGQQGVQGESGPKGEKGSQGIKGSQGLQGQKGSIGEMGLPGPTGEKGQHGISGSPGSPGLGGIKGEKGLKGEVGLPGIGIPGVPGVKGDAGRDGPHGLPGERGDKGDVGIPGMP--GFPGSKGATGHAGIPGSPGLPGEKGAKGTHGLVGIPGQKGLTGDSGVQGPPGHS-GEKGEPGYDGIPGSPGEKGEAGIPGRGL------------PGHPGEHGEKGSKGDIGFPGAPGISGVPGIKGDQGLPGFQGPQGPPGFPGPSGIPME-GPKGEKGQPGQAGYPGSPGPVGLPGHTGQDGIKGEKGERGWPGAPGFQGFKGDTGNQGP-------SGDAGPSGITGQKGDTGPPGIPGFPGLKGSLGISGEKGDRGDQGITGPKGDLGPPGPAGTHTV-----TKGESGEPGPQGPSGPRGIQGLPGPKGDKGVTGASGLPGPSGIPGIHGTPGQKGETGPSGPTGQTGYPGP-----------PGSDGLPGPIGLPGSPSMAHGFLVTRHSQTTETPQCPF 1448          
BLAST of Collagen IV NC1 domain-containing protein vs. Ensembl Xenopus
Match: COL4A1 (collagen, type IV, alpha 1 [Source:NCBI gene;Acc:100124870])

HSP 1 Score: 439.884 bits (1130), Expect = 1.090e-126
Identity = 621/1837 (33.81%), Postives = 789/1837 (42.95%), Query Frame = 3
Query:  333 QGRKGERGIPGSPGYPGKMGEMGFPGIRGDIGEKGLTGCDGQQGDFGNPGMNGLVGRTGQPGERGDDGDRGLSIIPKYGLKGNKGSRGLLGRYGRKGEKGFKGIKGYSGIFGIKGNKGYVGPMGRRGPKGDSLGTVIIQSEKGSKGDKGLKGQSGIPCKGFQIEGRMYGRVGSDGPIGDKGIKGEKGLMGEIGQSGIDGARGLNGEKGLPGEAGPRGERGDRGNPGFPGDPGASGADGTRGRQGERGPKGVHGISGADGPRGSRGDKGPSGSLLSCPGRKGEKGFFGI---PGIKGDIGNKGYQGHDGDIGEIG------FKGEKGYEGPLGP-----SCSEVEQGFRGTKGESGFPGLRGAKGQRGYSGNKGIKGKPNFGTGINNPGETGSYGNLGVPGEKGNKGFIGDTGEKGFSGTGKQGPEGPRGDKGDDGVNGQVGMIGMPGIKGDKGSTYPICPFCEKGYKGIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEGRMGLLGSKGRQGYKGGKGFSGSMGDAGEIGYVTIS----------------GTTIPGVKGEKGNQGPKGNKGEFGEAGSRGRKGYSGLKGFKG-------LIGERGTSFSSGDPGDKGLRGENGKDGVSFAGIPGEKGLKGD---KGNRGILGDVGSLSNCATRPITSKGFKGPQGAKGTSGSPGSAGKTGIVGNKGENGYPGK-------------------------RGIDGDNGIPGSKGEEGETGIKGHAGRPGNLGKSGLQGLRGEYGVKGDLGIQGIPGRKGVMGDPGPNGYAMIGSKGDKGIKGLPGIYGAKGDKGRPGYIGIPGFKGETGLIGRSGLKGDQGEIGEKGIKGFTFISNNPG--DRGLLGNKGLKGFPGELGNKGQVGVCTVRGDQGLRGYSGLIGDMGMKGEQGSKGIVGDYGAASRSGIMGRTGKIGNQGLPGDQXXXXXXXXXXXXXXXXYIGIPGFEGDRGEKGN---------KGFPGFPGDIGQPGRLGNPGISTEGVXXXXXXXXXXXXXXXXXXXXXXXXXXKQGDSGISIPGRQGIKGEDGTIGLPGEMGEPGPRGDFGQKGNIGITGEFGLQGNRGDDGLKGDDGIPGLNGPRGFIGDIGFVGFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXELGLDGSMGGKGD---NGP------RGFNGPTGIPGSKGFEGDKGIRGDIGV---------KGFQGQHGEIGFPGLKGVSGENGRQXXXXXXXXXXXXXXXXVCMQPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEVGESIRGLQGR---KGSTGLRGNIGIPGERGDKGIPGLQGKVG-----------------------NKGVKGDIGDKGFSGNIG------DKGYSGISGDKGSFGVKGDKGFQGDVGMLGKSGLQGDRGQKGIIGFRGTRG---------IPGSMGLPGEIGEKGDVGPSG----IGVKGLKGYQNAVGIKGRKGEKGLPGFPGRPGKVGDQGDKGPKGMKNMNTXXXXXXXXXXXXXXXXXXXXXXXXXLPGDMGEIGPNGPIGYA-----------------------DNGFLYATHSQSKDFPPCHGGGSPLYNGYSLLAIHGDIDSVTMDLGTPGSCLKNFSTIPFVNCFLERNTFYGGRCHVNMRNSRSYWLSTLQSYMSSPQPPS--KMDDYISRCSVCQTKTTVMAFHSQKSDWQMTKCPYGWQKLWAGFSFPMAVQASRSGSNQPFSSPGSCLKHFRSLPFIECNNHNSNCNHWRDGVSYYMTAVDSENQFVKAQGKVLKSQTDIMNSISKCVVCQRDMN 5351
            +G+KGERG+PG PG       MGF    G  G +G  G  GQ+GD G PG+ G  G  G PG  G  G+ GL  IP        G  G  G  G  G  G KG +G  G  G+ G  GY G  G+ GPKG+  G +        KG+KG  G +GIP                                G  G  G  GA G  GE G+    GP+GERGDRG PG P  P ++   G+   Q   G KG  G+ G +G RG  G         S  G KGE G  G    PG  GD G KG QG  G  G  G       KGEKG  GP GP     S  E+E   +G +G  GFPG +G KG +G  G  GI                   G+ GVP         G TG  GF G         RG+KG  G+ G         ++G KG                                    +   +   G  G  GL G+ G+ G++G +G  G  GDA     +                    + +PG+KG++G+ G  G  G  G  GS G  G  G KG  G       L G++G S   G PG  G  G  G DG    G+PG KG+ G    KG +G+ GD GS  N   R        G  G  G  G PG  G  GI G  G  G PGK                         +G  G  G PGS+GE+GE G+ G  G PG  G+ G QG+ G  G  G  G QG+ G  G+ GDPGP G   +G  G KG++G PG  G  GDKG PG  G+PG +G +G+ G  G KG+ G +G  GI+G   +        +G  G +GL GFPG  G KG+            RGY+G  G + M G +G KG +G  G    +GI G+ G  G +GLPG  G  G  G  G  GS G  G PG  G  GEKG+          G+PG  G+ G+ G  G PG  +E                                   ++ G +G KGE G IG+ GE G     GDFG  G  G  G+ G+QG  G  G KG  GI G  G +G  G IG +G  G  G +G+ G  G  G    G    +           +G+ G  G KGD   +GP      RG  G  GIPG  GF G KG  G  G+         KG +G HG +G PG KG++G++G QG  G  G  G+ G  G+   P                                 E G   RGL G     G  G +G+IG PG  G  G+PG++G  G                        KG KG  G  G+ G+ G        G  GI G+KG  G  G  GFQG  G  G  G  GD G  GI G +G  G         + GS+G+ GE G++GD G +G    +G  G  G          KGE G PG  G  G  G QG  GPKG K +           G+ G  G  G  G  G PG  GE GP+GP G                          +GFL   HSQ+ + P C  G + +Y+GYSLL + G+  +   DLG  GSCL+ FST+PF+ C +         C+   RN  SYWLST +    S  P +   +  +ISRC+VC+    VMA HSQ    Q+ +CP GW  LW G+SF M   A   GS Q  +SPGSCL+ FRS+PFIEC+   + CN++ +  S+++  ++    F K     LK+  D+   +S+C VC R  +
Sbjct:   38 KGQKGERGLPGLPGL------MGF---PGLQGPEGPPGPLGQKGDTGEPGLPGTKGTRGPPGSHGFPGNPGLPGIP--------GQDGPPGPSGIPGCNGTKGDRGPLGPPGLPGIIGYPGSPGQPGPKGEP-GDITGIDVSMIKGEKGFPGINGIPGTPGLPGTPGPMGPIGP--------------PGSAGPPGSHGAPGPKGEMGI-SFYGPKGERGDRGPPGAPCKP-STEPQGSENEQVYYGEKGEKGMPGENGERGQPGQ--------SFKGEKGEPGPLGPRGKPGKDGDQGEKGLQGVPGIPGFPGPPGFGGTKGEKGESGPQGPPGIVVSNGEIEVCEKGDRGLPGFPGSKGDKGLKGAQGFPGIP------------------GSPGVP-------LPGSTGPPGFPGE--------RGEKGQHGLPGLA-------LQGPKGRDG-------------------FPGPPGLPGPPGAIDTSIECKSGQPGDPGLPGNPGQNGFQGERGQKGDKGDACPSCDLVPPGLPGPPGPQGPPGDQGASGVPGIKGDRGHPGYDGPPGAPGPQGSAGLMGSPGAKGEPGEVFFEPRLKGDKGESGLPGHPGAPGREGRPGIDGQQ--GLPGSKGVAGTIGAKGEQGLPGDRGSPGNPGERGFPGPAGTGTSGLPGEKGEPGVPGFVGIPGTPGAKGEPGKAIIKTGPPGPMGGAGIPGFPGDQGEKGSPGHPGRPGSQGEKGEPGLPG-VGYPGPSGEKGFQGMPGTPGQAGFPGPQGVDGLPGLRGDPGPKGEPGLGLPGPKGVQGPPGPVGIPGDKGNPGASGVPGEQGFSGVPGHPGHKGEAGIVGVPGIQGPPGVPGMGPKGQQGSSGPQGLSGFPGPAGVKGE------------RGYAGFPG-LDMPGPKGDKGNIGSPGPTGATGIPGQPGAPGKEGLPGFPGPKGEMGVMGMPGSIGQPGAPGSPGALGEKGDAGPFGPPGISGYPGTKGEKGEEGLRGEPGKMSE-------------------------------TDKETMKGSKGEKGERGEIGISGEKGS---LGDFGSPGTPGKDGQQGVQGESGPKGEKGSQGIKGSQGLQGQKGSIGEMGLPGPTGEKGQHGISGSPGSPGLGGIKGEKGLKGEVGLPGIGIPGVPGVKGDAGRDGPHGLPGERGDKGDVGIPGMPGFPGSKGATGHAGIPGSPGLPGEKGAKGTHGLVGIPGQKGLTGDSGVQGPPGHSGEKGEPGYDGIPGSPGEKG-----------------------------EAGIPGRGLPGHPGEHGEKGSKGDIGFPGAPGISGVPGIKGDQGLPGFQGPQGPPGFPGPSGIPMEGPKGEKGQPGQAGYPGSPGPVGLPGHTGQDGIKGEKGERGWPGAPGFQGFKGDTGNQGPSGDAGPSGITGQKGDTGPPGIPGFPGLKGSLGISGEKGDRGDQGITGPKGDLGPPGPAGTHTVT-----KGESGEPGPQGPSGPRGIQGLPGPKGDKGVT----------GASGLPGPSGIPGIHGTPGQKGETGPSGPTGQTGYPGPPGSDGLPGPIGLPGSPSMAHGFLVTRHSQTTETPQCPFGTTAVYSGYSLLYVQGNERAHGQDLGASGSCLRKFSTMPFLFCNINN------VCNFASRNDYSYWLSTPEPMPMSMAPITGDGIKPFISRCTVCEVPAMVMAVHSQT--IQIPQCPDGWISLWIGYSFVMQTSAGAEGSGQALASPGSCLEEFRSVPFIECHGRGT-CNYYANTYSFWLATIEKNEMFKKPTPSTLKA-GDLRTHVSRCQVCMRRTS 1669          

HSP 2 Score: 280.796 bits (717), Expect = 1.572e-75
Identity = 454/1338 (33.93%), Postives = 567/1338 (42.38%), Query Frame = 3
Query:  216 QGFPGPRGYQGVS--GDKGDVGQFGMPG--------PKG------YKGFTGAIGPQGRKGERGIPGSP-----GYPGKMGEMGFPGIRGDIGEKGLTG---------------CDGQQGDFGNPGMNGLVGRTGQPGERGDDGDRGLSIIPKYGLKGNKGSRGLLGRYGRKGEKGF-----KGIKGYSGIFGIKGNKGYVGPMGRRGPKGDSLGT-------------VIIQSEKGSKGDKGLKGQSGIPCKGFQIEGRMYGRVGSDGPIGD------------------------KGIKGEKGLMGEIGQSGID------GARGLNGEKGLPGEA--GPR--GERGDRGNPGFPGDPGASGADGTRGRQGERGPKGVHGISGADGPRGSRGDKGPSGSLLSCPGRKGEKGFFGIPGIKGDIGNKGYQGHDGDIGEIGFKGEKGYEGPLGPSCSEVEQGFRGTKGESG-FPGLRGAKGQRGYSG---NKGIKGKPNFGTGINNPGETGSYGNLGVPGEKGNKGFIG------------DTGEKGFSGTGKQGPEG------------PRGDKGDDGVNGQVGMIGMPGIKGDKGSTYPICPFCEKGYKGIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEGRMGLLGSKGRQGYKGGKGFSGSMGDAGEIGYVTISGTTIPGVKGEKGN---QGPKGNKGEFGEAGSRGRKGYSGLKGFKGLIGERGTSFSSGDPGDKGLRGENGKDGVS----FAGIPGEKGLKGDKGNRGILGDVGSLSNCATRPITSKGFKGPQGAKGTSGSPGSAGKTGIVGNKGENGYPGKRGIDGDNGIPGSKGEEGETGIKGHAGRPGNLGKSGLQGLRGEYGVKGDLGI------------QGIPGRKGVMGDPGPNGYAMIGSKGDKGIKGLPGIYGAKGDKGRPGYIGIPGFKGETGLIGRSGLKGDQGEIGEKGIKGFTFISNNPGDRGLLGNKGLKGFPGELGNKGQVGVCTVRGDQGLRGYSGLIGD--MGMKGEQGSKGIVGDYGAASRSGIMGRTGKIGNQGLPGDQXXXXXXXXXXXXXXXXYIGIPGFEGDRGEKGNKGFPGFPGDIGQPGRLGNPGISTEGVXXXXXXXXXXXXXXXXXXXXXXXXXXKQGDSGIS-IPGRQGIKGEDGTIGLPGEMGEPGPRGDFGQKGNI---GITGEFGLQGNRGDDGLKGDDGIPGLNGPRGFIGDIGFVGFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXELGLDGSMGGKGDNGPRGFNGPTGIPGSKGFEGDKGIRGDIGVKGFQGQHGEIGFPGLKGVSGENG 3806
             G PGP+G  G+S  G KG+ G  G PG        P+G      Y G  G  G  G  GERG PG       G PG +G  G PG  GD GEKGL G                 G++G+ G  G  G+V   G+  E  + GDRGL   P  G KG+KG +G  G  G  G  G       G  G+ G  G KG  G  G +  +GPKG                    I+ + G  GD GL G  G    GFQ E    G  G   P  D                         GIKG++G  G  G  G        G  G  G KG PGE    PR  G++G+ G PG PG PG  G  G  G+QG  G KGV G  GA G +G  GD+G        PG  GE+GF G P   G  G  G +G  G  G +G  G  G +G  G +  +              FPG +G KG  G+ G   ++G KG+P    G+  PG +G  G  G+PG  G  GF G            D G KG  G G  GP+G             +G+ G  GV G+ G  G+PG  G KG    +      G  GIQG                               MG  G +G  G +G  GF G  G  GE GY    G  +PG KG+KGN    GP G  G  G+ G+ G++G  G  G KG +G  G   S G PG  G  G  G+ G +      GI G  G KG+KG  G+ G+ G +S         +  KG +G KG  G  G +G+ G +G+ G  G PGK G  G  G  G KGE+G  GIKG  G  G  G  G  GL G  G KG  GI            +G  G KG +G PG     + G KGD G  G  G+ G +GDKG  G  G+PGF G  G  G +G+ G  G  GEKG KG   +   PG +GL G+ G++G PG  G KG+ G   + G  G +G +G+ G    G  GE G KG  GD G     GI G  G  G+QGL                     I + G +G++G+ G  G+PG PG +G PG  G  GI  E                             +G+ G    PG QG KG+ G     G  G+ GP G  GQKG+    GI G  GL+G+ G  G KGD G  G+ GP+G +G  G  G                                            + G  G+ GP+G +GP GI G  G +GDKG+ G  G+ G  G  G  G PG KG +G +G
Sbjct:  203 HGAPGPKGEMGISFYGPKGERGDRGPPGAPCKPSTEPQGSENEQVYYGEKGEKGMPGENGERGQPGQSFKGEKGEPGPLGPRGKPGKDGDQGEKGLQGVPGIPGFPGPPGFGGTKGEKGESGPQGPPGIVVSNGE-IEVCEKGDRGLPGFP--GSKGDKGLKGAQGFPGIPGSPGVPLPGSTGPPGFPGERGEKGQHGLPG-LALQGPKGRDGFPGPPGLPGPPGAIDTSIECKSGQPGDPGLPGNPGQ--NGFQGERGQKGDKGDACPSCDLVPPGLPGPPGPQGPPGDQGASGVPGIKGDRGHPGYDGPPGAPGPQGSAGLMGSPGAKGEPGEVFFEPRLKGDKGESGLPGHPGAPGREGRPGIDGQQGLPGSKGVAGTIGAKGEQGLPGDRG-------SPGNPGERGFPG-PAGTGTSGLPGEKGEPGVPGFVGIPGTPGAKGEPGKAIIKTGPPGPMGGAGIPGFPGDQGEKGSPGHPGRPGSQGEKGEPGL-PGVGYPGPSGEKGFQGMPGTPGQAGFPGPQGVDGLPGLRGDPGPKGEPGLGLPGPKGVQGPPGPVGIPGDKGNPGASGVPGEQGFSGVPGHPGHKGEAGIV------GVPGIQGPP-------------------------GVPGMGPKGQQGSSGPQGLSGFPGPAGVKGERGYAGFPGLDMPGPKGDKGNIGSPGPTGATGIPGQPGAPGKEGLPGFPGPKGEMGVMGMPGSIGQPGAPGSPGALGEKGDAGPFGPPGISGYPGTKGEKGEEGLRGEPGKMSE-----TDKETMKGSKGEKGERGEIGISGEKGSLGDFGSPGTPGKDGQQGVQGESGPKGEKGSQGIKGSQGLQGQKGSIGEMGLPGPTGEKGQHGISGSPGSPGLGGIKGEKGLKGEVGLPGIGIPGVPGVKGDAGRDGPHGLPGERGDKGDVGIPGMPGFPGSKGATGHAGIPGSPGLPGEKGAKGTHGLVGIPGQKGLTGDSGVQGPPGHSGEKGEPGYDGIPGSPGEKGEAGIPGRGLPGHPGEHGEKGSKGDIGFPGAPGISGVPGIKGDQGL----PGFQGPQGPPGFPGPSGIPMEGPKGEKGQPGQAGYPGSPGPVGLPGHTGQDGIKGE-----------------------------KGERGWPGAPGFQGFKGDTGNQ---GPSGDAGPSGITGQKGDTGPPGIPGFPGLKGSLGISGEKGDRGDQGITGPKGDLGPPGPAGTHTV----------------------------------------TKGESGEPGPQGPSGPRGIQGLPGPKGDKGVTGASGLPGPSGIPGIHGTPGQKGETGPSG 1413          

HSP 3 Score: 278.1 bits (710), Expect = 1.066e-74
Identity = 399/1153 (34.61%), Postives = 507/1153 (43.97%), Query Frame = 3
Query:  201 GNKGRQGFPGPRGYQGVSGDKGDVGQFGMPGPKGYKGFTGAIG-----PQGR--------------------KGERGIPGSPGYPGKMGEMGFPGIRGDIGEKG--LTGCD----------------GQQGDFGNPGMNG------------------LVGRTGQPGERGDDGDRGLSIIPKYGLKGNKGSRGLLGRYGRKGEKGFKGIKGYSGIFGIKGNKGYVGPMGRRGPKGDSLGTVIIQSEKGSKGDKGLKGQSGIPCKGFQIEGRMYGRVGSDGPIGDKGIKGEKGLMGEIGQSGIDGAR-------------GLNGEKGLPGEAGPRGERGDRGNPGFPGD--PGASGADGTRGRQGERGPKGVHGISGADGPRGSRGDKGPSGSL-LSCPGRKG------------EKGFFGIPGIKGDIGNKGYQGHDGDIGEIGFKGEKGYEGPLGPSCSEV--EQGFRGTKGESGFPGLRGAKGQRGYSGNKGIKGKPNFGTGINNPGETGSYGNLGVPGEKGNKGFIGDTGEKGFSG-TGKQGPEGPRGDKGDDGVNGQVGMIGMPGIKGDKGSTYPICPFCEKGYKGIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEGRMGLLGSKGRQGYKGGKGFSGSMGDAGEIGYVTISGTT-------IPGVKGEKGNQGPKGNKGEFGEAGSRGRKGYSGLKGFKGLIGERGTSFSSGDPG------------------DKGLRGENGKDGVSFAGIPGEKGLKGDKGNRGILGDVGSLSNCATRPITSKGFKGPQGAKGTSGSPGSAGKTGIVGNKGENGY---PGKRGIDGDNGI---PGSKGEEGETGIKGHAGRPGNLGKSG-----LQGLRGEYGVKGDLGIQGIPGRKGVMGDPGPNGYAMIGSKGDKGIKG---------------LPGIYGAKGDKGRPGYIGIPGFKGETGL---IGRSGLKGDQGEIGEKGIKGFTFISNNPGDRGLLGNKGLKGFPGELGN------------KGQVGVCTVRGDQGLRGYSGLIGDMGMKGEQGSKGIVGDYGAASRSGIMGRTGKIGNQGLPGDQXXXXXXXXXXXXXXXXYIGIPGFEGDRGEK---------GNKGFPGFPGDIGQPGRLGNPGIST 3158
            G KG QGFPG  G  GV    G  G  G PG +G KG  G  G     P+GR                    + + G PG PG PG  G+ GF G RG  G+KG     CD                G QG  G PG+ G                    G  G PG +G+ G+  +   P+  LKG+KG  GL G  G  G +G  GI G  G+ G KG  G +G  G +G  GD       +   G+ G++G  G +G    G      + G  G  G  G  GI G  G  GE G++ I                 G  GEKG PG  G  G +G++G PG PG   PG SG  G +G  G  G  G  G  G DG  G RGD GP G   L  PG KG            +KG  G  G+ G+ G  G  GH G  GE G  G  G +GP G        +QG  G +G SGFPG  G KG+RGY+G            G++ PG  G  GN+G PG  G  G  G  G  G  G  G  GP+G  G  G  G  GQ G  G PG  G+KG   P  P    GY G +G                           ++G  GL G  G+      +   GS G+ GE G + ISG          PG  G+ G QG +G  G  GE GS+G KG  GL+G KG IGE G    +G+ G                  +KGL+GE G  G+   G+PG KG  G  G  G+ G+ G   +     +   GF G +GA G +G PGS G  G  G KG +G    PG++G+ GD+G+   PG  GE+GE G  G  G PG  G++G     L G  GE+G KG  G  G PG  G+ G PG         KGD+G+ G               +P + G KG+KG+PG  G PG  G  GL    G+ G+KG++GE G  G  GF     + G++G  G+ G  G  G+ G+            KG +G+   +GD+G +G +G  GD+G  G  G+  +    G +   G  G +G  G QGLPG +G  G  G  G  G     GIPG  G  G+K         G  G+PG PG  G PG +G PG  +
Sbjct:  359 GLKGAQGFPGIPGSPGVP-LPGSTGPPGFPGERGEKGQHGLPGLALQGPKGRDGFPGPPGLPGPPGAIDTSIECKSGQPGDPGLPGNPGQNGFQGERGQKGDKGDACPSCDLVPPGLPGPPGPQGPPGDQGASGVPGIKGDRGHPGYDGPPGAPGPQGSAGLMGSPGAKGEPGE--VFFEPR--LKGDKGESGLPGHPGAPGREGRPGIDGQQGLPGSKGVAGTIGAKGEQGLPGD-------RGSPGNPGERGFPGPAGTGTSG------LPGEKGEPGVPGFVGIPGTPGAKGEPGKAIIKTGPPGPMGGAGIPGFPGDQGEKGSPGHPGRPGSQGEKGEPGLPGVGYPGPSGEKGFQGMPGTPGQAGFPGPQGVDGLPGLRGDPGPKGEPGLGLPGPKGVQGPPGPVGIPGDKGNPGASGVPGEQGFSGVPGHPGHKGEAGIVGVPGIQGPPGVPGMGPKGQQGSSGPQGLSGFPGPAGVKGERGYAGF----------PGLDMPGPKGDKGNIGSPGPTGATGIPGQPGAPGKEGLPGFPGPKGEMGVMGMPGSIGQPGAPGSPGALGEKGDAGPFGPPGISGYPGTKG---------------------------EKGEEGLRGEPGKMSETDKETMKGSKGEKGERGEIGISGEKGSLGDFGSPGTPGKDGQQGVQGESGPKGEKGSQGIKGSQGLQGQKGSIGEMGLPGPTGEKGQHGISGSPGSPGLGGIKGEKGLKGEVGLPGIGIPGVPGVKGDAGRDGPHGLPGERGDKGDVGIPGMP--GFPGSKGATGHAGIPGSPGLPGEKGAKGTHGLVGIPGQKGLTGDSGVQGPPGHSGEKGEPGYDGIPGSPGEKGEAGIPGRGLPGHPGEHGEKGSKGDIGFPGAPGISGVPG--------IKGDQGLPGFQGPQGPPGFPGPSGIP-MEGPKGEKGQPGQAGYPGSPGPVGLPGHTGQDGIKGEKGERGWPGAPGFQGFKGDTGNQGPSGDAGPSGITGQKGDTGPPGIPGFPGLKGSLGISGEKGDRGDQGITGPKGDLGPPGPAGTHTVT--KGESGEPGPQGPSGPRGIQGLPGPKGDKGVTGASGLPGPS---GIPGIHGTPGQKGETGPSGPTGQTGYPGPPGSDGLPGPIGLPGSPS 1440          

HSP 4 Score: 259.996 bits (663), Expect = 4.640e-69
Identity = 467/1387 (33.67%), Postives = 594/1387 (42.83%), Query Frame = 3
Query:  174 CTPDKCQCFGNKGRQGFPGPRGYQGVSGDKGDVGQFGMPGPKGYKGFTGAIGPQGRKGERGIPGSPGYPGKMGEMGFPGIRGDIGEKGLTGCDGQQGD------FGNPGMNGLVGRTGQPGERGDDGDRGLSIIPKYGLKGNKGSRGLLG---------------------------RYGRKGEKGFKGIKGYSGIFGIKGNKGYVGPMGRR-GPKGDSLGTVIIQSEKGSKGDKGLKGQS---GIPCKGFQIEGRMYGRVGSDGPIGDKGIKGEKGLM------------------GEIGQSGIDGARGL-----------NGEKGLPGEAGPRGERGDRGNPGFPGDPGA-----SGADGTRGRQGERGPKGVHGISG--ADGPRGSRGDKGPSG---------SLLSCPGRKGEKGFFGIPGIKGDIGNKGYQGHDGDIGEI------------------------------GFKGEKGY---------------EGPLGPSCSEVEQG-------FRGTKGESGFPGLRGAKGQRGYSGNKGIKGKPNFGTGINNPGETGSYGNLGVPGEKGNKGFIGDTGEKGFSGTGKQGPEGPRGDKGDDGVNGQVGMIGMPGIKGDKGSTYPICPFCEKGYKGIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEGRMGLLGSKGRQGYKGGKGFSGSMGDAGEIGYVTISGTTIPGVKGEKGNQGPKGNKGEFGEAGSRGRKGYSGLKGFKGLIGERGTSFS-----------------SGDPGDKGLRGENGKDGVSFAGIPGEKGLKGDKGNRGILGDVGSLSNCATRPITSKGFKGPQGAKGTSGSPGSAGKTGIVGNKGENGYPGKRGID-----GDNGIPGSKGEEGETGIKGHAGRPGNLGKSGLQGLRGEYGVKGDLGIQGIPGRKGVMGDPGPNGYAMIGSKGDKGIKGLPGIY---GAKGDKGRPGYIGIPGFKGETGLIGRSGLKGDQGEIGEKGIKGFTFISNNPGDRGLLGNKGLKGFPGELGNKGQVGVCTVRGDQGLRGYSGLIGDMGM---KGEQGSKGIVGDYGAASRSGIMGRTGKIGNQGLPGDQXXXXXXXXXXXXXXXXYIGIPGFEGDRGEKGNKGFPGFPGDIGQPGRLGNPGISTEGVXXXXXXXXXXXXXXXXXXXXXXXXXXKQGDSGISIPGRQGIKGEDGTIGLPGEMGEPGPRGDFGQKGNIGITGEFGLQGNRGDDGLKGDDGIPGL--------NGPRGFIGDIGFVGFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXELGLDGSMGGKGDNGPRGF---NGPTGIPGSK---GFEGDKGIRGDIGVKGFQGQHGEIGFPGLKGVSGENG 3806
            C   KC C G KG++G  G  G  G+ G  G  G  G PGP G KG TG  G  G KG RG PGS G+PG  G  G PG  G  G  G+ GC+G +GD       G PG+ G  G  GQPG +G+ GD  ++ I    +KG KG  G+ G                            +G  G KG  GI      +G KG +G  GP G    P  +  G+   Q   G KG+KG+ G++   G P + F+ E    G +G  G  G  G +GEKGL                   GE G+SG  G  G+            G++GLPG  G +G++G +G  GFPG PG+      G+ G  G  GERG KG HG+ G    GP+G  G  GP G         + + C  + G+ G  G+PG  G  G +G +G  GD G+                               G KG++G+                G +G   ++ E G        +G KGESG PG  GA G+ G  G  G +G P    G+   G  G+ G  G+PG++G+    G+ GE+GF G    G  G  G+KG+ GV G VG+ G PG KG+ G                                      G  G  G  G  G  G +G +G  G  G  GS G+ GE G   + G   PG  GEKG QG  G  G+ G  G +G  G  GL+G  G  GE G                      G+PG  G+ GE G     F+G+PG  G KG+ G  G+ G  G        P   +G  GPQ   G SG PG AG       KGE GY G  G+D     GD G  GS G  G TGI G  G PG       +GL G  G KG++G+ G+PG  G  G PG  G   +G KGD G  G PGI    G KG+KG  G  G PG   ET      G KG++GE GE GI G      + G  G  G  G +G  GE G KG+ G   ++G QGL+G  G IG+MG+    GE+G  GI G  G+    GI G  G  G  GLPG                  + G+PG  GD+G+ G  G PGFPG  G  G  G PG                                        +PG +G KG  G +G+PG+ G  G  G  G  G+ G  GE G  G  G  G KG+ GIPG         +G +G  GDIGF G        G  G  G +G +                   + ++G  G KG  G  G+    GP G+PG     G +G+KG RG  G  GFQG  G+ G  G  G +G +G
Sbjct:   27 CGTSKCDCSGVKGQKGERGLPGLPGLMGFPGLQGPEGPPGPLGQKGDTGEPGLPGTKGTRGPPGSHGFPGNPGLPGIPGQDGPPGPSGIPGCNGTKGDRGPLGPPGLPGIIGYPGSPGQPGPKGEPGD--ITGIDVSMIKGEKGFPGINGIPGTPGLPGTPGPMGPIGPPGSAGPPGSHGAPGPKGEMGIS----FYGPKGERGDRGPPGAPCKPSTEPQGSENEQVYYGEKGEKGMPGENGERGQPGQSFKGEKGEPGPLGPRGKPGKDGDQGEKGLQGVPGIPGFPGPPGFGGTKGEKGESGPQGPPGIVVSNGEIEVCEKGDRGLPGFPGSKGDKGLKGAQGFPGIPGSPGVPLPGSTGPPGFPGERGEKGQHGLPGLALQGPKGRDGFPGPPGLPGPPGAIDTSIEC--KSGQPGDPGLPGNPGQNGFQGERGQKGDKGDACPSCDLVPPGLPGPPGPQGPPGDQGASGVPGIKGDRGHPGYDGPPGAPGPQGSAGLMGSPGAKGEPGEVFFEPRLKGDKGESGLPGHPGAPGREGRPGIDGQQGLPGS-KGVA--GTIGAKGEQGLPGDRGSP---GNPGERGFPGPAGTGTSGLPGEKGEPGVPGFVGIPGTPGAKGEPGKAI--------------------------------IKTGPPGPMGGAGIPGFPGDQGEKGSPGHPGRPGSQGEKGEPG---LPGVGYPGPSGEKGFQGMPGTPGQAGFPGPQGVDGLPGLRGDPGPKGEPGLGLPGPKGVQGPPGPVGIPGDKGNPGASGVPGEQG-----FSGVPGHPGHKGEAGIVGVPGIQGPPGVPGMGPKGQQGSSGPQ---GLSGFPGPAGV------KGERGYAGFPGLDMPGPKGDKGNIGSPGPTGATGIPGQPGAPGK------EGLPGFPGPKGEMGVMGMPGSIGQPGAPGSPG--ALGEKGDAGPFGPPGISGYPGTKGEKGEEGLRGEPGKMSETDKETMKGSKGEKGERGEIGISGEKGSLGDFGSPGTPGKDGQQGVQGESGPKGEKGSQGIKGSQGLQGQKGSIGEMGLPGPTGEKGQHGISGSPGSPGLGGIKGEKGLKGEVGLPGIGIPGVPGVKGDAGRDGPH-GLPGERGDKGDVGIPGMPGFPGSKGATGHAGIPGSP-------------------------------------GLPGEKGAKGTHGLVGIPGQKGLTGDSGVQGPPGHSGEKGEPGYDGIPGSPGEKGEAGIPGRGLPGHPGEHGEKGSKGDIGFPG------APGISGVPGIKGDQGLPGFQGPQGPPGFPGPSGIPMEGPKGEKGQPGQAGYPGSPGPVGLPGHTGQDGIKGEKGERGWPGAPGFQGFKGDTGNQGPSGDAGPSG 1298          

HSP 5 Score: 175.637 bits (444), Expect = 2.989e-43
Identity = 219/588 (37.24%), Postives = 272/588 (46.26%), Query Frame = 3
Query:  168 RICTPDKCQCFGNKGRQGFPGPRGYQGVSGDKGDVGQFGMPGP---KGYKGFTGAIGPQGRKGERGIPGSPGYPGKMGEMGFPGIRGDIGEKGLTGCDGQQGDFGNPGMNGLVGRTGQPGERGDDGDRGLSIIPKYGLKGNKGSRGLLGRYGRKGEKGFKGIKGYSGIFGIKGNKGYVGPMGRRGPKGDSLGTVIIQSEKGS-----KGDKGLKGQSGIPCKGFQIEGRMYGRVGSDGPIGDKGIKGEKGLMGEIGQSGIDGARGLNGEKGLPGEAGPRGERGDRGNPGFPGDPGASGADGTRGRQGERGPKGVHGISGADGPRGSRGDKGPSG----SLLSCPGRKGEK------GFFGIPGIKGDIGNKGYQG--------------------HDGDIGEIGFKGEKGY---EGPLGPSCSEVEQGFRGTKGESGFPGLRGAKGQRGYSGNKGIKGKPNFGTGINNPGETGS---------YGNLGVPGEKGNKGFIGDTGEKGFSG-----------------TGKQGPEGPR------GDKGDDGVNGQVGMI---GMPGIK---GDKGSTYPICPFCEKGYKG 1694
             I +P      G  G+ G PG  G  G  G KG++G  GMPG     G  G  GA+G +G  G  G PG  GYPG  GE G  G+RG+ G+   T  +  +G  G  G  G +G +G+ G  GD G  G          G  G +G+ G  G KGEKG +GIKG     G++G KG +G MG  GP G+     I  S         KG+KGLKG+ G+P  G      + G  G DGP G  G +G+KG +G  G  G  G++G  G  G+PG  G  GE+G +G  G  G PG  G  G  G QG  G  G  G  G DG  GS G+KG +G     L   PG  GEK      GF G PGI G  G KG QG                     +G  GE G  G+ GY    GP+G      + G +G KGE G+PG  G +G +G +GN+G  G           G+TG           G+LG+ GEKG++G  G TG KG  G                  G QGP GPR      G KGD GV G  G+    G+PGI    G KG T P  P  + GY G
Sbjct:  846 NIGSPGPTGATGIPGQPGAPGKEGLPGFPGPKGEMGVMGMPGSIGQPGAPGSPGALGEKGDAGPFGPPGISGYPGTKGEKGEEGLRGEPGKMSETDKETMKGSKGEKGERGEIGISGEKGSLGDFGSPGTP--------GKDGQQGVQGESGPKGEKGSQGIKGSQ---GLQGQKGSIGEMGLPGPTGEKGQHGISGSPGSPGLGGIKGEKGLKGEVGLPGIGIPGVPGVKGDAGRDGPHGLPGERGDKGDVGIPGMPGFPGSKGATGHAGIPGSPGLPGEKGAKGTHGLVGIPGQKGLTGDSGVQGPPGHSGEKGEPGYDGIPGSPGEKGEAGIPGRGLPGHPGEHGEKGSKGDIGFPGAPGISGVPGIKGDQGLPGFQGPQGPPGFPGPSGIPMEGPKGEKGQPGQAGYPGSPGPVGLPGHTGQDGIKGEKGERGWPGAPGFQGFKGDTGNQGPSGDAGPSGITGQKGDTGPPGIPGFPGLKGSLGISGEKGDRGDQGITGPKGDLGPPGPAGTHTVTKGESGEPGPQGPSGPRGIQGLPGPKGDKGVTGASGLPGPSGIPGIHGTPGQKGETGPSGPTGQTGYPG 1422          

HSP 6 Score: 169.859 bits (429), Expect = 1.680e-41
Identity = 204/568 (35.92%), Postives = 261/568 (45.95%), Query Frame = 3
Query:  168 RICTPDKCQCFGNKGRQGFPGPRGYQGVSGDKGDVGQFG---MPGPKGYKGFTGAIGPQGRKGERGIPGSPGYPGK---MGEMGFPGIRGDIGEKGLT------------GCDGQQGDFGNPGM-----------NGLVGRTGQPGERGDDGDRGLSIIPKYGLKGNKGSRGLLGRYGRKGEKGFKGIKGYSGIFGIKGNKGYVGPMGRRGPKGDSLGTVIIQSEKGSKGDKGLKGQSGIPCKGFQIEGRMYGRVGSDGPIGDKGIKGEKGLMGEIGQSGIDGARGLNGEKGL------------------PGEAGPRGERGDRGNPGFPGDPGASGADGTRGRQGERGPKGVHGISGADGPRGSRGDKGPSGSLLSCPGRKGEKGFFGIPGIKGDI------------GNKGYQGHDGDIGEIGFKGEKGYEGPLGPSCSEVEQGFRGTKGESGFPGLRGAKGQRGYSGNKGIKGKPNFGTGINNPGETGSYGNLGVPGEKGNKGFIGDTGEKGFSGTGKQGPEGPRGDKGDDGVNGQVGMIGMPGI-------KGDKGSTYPICPF 1673
            ++   DK    G+KG +G    RG  G+SG+KG +G FG    PG  G +G  G  GP+G KG +GI GS G  G+   +GEMG PG  G+ G+ G++            G  G +G+ G PG+            G  G  G PGERGD GD G+  +P  G  G+KG+ G  G  G  G  G KG KG  G+ GI G KG  G  G +GP G S G        G  G  G KG++GIP +G              G  G+ G KG KG +G  G  GI G  G+ G++GL                  P E GP+GE+G  G  G+PG PG  G  G  G+ G +G KG  G  GA G +G +GD G  G         G+ G  GI G KGD             G+ G  G  GD G+ G  G KG  GP GP+ +        TKGESG PG +G  G RG  G  G KG          PG +G  G  G PG+KG  G  G TG+ G+ G             G DG+ G +G+ G P +       +  + +  P CPF
Sbjct:  936 KMSETDKETMKGSKGEKGE---RGEIGISGEKGSLGDFGSPGTPGKDGQQGVQGESGPKGEKGSQGIKGSQGLQGQKGSIGEMGLPGPTGEKGQHGISGSPGSPGLGGIKGEKGLKGEVGLPGIGIPGVPGVKGDAGRDGPHGLPGERGDKGDVGIPGMP--GFPGSKGATGHAGIPGSPGLPGEKGAKGTHGLVGIPGQKGLTGDSGVQGPPGHS-GEKGEPGYDGIPGSPGEKGEAGIPGRGL------------PGHPGEHGEKGSKGDIGFPGAPGISGVPGIKGDQGLPGFQGPQGPPGFPGPSGIPME-GPKGEKGQPGQAGYPGSPGPVGLPGHTGQDGIKGEKGERGWPGAPGFQGFKGDTGNQGP-------SGDAGPSGITGQKGDTGPPGIPGFPGLKGSLGISGEKGDRGDQGITGPKGDLGPPGPAGTHTV-----TKGESGEPGPQGPSGPRGIQGLPGPKGDKGVTGASGLPGPSGIPGIHGTPGQKGETGPSGPTGQTGYPGP-----------PGSDGLPGPIGLPGSPSMAHGFLVTRHSQTTETPQCPF 1461          
BLAST of Collagen IV NC1 domain-containing protein vs. Ensembl Xenopus
Match: COL4A1 (collagen, type IV, alpha 1 [Source:NCBI gene;Acc:100124870])

HSP 1 Score: 439.884 bits (1130), Expect = 1.090e-126
Identity = 621/1837 (33.81%), Postives = 789/1837 (42.95%), Query Frame = 3
Query:  333 QGRKGERGIPGSPGYPGKMGEMGFPGIRGDIGEKGLTGCDGQQGDFGNPGMNGLVGRTGQPGERGDDGDRGLSIIPKYGLKGNKGSRGLLGRYGRKGEKGFKGIKGYSGIFGIKGNKGYVGPMGRRGPKGDSLGTVIIQSEKGSKGDKGLKGQSGIPCKGFQIEGRMYGRVGSDGPIGDKGIKGEKGLMGEIGQSGIDGARGLNGEKGLPGEAGPRGERGDRGNPGFPGDPGASGADGTRGRQGERGPKGVHGISGADGPRGSRGDKGPSGSLLSCPGRKGEKGFFGI---PGIKGDIGNKGYQGHDGDIGEIG------FKGEKGYEGPLGP-----SCSEVEQGFRGTKGESGFPGLRGAKGQRGYSGNKGIKGKPNFGTGINNPGETGSYGNLGVPGEKGNKGFIGDTGEKGFSGTGKQGPEGPRGDKGDDGVNGQVGMIGMPGIKGDKGSTYPICPFCEKGYKGIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEGRMGLLGSKGRQGYKGGKGFSGSMGDAGEIGYVTIS----------------GTTIPGVKGEKGNQGPKGNKGEFGEAGSRGRKGYSGLKGFKG-------LIGERGTSFSSGDPGDKGLRGENGKDGVSFAGIPGEKGLKGD---KGNRGILGDVGSLSNCATRPITSKGFKGPQGAKGTSGSPGSAGKTGIVGNKGENGYPGK-------------------------RGIDGDNGIPGSKGEEGETGIKGHAGRPGNLGKSGLQGLRGEYGVKGDLGIQGIPGRKGVMGDPGPNGYAMIGSKGDKGIKGLPGIYGAKGDKGRPGYIGIPGFKGETGLIGRSGLKGDQGEIGEKGIKGFTFISNNPG--DRGLLGNKGLKGFPGELGNKGQVGVCTVRGDQGLRGYSGLIGDMGMKGEQGSKGIVGDYGAASRSGIMGRTGKIGNQGLPGDQXXXXXXXXXXXXXXXXYIGIPGFEGDRGEKGN---------KGFPGFPGDIGQPGRLGNPGISTEGVXXXXXXXXXXXXXXXXXXXXXXXXXXKQGDSGISIPGRQGIKGEDGTIGLPGEMGEPGPRGDFGQKGNIGITGEFGLQGNRGDDGLKGDDGIPGLNGPRGFIGDIGFVGFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXELGLDGSMGGKGD---NGP------RGFNGPTGIPGSKGFEGDKGIRGDIGV---------KGFQGQHGEIGFPGLKGVSGENGRQXXXXXXXXXXXXXXXXVCMQPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEVGESIRGLQGR---KGSTGLRGNIGIPGERGDKGIPGLQGKVG-----------------------NKGVKGDIGDKGFSGNIG------DKGYSGISGDKGSFGVKGDKGFQGDVGMLGKSGLQGDRGQKGIIGFRGTRG---------IPGSMGLPGEIGEKGDVGPSG----IGVKGLKGYQNAVGIKGRKGEKGLPGFPGRPGKVGDQGDKGPKGMKNMNTXXXXXXXXXXXXXXXXXXXXXXXXXLPGDMGEIGPNGPIGYA-----------------------DNGFLYATHSQSKDFPPCHGGGSPLYNGYSLLAIHGDIDSVTMDLGTPGSCLKNFSTIPFVNCFLERNTFYGGRCHVNMRNSRSYWLSTLQSYMSSPQPPS--KMDDYISRCSVCQTKTTVMAFHSQKSDWQMTKCPYGWQKLWAGFSFPMAVQASRSGSNQPFSSPGSCLKHFRSLPFIECNNHNSNCNHWRDGVSYYMTAVDSENQFVKAQGKVLKSQTDIMNSISKCVVCQRDMN 5351
            +G+KGERG+PG PG       MGF    G  G +G  G  GQ+GD G PG+ G  G  G PG  G  G+ GL  IP        G  G  G  G  G  G KG +G  G  G+ G  GY G  G+ GPKG+  G +        KG+KG  G +GIP                                G  G  G  GA G  GE G+    GP+GERGDRG PG P  P ++   G+   Q   G KG  G+ G +G RG  G         S  G KGE G  G    PG  GD G KG QG  G  G  G       KGEKG  GP GP     S  E+E   +G +G  GFPG +G KG +G  G  GI                   G+ GVP         G TG  GF G         RG+KG  G+ G         ++G KG                                    +   +   G  G  GL G+ G+ G++G +G  G  GDA     +                    + +PG+KG++G+ G  G  G  G  GS G  G  G KG  G       L G++G S   G PG  G  G  G DG    G+PG KG+ G    KG +G+ GD GS  N   R        G  G  G  G PG  G  GI G  G  G PGK                         +G  G  G PGS+GE+GE G+ G  G PG  G+ G QG+ G  G  G  G QG+ G  G+ GDPGP G   +G  G KG++G PG  G  GDKG PG  G+PG +G +G+ G  G KG+ G +G  GI+G   +        +G  G +GL GFPG  G KG+            RGY+G  G + M G +G KG +G  G    +GI G+ G  G +GLPG  G  G  G  G  GS G  G PG  G  GEKG+          G+PG  G+ G+ G  G PG  +E                                   ++ G +G KGE G IG+ GE G     GDFG  G  G  G+ G+QG  G  G KG  GI G  G +G  G IG +G  G  G +G+ G  G  G    G    +           +G+ G  G KGD   +GP      RG  G  GIPG  GF G KG  G  G+         KG +G HG +G PG KG++G++G QG  G  G  G+ G  G+   P                                 E G   RGL G     G  G +G+IG PG  G  G+PG++G  G                        KG KG  G  G+ G+ G        G  GI G+KG  G  G  GFQG  G  G  G  GD G  GI G +G  G         + GS+G+ GE G++GD G +G    +G  G  G          KGE G PG  G  G  G QG  GPKG K +           G+ G  G  G  G  G PG  GE GP+GP G                          +GFL   HSQ+ + P C  G + +Y+GYSLL + G+  +   DLG  GSCL+ FST+PF+ C +         C+   RN  SYWLST +    S  P +   +  +ISRC+VC+    VMA HSQ    Q+ +CP GW  LW G+SF M   A   GS Q  +SPGSCL+ FRS+PFIEC+   + CN++ +  S+++  ++    F K     LK+  D+   +S+C VC R  +
Sbjct:   38 KGQKGERGLPGLPGL------MGF---PGLQGPEGPPGPLGQKGDTGEPGLPGTKGTRGPPGSHGFPGNPGLPGIP--------GQDGPPGPSGIPGCNGTKGDRGPLGPPGLPGIIGYPGSPGQPGPKGEP-GDITGIDVSMIKGEKGFPGINGIPGTPGLPGTPGPMGPIGP--------------PGSAGPPGSHGAPGPKGEMGI-SFYGPKGERGDRGPPGAPCKP-STEPQGSENEQVYYGEKGEKGMPGENGERGQPGQ--------SFKGEKGEPGPLGPRGKPGKDGDQGEKGLQGVPGIPGFPGPPGFGGTKGEKGESGPQGPPGIVVSNGEIEVCEKGDRGLPGFPGSKGDKGLKGAQGFPGIP------------------GSPGVP-------LPGSTGPPGFPGE--------RGEKGQHGLPGLA-------LQGPKGRDG-------------------FPGPPGLPGPPGAIDTSIECKSGQPGDPGLPGNPGQNGFQGERGQKGDKGDACPSCDLVPPGLPGPPGPQGPPGDQGASGVPGIKGDRGHPGYDGPPGAPGPQGSAGLMGSPGAKGEPGEVFFEPRLKGDKGESGLPGHPGAPGREGRPGIDGQQ--GLPGSKGVAGTIGAKGEQGLPGDRGSPGNPGERGFPGPAGTGTSGLPGEKGEPGVPGFVGIPGTPGAKGEPGKAIIKTGPPGPMGGAGIPGFPGDQGEKGSPGHPGRPGSQGEKGEPGLPG-VGYPGPSGEKGFQGMPGTPGQAGFPGPQGVDGLPGLRGDPGPKGEPGLGLPGPKGVQGPPGPVGIPGDKGNPGASGVPGEQGFSGVPGHPGHKGEAGIVGVPGIQGPPGVPGMGPKGQQGSSGPQGLSGFPGPAGVKGE------------RGYAGFPG-LDMPGPKGDKGNIGSPGPTGATGIPGQPGAPGKEGLPGFPGPKGEMGVMGMPGSIGQPGAPGSPGALGEKGDAGPFGPPGISGYPGTKGEKGEEGLRGEPGKMSE-------------------------------TDKETMKGSKGEKGERGEIGISGEKGS---LGDFGSPGTPGKDGQQGVQGESGPKGEKGSQGIKGSQGLQGQKGSIGEMGLPGPTGEKGQHGISGSPGSPGLGGIKGEKGLKGEVGLPGIGIPGVPGVKGDAGRDGPHGLPGERGDKGDVGIPGMPGFPGSKGATGHAGIPGSPGLPGEKGAKGTHGLVGIPGQKGLTGDSGVQGPPGHSGEKGEPGYDGIPGSPGEKG-----------------------------EAGIPGRGLPGHPGEHGEKGSKGDIGFPGAPGISGVPGIKGDQGLPGFQGPQGPPGFPGPSGIPMEGPKGEKGQPGQAGYPGSPGPVGLPGHTGQDGIKGEKGERGWPGAPGFQGFKGDTGNQGPSGDAGPSGITGQKGDTGPPGIPGFPGLKGSLGISGEKGDRGDQGITGPKGDLGPPGPAGTHTVT-----KGESGEPGPQGPSGPRGIQGLPGPKGDKGVT----------GASGLPGPSGIPGIHGTPGQKGETGPSGPTGQTGYPGPPGSDGLPGPIGLPGSPSMAHGFLVTRHSQTTETPQCPFGTTAVYSGYSLLYVQGNERAHGQDLGASGSCLRKFSTMPFLFCNINN------VCNFASRNDYSYWLSTPEPMPMSMAPITGDGIKPFISRCTVCEVPAMVMAVHSQT--IQIPQCPDGWISLWIGYSFVMQTSAGAEGSGQALASPGSCLEEFRSVPFIECHGRGT-CNYYANTYSFWLATIEKNEMFKKPTPSTLKA-GDLRTHVSRCQVCMRRTS 1669          

HSP 2 Score: 280.796 bits (717), Expect = 1.572e-75
Identity = 454/1338 (33.93%), Postives = 567/1338 (42.38%), Query Frame = 3
Query:  216 QGFPGPRGYQGVS--GDKGDVGQFGMPG--------PKG------YKGFTGAIGPQGRKGERGIPGSP-----GYPGKMGEMGFPGIRGDIGEKGLTG---------------CDGQQGDFGNPGMNGLVGRTGQPGERGDDGDRGLSIIPKYGLKGNKGSRGLLGRYGRKGEKGF-----KGIKGYSGIFGIKGNKGYVGPMGRRGPKGDSLGT-------------VIIQSEKGSKGDKGLKGQSGIPCKGFQIEGRMYGRVGSDGPIGD------------------------KGIKGEKGLMGEIGQSGID------GARGLNGEKGLPGEA--GPR--GERGDRGNPGFPGDPGASGADGTRGRQGERGPKGVHGISGADGPRGSRGDKGPSGSLLSCPGRKGEKGFFGIPGIKGDIGNKGYQGHDGDIGEIGFKGEKGYEGPLGPSCSEVEQGFRGTKGESG-FPGLRGAKGQRGYSG---NKGIKGKPNFGTGINNPGETGSYGNLGVPGEKGNKGFIG------------DTGEKGFSGTGKQGPEG------------PRGDKGDDGVNGQVGMIGMPGIKGDKGSTYPICPFCEKGYKGIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEGRMGLLGSKGRQGYKGGKGFSGSMGDAGEIGYVTISGTTIPGVKGEKGN---QGPKGNKGEFGEAGSRGRKGYSGLKGFKGLIGERGTSFSSGDPGDKGLRGENGKDGVS----FAGIPGEKGLKGDKGNRGILGDVGSLSNCATRPITSKGFKGPQGAKGTSGSPGSAGKTGIVGNKGENGYPGKRGIDGDNGIPGSKGEEGETGIKGHAGRPGNLGKSGLQGLRGEYGVKGDLGI------------QGIPGRKGVMGDPGPNGYAMIGSKGDKGIKGLPGIYGAKGDKGRPGYIGIPGFKGETGLIGRSGLKGDQGEIGEKGIKGFTFISNNPGDRGLLGNKGLKGFPGELGNKGQVGVCTVRGDQGLRGYSGLIGD--MGMKGEQGSKGIVGDYGAASRSGIMGRTGKIGNQGLPGDQXXXXXXXXXXXXXXXXYIGIPGFEGDRGEKGNKGFPGFPGDIGQPGRLGNPGISTEGVXXXXXXXXXXXXXXXXXXXXXXXXXXKQGDSGIS-IPGRQGIKGEDGTIGLPGEMGEPGPRGDFGQKGNI---GITGEFGLQGNRGDDGLKGDDGIPGLNGPRGFIGDIGFVGFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXELGLDGSMGGKGDNGPRGFNGPTGIPGSKGFEGDKGIRGDIGVKGFQGQHGEIGFPGLKGVSGENG 3806
             G PGP+G  G+S  G KG+ G  G PG        P+G      Y G  G  G  G  GERG PG       G PG +G  G PG  GD GEKGL G                 G++G+ G  G  G+V   G+  E  + GDRGL   P  G KG+KG +G  G  G  G  G       G  G+ G  G KG  G  G +  +GPKG                    I+ + G  GD GL G  G    GFQ E    G  G   P  D                         GIKG++G  G  G  G        G  G  G KG PGE    PR  G++G+ G PG PG PG  G  G  G+QG  G KGV G  GA G +G  GD+G        PG  GE+GF G P   G  G  G +G  G  G +G  G  G +G  G +  +              FPG +G KG  G+ G   ++G KG+P    G+  PG +G  G  G+PG  G  GF G            D G KG  G G  GP+G             +G+ G  GV G+ G  G+PG  G KG    +      G  GIQG                               MG  G +G  G +G  GF G  G  GE GY    G  +PG KG+KGN    GP G  G  G+ G+ G++G  G  G KG +G  G   S G PG  G  G  G+ G +      GI G  G KG+KG  G+ G+ G +S         +  KG +G KG  G  G +G+ G +G+ G  G PGK G  G  G  G KGE+G  GIKG  G  G  G  G  GL G  G KG  GI            +G  G KG +G PG     + G KGD G  G  G+ G +GDKG  G  G+PGF G  G  G +G+ G  G  GEKG KG   +   PG +GL G+ G++G PG  G KG+ G   + G  G +G +G+ G    G  GE G KG  GD G     GI G  G  G+QGL                     I + G +G++G+ G  G+PG PG +G PG  G  GI  E                             +G+ G    PG QG KG+ G     G  G+ GP G  GQKG+    GI G  GL+G+ G  G KGD G  G+ GP+G +G  G  G                                            + G  G+ GP+G +GP GI G  G +GDKG+ G  G+ G  G  G  G PG KG +G +G
Sbjct:  203 HGAPGPKGEMGISFYGPKGERGDRGPPGAPCKPSTEPQGSENEQVYYGEKGEKGMPGENGERGQPGQSFKGEKGEPGPLGPRGKPGKDGDQGEKGLQGVPGIPGFPGPPGFGGTKGEKGESGPQGPPGIVVSNGE-IEVCEKGDRGLPGFP--GSKGDKGLKGAQGFPGIPGSPGVPLPGSTGPPGFPGERGEKGQHGLPG-LALQGPKGRDGFPGPPGLPGPPGAIDTSIECKSGQPGDPGLPGNPGQ--NGFQGERGQKGDKGDACPSCDLVPPGLPGPPGPQGPPGDQGASGVPGIKGDRGHPGYDGPPGAPGPQGSAGLMGSPGAKGEPGEVFFEPRLKGDKGESGLPGHPGAPGREGRPGIDGQQGLPGSKGVAGTIGAKGEQGLPGDRG-------SPGNPGERGFPG-PAGTGTSGLPGEKGEPGVPGFVGIPGTPGAKGEPGKAIIKTGPPGPMGGAGIPGFPGDQGEKGSPGHPGRPGSQGEKGEPGL-PGVGYPGPSGEKGFQGMPGTPGQAGFPGPQGVDGLPGLRGDPGPKGEPGLGLPGPKGVQGPPGPVGIPGDKGNPGASGVPGEQGFSGVPGHPGHKGEAGIV------GVPGIQGPP-------------------------GVPGMGPKGQQGSSGPQGLSGFPGPAGVKGERGYAGFPGLDMPGPKGDKGNIGSPGPTGATGIPGQPGAPGKEGLPGFPGPKGEMGVMGMPGSIGQPGAPGSPGALGEKGDAGPFGPPGISGYPGTKGEKGEEGLRGEPGKMSE-----TDKETMKGSKGEKGERGEIGISGEKGSLGDFGSPGTPGKDGQQGVQGESGPKGEKGSQGIKGSQGLQGQKGSIGEMGLPGPTGEKGQHGISGSPGSPGLGGIKGEKGLKGEVGLPGIGIPGVPGVKGDAGRDGPHGLPGERGDKGDVGIPGMPGFPGSKGATGHAGIPGSPGLPGEKGAKGTHGLVGIPGQKGLTGDSGVQGPPGHSGEKGEPGYDGIPGSPGEKGEAGIPGRGLPGHPGEHGEKGSKGDIGFPGAPGISGVPGIKGDQGL----PGFQGPQGPPGFPGPSGIPMEGPKGEKGQPGQAGYPGSPGPVGLPGHTGQDGIKGE-----------------------------KGERGWPGAPGFQGFKGDTGNQ---GPSGDAGPSGITGQKGDTGPPGIPGFPGLKGSLGISGEKGDRGDQGITGPKGDLGPPGPAGTHTV----------------------------------------TKGESGEPGPQGPSGPRGIQGLPGPKGDKGVTGASGLPGPSGIPGIHGTPGQKGETGPSG 1413          

HSP 3 Score: 278.1 bits (710), Expect = 1.066e-74
Identity = 399/1153 (34.61%), Postives = 507/1153 (43.97%), Query Frame = 3
Query:  201 GNKGRQGFPGPRGYQGVSGDKGDVGQFGMPGPKGYKGFTGAIG-----PQGR--------------------KGERGIPGSPGYPGKMGEMGFPGIRGDIGEKG--LTGCD----------------GQQGDFGNPGMNG------------------LVGRTGQPGERGDDGDRGLSIIPKYGLKGNKGSRGLLGRYGRKGEKGFKGIKGYSGIFGIKGNKGYVGPMGRRGPKGDSLGTVIIQSEKGSKGDKGLKGQSGIPCKGFQIEGRMYGRVGSDGPIGDKGIKGEKGLMGEIGQSGIDGAR-------------GLNGEKGLPGEAGPRGERGDRGNPGFPGD--PGASGADGTRGRQGERGPKGVHGISGADGPRGSRGDKGPSGSL-LSCPGRKG------------EKGFFGIPGIKGDIGNKGYQGHDGDIGEIGFKGEKGYEGPLGPSCSEV--EQGFRGTKGESGFPGLRGAKGQRGYSGNKGIKGKPNFGTGINNPGETGSYGNLGVPGEKGNKGFIGDTGEKGFSG-TGKQGPEGPRGDKGDDGVNGQVGMIGMPGIKGDKGSTYPICPFCEKGYKGIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEGRMGLLGSKGRQGYKGGKGFSGSMGDAGEIGYVTISGTT-------IPGVKGEKGNQGPKGNKGEFGEAGSRGRKGYSGLKGFKGLIGERGTSFSSGDPG------------------DKGLRGENGKDGVSFAGIPGEKGLKGDKGNRGILGDVGSLSNCATRPITSKGFKGPQGAKGTSGSPGSAGKTGIVGNKGENGY---PGKRGIDGDNGI---PGSKGEEGETGIKGHAGRPGNLGKSG-----LQGLRGEYGVKGDLGIQGIPGRKGVMGDPGPNGYAMIGSKGDKGIKG---------------LPGIYGAKGDKGRPGYIGIPGFKGETGL---IGRSGLKGDQGEIGEKGIKGFTFISNNPGDRGLLGNKGLKGFPGELGN------------KGQVGVCTVRGDQGLRGYSGLIGDMGMKGEQGSKGIVGDYGAASRSGIMGRTGKIGNQGLPGDQXXXXXXXXXXXXXXXXYIGIPGFEGDRGEK---------GNKGFPGFPGDIGQPGRLGNPGIST 3158
            G KG QGFPG  G  GV    G  G  G PG +G KG  G  G     P+GR                    + + G PG PG PG  G+ GF G RG  G+KG     CD                G QG  G PG+ G                    G  G PG +G+ G+  +   P+  LKG+KG  GL G  G  G +G  GI G  G+ G KG  G +G  G +G  GD       +   G+ G++G  G +G    G      + G  G  G  G  GI G  G  GE G++ I                 G  GEKG PG  G  G +G++G PG PG   PG SG  G +G  G  G  G  G  G DG  G RGD GP G   L  PG KG            +KG  G  G+ G+ G  G  GH G  GE G  G  G +GP G        +QG  G +G SGFPG  G KG+RGY+G            G++ PG  G  GN+G PG  G  G  G  G  G  G  G  GP+G  G  G  G  GQ G  G PG  G+KG   P  P    GY G +G                           ++G  GL G  G+      +   GS G+ GE G + ISG          PG  G+ G QG +G  G  GE GS+G KG  GL+G KG IGE G    +G+ G                  +KGL+GE G  G+   G+PG KG  G  G  G+ G+ G   +     +   GF G +GA G +G PGS G  G  G KG +G    PG++G+ GD+G+   PG  GE+GE G  G  G PG  G++G     L G  GE+G KG  G  G PG  G+ G PG         KGD+G+ G               +P + G KG+KG+PG  G PG  G  GL    G+ G+KG++GE G  G  GF     + G++G  G+ G  G  G+ G+            KG +G+   +GD+G +G +G  GD+G  G  G+  +    G +   G  G +G  G QGLPG +G  G  G  G  G     GIPG  G  G+K         G  G+PG PG  G PG +G PG  +
Sbjct:  359 GLKGAQGFPGIPGSPGVP-LPGSTGPPGFPGERGEKGQHGLPGLALQGPKGRDGFPGPPGLPGPPGAIDTSIECKSGQPGDPGLPGNPGQNGFQGERGQKGDKGDACPSCDLVPPGLPGPPGPQGPPGDQGASGVPGIKGDRGHPGYDGPPGAPGPQGSAGLMGSPGAKGEPGE--VFFEPR--LKGDKGESGLPGHPGAPGREGRPGIDGQQGLPGSKGVAGTIGAKGEQGLPGD-------RGSPGNPGERGFPGPAGTGTSG------LPGEKGEPGVPGFVGIPGTPGAKGEPGKAIIKTGPPGPMGGAGIPGFPGDQGEKGSPGHPGRPGSQGEKGEPGLPGVGYPGPSGEKGFQGMPGTPGQAGFPGPQGVDGLPGLRGDPGPKGEPGLGLPGPKGVQGPPGPVGIPGDKGNPGASGVPGEQGFSGVPGHPGHKGEAGIVGVPGIQGPPGVPGMGPKGQQGSSGPQGLSGFPGPAGVKGERGYAGF----------PGLDMPGPKGDKGNIGSPGPTGATGIPGQPGAPGKEGLPGFPGPKGEMGVMGMPGSIGQPGAPGSPGALGEKGDAGPFGPPGISGYPGTKG---------------------------EKGEEGLRGEPGKMSETDKETMKGSKGEKGERGEIGISGEKGSLGDFGSPGTPGKDGQQGVQGESGPKGEKGSQGIKGSQGLQGQKGSIGEMGLPGPTGEKGQHGISGSPGSPGLGGIKGEKGLKGEVGLPGIGIPGVPGVKGDAGRDGPHGLPGERGDKGDVGIPGMP--GFPGSKGATGHAGIPGSPGLPGEKGAKGTHGLVGIPGQKGLTGDSGVQGPPGHSGEKGEPGYDGIPGSPGEKGEAGIPGRGLPGHPGEHGEKGSKGDIGFPGAPGISGVPG--------IKGDQGLPGFQGPQGPPGFPGPSGIP-MEGPKGEKGQPGQAGYPGSPGPVGLPGHTGQDGIKGEKGERGWPGAPGFQGFKGDTGNQGPSGDAGPSGITGQKGDTGPPGIPGFPGLKGSLGISGEKGDRGDQGITGPKGDLGPPGPAGTHTVT--KGESGEPGPQGPSGPRGIQGLPGPKGDKGVTGASGLPGPS---GIPGIHGTPGQKGETGPSGPTGQTGYPGPPGSDGLPGPIGLPGSPS 1440          

HSP 4 Score: 259.996 bits (663), Expect = 4.640e-69
Identity = 467/1387 (33.67%), Postives = 594/1387 (42.83%), Query Frame = 3
Query:  174 CTPDKCQCFGNKGRQGFPGPRGYQGVSGDKGDVGQFGMPGPKGYKGFTGAIGPQGRKGERGIPGSPGYPGKMGEMGFPGIRGDIGEKGLTGCDGQQGD------FGNPGMNGLVGRTGQPGERGDDGDRGLSIIPKYGLKGNKGSRGLLG---------------------------RYGRKGEKGFKGIKGYSGIFGIKGNKGYVGPMGRR-GPKGDSLGTVIIQSEKGSKGDKGLKGQS---GIPCKGFQIEGRMYGRVGSDGPIGDKGIKGEKGLM------------------GEIGQSGIDGARGL-----------NGEKGLPGEAGPRGERGDRGNPGFPGDPGA-----SGADGTRGRQGERGPKGVHGISG--ADGPRGSRGDKGPSG---------SLLSCPGRKGEKGFFGIPGIKGDIGNKGYQGHDGDIGEI------------------------------GFKGEKGY---------------EGPLGPSCSEVEQG-------FRGTKGESGFPGLRGAKGQRGYSGNKGIKGKPNFGTGINNPGETGSYGNLGVPGEKGNKGFIGDTGEKGFSGTGKQGPEGPRGDKGDDGVNGQVGMIGMPGIKGDKGSTYPICPFCEKGYKGIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEGRMGLLGSKGRQGYKGGKGFSGSMGDAGEIGYVTISGTTIPGVKGEKGNQGPKGNKGEFGEAGSRGRKGYSGLKGFKGLIGERGTSFS-----------------SGDPGDKGLRGENGKDGVSFAGIPGEKGLKGDKGNRGILGDVGSLSNCATRPITSKGFKGPQGAKGTSGSPGSAGKTGIVGNKGENGYPGKRGID-----GDNGIPGSKGEEGETGIKGHAGRPGNLGKSGLQGLRGEYGVKGDLGIQGIPGRKGVMGDPGPNGYAMIGSKGDKGIKGLPGIY---GAKGDKGRPGYIGIPGFKGETGLIGRSGLKGDQGEIGEKGIKGFTFISNNPGDRGLLGNKGLKGFPGELGNKGQVGVCTVRGDQGLRGYSGLIGDMGM---KGEQGSKGIVGDYGAASRSGIMGRTGKIGNQGLPGDQXXXXXXXXXXXXXXXXYIGIPGFEGDRGEKGNKGFPGFPGDIGQPGRLGNPGISTEGVXXXXXXXXXXXXXXXXXXXXXXXXXXKQGDSGISIPGRQGIKGEDGTIGLPGEMGEPGPRGDFGQKGNIGITGEFGLQGNRGDDGLKGDDGIPGL--------NGPRGFIGDIGFVGFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXELGLDGSMGGKGDNGPRGF---NGPTGIPGSK---GFEGDKGIRGDIGVKGFQGQHGEIGFPGLKGVSGENG 3806
            C   KC C G KG++G  G  G  G+ G  G  G  G PGP G KG TG  G  G KG RG PGS G+PG  G  G PG  G  G  G+ GC+G +GD       G PG+ G  G  GQPG +G+ GD  ++ I    +KG KG  G+ G                            +G  G KG  GI      +G KG +G  GP G    P  +  G+   Q   G KG+KG+ G++   G P + F+ E    G +G  G  G  G +GEKGL                   GE G+SG  G  G+            G++GLPG  G +G++G +G  GFPG PG+      G+ G  G  GERG KG HG+ G    GP+G  G  GP G         + + C  + G+ G  G+PG  G  G +G +G  GD G+                               G KG++G+                G +G   ++ E G        +G KGESG PG  GA G+ G  G  G +G P    G+   G  G+ G  G+PG++G+    G+ GE+GF G    G  G  G+KG+ GV G VG+ G PG KG+ G                                      G  G  G  G  G  G +G +G  G  G  GS G+ GE G   + G   PG  GEKG QG  G  G+ G  G +G  G  GL+G  G  GE G                      G+PG  G+ GE G     F+G+PG  G KG+ G  G+ G  G        P   +G  GPQ   G SG PG AG       KGE GY G  G+D     GD G  GS G  G TGI G  G PG       +GL G  G KG++G+ G+PG  G  G PG  G   +G KGD G  G PGI    G KG+KG  G  G PG   ET      G KG++GE GE GI G      + G  G  G  G +G  GE G KG+ G   ++G QGL+G  G IG+MG+    GE+G  GI G  G+    GI G  G  G  GLPG                  + G+PG  GD+G+ G  G PGFPG  G  G  G PG                                        +PG +G KG  G +G+PG+ G  G  G  G  G+ G  GE G  G  G  G KG+ GIPG         +G +G  GDIGF G        G  G  G +G +                   + ++G  G KG  G  G+    GP G+PG     G +G+KG RG  G  GFQG  G+ G  G  G +G +G
Sbjct:   27 CGTSKCDCSGVKGQKGERGLPGLPGLMGFPGLQGPEGPPGPLGQKGDTGEPGLPGTKGTRGPPGSHGFPGNPGLPGIPGQDGPPGPSGIPGCNGTKGDRGPLGPPGLPGIIGYPGSPGQPGPKGEPGD--ITGIDVSMIKGEKGFPGINGIPGTPGLPGTPGPMGPIGPPGSAGPPGSHGAPGPKGEMGIS----FYGPKGERGDRGPPGAPCKPSTEPQGSENEQVYYGEKGEKGMPGENGERGQPGQSFKGEKGEPGPLGPRGKPGKDGDQGEKGLQGVPGIPGFPGPPGFGGTKGEKGESGPQGPPGIVVSNGEIEVCEKGDRGLPGFPGSKGDKGLKGAQGFPGIPGSPGVPLPGSTGPPGFPGERGEKGQHGLPGLALQGPKGRDGFPGPPGLPGPPGAIDTSIEC--KSGQPGDPGLPGNPGQNGFQGERGQKGDKGDACPSCDLVPPGLPGPPGPQGPPGDQGASGVPGIKGDRGHPGYDGPPGAPGPQGSAGLMGSPGAKGEPGEVFFEPRLKGDKGESGLPGHPGAPGREGRPGIDGQQGLPGS-KGVA--GTIGAKGEQGLPGDRGSP---GNPGERGFPGPAGTGTSGLPGEKGEPGVPGFVGIPGTPGAKGEPGKAI--------------------------------IKTGPPGPMGGAGIPGFPGDQGEKGSPGHPGRPGSQGEKGEPG---LPGVGYPGPSGEKGFQGMPGTPGQAGFPGPQGVDGLPGLRGDPGPKGEPGLGLPGPKGVQGPPGPVGIPGDKGNPGASGVPGEQG-----FSGVPGHPGHKGEAGIVGVPGIQGPPGVPGMGPKGQQGSSGPQ---GLSGFPGPAGV------KGERGYAGFPGLDMPGPKGDKGNIGSPGPTGATGIPGQPGAPGK------EGLPGFPGPKGEMGVMGMPGSIGQPGAPGSPG--ALGEKGDAGPFGPPGISGYPGTKGEKGEEGLRGEPGKMSETDKETMKGSKGEKGERGEIGISGEKGSLGDFGSPGTPGKDGQQGVQGESGPKGEKGSQGIKGSQGLQGQKGSIGEMGLPGPTGEKGQHGISGSPGSPGLGGIKGEKGLKGEVGLPGIGIPGVPGVKGDAGRDGPH-GLPGERGDKGDVGIPGMPGFPGSKGATGHAGIPGSP-------------------------------------GLPGEKGAKGTHGLVGIPGQKGLTGDSGVQGPPGHSGEKGEPGYDGIPGSPGEKGEAGIPGRGLPGHPGEHGEKGSKGDIGFPG------APGISGVPGIKGDQGLPGFQGPQGPPGFPGPSGIPMEGPKGEKGQPGQAGYPGSPGPVGLPGHTGQDGIKGEKGERGWPGAPGFQGFKGDTGNQGPSGDAGPSG 1298          

HSP 5 Score: 175.637 bits (444), Expect = 2.989e-43
Identity = 219/588 (37.24%), Postives = 272/588 (46.26%), Query Frame = 3
Query:  168 RICTPDKCQCFGNKGRQGFPGPRGYQGVSGDKGDVGQFGMPGP---KGYKGFTGAIGPQGRKGERGIPGSPGYPGKMGEMGFPGIRGDIGEKGLTGCDGQQGDFGNPGMNGLVGRTGQPGERGDDGDRGLSIIPKYGLKGNKGSRGLLGRYGRKGEKGFKGIKGYSGIFGIKGNKGYVGPMGRRGPKGDSLGTVIIQSEKGS-----KGDKGLKGQSGIPCKGFQIEGRMYGRVGSDGPIGDKGIKGEKGLMGEIGQSGIDGARGLNGEKGLPGEAGPRGERGDRGNPGFPGDPGASGADGTRGRQGERGPKGVHGISGADGPRGSRGDKGPSG----SLLSCPGRKGEK------GFFGIPGIKGDIGNKGYQG--------------------HDGDIGEIGFKGEKGY---EGPLGPSCSEVEQGFRGTKGESGFPGLRGAKGQRGYSGNKGIKGKPNFGTGINNPGETGS---------YGNLGVPGEKGNKGFIGDTGEKGFSG-----------------TGKQGPEGPR------GDKGDDGVNGQVGMI---GMPGIK---GDKGSTYPICPFCEKGYKG 1694
             I +P      G  G+ G PG  G  G  G KG++G  GMPG     G  G  GA+G +G  G  G PG  GYPG  GE G  G+RG+ G+   T  +  +G  G  G  G +G +G+ G  GD G  G          G  G +G+ G  G KGEKG +GIKG     G++G KG +G MG  GP G+     I  S         KG+KGLKG+ G+P  G      + G  G DGP G  G +G+KG +G  G  G  G++G  G  G+PG  G  GE+G +G  G  G PG  G  G  G QG  G  G  G  G DG  GS G+KG +G     L   PG  GEK      GF G PGI G  G KG QG                     +G  GE G  G+ GY    GP+G      + G +G KGE G+PG  G +G +G +GN+G  G           G+TG           G+LG+ GEKG++G  G TG KG  G                  G QGP GPR      G KGD GV G  G+    G+PGI    G KG T P  P  + GY G
Sbjct:  846 NIGSPGPTGATGIPGQPGAPGKEGLPGFPGPKGEMGVMGMPGSIGQPGAPGSPGALGEKGDAGPFGPPGISGYPGTKGEKGEEGLRGEPGKMSETDKETMKGSKGEKGERGEIGISGEKGSLGDFGSPGTP--------GKDGQQGVQGESGPKGEKGSQGIKGSQ---GLQGQKGSIGEMGLPGPTGEKGQHGISGSPGSPGLGGIKGEKGLKGEVGLPGIGIPGVPGVKGDAGRDGPHGLPGERGDKGDVGIPGMPGFPGSKGATGHAGIPGSPGLPGEKGAKGTHGLVGIPGQKGLTGDSGVQGPPGHSGEKGEPGYDGIPGSPGEKGEAGIPGRGLPGHPGEHGEKGSKGDIGFPGAPGISGVPGIKGDQGLPGFQGPQGPPGFPGPSGIPMEGPKGEKGQPGQAGYPGSPGPVGLPGHTGQDGIKGEKGERGWPGAPGFQGFKGDTGNQGPSGDAGPSGITGQKGDTGPPGIPGFPGLKGSLGISGEKGDRGDQGITGPKGDLGPPGPAGTHTVTKGESGEPGPQGPSGPRGIQGLPGPKGDKGVTGASGLPGPSGIPGIHGTPGQKGETGPSGPTGQTGYPG 1422          

HSP 6 Score: 169.859 bits (429), Expect = 1.680e-41
Identity = 204/568 (35.92%), Postives = 261/568 (45.95%), Query Frame = 3
Query:  168 RICTPDKCQCFGNKGRQGFPGPRGYQGVSGDKGDVGQFG---MPGPKGYKGFTGAIGPQGRKGERGIPGSPGYPGK---MGEMGFPGIRGDIGEKGLT------------GCDGQQGDFGNPGM-----------NGLVGRTGQPGERGDDGDRGLSIIPKYGLKGNKGSRGLLGRYGRKGEKGFKGIKGYSGIFGIKGNKGYVGPMGRRGPKGDSLGTVIIQSEKGSKGDKGLKGQSGIPCKGFQIEGRMYGRVGSDGPIGDKGIKGEKGLMGEIGQSGIDGARGLNGEKGL------------------PGEAGPRGERGDRGNPGFPGDPGASGADGTRGRQGERGPKGVHGISGADGPRGSRGDKGPSGSLLSCPGRKGEKGFFGIPGIKGDI------------GNKGYQGHDGDIGEIGFKGEKGYEGPLGPSCSEVEQGFRGTKGESGFPGLRGAKGQRGYSGNKGIKGKPNFGTGINNPGETGSYGNLGVPGEKGNKGFIGDTGEKGFSGTGKQGPEGPRGDKGDDGVNGQVGMIGMPGI-------KGDKGSTYPICPF 1673
            ++   DK    G+KG +G    RG  G+SG+KG +G FG    PG  G +G  G  GP+G KG +GI GS G  G+   +GEMG PG  G+ G+ G++            G  G +G+ G PG+            G  G  G PGERGD GD G+  +P  G  G+KG+ G  G  G  G  G KG KG  G+ GI G KG  G  G +GP G S G        G  G  G KG++GIP +G              G  G+ G KG KG +G  G  GI G  G+ G++GL                  P E GP+GE+G  G  G+PG PG  G  G  G+ G +G KG  G  GA G +G +GD G  G         G+ G  GI G KGD             G+ G  G  GD G+ G  G KG  GP GP+ +        TKGESG PG +G  G RG  G  G KG          PG +G  G  G PG+KG  G  G TG+ G+ G             G DG+ G +G+ G P +       +  + +  P CPF
Sbjct:  936 KMSETDKETMKGSKGEKGE---RGEIGISGEKGSLGDFGSPGTPGKDGQQGVQGESGPKGEKGSQGIKGSQGLQGQKGSIGEMGLPGPTGEKGQHGISGSPGSPGLGGIKGEKGLKGEVGLPGIGIPGVPGVKGDAGRDGPHGLPGERGDKGDVGIPGMP--GFPGSKGATGHAGIPGSPGLPGEKGAKGTHGLVGIPGQKGLTGDSGVQGPPGHS-GEKGEPGYDGIPGSPGEKGEAGIPGRGL------------PGHPGEHGEKGSKGDIGFPGAPGISGVPGIKGDQGLPGFQGPQGPPGFPGPSGIPME-GPKGEKGQPGQAGYPGSPGPVGLPGHTGQDGIKGEKGERGWPGAPGFQGFKGDTGNQGP-------SGDAGPSGITGQKGDTGPPGIPGFPGLKGSLGISGEKGDRGDQGITGPKGDLGPPGPAGTHTV-----TKGESGEPGPQGPSGPRGIQGLPGPKGDKGVTGASGLPGPSGIPGIHGTPGQKGETGPSGPTGQTGYPGP-----------PGSDGLPGPIGLPGSPSMAHGFLVTRHSQTTETPQCPF 1461          
BLAST of Collagen IV NC1 domain-containing protein vs. Ensembl Xenopus
Match: COL4A5 (collagen, type IV, alpha 5 [Source:NCBI gene;Acc:100492984])

HSP 1 Score: 309.301 bits (791), Expect = 4.041e-85
Identity = 420/1305 (32.18%), Postives = 539/1305 (41.30%), Query Frame = 3
Query: 1902 TTIPGVKGEKGNQGPKGNKGEFGEAGSRGRKGYS-------GLKGFKGLIGERGTSFSSGDPGDKGLRGENGKDGVSFAG-------IPGEKGLKGDKGNRGILGDVGSLSNCATRPITSKGFKGPQGAKGTSGSPGSAGKTGIVGNKGENG---YPGKRGIDGDNGIPGSKGEEG--------------ETGIKGHAGRPGNLGKSGLQGLRGEYGV-KGDLGI---------QGIPGRKGVMGDPGPNGYAMIGSKGDKGIKGLPGIYGAKGDKGRPGYIGIPGFKGETGLIGRSGLKGDQGEIGEKGIKGFTFISNNPGDRGLLGNKGLKGFPGELGNKGQVGVCTVRGDQGLRGYSGLIGDMGMKGEQGS--------------------------------------KGIVGDYGAASRSGIMGRTGKIGNQGLPGDQXXXXXXXXXXXXXXXXYIGIPGFEGDRGEKGNKGFPGFPGDIGQPGRLGNPGISTEGVXXXXXXXXXXXXXXXXXXXXXXXXXXKQGDSGIS-IPGRQGIKGEDGTIGLPGEMGEPGPRGDFGQKGNIGITGEFGLQGNRGDDGLKGDDGIPGLNGPRGFIGDIGFVGFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXELGLDGSMGGKGDNGPRGFNGPTGIPGSKGFEGDKGIRGDIGVKGFQGQHGE-----IGFPGLKGVSGENGRQXXXXXXXXXXXXXXXXVCMQPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEVGESIR-GLQGRKGSTGLRGNIGIPGERGDKGIPGLQG-----KVGNKGVKGDIGDKGFSGNIGDKGYSGISGDKGSFGVKGDKGFQGDVGMLGK---------------------------------------------SGLQGDRGQKGIIGFRGTRGIPGSMGLPGEIGEKGDVG--------------------PSGIGVKGLKGYQNAVGIKGRKGEKGLPGFPGRPGKVGDQGDKGPKGMKNMNTXXXXXXXXXXXXXXXXXXXXXXXXXLPGDMGEIGPNGPIGYADNGFLYATHSQSKDFPPCHGGGSPLYNGYSLLAIHGDIDSVTMDLGTPGSCLKNFSTIPFVNCFLERNTFYGGRCHVNMRNSRSYWLSTLQSYMSSPQPPSKMD--DYISRCSVCQTKTTVMAFHSQKSDWQMTKCPYGWQKLWAGFSFPMAVQASRSGSNQPFSSPGSCLKHFRSLPFIECNNHNSNCNHWRDGVSYYMTAVDSENQFVKAQGKVLKSQTDIMNSISKCVVCQR 5342
            T+ PG+ G +G  G  G  GE G+ G +G   Y+       G KG  GL G  G+  S G PG KG  G  G +G+           I G  G KG+ G   ++G++              GF GP G+ G  G PG  G  GI G KGE G     G RG  GD G PG  G+ G              E GI+G +GRPG  G  G +G  G+  + KGD G           G PG  G+ G PG  G  + GSKG+ GI G+ G+ G+ G KG PG  G PG  G  G  G  G  G  G  G KG  GF       G  GL G+ G  G  G  G KG+ G     G  GL G +G  G +G KG+ G                                       +G  GD GA     + G  G  G+ G PG++GF G  G  G +G     G+PGF G +GE G  G PG  G  G PG  G PG                            G  G  G  G+S +PG +G KGE G  G PG       R D       G+ GE GL G+ G  G KG  G+PG +G  G IG  G  G  G   +  +                            ++    + G    +    F+GP G  GS G  G  G  G  G  G +G+ GE      G PG+ G  G+ G  G      +        +C  P        G  G  G KG  G TG +G  G  G  GES R G QG  G  G  G  GIPG  G KG PGL G       G  G +G  GD G SG+ G+ G  G  GD+G  G  G +G  G  G+ G                                                LQGD G+ G+ G +G +G+PG  G PG  G  G  G                        G  G  G   ++G+ G  G  GLPGF G+ G+ GD+G  G  G + +N        +   G                               +GFL   HSQS D P C  G + +Y+GYSLL + G+  +   DLGT GSCL+ FST+PF+ C +         C+   RN  SYWLST +    S +P    D   +ISRC+VC+    V+A HSQ    Q+ +CP GW  LW G+SF M   A   GS Q  +SPGSCL+ FRS PFIEC+   + CN++ +  S+++  V+    F K Q + LK+  D+   +S+C VC +
Sbjct:  163 TSAPGLPGTQGLPGDPGFLGERGQKGDKGDTCYNCIGNGILGPKGDPGLPGFPGSPGSPGAPGQKGAMGIPGTNGLPGPPGFPGNPGISGRPGPKGEPGE--VIGEIKGEKG-------DPGFPGPAGSPGLDGVPGRDGTPGIPGPKGEPGGFALKGDRGFPGDIGFPGHPGDRGLMGPPGFGPSGPPGEKGIQGVSGRPGAPGIPGPKGSPGQTVMEKGDFGPPGLPGIPGDAGTPGEPGLPGQPGIPG--VPGSKGEPGIPGI-GLPGSAGAKGFPGNTGPPGAPGLAGRPGSDGSPGQPGLPGPKGDPGF-------GLPGLPGSPGPAGLKGSQGPKGESGF---PGSPGLPGRAGFDGPVGPKGDSGQNGLPGTPGPPGVPGAGGQGPPGQPGLPGPAGPPGNTGIQGEKGDPGAPGFD-MPGPPGDRGSPGFPGERGFTGPPGPPGAQGRD---GLPGFSGAKGEMGVMGPPGSVGPAGNPGNPGLPG--------------------------SKGNDGNPGQPGLSGLPGAEGEKGERGLPGPPG-------RVDSANLQFKGVKGEPGLPGSSGLSGAKGAAGLPGNSGSPGQIGIPGSPGLPGCLFSSAKN---------------------------DVAAAWNCGRFNTSYSNVFSGPPGSKGSPGQPGRPGSAGSPGFSGLKGEKGEPGISGAGIPGISGPKGDPGLPGFPEDAEVSISTILVCIC-NPMFVFVIVSGSPGSPGLKGVDGPTGNSGLPGSPGLRGESGRPGPQGTPGEKGQPGQDGIPGPSGLKGEPGLPGFGSPGLPGLPGSQGQKGDAGLSGSPGNPGLPGFKGDQGFPGSPGPQGPTGQPGLPGPRTEGPKGDPGPVGPPGRPGINNQTGIYFLINGNLIQIGGSTFIIYCSLQGDPGRPGLNGMKGDQGVPGVPGFPGLPGLPGPKGEYREIKGAPGLPGPPGRPGVNGPPGPPGSPGLPGSLGLPGDTGRDGLPGFEGQLGRKGDRGLPGQPGSRGINGPPGPDGLQGPPGPPGLGS-----------------------VAHGFLITRHSQSTDAPGCPFGTTRIYDGYSLLYVQGNERAHGQDLGTAGSCLRRFSTMPFMFCNINN------VCNFASRNDYSYWLSTPEPMPMSMEPLRGRDIQPFISRCAVCEAPAMVIAVHSQT--IQIPQCPQGWSSLWIGYSFMMHTSAGAEGSGQALASPGSCLEEFRSAPFIECHGRGT-CNYYANSYSFWLATVEMSEMFSKPQSETLKA-GDLRTRVSRCQVCMK 1347          

HSP 2 Score: 214.927 bits (546), Expect = 1.709e-55
Identity = 343/1028 (33.37%), Postives = 432/1028 (42.02%), Query Frame = 3
Query:  225 PGPRGYQGVSGDKGDVGQFGMPGPKGYKGFTGAIGPQGRKGERGIPGSPGYPGKMGEMGFPGIRGDIGEKGLTGCDGQQGDFGNPGMNGLVGRTGQPGE-----RGDDGDRGLSIIPKYGLKGNKGSRGLLGRYGRKGEKGFKGIKGYSGIFGIKGNKGYVGPMGRRGPKGD-------SLGTVIIQSEKGSKGDKGLKGQSGIP-CKGFQIEGRM----YGRVGSDGPIGDKGIKGEKGLMGEIGQSGIDGARGLNGEKG--LPGEAGPRGERGDRGNPGFPGDPGASGADGTRGRQGERGPKG-----VHGISGADGPRGSRGDKGPSGSLLSCPGRKGEKGFFGIPGIKGDIGNKGYQGHDGDIGEIG-----------------------------------FKGEKGYEGPLGPSCSEVEQGFRGTKGESGFPGLRGAKGQRGYSGNKGIKGKPNFGTGINNPGETGSYGNLGVPGEKGNKGFIGDTGEKGFSGTGKQGPEGPRGDKGDDGVNGQVGMIGMPGIKGDKGSTYPICPFCEKGYKGIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEGRMGLLGSKGRQGYKGGKGFSGSMGDAGEIGYVTISGTTIPGVKGEKGNQGPKGNKGEFGEAGSRGRKGYSGLKGFKGLIGERGTSFSSGDPGDKGLRGENGKDGVSFAGIPGEKGLKGDKGNRGILGD----VGSLSNCATRP----ITSKGFKGPQGAKGTSGSPGSAGKTGIVGNKGENGYPGKRGIDGDNGIPGSKGEEGETGIKGHAGRPGNLGKSGLQGLRGEYGVKGDLGIQGIPGRKGVMGDPGPNGYAMIGSKGDKGIKGLPGIYGAKGDKGRPG---------------------------YIGIPGFKGETG---LIGRSGLKGDQGEIGEKGIKGFTFISNNPGDRGLLGNKGLKGFPGELGNKGQV-------------------------------GVCTVRGDQGLRGYSGLIGDMGMKGEQGSKGIVGDYG 2924
            PG  G QG+ GD G +G+ G  G KG   +   IG  G  G +G PG PG+PG  G  G PG +G +G  G  G  G  G  GNPG++G  G  G+PGE     +G+ GD G          G  GS GL G  GR G  G  G KG  G F +KG++G+ G +G  G  GD         G      EKG +G  G  G  GIP  KG   +  M    +G  G  G  GD G  GE GL G+ G  G+ G++G  G  G  LPG AG +G  G+ G PG PG  G  G+DG+ G+ G  GPKG     + G+ G+ GP G +G +GP          KGE GF G PG+ G  G  G  G  GD G+ G                                    +GEKG  G  G        G  G +G  GFPG RG  G  G  G +G  G P F         +G+ G +GV G  G+ G  G+ G  G  G+           KG+DG  GQ G+ G+PG +G+KG         E+G  G  G +                          +G  GL GS G  G KG  G  G+ G  G+IG     G         K +     N G F  + S     +SG  G KG  G+ G   S+G PG  GL+GE G+ G+S AGIPG  G KGD G  G   D    + ++  C   P    +   G  G  G KG  G  G++G  G  G +GE+G PG +G  G+ G PG  G  G +G+KG  G PG  G  GL GL G  G KGD G+ G PG  G           + G KGD+G  G PG  G  G  G PG                           Y  I G   + G    I    L+GD G  G  G+KG         D+G+ G  G  G PG  G KG+                                G   + GD G  G  G  G +G KG++G  G  G  G
Sbjct:  166 PGLPGTQGLPGDPGFLGERGQKGDKGDTCYN-CIG-NGILGPKGDPGLPGFPGSPGSPGAPGQKGAMGIPGTNGLPGPPGFPGNPGISGRPGPKGEPGEVIGEIKGEKGDPGF--------PGPAGSPGLDGVPGRDGTPGIPGPKGEPGGFALKGDRGFPGDIGFPGHPGDRGLMGPPGFGPSGPPGEKGIQGVSGRPGAPGIPGPKGSPGQTVMEKGDFGPPGLPGIPGDAGTPGEPGLPGQPGIPGVPGSKGEPGIPGIGLPGSAGAKGFPGNTGPPGAPGLAGRPGSDGSPGQPGLPGPKGDPGFGLPGLPGSPGPAGLKGSQGP----------KGESGFPGSPGLPGRAGFDGPVGPKGDSGQNGLPGTPGPPGVPGAGGQGPPGQPGLPGPAGPPGNTGIQGEKGDPGAPG----FDMPGPPGDRGSPGFPGERGFTGPPGPPGAQGRDGLPGF---------SGAKGEMGVMGPPGSVGPAGNPGNPGLPGS-----------KGNDGNPGQPGLSGLPGAEGEKG---------ERGLPGPPGRVDSANLQFKGV----------------KGEPGLPGSSGLSGAKGAAGLPGNSGSPGQIGIPGSPGLPGCLFSSAKNDVAAAWNCGRFNTSYS---NVFSGPPGSKGSPGQPGRPGSAGSPGFSGLKGEKGEPGISGAGIPGISGPKGDPGLPGFPEDAEVSISTILVCICNPMFVFVIVSGSPGSPGLKGVDGPTGNSGLPGSPGLRGESGRPGPQGTPGEKGQPGQDGIPGPSGLKGEPGLPG-FGSPGLPGLPGSQGQKGDAGLSGSPGNPG-----------LPGFKGDQGFPGSPGPQGPTGQPGLPGPRTEGPKGDPGPVGPPGRPGINNQTGIYFLINGNLIQIGGSTFIIYCSLQGDPGRPGLNGMKG---------DQGVPGVPGFPGLPGLPGPKGEYREIKGAPGLPGPPGRPGVNGPPGPPGSPGLPGSLGLPGDTGRDGLPGFEGQLGRKGDRGLPGQPGSRG 1100          

HSP 3 Score: 190.66 bits (483), Expect = 5.675e-48
Identity = 353/1097 (32.18%), Postives = 440/1097 (40.11%), Query Frame = 3
Query:  195 CF-----GNKGRQGFPGPRGYQGVSGDKGDVGQFGMPGPKGYKGFTGAIGPQ------------GRKGERGIPGSPGYPGKMGEMGFPGIR--------------GDIGEKGLTGCDGQQGDFGNPGMN--GLVGRTGQPGERGDDGDRGLSIIPKYGLKGNKGSRGLLGRYGRKGEKGFKGIKGYSGIFGIKGNKGYVGPMGRRGPKGDSLGTVIIQSEKGSKGDKGLKGQSGIP-------CKGFQIEGRMYGRVGSDGPIGD-----KGIKGEKGLMGEIGQSGIDGARGLNGEKGLPGEAGPRGERGDRGNPGFPGDPGASGADGTRGRQG-----------ERGPKGVHGISGADG---PRGSRG-------------------DKGPSGS--------LLSCPGRKGEKGFFGIPGIKGDIGNKGYQGHDGDIGEIGFKGEKGYEGPLGPSCSEVEQGFRGTKGESGF--PGLRGAKGQRGYSGNKGIKGKPNFGTGINNPGETGSYGNLGVPGEKGNKGFIGDTGEKGFSGTGKQGPEGP---------------------------RGDKGDDGVNGQVGMIGMPGIKGDKGST-YPICPFCEKGYKGIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEGRMGLLGSKGRQGYKGGKGFSGSMGDAGEIGYVTISGTTIPGVKGEKGNQGPKGNKGEFGEAGSRGRKGYSGLKGFKGLIGERGTSF-----SSGDPGDKGLRGENGKDGVS-FAGIPGEKGLKGDKGNRGIL-----GDVGSLSNCATRPIT-SKGFKGPQGAKGTSGS---PGSAGKTGIVGNKGENGYPGKRG------------------------------------------IDGDNGIPGSKGEEGETGIKGHAGRPGNLGKSGLQGLRGEYGVKGDLGIQGIPGRKGVMGDPGPNGYAMIGSKGDKGIKGLPGIYGAKGD---KGRPGYIGIPGFKGETGLIGRSGLKGDQGEIGEKGIK--------------GFTFISNNPGDRGLLGNKGLKGFPGELGNKGQVGVCTVRGDQGLRGYSGLIGDMGMKGEQGSKGIVG 2915
            CF     G  G  G PGP G  G +G K  +G F +     Y      I  Q            GR G +G  G PG  G  G+ GFPG++              G  G  GL G  GQ+GD G PG++  GL G  G  G  G  G  G       GL G +G  G  G  G +G+KG KG   Y+ I    GN       G  GPKGD  G        GS G  G KG  GIP         GF     + GR G  G  G+     KG KG+ G  G  G  G+DG  G +G  G+PG  G  G    +G+ GFPGD G  G  G RG  G           E+G +GV G  GA G   P+GS G                   D G  G         +   PG KGE G  GI G+ G  G KG+ G+ G  G  G  G  G +G      S  + G  G KG+ GF  PGL G+ G  G  G++G K            GE+G  G+ G+PG  G  G +G  G+ G +G                                    +G+KGD G  G      MPG  GD+GS  +P     E+G+ G  G  G                         +GR GL G  G +G  G  G  GS+G AG  G         PG+ G KGN G  G  G  G  G+ G KG  GL G  G +      F       G PG  GL G  G  G+   +G PG+ G+ G  G  G L      DV +  NC     + S  F GP G+KG+ G    PGSAG  G  G KGE G PG  G                                          + G  G PG KG +G TG  G  G PG  G+SG  G +G  G KG  G  GIPG  G+ G+PG  G+      G  G+ GLPG  G KGD    G PG  G+PGFKG+ G  G  G +G  G+ G  G +              G   I+N  G   L+    +     ++G    +  C+++GD G  G +G+ GD G+ G  G  G+ G
Sbjct:   10 CFFFKTQGLPGHDGEPGPAGIPGCNGTKVHLGFFLIVSLVFYSFPPEYIFSQLKLQKVISRPGTGRVGPKGNTGPPGITGPKGDRGFPGLQGPPGFPGTPGTSSVGPSGNPGLPGERGQKGDDGPPGISIPGLPGSEGLAGPPGPPGLPGRPGTSAPGLPGTQGLPGDPGFLGERGQKGDKGDTCYNCI----GN-------GILGPKGDP-GLPGFPGSPGSPGAPGQKGAMGIPGTNGLPGPPGFPGNPGISGRPGPKGEPGEVIGEIKGEKGDPGFPGPAGSPGLDGVPGRDGTPGIPGPKGEPGGFALKGDRGFPGDIGFPGHPGDRGLMGPPGFGPSGPPGEKGIQGVSGRPGAPGIPGPKGSPGQTVMEKGDFGPPGLPGIPGDAGTPGEPGLPGQPGIPGVPGSKGEPGIPGI-GLPGSAGAKGFPGNTGPPGAPGLAGRPGSDG------SPGQPGLPGPKGDPGFGLPGLPGSPGPAGLKGSQGPK------------GESGFPGSPGLPGRAGFDGPVGPKGDSGQNGLPGTPGPPGVPGAGGQGPPGQPGLPGPAGPPGNTGIQGEKGDPGAPG----FDMPGPPGDRGSPGFP----GERGFTGPPGPPGA------------------------QGRDGLPGFSGAKGEMGVMGPPGSVGPAGNPGN--------PGLPGSKGNDGNPGQPGLSGLPGAEGEKGERGLPGPPGRVDSANLQFKGVKGEPGLPGSSGLSGAKGAAGLPGNSGSPGQIGIPGSPGLPGCLFSSAKNDVAAAWNCGRFNTSYSNVFSGPPGSKGSPGQPGRPGSAGSPGFSGLKGEKGEPGISGAGIPGISGPKGDPGLPGFPEDAEVSISTILVCICNPMFVFVIVSGSPGSPGLKGVDGPTGNSGLPGSPGLRGESGRPGPQGTPGEKGQPGQDGIPGPSGLKGEPGLPGF------GSPGLPGLPGSQGQKGDAGLSGSPGNPGLPGFKGDQGFPGSPGPQGPTGQPGLPGPRTEGPKGDPGPVGPPGRPGINNQTGIYFLINGNLI-----QIGGSTFIIYCSLQGDPGRPGLNGMKGDQGVPGVPGFPGLPG 1024          

HSP 4 Score: 180.644 bits (457), Expect = 6.232e-45
Identity = 343/1087 (31.55%), Postives = 428/1087 (39.37%), Query Frame = 3
Query:  432 KGLTGCDGQQGDFGNPGMNG------------LV------------------------------GRTGQPGERGDDGDRGLSIIPKYGLK---------GNKGSRGLLGRYGRKGEKGFKGIK----------------------------GYSGIFGIKGNKGYVGPMGRRGPKGDSLGTVIIQSEKGSKGDKGLKGQSGIPCKGFQIEGRMYGRVGSDGPIGDKGIKGEKGLMGEIGQSGIDGARGLNGEKGLPGEAGPRGE--------RGDRGNPGFPGDPGASGADGTRGRQGE---RGPKGVHGISGADGPRGSRGDKGPSGSLLSCPGRKGEKGFF--------------GIPGIKGDIGNKGYQGHDGDIGEI-------------------GFKGEKGYEGPLGPSCSEVEQGFRGTKGESGFP--GLRGAKGQRGYSGNKGIKGKPNFGTGINNPGETGSYGNLGVPGEKGNKGFIGDTGEKGFSGTGKQGPEGPRGDKGDDGVNGQVGMIGMPGIKGDKGSTYPICPFCEKGYKGIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEGRMGLLGSKGRQGYKGGKGF--SGSMGDAGEIGYVTISGTTIPGVKGEKGNQGPKGNKGEFGEAGSRGRKGYSGLKGFKGLIGERGTSFSSGDPGDKGLRGENGKDGVS-FAGIPGEKGLKGDKGNRGILGDVGSLSNCATRPITSKGFKGPQGAKGTSGSPGSAGKTGIVGNKGENGYPGKRGIDGDNGIPGS--------------------------KGEEGETGIKGHAGRPGNLGKSGLQGLRGEYGVKGDLGIQGIPGRKGVMGDPGPNGY-----------------AMIGSKGDKGIKGLPGIYGAKGDKGRPGYIGIPGFKGETGLIGRSGLKGDQGEIGEKGIKGFTFISNNPGDRGLLGNKGLKGFPGELGNKGQVGVCTVRGDQGLRGYSGLIGDMGMKGEQGSKGIVGDYGAASR-------SGIMGRTGKIGNQG-----LPGDQXXXXXXXXXXXXXXXXYIGIPGFEGDRGEKGNKGFPGFPGDIGQPGRLGN 3143
            +GL G DG+ G  G PG NG            LV                              G TG PG  G  GDRG   +               G  G+ GL G  G+KG+ G  GI                             G  G  G+ G+ G++G  G++G KGD+    I     G KGD GL G  G P                    G  G  G+KG MG  G +G+ G  G  G  G+ G  GP+GE        +G++G+PGFPG  G+ G DG  GR G     GPKG  G     G RG  GD G        PG  G++G                GI G+ G  G  G  G  G  G+                    G  GE G  G  G        G  G+KGE G P  GL G+ G +G+ GN G  G P        PG  GS G  G+PG KG+ GF    G  G  G+      GP G KG  G  G+ G  G PG+ G  G   P+ P  + G    Q  L            G +G  G  GLPG  G  G  G +G +G  G  GF   G  GD G            PG  GE+G     G  G  G  G  G  G+SG KG  G++G  G+   +G+PG+ GL G  G DG     G+ G  G +G+KG RG+ G  G + +   +      FKG +G  G  GS G +G  G  G  G +G PG+ GI G  G+PG                            G  G  G  G  GRPG+ G  G  GL+GE G  G  G  GIPG  G  GDPG  G+                  M       G  G PG+ G  G  G  G  G PG +GE+G  G  G  G++G+ G+ GI G + +   PG  G  G+ GL G PG  G KG  G+    G+ GL G+ G  G  G  G QG  G  G  G  +                 I NQ      + G+    G   F  +   +G  G PG  G +G++G  G PGFPG  G PG  G 
Sbjct:   16 QGLPGHDGEPGPAGIPGCNGTKVHLGFFLIVSLVFYSFPPEYIFSQLKLQKVISRPGTGRVGPKGNTGPPGITGPKGDRGFPGLQGPPGFPGTPGTSSVGPSGNPGLPGERGQKGDDGPPGISIPGLPGSEGLAGPPGPPGLPGRPGTSAPGLPGTQGLPGDPGFLGERGQKGDKGDTCYNCIGNGILGPKGDPGLPGFPGSP--------------------GSPGAPGQKGAMGIPGTNGLPGPPGFPGNPGISGRPGPKGEPGEVIGEIKGEKGDPGFPGPAGSPGLDGVPGRDGTPGIPGPKGEPGGFALKGDRGFPGDIG-------FPGHPGDRGLMGPPGFGPSGPPGEKGIQGVSGRPGAPGIPGPKGSPGQTVMEKGDFGPPGLPGIPGDAGTPGEPGLPGQPG------IPGVPGSKGEPGIPGIGLPGSAGAKGFPGNTGPPGAPGL---AGRPGSDGSPGQPGLPGPKGDPGF----GLPGLPGS-----PGPAGLKGSQGPKGESGFPGSPGLPGRAGFDGPVGPKGDSG----QNGLPGTPGPPGVPGAGGQGPPGQPGLPGPAGPPGNTGIQGEKGDPGAPGFDMPGPPGDRGS-----------PGFPGERGF---TGPPGPPGAQGRDGLPGFSGAKGEMGVMGPPGSVGPAGNPGNPGLPGSKGNDGNPGQPGLSGLPGAEGEKGERGLPGPPGRVDSANLQ------FKGVKGEPGLPGSSGLSGAKGAAGLPGNSGSPGQIGIPGSPGLPGCLFSSAKNDVAAAWNCGRFNTSYSNVFSGPPGSKGSPGQPGRPGSAGSPGFSGLKGEKGEPGISG-AGIPGISGPKGDPGLPGFPEDAEVSISTILVCICNPMFVFVIVSGSPGSPGLKGVDGPTGNSGLPGSPGLRGESGRPGPQGTPGEKGQPGQDGIPGPSGLKGEPGLPG-FGSPGLPGLPGSQGQKGDAGLSGSPGNPGLPGFKGDQGFPGSPGPQGPTGQPGLPGPRTEGPKGDPGPVGPPGRPGINNQTGIYFLINGNLIQIGGSTFIIYCSLQGDPGRPGLNGMKGDQGVPGVPGFPGLPGLPGPKGE 1031          

HSP 5 Score: 167.162 bits (422), Expect = 9.602e-41
Identity = 302/936 (32.26%), Postives = 374/936 (39.96%), Query Frame = 3
Query:  201 GNKGRQGFPGPRGYQGVSGDKGDVGQFGMPGPKGYKGFTGAIGPQGRKGERGIPGSPGYPGKMG-----------EMGFPGIRGDIGEKGLTGCDG-------QQGDF------------GNPGMNGLVGRTGQPGERGDDGDRGLSIIPKYGLKGNKGSRGLLGRYGRKGEKGFKGIKGYSGIFGIKGNKGYVGPMGRRGPKGD----------SLGTVIIQSEKGSKGDKGLKGQSGIPCKGFQIEGRMYGRVGSDGPIGDKGIKGEKGLMGEIGQSGIDGARG--------------------LNGEKGLPGEAG--PRGERGDRGNPGFPGDPGASGADGTRGRQGERGPKGVHGISGADGPRGSRGDKGPSGSLLSCPGRKGEKGFFGIPGIKGDIGNKGYQGHDGDIGEIGFKGEKGYEGPLGPSCSEVEQGFRGTKGESGFPGLRGAKGQRGYSGNKGIKGKPNFGTGINNPGETGSYGNLGVPGEKGNKGFIGDTGEKGFSGTGKQGP---------EGPRGDKGDDGVNGQVGMIGMPGIKGDKGSTYPICPFCEKGYKGIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEGRMGLLGSKGRQGYKGGKGFSGSMGDAGEIG--------------YVTISGTTIPGVKGEKGNQGPKGNKGEFGEAGSRGRKGYSGLKGFKGLIGERGTSFSSGDPGDKGLRGENGKDGVSFAGIPGEKGLKGDKGNRGILGDVGSLSNCATRPITSKGFKGPQGAKGTSGSPGSAG-----------------------KTGIV----GN---------------KGENGYPGKRGIDGDNGIPGSKGEEGETGIKGHAGR-------------------------------------PGNLGKSGLQGLRGEYGVKGDLGIQGIPGRKGVMGD 2516
            G KG  GFPGP G  G+ G  G  G  G+PGPKG  G     G +G  G+ G PG PG  G MG           E G  G+ G  G  G+ G  G       ++GDF            G PG  GL G+ G PG  G  G+ G   IP  GL G+ G++G  G  G  G  G  G  G         + G  G  G  GPKGD          S G   ++  +G KG+ G  G  G+P           GR G DGP+G KG  G+ GL G  G  G+ GA G                    + GEKG PG  G    G  GDRG+PGFPG+ G +G  G  G QG     G+ G SGA   +G  G  GP GS+    G  G  G  G+PG KG+ GN G  G  G  G  G KGE+G  GP G   S   Q F+G KGE G PG  G  G +G +G                PG +GS G +G+PG  G  G +  + +   +     G           GP G KG  G  G+ G  G PG  G KG         EKG  GI G                                   G  G  G KG  G  G   DA E+               +V +SG+  PG  G KG  GP GN G     GS G +G SG  G +G  GE+G     G PG  GL+GE G  G    G+PG  G +G KG+ G+ G  G+      +    +GF G  G +G +G PG  G                       +TGI     GN               +G+ G PG  G+ GD G+PG  G  G  G+ G  G                                      PG+ G+ GL G  G+ G KGD G+ G PG +G+ G 
Sbjct:  269 GEKGDPGFPGPAGSPGLDGVPGRDGTPGIPGPKGEPGGFALKGDRGFPGDIGFPGHPGDRGLMGPPGFGPSGPPGEKGIQGVSGRPGAPGIPGPKGSPGQTVMEKGDFGPPGLPGIPGDAGTPGEPGLPGQPGIPGVPGSKGEPG---IPGIGLPGSAGAKGFPGNTGPPGAPGLAGRPG---------SDGSPGQPGLPGPKGDPGFGLPGLPGSPGPAGLKGSQGPKGESGFPGSPGLP-----------GRAGFDGPVGPKGDSGQNGLPGTPGPPGVPGAGGQGPPGQPGLPGPAGPPGNTGIQGEKGDPGAPGFDMPGPPGDRGSPGFPGERGFTGPPGPPGAQGR---DGLPGFSGA---KGEMGVMGPPGSV----GPAGNPGNPGLPGSKGNDGNPGQPGLSGLPGAEGEKGERGLPGPPGRVDSANLQ-FKGVKGEPGLPGSSGLSGAKGAAGL---------------PGNSGSPGQIGIPGSPGLPGCLFSSAKNDVAAAWNCGRFNTSYSNVFSGPPGSKGSPGQPGRPGSAGSPGFSGLKG---------EKGEPGISGA----------------------------------GIPGISGPKGDPGLPGFPEDA-EVSISTILVCICNPMFVFVIVSGS--PGSPGLKGVDGPTGNSGL---PGSPGLRGESGRPGPQGTPGEKGQPGQDGIPGPSGLKGEPGLPGFGSPGLPGLPGSQGQKGDAGLSGSPGNPGLPGFK--GDQGFPGSPGPQGPTGQPGLPGPRTEGPKGDPGPVGPPGRPGINNQTGIYFLINGNLIQIGGSTFIIYCSLQGDPGRPGLNGMKGDQGVPGVPGFPGLPGLPGPKGEYREIKGAPGLPGPPGRPGVNGPPGPPGSPGLPGSLGLPGDTGRDGLPGFEGQLGRKGDRGLPGQPGSRGINGP 1104          

HSP 6 Score: 164.851 bits (416), Expect = 5.572e-40
Identity = 325/984 (33.03%), Postives = 407/984 (41.36%), Query Frame = 3
Query:  183 DKC-QCFGNKGRQGFPGPRGYQGVSGDKGDVGQFGMPGPKGYKGFTGA---IGPQGRKGERGIPGSPGYPGKMGEMGFPGIRGDIGE-KGLTGCDGQQGDFGNPGMNGLVGRTGQPGERGDDGDRGLSIIPKYGLKGNKGSRGLLGRYGRKGEKGFKGIKGYSGIF-----GIKGNKGYVGPMGRRGPKGDSLGTVIIQ------------SEKGSKGDKGLKGQSGIP-CKGFQIEGRMYGRVGSDGPIGDKGIKGEKGLMGEIGQSGIDGARGLNGEKGLPGEAGPRGERGDRGNPGFPGDPGASGADGTRGRQGER---GPKGVHGISGADGPRGSRGDKG-------------------PSGSLLSCPGRKGEKGFFGIPGIKGDIGNKGYQ--GHDGDIGEIGFKGEKGYEGPLGPSCSEVEQGFRGTKGESGFPGLRGAKGQRGYSGNKGIKGKPNFGTGINNPGETGSYGNLGVPGEKGNKGFIGDTGEKGFSGTGKQGPEGPRGDKGDDGVNGQVGMIGMPGIKGDKGST-------YPICPFCEKGYKGIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEGRMGLLGSKGRQGYKGGKGFSGSMGDAGEIGYVTISGTTIPGVKGEKGNQGPKGNKGEF----------------------GEAGSRGRKGYSGLKGFKGLIGERGTSFSSGDPGDKGLRGENGKDGVSFAGIPGEKGLKGDKGNRGILGDVGSLSNCATRPITSKGFKGPQGAKGTSGSPGSAGKTGIVGNKGENGYPGKRGIDGDNGIPGSKGEEGETGIKGHAGRPGNLGKSGLQGLRGEYG-VKGDL------------GIQGIPGRKGVMGDPGPNGYAMIGSKGDKGIKGLPGIYGAKGDKGRPGYIGIPGFKGETGLI-------------------------------------GRSGLKGDQGEIGEKGIKGFTFISNNPGDRGL 2756
            D C  C GN    G  GP+G  G+ G  G  G  G PG KG  G  G     GP G  G  GI G PG  G+ GE+        IGE KG  G  G  G  G+PG++G+ GR G PG  G  G+ G      + LKG++G  G +G  G  G++G  G  G+         GI+G  G  G  G  GPKG    TV+ +             + G+ G+ GL GQ GIP   G + E  + G +G  G  G KG  G  G  G  G +G  G+ G  G+ GLP   GP+G+ G  G PG PG PG +G  G++G +GE    G  G+ G +G DGP G +GD G                           PG  G  G  GI G KGD G  G+   G  GD G  GF GE+G+ GP GP  ++   G  G  G  G  G+ G  G  G +GN G  G P       NPG+ G  G  G  GEKG +G  G  G    +    +G +G  G  G  G++G  G  G+PG  G  G          P C F              + +       G      +    G  G  G  G  GR G  G  GFSG  G+ GE G   ISG  IPG+ G KG+ G  G   +                       G  GS G KG  G  G  GL G  G    SG PG +G  GE G+ G    GIPG  GLKG+ G  G  G  G             G  G QG KG +G  GS G  G+ G KG+ G+PG  G  G  G PG  G   E          G  G+ G+    G Y  + G+L             +QG PGR G           + G KGD+G+ G+PG          PG  G+PG KGE   I                                     GR GL G +G++G KG +G   +   PG RG+
Sbjct:  192 DTCYNCIGN----GILGPKGDPGLPGFPGSPGSPGAPGQKGAMGIPGTNGLPGPPGFPGNPGISGRPGPKGEPGEV--------IGEIKGEKGDPGFPGPAGSPGLDGVPGRDGTPGIPGPKGEPG-----GFALKGDRGFPGDIGFPGHPGDRGLMGPPGFGPSGPPGEKGIQGVSGRPGAPGIPGPKGSPGQTVMEKGDFGPPGLPGIPGDAGTPGEPGLPGQPGIPGVPGSKGEPGIPG-IGLPGSAGAKGFPGNTGPPGAPGLAGRPGSDGSPGQPGLP---GPKGDPG-FGLPGLPGSPGPAGLKGSQGPKGESGFPGSPGLPGRAGFDGPVGPKGDSGQNGLPGTPGPPGVPGAGGQGPPGQPGLPGPAGPPGNTGIQGEKGDPGAPGFDMPGPPGDRGSPGFPGERGFTGPPGPPGAQGRDGLPGFSGAKGEMGVMGPPGSVGPAGNPGNPGLPGSKGNDGNPGQPGLSGLPGAEGEKGERGLPGPPGRVDSANLQFKGVKGEPGLPGSSGLSGAKGAAGLPGNSGSPGQIGIPGSPGLPGCLFSSA-----------KNDVAAAWNCGRFNTSYSNVFSGPPGSKGSPGQPGRPGSAGSPGFSGLKGEKGEPG---ISGAGIPGISGPKGDPGLPGFPEDAEVSISTILVCICNPMFVFVIVSGSPGSPGLKGVDGPTGNSGLPGSPGLRGESGRPGPQGTPGEKGQPGQD--GIPGPSGLKGEPGLPG-FGSPG-----------LPGLPGSQGQKGDAGLSGSPGNPGLPGFKGDQGFPGSPGPQGPTGQPGLPGPRTEGPKGDPGPV-GPPGRPGINNQTGIYFLINGNLIQIGGSTFIIYCSLQGDPGRPG-----------LNGMKGDQGVPGVPGF---------PGLPGLPGPKGEYREIKGAPGLPGPPGRPGVNGPPGPPGSPGLPGSLGLPGDTGRDGLPGFEGQLGRKGDRG---LPGQPGSRGI 1101          

HSP 7 Score: 163.31 bits (412), Expect = 1.292e-39
Identity = 359/1169 (30.71%), Postives = 453/1169 (38.75%), Query Frame = 3
Query:  399 GFPGIRGDIGEKGLTGCDGQQGDFGNPGMNGLVGRTGQPGERGDDGDRGLSII--PKYGLKGNKGSRGLLGRYGRKGEKGFKGIKGYSGIFGIKGNKGYVGPMGRRGPKGDSLGTVIIQSEKGSKGDKGLKGQS--GIP------CKGFQIEGRMYGRVGSDGPIGDKGIKGEKGLMGEIGQSGIDGARGLNGEKGLPGEAGPRGERGDRGNPGFPGDPGASGADGTRGRQGERGPKGVHG---------ISGADGPRGSRGD--------------KGPSGS--LLSCPGRKGEKGFFGIPGIKGDIGNKGYQGHDGDIGEIGFKGEKGYEGPLGPSCSEV-----EQGFRGTKGESGFPGLRGAKGQRGYSGNKGIKGKPNFGTGINNPGETGSYGNLGVPGEKGNKGFIGDTGEKGFSGTGKQGPEGPRGDKGDDGVNGQVGMIGMPGIKGDKGSTYPICPFCEKGYKGIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEGRMGLLGSKGRQGYKGGKGFSGSMGDAGEIGYVTISGTTIPGVKGEKGNQGPKGNKGEFGEAGSRGRKGYSGLKGFKGLIGERGTSFSSGDPGD--------------------------KGLRGENGKDGVSFAGIPGEKGLKGDKGNRGILGDVGSLSNCATRPITSKGFKGPQGAKGTSGSPGSAGKTGIVGNKGENGYPGKRGIDGD------NGIPGSKGEEGETGIKGHAGR--------------PGNLGKSGLQGLRGEYGVKGDLGIQGIPGRKGVMGDPGPNGYAMIGSKGDKG---------------IKGLPGIYGAKGDKGRPGYIGIPGFKGETGLIGRSGLKGDQGEIGEKGIKGFTFISNNPGDRGLLGNKGLKGFPGELG-NKGQVGVCTVRGDQGLRGYSGLIGDMGMKGEQGSKGIVGDYGAASRSGIMGRTGKIGNQGLPGDQXXXXXXXXXXXXXXXXYIGIPGFEGDRGEKGNKGFPGFPGDIGQPGRLGNPGISTEGVXXXXXXXXXXXXXXXXXXXXXXXXXXKQGDSGIS-IPGRQGIKGEDGTIGLPGEMGEPGPRGDFGQKGNIGITGE------------------------FGLQGNRGDDG---------LKGDDGIPGLNGPRGFIGDIGFVGF 3497
            G PG  G+ G  G+ GC+G +   G   +  LV  +  P E      +   +I  P  G  G KG+ G  G  G KG++GF G++G  G  G  G    VGP G  G          +  E+G KGD G  G S  G+P                     + G  G +G+ G+ G +GE GQ G  G    N         G  G +GD G PGFPG PG+ GA G +G  G  G  G+ G         ISG  GP+G  G+               GP+GS  L   PGR G  G   IPG KG+ G    +G  G  G+IGF G  G  G +GP          E+G +G  G  G PG+ G KG  G +  +  KG          PG+ G+ G  G+PG+ G  G  G  GE G  G                     +G+ G  G KG  G+T P                                           G  GL G  G  G  G  G  G  GD G  G   + G+  PG  G KG+QGPKG  G  G  G  GR G+ G  G KG  G+ G   + G PG                           +G +G+ G  G    G PG++G  G  G RG  G  G             G  G  GAKG  G  G  G  G  GN G  G PG +G DG+      +G+PG++GE+GE G+ G  GR              PG  G SGL G +G  G+ G+    G PG+ G+ G PG  G     +K D                   G PG  G+ G  GRPG  G PGF         SGLKG++GE G  G       +  PG  G  G+ GL GFP +   +   + VC           SG  G  G+KG  G     G+ G     G+ G +G+ G QG PG++                  G PG +G  G  G KG PG PG  G PG  G PG                               G++GD+G+S  PG  G+ G  G  G PG    PGP+G  GQ G  G   E                        F + GN    G         L+GD G PGLNG +G  G  G  GF
Sbjct:   17 GLPGHDGEPGPAGIPGCNGTKVHLGFFLIVSLVFYSFPP-EYIFSQLKLQKVISRPGTGRVGPKGNTGPPGITGPKGDRGFPGLQGPPGFPGTPGTS-SVGPSGNPG----------LPGERGQKGDDGPPGISIPGLPGSEGLAGPPGPPGLPGRPGTSAPGLPGTQGLPGDPGFLGERGQKGDKGDTCYNCIGN-----GILGPKGDPGLPGFPGSPGSPGAPGQKGAMGIPGTNGLPGPPGFPGNPGISGRPGPKGEPGEVIGEIKGEKGDPGFPGPAGSPGLDGVPGRDGTPG---IPGPKGEPGGFALKGDRGFPGDIGFPGHPGDRGLMGPPGFGPSGPPGEKGIQGVSGRPGAPGIPGPKGSPGQTVME--KGDFGPPGLPGIPGDAGTPGEPGLPGQPGIPGVPGSKGEPGIPG---------------------IGLPGSAGAKGFPGNTGP------------------------------------------PGAPGLAGRPGSDGSPGQPGLPGPKGDPG-FGLPGLPGS--PGPAGLKGSQGPKGESGFPGSPGLPGRAGFDGPVGPKGDSGQNGLPGTPGPPGVPGAGGQGPPGQPGLPGPAGPPGNTGIQGEKGDPGAPGFDMPGPPGDRGSPGFPGERGFTGPPGPPGAQGR-----DGLPGFSGAKGEMGVMGPPGSVGPAGNPGNPGLPGSKGNDGNPGQPGLSGLPGAEGEKGERGLPGPPGRVDSANLQFKGVKGEPGLPGSSGLSGAKGAAGLPGN---SGSPGQIGIPGSPGLPGCLFSSAKNDVAAAWNCGRFNTSYSNVFSGPPGSKGSPGQPGRPGSAGSPGF---------SGLKGEKGEPGISG-------AGIPGISGPKGDPGLPGFPEDAEVSISTILVCICNPMFVFVIVSGSPGSPGLKGVDGP---TGNSGLPGSPGLRGESGRPGPQGTPGEK------------------GQPGQDGIPGPSGLKGEPGLPG-FGSPGLPGLPG-----------------------------SQGQKGDAGLSGSPGNPGLPGFKGDQGFPGS---PGPQGPTGQPGLPGPRTEGPKGDPGPVGPPGRPGINNQTGIYFLINGNLIQIGGSTFIIYCSLQGDPGRPGLNGMKGDQGVPGVPGF 1019          

HSP 8 Score: 155.606 bits (392), Expect = 3.748e-37
Identity = 341/1032 (33.04%), Postives = 411/1032 (39.83%), Query Frame = 3
Query:  780 LKGQSGIPCKGFQIEGRMYGRVGSDGPIGDKGIKGEKGLMG-------------------------EIGQSGIDGARGLNGEKGLPGEAGPRGERGDRGNPGF------PGDPGASGADGTRGRQGERGPKGVHGISGADGPRGSRGDKGPSGSLLSCPGRKGEK-----GFFGIPGIKGDIGNKGYQGHDGDIGEIGFKGEKGYEGPLGPSCSE-VEQGFRGTKGESGFPGLRGAKGQRGYSGNKGIKGKPNFGTGINNPGETGSYGNLGVPGEKGNKGFI-----GDTGEKGFSGTGKQGPEGPRGDKGDDGVNGQVGMIGMPGIKGDKGSTYPICPFCEKGYKGIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEGRMGLLGSKGRQGYKGGKGFSGSM----------------GDAGEIGYVTISGTT-IPGVKGEKGNQGPKGNKGEFGEAGSRGRKGYSGLKGFKGLIGERGTSFSSGDPGDKGLRGENGKDGVSFAGIPGEKGLKGDKGNRGILGDVGSLSNCATRPITSKGFKGPQGAKGTSGS-----------------------------PGSAGKTGIVGNKGENGYPG--KRGIDGDNGIPGSKGEEGETGIKGHAGRPGNLGKSGLQGLRGEYGV---------KGDLGIQGIPGRKGVMGDPGPNGYA-MIGSKGDKGIKGLPG-----------IYGAKGDKGRPGYIGIPGFKGETGLIGRSGLKGDQGEIGEKGIKGFTFISNNPGDRGLLGNKGL------KGFPGELGNKGQVGVCTVRGDQGLRGYSGLIGDMGMKGEQGSKGIVGDYGAASRSGIMGRTGKIGNQGLPG--DQXXXXXXXXXXXXXXXXYI--------GIPGFEGDRGEKGNKGFPGFPGDIGQPGRLGNPGISTEGVXXXXXXXXXXXXXXXXXXXXXXXXXXKQGDSGISIPGRQGIKGEDGTIGLPGEMGEPGPRGDFGQKGNIGITGEFGLQGNRGDDGLKGDDGIPGLNGPRGFIGDIGFVG 3494
            L  QS I C  F+ +G + G  G  GP G  G  G K  +G                          I + G  G  G  G  G PG  GP+G   DRG PG       PG PG S            GP G  G+ G    RG +GD GP G  +S PG  G +             +      G  G  G  G+ GF GE+G +G  G +C   +  G  G KG+ G PG  G+ G  G  G KG  G P        PG  G+ G  G PG KG  G +     G+ G+ GF         GP G  G DGV G+ G  G+PG KG+ G       F  KG +G          +  +         G  G PG++G  G+ G  G  G  G KG  G                  GDAG  G   + G   IPGV G KG  G  G     G  GS G KG+ G  G  G  G  G   S G PG  GL G  G  G    G+PG  G  G KG++G  G+ G   +         GF GP G KG SG                               G  G TGI G KG+ G PG    G  GD G PG  GE G TG  G  G  G  G  G  G +GE GV          G+ G  G+PG KG  G+PG  G + + G++G+KG +GLPG             G KG+ G PG  G+ G KG  GL G SG  G  G  G  G+ G  F S    D     N G         F G  G+KG  G     G  G  G+SGL      KGE+G  GI G       +GI G +G  G+ GLPG  +              +  ++        G PG +G  G  GN G PG PG  G+ GR G  G   E                           G+ G  G  IPG  G+KGE G  G  G  G PG  G  GQKG+ G++G     GN G  G KGD G PG  GP+G  G  G  G
Sbjct:    2 LYHQSEICCFFFKTQG-LPGHDGEPGPAGIPGCNGTKVHLGFFLIVSLVFYSFPPEYIFSQLKLQKVISRPGT-GRVGPKGNTGPPGITGPKG---DRGFPGLQGPPGFPGTPGTSSV----------GPSGNPGLPGE---RGQKGDDGPPG--ISIPGLPGSEGLAGPPGPPGLPGRPGTSAPGLPGTQGLPGDPGFLGERGQKGDKGDTCYNCIGNGILGPKGDPGLPGFPGSPGSPGAPGQKGAMGIPGTNGLPGPPGFPGNPGISGRPGPKGEPGEVIGEIKGEKGDPGF--------PGPAGSPGLDGVPGRDGTPGIPGPKGEPGG------FALKGDRGFP-GDIGFPGHPGDRGLMGPPGFGPSGPPGEKGIQGVSGRPGAPGIPGPKGSPGQTVMEKGDFGPPGLPGIPGDAGTPGEPGLPGQPGIPGVPGSKGEPGIPG----IGLPGSAGAKGFPGNTGPPGAPGLAGRPGSDGSPGQPGLPGPKGDPGFGLPGLPGSPGPAGLKGSQGPKGESGFPGSPGLP--GRAGFDGPVGPKGDSGQNGLPGTPGPPGVPGAGGQGPPGQPGLPGPAGPPGNTGIQGEKGDPGAPGFDMPGPPGDRGSPGFPGERGFTGPPGPPGAQGRDGLPGFSGAKGEMGVMGPPGSVGPAGNPGNPGLPGSKGNDGNPGQPGLSGLPGAEGEKGERGLPGPPGRVDSANLQFKGVKGEPGLPGSSGLSGAKGAAGLPGNSGSPGQIGIPGSPGLPGCLFSSAK-NDVAAAWNCGRFNTSYSNVFSGPPGSKGSPGQPGRPGSAGSPGFSGL------KGEKGEPGISG-------AGIPGISGPKGDPGLPGFPEDAEVSISTILVCICNPMFVFVIVSGSPGSPGLKGVDGPTGNSGLPGSPGLRGESGRPGPQGTPGE--------------------------KGQPGQDG--IPGPSGLKGEPGLPGF-GSPGLPGLPGSQGQKGDAGLSGS---PGNPGLPGFKGDQGFPGSPGPQGPTGQPGLPG 946          

HSP 9 Score: 148.288 bits (373), Expect = 5.221e-35
Identity = 316/997 (31.70%), Postives = 391/997 (39.22%), Query Frame = 3
Query: 1161 PGRKGEKGFFGIPGIKGDIGNKGYQGHDGDIGEIGFKGEKGY---EGPLGPSCSEVEQGFRGTKGESGFPGLRGAKGQRGYSGNKGIKGKPNFGTGINNPGETGSYGNLGVPGEKGNKGFIGDTGEKGFSGTGKQGPE-----------------GPRGDKGDDGVNGQVGMIGMPGIKGDKGSTYPICPFCEKGYKGIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEGRMGLLGSKGRQGYKGGKGFSGSMGDAGEIGYVTISGTTI----------------PGVKGEKGN-----QGPKGNKGEFGEAGSRGRKGYSGLKGFKGLIGERGTSFSSGDPGDKGLRGENGKDGVSFAGIPGEKGLKGDKGNRGILGDVGSLSNCATRPITSKGFKGPQGAKGTSGSPGSAGKTGI----------------VGNKGENGYPGKRGIDGDNGIPGSKGEEGETGI-----KGHAGRPGNLGKSGLQGLRGEYGVKGDLGIQGIPGRKGVMGDPGPNGYAMIGSKGDKGIKGLPGIYGAKGDKGRPGYIGIPGFKGETGLIGRSGLKGD-----------------------------------------QGEIGEKGIKGFTFISNNPGDRGLLGNKGLKGFPGELGNKGQVGVCTVRGDQGLRGYSGLIGDMGMKGEQGSKGIVGDYGAASRSGIMGRTGKIGNQGLPGDQXXXXXXXXXXXXXXXXYIGIPGFEGDRGEKGNKGFPG--------FPGDIGQPGRLGNPGIS----TEGVXXXXXXXXXXXXXXXXXXXXXXXXXXKQGDSGISIPGRQGIKGEDGTIGLPGEMGEPGPRGDFGQKGNIGITGEFGLQGNRGDDGLKGDDGIPGLNGPRGFIGDIGFVGFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXELGLDGSMGGKGDNGPRGFNGPTGIPGSKGFEGDKGIRGDIGVKGFQGQHGEIGFPGLKGVSGENG 3806
            PG  GE G  GIPG  G    K + G    +  + +     Y   +  L    S    G  G KG +G PG+ G KG RG+ G +G  G      G       G  GN G+PGE+G KG   D G  G S  G  G E                    G  G  G+ G  G +G  G KGDKG T          Y  I                                  G+LG KG  G  G  G  GS G  G+ G + I GT                  PG KGE G      +G KG+ G  G AGS G  G  G  G  G+ G +G      +PG   L+G+ G         PG+ G  G  G+RG++G  G   +        +G  G  GA G  G  GS G+T +                 G  GE G PG+ GI G   +PGSKGE G  GI      G  G PGN G  G  GL G  G  G  G  G+PG KG   DPG     + GS G  G+KG      ++G KG  G+ G PG  G  G  G  G KGD                                         QGE G+ G  GF  +   PGDR      G  GFPGE G  G  G    +G  GL G+SG  G+MG+ G  GS G  G+ G     G+ G  G  GN G PG                    G+PG EG++GE+G  G PG        F G  G+PG  G+ G+S      G+ G+ G  G  G  G PGLPG +    K   +     GR      +   G PG  G PG  G  G  G+ G +   GL+G +G+ G+ G  GIPG++GP+   GD G  GF                      V                G  GS G KG +GP G    +G+PGS G  G+ G  G  G  G +GQ G+ G PG  G+ GE G
Sbjct:   19 PGHDGEPGPAGIPGCNG---TKVHLGFFLIVSLVFYSFPPEYIFSQLKLQKVISRPGTGRVGPKGNTGPPGITGPKGDRGFPGLQGPPGF----PGTPGTSSVGPSGNPGLPGERGQKG---DDGPPGISIPGLPGSEGLAGPPGPPGLPGRPGTSAPGLPGTQGLPGDPGFLGERGQKGDKGDTC---------YNCIGN--------------------------------GILGPKGDPGLPGFPGSPGSPGAPGQKGAMGIPGTNGLPGPPGFPGNPGISGRPGPKGEPGEVIGEIKGEKGDPGFPGPAGSPGLDGVPGRDGTPGIPGPKG------EPGGFALKGDRG--------FPGDIGFPGHPGDRGLMGPPGFGPSGPPGEKGIQGVSGRPGAPGIPGPKGSPGQTVMEKGDFGPPGLPGIPGDAGTPGEPGLPGQPGIPG---VPGSKGEPGIPGIGLPGSAGAKGFPGNTGPPGAPGLAGRPGSDGSPGQPGLPGPKG---DPGFGLPGLPGSPGPAGLKG------SQGPKGESGFPGSPGLPGRAGFDGPVGPKGDSGQNGLPGTPGPPGVPGAGGQGPPGQPGLPGPAGPPGNTGIQGEKGDPGAPGFD-MPGPPGDR------GSPGFPGERGFTGPPGPPGAQGRDGLPGFSGAKGEMGVMGPPGSVGPAGNPG---NPGLPGSKGNDGNPGQPG------------------LSGLPGAEGEKGERGLPGPPGRVDSANLQFKGVKGEPGLPGSSGLSGAKGAAGLPGNSGSPGQIGIPGSPGLPGCLFSSAKNDVAAAWNCGRFNTSYSNVFSGPPGSKGSPGQPGRPGSAGSPGFS---GLKGEKGEPGISG-AGIPGISGPK---GDPGLPGFPEDAEVSISTILVCICNPMFVFVIVS-------------GSPGSPGLKGVDGPTGN---SGLPGSPGLRGESGRPGPQGTPGEKGQPGQDGIPGPSGLKGEPG 887          

HSP 10 Score: 55.0694 bits (131), Expect = 1.466e-6
Identity = 70/174 (40.23%), Postives = 80/174 (45.98%), Query Frame = 3
Query: 4005 GRKGSTGLRGNIGIPGERGDKGIPGLQGKVGNKGVKGDIGDKGFSGNIGDKGYSGISGDKGSFGVKGDKGFQGD--VGMLGKSGLQGDRGQKGIIGFRGTRGIPGSMGLPGEIGEKGDVGPSGIGVKGLKGYQNAV--GIKGRKGEKGLPGFPGRPGKVGDQGDKGPKGMKNMN 4514
            GR G  G  G  GI G +GD+G PGLQG  G  G  G     G SGN G  G  G  GD G  G+    G  G   +           R      G  GT+G+PG  G  GE G+KGD        KG   Y N +  GI G KG+ GLPGFPG PG  G  G KG  G+   N
Sbjct:   74 GRVGPKGNTGPPGITGPKGDRGFPGLQGPPGFPGTPGT-SSVGPSGNPGLPGERGQKGDDGPPGIS-IPGLPGSEGLAGPPGPPGLPGRPGTSAPGLPGTQGLPGDPGFLGERGQKGD--------KGDTCY-NCIGNGILGPKGDPGLPGFPGSPGSPGAPGQKGAMGIPGTN 236          
BLAST of Collagen IV NC1 domain-containing protein vs. Ensembl Xenopus
Match: med27 (mediator complex subunit 27 [Source:Xenbase;Acc:XB-GENE-6054175])

HSP 1 Score: 291.197 bits (744), Expect = 9.342e-79
Identity = 415/1155 (35.93%), Postives = 539/1155 (46.67%), Query Frame = 3
Query:  201 GNKGRQGFPGPRGYQGVSGDKGDV----------GQFGMPGPKGYKGFTGAIGPQGRKGERGIPGSPGYPGKMG---EMGFPGIRGDIGEKGLT---GCDGQQGDFGNPGM---------NGLVGRTGQPGERGDDGDRGLSIIPKY-GLKGNKGSRGLLGRYGRKGEKGFKGIKGYSGIFGIKGNKGYVGPMGRRGPKGDSLGTVIIQSEKGSKGDKGLKGQSGIPCKGFQIEGRMYGRVGSDGPIGDKGIKGEKGLMGEIGQSGIDGARGLNGEKGLPGEAGPRGERGDRGNPGFPGDPGASGADGTRGRQGERGPKGVHGISGADGPRGSRGDKGPSGSLLSCPGRKGEKGFFGIPGIKGDIGNKGYQGHDGDIGEIGFKGEKGYEGPLGPSCSEVEQGFRGTKGESGFPGLRGAKGQRGY---SGNKGIKGKPNFGTGINNPGETGSYGNLGVPGEKGNKGFIGDTGEKGFSGTGKQGPEGPRGDKGDDGVNGQVGMIGMPGIKGDKGSTYPICPFCEKGYKGIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEGRMGLLGSKGRQGYKGGKGFSGSMGDAGEIGYVTISGTTIPGVKGEKGNQGPKGNKGEFGEAG--SRGRKGYSGLKGFKGLIGERGTSFSSGDPGDKGLRGENGKDGVSFAGIPGEKGLKGDKGNRGILGDVGSLSNCATRPITSKGFKGPQGAKGTSGSPGSAGKTGIVGNKGENG----YPGKRGIDGDNGIPGSKGEEGETGIKGHAGRPGNLGKSGLQGLRGEYGVKGDLGIQGIPGRKGVMGDPGPNGYA----MIGSKGDKGIKGLPGIYGAKGDKGRPGYIGIPGFKGETGLIGRS--GLKGDQGEIGEKGIKG-FTFISNNPGDRGLLGNKGLKGFPGELGNKGQVGVCTVRGDQGLRGYSGLIGDM------------------GMKGEQGSKGIVGDYGAASRSGIMGRTGKIGNQGLPGDQXXXXXXXXXXXXXXXXYIGIPGFEGDRGEKGNK---GFPGFPGDIGQPGRLGNPGISTEGVXXXXXXXXXXXXXXXXXXXXXXXXXXKQGDSGIS-IPGRQGIKGEDGTIGLPGEMGEPGPRGDFGQKGNIGITGEFGLQGNRGDDGLKGDDGIPGLNGPRGFI 3473
            G  G++G PG RG +G+ G++G+           G  G PGP G+ GF G  G +G  G+RG+ G PG PG +G     GFPG  G+ G+K      G  G QGD G PG+         NG  G  G PG  G DG +GL     + GL GN G+RG  G  G     GF G KG  G  G +G  G+ G  G  GP+GD       ++E G +G     G   I            G  G +G  G KG  G  G  G  G  GI G RG +   G PG +G RG+RG+ G PG PG PG SG  G +G QGE               +GS GD+      L  P   GE+G  G+PG++G  G +G QG  G  G++G  G  G             +G +G+ G  G PG+ G     G+    GN G  G          PG+ G  G  G PG  G KG  G+ G  GF G         RG  G+ G+ G VGM G+PG+KG KGS          G +G Q                                 G+ G+KGR  ++G KG SG++G  G  G    SGT     KG++G QGP G+  +  E    ++G  G  G+ GFKG+ G +G+    G PG  GL G  G     F G  GE G  G  GN+GILG+VG         I   GF GP+G  G SG PG  G+ G  G+ GE G     PG+RG  G  G PG  G+    GI G  G  G+ G  G++G+ GE+G  G+   +G PG++G++G PG  G+     + G KG  G  GLPG +G  G +G  G  G+PG KG  G  G    GLKG +G  G KG  G  + I   PG  G  G +G +G PG +G  G VG   VRG  G    +GL+GD+                  G+  + G KG++GD G     G  G  G  G  G+PG  G PG+KG KG  G +G++G+ G+ GD+G KG +   G  G  G  GQPG +  P + T                G PG  G+IG  G QGD G   + G  G  G+ G  GLPG  G P P G  G++G +G TG  G +G  G  G  G  G+PG +   G++
Sbjct:  463 GRDGQRGAPGSRGLRGIKGEQGECRCYEGDEAGRGPAGEPGPVGFPGFQGHAGRKGEAGDRGVQGLPGAPGTVGLAGPAGFPGPAGEKGDKVFATEKGSKGAQGDSGFPGVPGRDGYPGRNGRDGSPGFPGPSG-DGIKGLPGSHGFPGLPGNAGARGETGFPG----PGFPGSKGLRGEPGNRGVSGFPGVPGLSGPQGDCYQETDEENEIGKEG----TGCRLIAPPAPAGAPGPPGLPGYNGIRGQKGFPGPHGFDGVFGLKGIKGDRGTDSLPGPPGFSGQRGDRGNAGLPGLPGVPGLSGKPGFKGVQGE---------------KGSVGDR------LGAP--SGEQGNTGLPGLQGLKGTQGDQGIPGLQGKVGTPGTPG------------NKGIKGSPGAPGVPGIPGPAALFGFPGMPGNPGTPGPQGSMGPPGPPGQRGDEGEKGPPGPAGMKGLPGELGVGGFIGV--------RGRHGNPGIPGLVGMHGLPGVKGIKGSP---------GMEGFQ---------------------------------GMKGAKGRPAWRGLKGPSGNIGFPGVKGGNGTSGT-----KGDRGEQGPPGDPPKMPEMMLLTKGETGDQGVSGFKGISGLKGSKGMPGPPGQLGLPGLPGLRSFEF-GDKGETGTPGVIGNQGILGEVGPDGI-----IGFPGFTGPRGTPGISGFPGVPGERGKYGDIGERGDTIDLPGERGTKGQGGTPGLPGQR---GIHGEKGTTGDEGFRGIEGVIGEHGQTGE---KGFPGQQGLVGFPGSQGFPGLPGVPGEKGSSGFPGLPGQHGFPGIRGIAGLDGLPGTKGINGQPGADIIGLKGFKGLSGGKGQPGEASTIVGMPGPAGSKGAEGDQGLPGLIGLPGTVG---VRGLPGFSNKTGLLGDVGPPGPPGLPGFPGPIGRPGLPSKPGVKGVIGDLGLQGNYGAKGIPGDEGKVGVPGLAGIPGAKGLKGSAGFQGFVGVSGYRGDQGPKGLRGDIGEYGLKGPPGQPGPMSEPPLITA-------------EQGYPGAHGIIGHQGVQGDMGPKGLVGTPGAPGQTGKEGLPGVPGWPAPPGSRGEQGPMGRTGPNGFKGASGVPGRAGLPGMPGRSVNIGYL 1490          

HSP 2 Score: 284.648 bits (727), Expect = 1.186e-76
Identity = 393/1133 (34.69%), Postives = 502/1133 (44.31%), Query Frame = 3
Query:  255 GDKGDVGQFGMPGPKGYKGFTGAIGPQGRKGERGIPGSPGYPGKMGEMGFPGIRGDIGEKGLTGCDGQQGDFGNPGMNGLVGRTGQPGE----RGDDGDRGLSIIPKYGLKGNKGSRGLLGRYGRKGEKGFKGIKGYSGIFGIKGNKGYVGPMGRRGPKGDSLGTVIIQSEKGSKGDKGLKGQSGIPCK-GFQIEGRMYGRVGSDGPIGD--KGIKGEKGLMGEIGQSGIDGARGLNGEKGLPGEAGPRGERGDRGNPGFPGDPGASGADGT--------------------------------------RGRQGERGPKGVHGISGADGPRGSRGDKGPSGSLLSCPGRKGEKG---------FFGIPGIKGDIGNKGYQGHDGDIGEI--GFKGEKGYEGPLGPSCSEVEQGFRGTKGESGFPGLRGAKGQRGYSGNKGIKGKPNFGTGINNPGETGSYGNLGVPG---------------------EKGNKGFIGDTGEKGFSG-TGKQGPEGPRGDKGDDGVNGQVGMIGMPGIKGDKGSTYPICPFCEKGYKGIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEGRMGLLGSKGRQGYKGGKGFSGSMGDAGEIGYVTISGTTIPGVKGEKGNQGPKGN-----------KGEFGEAGSRGRKGYSGLKGFKGL-------------------IGERGTSFSSGDPGDKGLRGENGKDGV-SFAGIPGEKGLKGDKGNRGILGDVGSLSNCATRPITSKGFKGPQGAKGTSGSPGSAGKTGIVGNKGENGYPGKRGIDGDNGIPGSKGEEGETGIKGHAGRPGNLGKSGLQGLRGEYG---------------VKGDLGIQGIPGRKGVMGDPGPNGYAMIGSKGDKGIKGLPGIY-------------GAKGDKGRPGYIGIPGFKGETGLIGRSGLKG---------------------DQGEIGEKGIKGFTFISNNPGDRGLLGNKGLKGFPGELGNKGQVGVCTVRGDQGLR---GYSGLIGDMGMKGEQGSKGIVGDYGAASRSGIMGRTGKI-------GNQGLPGDQXXXXXXXXXXXXXXXXYIGIPGFEGDRGEKGNKGFPGFPGDIGQPGRLGNPG 3149
            G  GD G  G  GPKGY+G TG   P  + G  GI G+PG  G  G+ G+PG R  IG KGL G  G+ G  G PG  GL G  G+ GE     GD+  RG +  P  G  G  G +G  GR G  G++G +G+ G  G  G+ G  G+ GP G +G K       +  +EKGSKG +G  G  G+P + G+       G  G  GP GD  KG+ G  G  G  G +G  G  G  G  G PG  G RGE G+RG  GFPG PG SG  G                                        G +G++G  G HG  G  G +G +GD+G + SL   PG  G++G           G+PG+ G  G KG QG  G +G+      GE+G  G  G       QG +GT+G+ G PGL+G  G  G  GNKGIKG P        PG    +G  G+PG                     ++G KG  G  G KG  G  G  G  G RG  G+ G+ G VGM G+PG+KG KGS                                           G EG  G+ G+KGR  ++G KG SG++G  G  G    SGT     KG++G QGP G+           KGE G+ G  G KG SGLKG KG+                    G++G + + G  G++G+ GE G DG+  F G  G +G  G  G  G+ G+ G   +   R  T     G +G KG  G+PG  G+ GI G KG  G  G RGI+G  G  G  GE+G  G +G  G PG+ G  GL G+ GE G               ++G  G+ G+PG KG+ G PG +   + G KG  G KG PG               GA+GD+G PG IG+PG  G  GL G S   G                       G   + G+KG        GD GL GN G KG PG+ G  G  G+  + G +GL+   G+ G +G  G +G+QG KG+ GD G     G  G+ G +         QG PG                 G IG  G +GD G KG  G PG PG  G+ G  G PG
Sbjct:  401 GQTGDTGLKGQRGPKGYQGDTGL--PAFQPGPPGIDGAPGKEGPPGQPGYPGGR--IGMKGLPGFPGRDGQRGAPGSRGLRGIKGEQGECRCYEGDEAGRGPAGEP--GPVGFPGFQGHAGRKGEAGDRGVQGLPGAPGTVGLAGPAGFPGPAGEKGDK-------VFATEKGSKGAQGDSGFPGVPGRDGYPGRNGRDGSPGFPGPSGDGIKGLPGSHGFPGLPGNAGARGETGFPG-PGFPGSKGLRGEPGNRGVSGFPGVPGLSGPQGDCYQETDEENEIGKEGTGCRLIAPPAPAGAPGPPGLPGYNGIRGQKGFPGPHGFDGVFGLKGIKGDRG-TDSLPGPPGFSGQRGDRGNAGLPGLPGVPGLSGKPGFKGVQGEKGSVGDRLGAPSGEQGNTGLPG------LQGLKGTQGDQGIPGLQGKVGTPGTPGNKGIKGSPGAPGVPGIPGPAALFGFPGMPGNPGTPGPQGSMGPPGPPGQRGDEGEKGPPGPAGMKGLPGELGVGGFIGVRGRHGNPGIPGLVGMHGLPGVKGIKGSP------------------------------------------GMEGFQGMKGAKGRPAWRGLKGPSGNIGFPGVKGGNGTSGT-----KGDRGEQGPPGDPPKMPEMMLLTKGETGDQGVSGFKGISGLKGSKGMPGPPGQLGLPGLPGLRSFEFGDKGETGTPGVIGNQGILGEVGPDGIIGFPGFTGPRGTPGISGFPGVPGERGKYGDIGERGDTID-LPGERGTKGQGGTPGLPGQRGIHGEKGTTGDEGFRGIEGVIGEHGQTGEKGFPGQQGLVGFPGSQGFPGLPGVPGEKGSSGFPGLPGQHGFPGIRGIAGLDGLPGTKGINGQPGADIIGLKGFKGLSGGKGQPGEASTIVGMPGPAGSKGAEGDQGLPGLIGLPGTVGVRGLPGFSNKTGLLGDVGPPGPPGLPGFPGPIGRPGLPSKPGVKGVI------GDLGLQGNYGAKGIPGDEGKVGVPGLAGIPGAKGLKGSAGFQGFVGVSGYRGDQGPKGLRGDIGEYGLKGPPGQPGPMSEPPLITAEQGYPGAH---------------GIIGHQGVQGDMGPKGLVGTPGAPGQTGKEGLPGVPG 1443          

HSP 3 Score: 281.182 bits (718), Expect = 1.142e-75
Identity = 479/1450 (33.03%), Postives = 611/1450 (42.14%), Query Frame = 3
Query:   66 LPKFKNSYHYLLLLIMVSQSYYAQDSDPDPFKCL--RICTPDKCQCFGNKGRQGFPGPRGYQGVSGDKGDVGQFGMPGPKGYK---GFTGAIGPQGRKGERGIPGSPGYPGKMGEMGFPGIRGDIGEKGLTGCDGQQGDFGNPGMNGLVGRTGQPGERGDDGDRG----LSIIPKYGLKGNKGSRGL-----------------------------LGRYGRKG------------EKGFKGIKGYSGIFGIKGNKGYVGPMGRRGPKGDSLGTVIIQSEKGSKGDKGLKGQSGIP----CKGFQIEGRMYGRVGSDGPIGDKGIKGE-------------------KGLMGEIGQSGIDGAR----------------------GLNGEKGLPGEAGPRGERGDRGNPGF-PGDPGASGADGTR----------GRQGERGPKGVHGISGADGPRGSRGDKGPSGSLLSC---------------PGRKGEKGFFGIPGIKGDIGNKGYQGHDGDIGEIGFKGEKGYEGPLGPSCSEV---EQGFRGTKGESGFPGLRGAKGQRGYSGNKGIKGKPNFGTGINNPGETGSYGNLGVPGEKGNKGFIGDTGEKGFSGTGKQGPEGPRGDKGDDGVNGQVGMIGMPGIKGDKGSTYPICPFCEKGYKGIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEGRMGLLGSKGRQGYKGGKGFSGSMGDAGEIGYV-TISGTTIPGVKGEKGNQGPKGNKGEFGEAGSRGRKGYSGLKGFKGLIGER-----GTSFSSGDPGDKGLRGENGKDG-------VSFAGIPGEKGLKGDKGNRGILGDVGSLS---------NCAT-------------RPITSKGFKGPQGAKGTSGSPGSAGKTGIVGNKGENGYPGKRGIDGDNGIPGSK------GEEGETGIKGHAGRP---------GNLGKSGLQGLRGEYGVKGDLGIQGIPGRKGVMGDPGPNGYAMIGSKGDKGIKGLPGIYGAKGDKGRPGYIGIPGF----------KGETGLIGRSGLKGDQGEIGEKGIKGFTFISNNPGDRGLLGNKGLKGFPGELGNKGQVG----VCTVRGDQGLRGYSGLIGDMGMKGEQGSKGIVGDYGAASRSGIMGRTGKIGNQGLPGDQXXXXXXXXXXXXXXXXYIGIPGFEGDRGEKGNKGFPGFPGDIGQPGRLGNPGISTEGVXXXXXXXXXXXXXXXXXXXXXXXXXXKQGDSGISIPGRQGIKGEDGT--IGLPGEMGEPGPRGDFGQKGNIGITGEFGLQGNRGDDGLKGDDGIPGLNGPRGFIGDIGFVGFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX----ELGLDGSMGGK---GDNGPRGFNGPTGIPGSKGFEGDKGIRGDIGVKGFQGQH------GEIGFPGLKGVSGENG 3806
            L  +  ++  L ++++   +  A   D         R C+   CQC   KG +G PGP G QG SG  G +G  G+ G KG K   GF G  GP G KG+ G+ G PG  G  G  G  G RG  G     GC+G QGD G  G +G  G  G  G  G  G +G    +SI  K  L+G +GS G                              LG YG KG             +G +  K    I  ++  KG  G  G +G  GD  G   +  EKG +G  G  GQ G P      G   E    G  G  G  G KG KGE                   KG  GEIG  G++G                        G  G+ GL G+ GP+G +GD G P F PG PG  GA G            GR G +G  G  G  G  G  GSRG +G  G    C               PG  G  GF G  G KG+ G++G QG  G  G +G  G  G+ GP G    +V   E+G +G +G+SGFPG+    G+ GY G  G  G P F  G +  G  G  G+ G PG  GN G  G+T   GF G G  G +G RG+ G+ GV+   G  G+PG+ G +G  Y             Q    E           L       G PG  G  G  G +G++G+ G  GF G  G  G  G   T S    PG  G++G++G  G  G  G  G  G+ G+ G++G KG +G+R     G   ++G PG +GL+G  G  G       V   G PG KG+KG  G  G+ G  G  +         N  T                  +G KGP G  G  G PG  G  G +G +G +G PG  G+ G +G+PG K      G EG  G+KG  GRP         GN+G  G++G  G  G KGD G QG PG    M +         G +G  G KG+ G+ G+KG  G PG +G+PG           KGETG  G  G +G  GE+G  GI GF   +   G RG  G  G  G PGE G  G +G       + G++G +G  G  G  G +G  G KG  GD G     G++G  G+ G +G PG QG  G  G +         G PG  G  GEKG+ GFPG PG  G PG  G  G+                                       +PG +GI G+ G   IGL G  G  G +G  G+   I      G+ G  G  G +GD G+PGL G  G +G  G  GF    G  G  G  G  G         +              +LGL G+ G K   GD G  G  G  GIPG+KG +G  G +G +GV G++G        G+IG  GLKG  G+ G
Sbjct:   22 LQHYSVTWCMLFVVLVTCFAGNAHAGDKSYTGPCGGRDCS-QGCQCLPEKGSRGQPGPLGGQGTSGPPGLIGIAGLQGRKGDKGERGFPGVTGPSGDKGQSGVTGFPGADGVPGHTGQGGPRGKPGHD---GCNGTQGDAGVGGSHGSRGPPGISGGFGAKGQKGEPFHVSIEVKNRLRGPRGSPGTAGFIGPQGYRGPRGPPGPPGPQGPQGNRGLGYYGEKGEPGDPGPPGEQPRQGEREQKHKIEILLLQ-YKGAKGDQGEKGNPGDK-GQPAVTGEKGEEGITGFPGQRGFPGNDGNSGASGEIGFPGANGVPGLPGTKGKKGEVGDLGPQGPVTFVNGQQKRKGYEGEIGFPGLNGVYGDDGDPGDPGFPGQNGSPSRFPGQTGDTGLKGQRGPKGYQGDTGLPAFQPGPPGIDGAPGKEGPPGQPGYPGGRIGMKGLPGFPGRDGQRGAPGSRGLRGIKGEQGECRCYEGDEAGRGPAGEPGPVGFPGFQGHAGRKGEAGDRGVQGLPGAPGTVGLAGPAGFPGPAGEKGDKVFATEKGSKGAQGDSGFPGV---PGRDGYPGRNGRDGSPGF-PGPSGDGIKGLPGSHGFPGLPGNAGARGET---GFPGPGFPGSKGLRGEPGNRGVS---GFPGVPGLSGPQGDCY-------------QETDEENEIGKEGTGCRLIAPPAPAGAPGPPGLPGYNGIRGQKGFPGPHGFDGVFGLKGIKGDRGTDSLPGPPGFSGQRGDRGNAGLPGLPGVPGLSGKPGFKGVQGEKGSVGDRLGAPSGEQGNTGLPGLQGLKGTQGDQGIPGLQGKVGTPGTPGNKGIKGSPGAPGVPGIPGPAALFGFPGMPGNPGTPGPQGSMGPPGPPGQRGDEGEKGPPGPAGMKGLPGELGVGGFIGVRGRHGNPGIPGLVGMHGLPGVKGIKGSPGMEGFQGMKGAKGRPAWRGLKGPSGNIGFPGVKGGNGTSGTKGDRGEQGPPGDPPKMPEMMLLTKGETGDQGVSGFKGISGLKGSKGMPGPPGQLGLPGLPGLRSFEFGDKGETGTPGVIGNQGILGEVGPDGIIGFPGFT---GPRGTPGISGFPGVPGERGKYGDIGERGDTIDLPGERGTKGQGGTPGLPGQRGIHGEKGTTGDEGFRGIEGVIGEHGQTGEKGFPGQQGLVGFPGSQ---------GFPGLPGVPGEKGSSGFPGLPGQHGFPGIRGIAGLD-------------------------------------GLPGTKGINGQPGADIIGLKGFKGLSGGKGQPGEASTI-----VGMPGPAGSKGAEGDQGLPGLIGLPGTVGVRGLPGFSNKTGLLGDVGPPGPPGLPGFPGPIGRPGLPSKPGVKGVIGDLGLQGNYGAKGIPGDEGKVGVPGLAGIPGAKGLKGSAGFQGFVGVSGYRGDQGPKGLRGDIGEYGLKGPPGQPG 1388          

HSP 4 Score: 272.707 bits (696), Expect = 5.049e-73
Identity = 431/1318 (32.70%), Postives = 561/1318 (42.56%), Query Frame = 3
Query:  201 GNKGRQGFPGPRGYQGVSGDKGDVGQFGMPGPKGYKGFTGAIGPQGRKGERGIPGSPGYPGKMGEMGFPGIRGDIGEKG-LTGCDGQQ------GDFGNPGMNGL-------------------------VGRTGQPGERGDDGDRGLSIIPKYGLKGNKGSRGLLGRYGRKGEKGFK-------GIKGYSGIFGIKGNKGYVGPMGRRGPKGDSLGTVIIQSEKGSKGDKGLKGQSGIPCKGFQIEGRMYGRVGSDGPIGDKGIKGEKGLMGEIGQSGIDGARGLNGEKGLPGEAGPRGERGDRGNPGFPGDPGASGADGTRGRQGERGPKGVHGISGADGPRGSRGDKGPSGSLLSCPGRKGEKGFFGIPGIKGDIGNKGYQGHDGDIGEIGFKGEKGYEGPLGPSCSEVEQ-----------------------------GFRGTKGESGFPGLRGAKGQRGYSGNKGIKGKPNFGTGINNPGETGSYGNLGVPGEKGNKGFIGDTGEKGFSGTGKQGPEGPRGDK--GDDGVNGQVGMIGMPGIKGDKGSTYPICPFCEKGYKGIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEGRMGLLGSKGRQGYKGGKGFSGSMGDAGEIGYVTISGTTIPGVKGEKGNQGPKGNKGEFGEAGSRGRKGYSGLKGFKGLIGERGTSFSSGDPGDKGLRGENGKDG----VSFAGIPGEKGLKGDKGNRGILGDVGSLSNCATRPITSKGFKGPQGAKGTSGSPGSAGKTGIVGNKGENGYPG-----------KRGIDGDNGIPGSKGEEGETGIKGHAGRPGNLGKSGLQGLRG-EYGVKGDLGIQGIPGRKGVMGDPGPNGYA----MIGSKGDKGIKGLPGIYGAKGDKG----------RPGYIGIPGFKGETGLIGRSGLKGDQGEIGEKGIKGFTFISNN---------PGDRGLLGNKGLKGFPGELGNKGQVGVCTVRGDQGLRGYSGLIGDMGMKGEQGSKGIVGDYGAASRSGIMGRTGKIGNQGLPGDQXXXXXXXXXXXXXXXXYIGIPGFEGDRGEKGNKGFPGFPGDIGQPGRLGNPGISTEGVXXXXXXXXXXXXXXXXXXXXXXXXXXKQGDSGISIPGRQGIKGEDGTIGLPGEMGE---PGPRGDFGQKGNIGITGEFGLQGNRGDDGLKGDDGIPGLNGPRGFIGDIGFVGFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXELGLDGSMGGKGDNGPRGFNGPTGIPGSKGFEGDKGIRG---DIGVKGFQGQHGEIGFPGLKGVSGENGR 3809
            G++G +G PG +G   V+G+KG+ G  G PG    +GF G  G  G  GE G PG+ G PG  G  G  G  GD+G +G +T  +GQQ      G+ G PG+NG+                          G TG  G+RG  G +G + +P +      G  G+ G  G++G  G         G+KG  G  G  G +G  G  G RG KG+       + ++  +G  G  G  G P  GFQ      G  G  G  GD+G++G  G  G +G +G  G  G  GEKG    A  +G +G +G+ GFPG PG    DG  GR G  G  G  G SG DG +G  G  G        PG  G +G  G PG  G  G+KG +G  G+ G  GF G  G  GP G    E ++                             G+ G +G+ GFPG  G  G  G  G KG +G  +        G+ G  GN G+PG  G  G  G  G KG      QG +G  GD+     G  G  G+ G+ G+KG +G         ++G  G+Q                              G++G  G+ G +G KG  G  G  G  G        G  +PG  G  G QG  G  G  G+ G  G KG  G  G KGL GE G        G  G+RG +G  G    V   G+PG KG+KG  G  G  G  G+    A R     G KGP G  G  G  G  G +G  G++GE G PG            +G  GD G+ G KG  G  G KG  G PG LG  GL GLR  E+G KG+ G  G+ G +G++G+ GP+G        G +G  GI G PG+ G +G  G           PG  G  G  G  GL G+ G+ G++G  G++G +G   +            PG +GL+G  G +GFPG  G  G+ G     G  G  G+ G+ G  G+ G  G+KGI G  GA    G+ G  G  G +G PG+              +   +G+PG  G +G +G++G PG  G  G  G  G PG S +                                    +P + G+KG  G +GL G  G    PG  G  G  G  GI G  GL+G+ G  G  G  G  G  GP+G  GDIG  G +G  G  G   E      E                    G+ G  G +GD GP+G  G  G PG  G EG  G+ G     G +G QG  G  G  G KG SG  GR
Sbjct:  276 GDQGEKGNPGDKGQPAVTGEKGEEGITGFPG---QRGFPGNDGNSGASGEIGFPGANGVPGLPGTKGKKGEVGDLGPQGPVTFVNGQQKRKGYEGEIGFPGLNGVYGDDGDPGDPGFPGQNGSPSRFPGQTGDTGLKGQRGPKGYQGDTGLPAF----QPGPPGIDGAPGKEGPPGQPGYPGGRIGMKGLPGFPGRDGQRGAPGSRGLRGIKGEQGECRCYEGDEAGRGPAGEPGPVGFP--GFQ------GHAGRKGEAGDRGVQGLPGAPGTVGLAGPAGFPGPAGEKGDKVFATEKGSKGAQGDSGFPGVPGR---DGYPGRNGRDGSPGFPGPSG-DGIKGLPGSHG----FPGLPGNAGARGETGFPG-PGFPGSKGLRGEPGNRGVSGFPGVPGLSGPQGDCYQETDEENEIGKEGTGCRLIAPPAPAGAPGPPGLPGYNGIRGQKGFPGPHGFDGVFGLKGIKGDRGTDSLPGPPGFSGQRGDRGNAGLPGLPGVPGLSGKPGFKGV-----QGEKGSVGDRLGAPSGEQGNTGLPGLQGLKGTQG---------DQGIPGLQ------------------------------GKVGTPGTPGNKGIKGSPGAPGVPGIPGPAALFGFPG--MPGNPGTPGPQGSMGPPGPPGQRGDEGEKGPPGPAGMKGLPGELGVG------GFIGVRGRHGNPGIPGLVGMHGLPGVKGIKGSPGMEGFQGMKGAKGRPAWR-----GLKGPSGNIGFPGVKGGNGTSGTKGDRGEQGPPGDPPKMPEMMLLTKGETGDQGVSGFKGISGLKGSKGMPGPPGQLGLPGLPGLRSFEFGDKGETGTPGVIGNQGILGEVGPDGIIGFPGFTGPRGTPGISGFPGVPGERGKYGDIGERGDTIDLPGERGTKGQGGTPGLPGQRGIHGEKGTTGDEGFRGIEGVIGEHGQTGEKGFPGQQGLVGFPGSQGFPGLPGVPGEKGSSGFPGLPGQHGFPGIRGIAGLDGLPGTKGINGQPGA-DIIGLKGFKGLSGGKGQPGE--------------ASTIVGMPGPAGSKGAEGDQGLPGLIGLPGTVGVRGLPGFSNK----------TGLLGDVGPPGPPGLPGFPGPIGRPGLPSKPGVKGVIGDLGLQGNYGAKGIPGDEGKVGVPGLAGIPGAKGLKGSAGFQGFVGVSGYRGDQGPKGLRGDIGEYGLKGPPGQPGPMSEPPLITAEQGYPGAH-------------GIIGHQGVQGDMGPKGLVGTPGAPGQTGKEGLPGVPGWPAPPGSRGEQGPMGRTGPNGFKGASGVPGR 1474          

HSP 5 Score: 253.062 bits (645), Expect = 5.563e-67
Identity = 175/482 (36.31%), Postives = 238/482 (49.38%), Query Frame = 3
Query: 3990 IRGLQGRKGSTGLRGNI------------------GIPGERGDKGIPGLQGKVGNKGVKGDIGDKGFSGNIGDKGYSGISGDKGSFGVKGDKGFQGDVGMLGKSGLQGDRGQKGII---GFRGTRGIPGSMGLPGEI-GEKGDVGPSGI-------GVKGLKGYQNAVGIKGRKGEKGLPGFPGRPGKVGDQGDKGPKGMKNMNTXXXXXXXXXXXXXXXXXXXXXXXXXLPGDMGEIGPNGPIGYADNGFLYATHSQSKDFPPCHGGGSPLYNGYSLLAIHGDIDSVTMDLGTPGSCLKNFSTIPFVNCFLERNTFYGGRCHVNMRNSRSYWLSTLQSYMSSPQPPSKMDDYISRCSVCQTKTTVMAFHSQKSDWQMTKCPYGWQKLWAGFSFPMAVQASRSGSNQPFSSPGSCLKHFRSLPFIECNNHNSNCNHWRDGVSYYMTAVDSENQFVKAQGKVLKSQTDIMNSISKCVVCQRDM 5348
            +RGL G    TGL G++                  G+P +      PG++G +G+ G++G+ G KG  G+ G  G  G++G  G+ G+KG  GFQG VG+ G  G QG +G +G I   G +G  G PG M  P  I  E+G  G  GI       G  G KG     G  G+ G++GLPG PG P   G +G++GP G    N                   G  G  G+PG  G   P  P    + G+L   HSQ+ + P C  G + L+ GYSLL   G   +   DLG  GSCL+ FST+PF+ C        G  C+   RN +SYWLST       P    ++  YISRCSVC+     +A HSQ  D  +  CP GW+ LW G+SF M   A   G  Q  SSPGSCL+ FR+ PFIECN     C+++ +  S+++T +D   Q        LK+   I   IS+C VC +++
Sbjct: 1266 VRGLPGFSNKTGLLGDVGPPGPPGLPGFPGPIGRPGLPSK------PGVKGVIGDLGLQGNYGAKGIPGDEGKVGVPGLAGIPGAKGLKGSAGFQGFVGVSGYRGDQGPKGLRGDIGEYGLKGPPGQPGPMSEPPLITAEQGYPGAHGIIGHQGVQGDMGPKGLVGTPGAPGQTGKEGLPGVPGWPAPPGSRGEQGPMGRTGPN-------------------GFKGASGVPGRAGL--PGMPGRSVNIGYLLVKHSQTDEEPMCPVGMARLWTGYSLLYFEGQEKAHNQDLGLAGSCLQRFSTMPFLYC------NPGDVCYYANRNDKSYWLSTTAPLPMMPVVEEEIRPYISRCSVCEAPAVAIAVHSQ--DVSIPHCPDGWRSLWIGYSFLMHTAAGDEGGGQSLSSPGSCLEDFRATPFIECNGGRGTCHYFANKYSFWLTTIDEPFQ-SSPPADTLKAGL-IRTHISRCQVCMKNL 1710          

HSP 6 Score: 249.21 bits (635), Expect = 9.938e-66
Identity = 431/1328 (32.45%), Postives = 543/1328 (40.89%), Query Frame = 3
Query:  201 GNKGRQGFPGPRGYQGVSGDKGDVGQFGMPGPKGYKGFTGAIGPQGRKGERGIPGSPGYPGKMGEMGFPGIRGDIGEKGLTGCDGQQGDFGNPGM------NGLVGRTGQPGERGDDG---------------------DRGLSII---------------PKYGLKGNKGSRGLL-----GRYGRKGEKGFKGIKGYSGIFGIKGNKGYVGPMGRRGPKGDSLGTVIIQSEKGSKGDKGLKGQSGIP-CKGFQIEGRMYGRVGSDGPIG-DKGIKGEKGLMGEIGQSGIDGAR----------------------GLNGEKGLPGEAGPRGERGDRGNPGF-PGDPGASGADGTRGRQGER-------GPKGVHGISGADGPRGSRGDKGPSGSLLSCPGRKGEKGFFGIPGIKGDIGNKGYQGHDGDIGEIGFKGEKGYEGPLGPSCSEVEQGFRGTKGESGFPGLRGAKGQRGYSGNKGIKGKPNFGTGINNPGETGSYGNLGVPGEKGNKGFIGDTGEKGFSGTGKQGPEGPRGDKGDDGVNGQVGMIGMPGIKGDKGSTYPICPFCEKGYKGIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEGRMGLLGSKGRQGYKGGKGFSGSMGDA-------GEIGYVTISGTTIPGVKGEKGNQGPKGN--KGEFGEAGSRGRKGYSGLKGFKGLIGERGTSFSSGDPGDKGLRGENGKDGVSFAGIPGEKGLKGDKGNRGILGDVGSLSNCATRPITSKGFKGPQGAKGTSGSPGSAGKTGIVGNKGENGYPGKRGIDGDNGIPGSKGEEGETGIKGHAGRPGNLGKSGLQGL------------RGEYGVKGDLGIQGIPGRKGVMGDPGPNGYAMIGSKGDKGIKGLPGIYGAKGDKGRPGYIGIPGFKGETGLIGRSGLKGDQGEIGEKGIKGFTFISNNPGDRGLLGNKGLKGFPGELGNKGQVGVCT--VRGDQGLRGY---SGLIGDMGMKGEQGSKGIVGDYGAAS----RSGIMGRTGKIGNQGLPGDQXXXXXXXXXXXXXXXXYIGIPGFEGDRGEKGNKGFPGFPGDIGQPGRLGNPGISTEGVXXXXXXXXXXXXXXXXXXXXXXXXXXKQGDSGISIPGRQGIKGEDGTIGLPGEMGEPGPRGDFGQKGNIGITGEFGLQGNRGDDGLKGDDGIPGLNGPRGFIGDIGFVGFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXELGLDGSMGGKGDNGPRGFNGPTGIPGSKGFEGDKGIRGD-----IGVKGF------QGQHGE----IGFPGLKGVSGENGRQ 3812
            G +GR+G  G RG+ GV+G  GD GQ G+    G+ G  G  G  G+ G RG PG  G  G  G+ G  G  G  G  G++G  G +G  G P        N L G  G PG  G  G                     +RGL                  P+ G +  K    +L     G  G +GEKG  G KG   + G KG +G  G  G+RG  G+           G+ G+ G  G +G+P   G + +    G +G  GP+    G +  KG  GEIG  G++G                        G  G+ GL G+ GP+G +GD G P F PG PG  GA G  G  G+        G KG+ G  G DG RG+ G +G    L    G +GE   +     +GD   +G  G  G +G  GF+G  G +G         E G RG +G  G PG  G  G  G+ G  G KG   F T   + G  G  G  GVPG  G  G  G  G  GF G        P GD G  G+ G  G  G+PG  G +G T     F   G+ G                               +G  G  G++G  G+ G  G SG  GD         EIG        I           P      G  G+ G  G  G+ G+ G KG+ G+RGT    G PG  G RG+ G  G+   G+PG  GL G  G +G+ G+ GS+ +    P   +G  G  G +G  G+ G  G  G+ G  G  G PG +GI G  G PG  G  G   + G  G PGN G  G QG              GE G  G  G++G+PG  GV G  G  G    G+ G  G+ G+ G+ G KG KG PG  G  G KG  G     GLKG  G IG  G+KG    S   GDRG       +G PG+     ++ + T    GDQG+ G+   SGL G  GM G  G  G+ G  G  S      G  G  G IGNQG+ G+             G  G IG PGF G RG  G  GFPG PG+ G+ G +G                                   ++GD+ I +PG +G KG+ GT GLPG+      RG  G+KG  G  G  G++G  G+ G  G+ G PG  G  GF G  GF G  G                                     G  GS G  G  G  GF G  GI G  G  G KGI G      IG+KGF      +GQ GE    +G PG  G  G  G Q
Sbjct:   95 GLQGRKGDKGERGFPGVTGPSGDKGQSGV---TGFPGADGVPGHTGQGGPRGKPGHDGCNGTQGDAGVGGSHGSRGPPGISGGFGAKGQKGEPFHVSIEVKNRLRGPRGSPGTAGFIGPQGYRGPRGPPGPPGPQGPQGNRGLGYYGEKGEPGDPGPPGEQPRQGEREQKHKIEILLLQYKGAKGDQGEKGNPGDKGQPAVTGEKGEEGITGFPGQRGFPGND-------GNSGASGEIGFPGANGVPGLPGTKGKKGEVGDLGPQGPVTFVNGQQKRKGYEGEIGFPGLNGVYGDDGDPGDPGFPGQNGSPSRFPGQTGDTGLKGQRGPKGYQGDTGLPAFQPGPPGIDGAPGKEGPPGQPGYPGGRIGMKGLPGFPGRDGQRGAPGSRG----LRGIKGEQGECRCY-----EGDEAGRGPAGEPGPVGFPGFQGHAGRKG---------EAGDRGVQGLPGAPGTVGLAGPAGFPGPAGEKGDKVFATEKGSKGAQGDSGFPGVPGRDGYPGRNGRDGSPGFPG--------PSGD-GIKGLPGSHGFPGLPGNAGARGETG----FPGPGFPG------------------------------SKGLRGEPGNRGVSGFPGVPGLSGPQGDCYQETDEENEIGKEGTGCRLIAPPAPAGAPGPPGLPGYNGIRGQKGFPGPHGFDGVFGLKGIKGDRGTDSLPGPPGFSGQRGDRGNAGL--PGLPGVPGLSGKPGFKGVQGEKGSVGDRLGAPSGEQGNTGLPGLQGLKGTQGDQGIPGLQGKVGTPGTPGNKGIKGSPGAPGVPGIPGPAALFGFPGMPGNPGTPGPQGSMGPPGPPGQRGDEGEKGPPGPAGMKGLPGELGVGGFIGVRGRH--GNPGIPGLVGMHGLPGVKGIKGSPGMEGFQGMKGAKGRPAWRGLKGPSGNIGFPGVKGGNGTSGTKGDRGE------QGPPGDPPKMPEMMLLTKGETGDQGVSGFKGISGLKGSKGMPGPPGQLGLPGLPGLRSFEFGDKGETGTPGVIGNQGILGE------------VGPDGIIGFPGFTGPRGTPGISGFPGVPGERGKYGDIG-----------------------------------ERGDT-IDLPGERGTKGQGGTPGLPGQ------RGIHGEKGTTGDEGFRGIEGVIGEHGQTGEKGFPGQQGLVGFPGSQGFPGLPGVP-----------------------------------GEKGSSGFPGLPGQHGFPGIRGIAGLDGLPGTKGINGQPGADIIGLKGFKGLSGGKGQPGEASTIVGMPGPAGSKGAEGDQ 1252          

HSP 7 Score: 234.187 bits (596), Expect = 3.649e-61
Identity = 342/978 (34.97%), Postives = 442/978 (45.19%), Query Frame = 3
Query:  201 GNKGRQGFPGPRGYQGVSGDKGDVGQFGMPGPKG--------YKGFTGAIGPQGRKGERGIPGSPGYPGKMGEMGFPGIRGDIGEKGLTGCDGQQGD----------FGNPGM----------------------NGLVGRTGQPGERGDDGDRGLSIIPKYGLKGNKGSRGLLGR---YGRKGEKGFKGIKGYSGIFGIKGNKGYVGPMGRRGPKGDSLGTVIIQSEKGSKGDKGLKGQSGIPCKGFQIEGRMYGRVGSDGPIGDKGIKGEKGLMGEIGQSGIDGARGLNGEKGLPG---------------------EAGPRGERGDRGNPGFPGDPGASGADGTRGRQGERGPKGVHGISGADGPRGSRGDKGPSGSLLSCPGRKGEKGFFGIPGIKGDIGNKGYQGHDGDIGEIGFKGEKGYEGPLG-----PSCSEVEQGFRGTKGESGFPGLRGAKGQRGYSGNKGIKGKPNFGTGINNPGETGSYGNLGVPGEKGNKGFIGDTGEKGFSGTGKQGPEGPRGDKGDDGVNGQVGMIGMPGIKGDKGSTYPICPFCEKGYKGIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEGRMGLLGSKGRQGYKGGKGFSGSMGDAGEIGYVTISGTTIPGVKGEKGNQGPKGNKGEFGEAGSRGRKGYSGLKGFKGLIGERGTSFSSGDPGDKGLRGENGKDG--VSFAGIPGEKGLKGDKGNRGILGDVGSLSNCATRPITSKGFKGPQG------------------AKGTSGSPGSAGKTGIVGNKGENGYPGKRGIDGDNG---IPGSKGEEGETGIKGHAGRPGNLGKSGLQGLRGEYGVKGDLG---IQGIPGRKGVMGDPGPNGYAMIGSKGDKGIKGLPGIYGAKGDKGRPGYIGIPGFKGET---GLIGRSGLKGDQGEIGEKGIKGFTFISNNPGDRGLLGNKGLKGFPGELGNKGQVGVCTVRGDQ 2840
            G +G  GFPG  G  G  G  G  G  G PGP G          GF G  G  G +GE G PG PG+PG  G  G PG RG  G  G+ G  G QGD           G  G                       NG+ G+ G PG  G DG  GL      G+KG++G+  L G     G++G++G  G+ G  G+ G+ G  G+ G  G +G  GD LG      E+G+ G  GL+G  G   +G Q    + G+VG+ G  G+KGIKG  G     G  GI G   L G  G+PG                     + G +G  G  G  G PG+ G  G  G RGR G  G  G+ G+ G  G +G +G  G  G      G KG KG     G+KG  GN G+ G  G  G  G KG++G +GP G     P    + +G  G +G SGF G+ G KG +G  G  G  G P    G+ +  E G  G  G PG  GN+G +G+ G  G    G  G  GPRG  G  G  G  G  G  G  G++G T  +    E+G KG         + G  G+ G +G  G KG  GDEG  G+ G  G  G  G KGF G  G  G  G     G  +PGV GEKG+ G  G  G+ G  G RG  G  GL G KG+ G+ G     G  G KGL G  G+ G   +  G+PG  G KG +G++G+ G +G       R +   GF    G                    G  G P   G  G++G+ G  G  G +GI GD G   +PG  G  G  G+KG AG  G +G SG +G +G  G++GD+G   ++G PG+ G M +P      +   +G  G  G+ G  G +GD G  G +G PG  G+T   GL G  G     G  GE+G  G T  +   G  G+ G  GL G PG   N G + V   + D+
Sbjct:  563 GAQGDSGFPGVPGRDGYPGRNGRDGSPGFPGPSGDGIKGLPGSHGFPGLPGNAGARGETGFPG-PGFPGSKGLRGEPGNRGVSGFPGVPGLSGPQGDCYQETDEENEIGKEGTGCRLIAPPAPAGAPGPPGLPGYNGIRGQKGFPGPHGFDGVFGLK-----GIKGDRGTDSLPGPPGFSGQRGDRGNAGLPGLPGVPGLSGKPGFKGVQGEKGSVGDRLGAP--SGEQGNTGLPGLQGLKGT--QGDQGIPGLQGKVGTPGTPGNKGIKGSPG---APGVPGIPGPAALFGFPGMPGNPGTPGPQGSMGPPGPPGQRGDEGEKGPPGPAGMKGLPGELGVGGFIGVRGRHGNPGIPGLVGMHGLPGVKGIKGSPGMEGFQ----GMKGAKGRPAWRGLKGPSGNIGFPGVKGGNGTSGTKGDRGEQGPPGDPPKMPEMMLLTKGETGDQGVSGFKGISGLKGSKGMPGPPGQLGLPGL-PGLRS-FEFGDKGETGTPGVIGNQGILGEVGPDGI--IGFPGFTGPRGTPGISGFPGVPGERGKYGDIGERGDTIDLP--GERGTKG---------QGGTPGLPGQRGIHGEKGTTGDEGFRGIEGVIGEHGQTGEKGFPGQQGLVGFPGSQGFPG--LPGVPGEKGSSGFPGLPGQHGFPGIRGIAGLDGLPGTKGINGQPGADII-GLKGFKGLSGGKGQPGEASTIVGMPGPAGSKGAEGDQGLPGLIGLPGTVGVRGLP--GFSNKTGLLGDVGPPGPPGLPGFPGPIGRPGLPSKPGVKGVIGDLGLQGNYGAKGIPGDEGKVGVPGLAGIPGAKGLKGSAGFQGFVGVSGYRGDQGPKGLRGDIGEYGLKGPPGQPGPMSEP----PLITAEQGYPGAHGIIGHQGVQGDMGPKGLVGTPGAPGQTGKEGLPGVPGWPAPPGSRGEQGPMGRTGPNGFKGASGVPGRAGLPGMPGRSVNIGYLLVKHSQTDE 1499          

HSP 8 Score: 219.935 bits (559), Expect = 9.681e-57
Identity = 411/1223 (33.61%), Postives = 512/1223 (41.86%), Query Frame = 3
Query:  525 GDDGDRGLSIIPKYGLKG---------NKGSRGLLGRYGRKGEKGFKGIKGYSGIFGIKGNKGYVGPMGRRGPKGDSLGTVIIQSEKGSKGDKGLKGQSGIPCKGFQIEGRMYGRVGSDGPIGDKGIKGEKGLMGEIGQSGIDGARGLNGEKGLPGEAGPRGERGDRGNPGFPGDPGASGADGTRG--------------------RQGERGPKGVHGIS-------GADGPRGSRGDKGPSGSLLSCPGRKGEKGFFGIPGIKGDIGNKGYQGHDGDIG---------EIGFKGEKGYEGPLGPSCSEV----EQGFRGTKGESGFPGLRGAKGQRGYSGNKGIKGKPNFGTGINNPGETGSYGNLGVPGEKGNKGFIGDTGEKGFS--------GTGKQ-------------GPEGPRGDKGDDGVNGQVGMIGMPGIKGDKGSTYPICPFCEKGYKGIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEGRMGLLGSKGRQGYKGGKGFSGSMGDAGEIGYVTISGTTIPGVKGEKGNQGPKGNKGEFGEAGSRGRKGYSGLKGFKGLIGE--RGTSFSSGDPGDKGLRGENGKDGVSFAGIPGEKGLKGDKGNRGILGDVGSLSNCATRPITSKGFKGPQG-AKGTSGSPGSAGKTGI----------------------VGNKGENGYPGKRGIDGDNGIPGSKGEEGETGIKGHAGRPGNLGKSGLQGLRGEYGVKGDLGIQGIPGRKGVMGDPGPNGYAMIGSKGDKGIKGLPGIYGAK---GDKGRPGY---IGIPGFKGETGLIGRSGLKGDQGEIGEKGIKGFTFISNNP---------------------GDRGLLGNKGLKGFPGELGNKGQVGVCTVRGDQGLRGYSGLIGDMGMKGEQGSKGIVGDYGAASRSGIMGRTGKIGNQGLPGDQXXXXXXXXXXXXXXXXYIGIPGFEGDRGEKGNKGFPGFPGDIGQPGRLGNPGISTEGVXXXXXXXXXXXXXXXXXXXXXXXXXXKQGDSGIS-IPGRQGIKGEDGTIGLPGEMGEPGPRG----DFGQKGNIGITGEFGLQGNRGDDGLKGDDGIPGLNGPRGFIGDIGFVGFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXELGLDGSMGGKGDNGPRGFNGPTGIPGSKGFEGDKGIRGDIGVKGFQGQHGEIGFPGLKGVSGENGRQ 3812
            G D  +G   +P+ G +G           G  GL+G  G +G KG KG +G+ G+ G  G+KG  G  G  G  G       +    G  G +G  G  G  C G Q +  + G  GS GP G  G  G KG  GE     I+    L G +G PG AG  G +G RG  G PG PG  G  G RG                    RQGER  K  H I        GA G +G +G+ G  G   +  G KGE+G  G PG +G  GN G  G  G+IG           G KG+KG  G LGP         +Q  +G +GE GFPGL G  G  G  G+ G  G+   G+    PG+TG   + G+ G++G KG+ GDTG   F           GK+             G +G  G  G DG  G  G  G+ GIKG++G          + Y+G +   G  GE G  G  G +G+ G KG  GD G  GL G+ G  G  G  GF G  G+ G+  + T         KG KG QG  G  G  G  G  GR G  G  GF G  G+  +G   S G PG  G  G  G+ G    G PG KGL+G+ GNRG+ G  G             G  GPQG     +      GK G                        G +G+ G+PG  G DG  G+ G KG+ G   + G  G  G  G  G  GL G  GV G   + G PG KGV G+ G  G  +    G++G  GLPG+ G K   GD+G PG    +G PG  G  G+ G  G  G  G  G   + GF  +  NP                     G++G  G  G+KG PGELG  G +G   VRG  G  G  GL+   GM G  G KGI G  G     G+ G  G+   +GL G  G                IG PG +G  G  G KG  G  G  G P ++    + T+G                           + GD G+S   G  G+KG  G  G PG++G PG  G    +FG KG  G  G  G QG  G+ G  G  G PG  GPRG  G  GF G                             +  +      + L G  G KG  G  G  G  GI G KG  GD+G RG  GV G  GQ GE GFPG +G+ G  G Q
Sbjct:   57 GRDCSQGCQCLPEKGSRGQPGPLGGQGTSGPPGLIGIAGLQGRKGDKGERGFPGVTGPSGDKGQSGVTGFPGADG-------VPGHTGQGGPRGKPGHDG--CNGTQGDAGVGGSHGSRGPPGISGGFGAKGQKGEPFHVSIEVKNRLRGPRGSPGTAGFIGPQGYRGPRGPPGPPGPQGPQGNRGLGYYGEKGEPGDPGPPGEQPRQGEREQK--HKIEILLLQYKGAKGDQGEKGNPGDKGQP-AVTGEKGEEGITGFPGQRGFPGNDGNSGASGEIGFPGANGVPGLPGTKGKKGEVGDLGPQGPVTFVNGQQKRKGYEGEIGFPGLNGVYGDDGDPGDPGFPGQ--NGSPSRFPGQTG---DTGLKGQRGPKGYQGDTGLPAFQPGPPGIDGAPGKEGPPGQPGYPGGRIGMKGLPGFPGRDGQRGAPGSRGLRGIKGEQGEC--------RCYEGDEAGRGPAGEPGPVGFPGFQGHAGRKGEAGDRGVQGLPGAPGTVGLAGPAGFPGPAGEKGDKVFAT--------EKGSKGAQGDSGFPGVPGRDGYPGRNGRDGSPGFPGPSGDGIKGLPGSHGFPGLPGNAGARGETGFPGPGFPGSKGLRGEPGNRGVSGFPGV-----------PGLSGPQGDCYQETDEENEIGKEGTGCRLIAPPAPAGAPGPPGLPGYNGIRGQKGFPGPHGFDGVFGLKGIKGDRGTDSLPGPPGFSGQRGDRGNAGLPGLPGVPG---LSGKPGFKGVQGEKGSVGDRLGAPSGEQGNTGLPGLQGLKGTQGDQGIPGLQGKVGTPGTPGNKGIKGSPGAPGVPGIPGPAALFGFPGMPGNPGTPGPQGSMGPPGPPGQRGDEGEKGPPGPAGMKGLPGELGVGGFIG---VRGRHGNPGIPGLV---GMHGLPGVKGIKGSPGMEGFQGMKGAKGRPAWRGLKGPSGN---------------IGFPGVKGGNGTSGTKGDRGEQGPPGDPPKMPEMMLLTKG---------------------------ETGDQGVSGFKGISGLKGSKGMPGPPGQLGLPGLPGLRSFEFGDKGETGTPGVIGNQGILGEVGPDGIIGFPGFTGPRGTPGISGFPGV----------------------PGERGKYGDIGERGDTIDLPGERGTKGQGGTPGLPGQRGIHGEKGTTGDEGFRGIEGVIGEHGQTGEKGFPGQQGLVGFPGSQ 1162          

HSP 9 Score: 200.29 bits (508), Expect = 8.470e-51
Identity = 338/1030 (32.82%), Postives = 425/1030 (41.26%), Query Frame = 3
Query: 1809 GSKGRQGYKGGKGFSGSMGDAGEIGYVTISGTTIPGVKGEKGNQGPKGNKGEFGEAGSRGRKGYSGLKGFKGLIGERG----TSFSSGDPGDKGLRGENGKDGVS-----------------------FAGIPGEKGLKGDKGNRGILGDVGSLSNCATRPITSKGFKGPQGAKGTSGSPGSAGKTGI-VGNKGENGYPGK---RGIDGDNGIPGSKGEEGETGI-------KGHAGRPGNLGKSGLQGLRGEYGVKGDLGIQGIPGRKGVMGDPGPNGY-------------AMIGSKGDKGIKGLPGIYGAKGDKGRPGYIGIPGF--------KGETGLIGRSGLKGDQGEIGEKGIKGFTFISNNPGDRGLLGNKGLKGFPGELGNKGQVGVCTVRGDQ--------------------------------GLRGYSGLIGDMGMKGEQGSKGIVGDYGAASRSGIMGRTGKIGNQGLPGDQXXXXXXXXXXXXXXXXYIGIPGFEGDRGEKGNKGFPGFPGDIGQPGRLGNPGISTEGVXXXXXXXXXXXXXXXXXXXXXXXXXXKQGDSGISIPGRQGI-KGEDGTIGLPGEMGEPGPRGDFGQKGNIGITGEFGLQGNRGDDGLKGDDGIPGLNGPRGFIGDIGFVGFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX-ELGLDGSMGGKGDNGPRGFNGPTGI------------PGSKGFEGDKGIRGDIGVKGFQGQHGEIGFPGLK---GVSGENGRQXXXXXXXXXXXXXXXXVCMQPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEVGESIRGLQGRKGSTGLRGNIGIPGERGDKGIPGLQG-------KVGNKGVKGDIGDKGFSGNIGDKGYSGISGDKGSFGVKGDKGFQGDVGMLGKSGLQGDRGQK-GIIGFRGTRGIPGSMGLPGEIGEKGDVGPSGIGVKGLKGYQNAVGIKGRKGEKGLP------------GFPGRPGKVGDQGDKGPKGMKNMN 4514
            G+KG QG KG  G  G     GE G   I+G   PG +G  GN G  G  GE G  G+ G  G  G KG KG +G+ G     +F +G    KG  GE G  G++                       F G  G+ GLKG +G +G  GD G        P    G  G  GA G  G PG  G  G  +G KG  G+PG+   RG  G  G+ G KGE+GE          +G AG PG +G  G QG  G  G  GD G+QG+PG  G +G  GP G+                GSKG +G  G PG+ G  G  GR G  G PGF        KG  G  G  GL G+ G  GE G  G  F  +  G RG  GN+G+ GFPG  G  G  G C    D+                                G+RG  G  G  G  G  G KGI GD G  S               LPG                      PGF G RG++GN G PG PG    PG  G PG   +GV                           QG+ G S+  R G   GE G  GLPG  G  G +GD G  G  G  G  G  GN+G  G  G  G+PG+ GP    G  G  G  G+ G +G  G  G  G      +        +     ELG+ G +G +G +G  G  G  G+            PG +GF+G KG +G    +G +G  G IGFPG+K   G SG  G +G  G  G      +  +  +                                 GE G+  +G+ G KG +GL+G+ G+PG  G  G+PGL G         G  G  G IG++G  G +G  G  G  G  G  G  G  GF G  G  GK G  G+RG    + G RGT+G  G+ GLPG+ G  G+ G +G   +G +G +  +G  G+ GEKG P            GFPG PG  G++G  G  G+   +
Sbjct:  273 GAKGDQGEKGNPGDKGQPAVTGEKGEEGITG--FPGQRGFPGNDGNSGASGEIGFPGANGVPGLPGTKGKKGEVGDLGPQGPVTFVNGQQKRKGYEGEIGFPGLNGVYGDDGDPGDPGFPGQNGSPSRFPGQTGDTGLKGQRGPKGYQGDTG-------LPAFQPGPPGIDGAPGKEGPPGQPGYPGGRIGMKGLPGFPGRDGQRGAPGSRGLRGIKGEQGECRCYEGDEAGRGPAGEPGPVGFPGFQGHAGRKGEAGDRGVQGLPGAPGTVGLAGPAGFPGPAGEKGDKVFATEKGSKGAQGDSGFPGVPGRDGYPGRNGRDGSPGFPGPSGDGIKGLPGSHGFPGLPGNAGARGETGFPGPGFPGSK-GLRGEPGNRGVSGFPGVPGLSGPQGDCYQETDEENEIGKEGTGCRLIAPPAPAGAPGPPGLPGYNGIRGQKGFPGPHGFDGVFGLKGIKGDRGTDS---------------LPGP---------------------PGFSGQRGDRGNAGLPGLPG---VPGLSGKPGF--KGV---------------------------QGEKG-SVGDRLGAPSGEQGNTGLPGLQGLKGTQGDQGIPGLQGKVGTPGTPGNKGIKGSPGAPGVPGIPGPAALFGFPGMPGNPGTPGPQGSMGPPGPPGQRGDEGEKGPPGPAGMKGLPGELGVGGFIGVRGRHGNPGIPGLVGMHGLPGVKGIKGSPGMEGFQGMKGAKGRPAWRGLKGPSGNIGFPGVKGGNGTSGTKGDRGEQGPPGDPPKMPEMMLLTK---------------------------------GETGD--QGVSGFKGISGLKGSKGMPGPPGQLGLPGLPGLRSFEFGDKGETGTPGVIGNQGILGEVGPDGIIGFPGFTGPRGTPGISGFPGVPGERGKYGDIGERGDTIDLPGERGTKGQGGTPGLPGQRGIHGEKGTTGD--EGFRGIEGVIGEHGQTGEKGFPGQQGLVGFPGSQGFPGLPGVPGEKGSSGFPGLPGQH 1186          

HSP 10 Score: 190.274 bits (482), Expect = 1.047e-47
Identity = 263/766 (34.33%), Postives = 333/766 (43.47%), Query Frame = 3
Query: 1791 GRMGLLGSKGRQGYKGGKGFSGSMGDAGEIGYVTISGTTIPGVKGEKGNQGPKGNKGEFGE-----AGSRGRKGYSGLKGFKGLIGERGTSF------SSGDPGDKGLRGENGKDGVSFAGIPGEKGLKGDKGNRGILGDVGSLSNCATRPIT----SKGFKGPQGAKGTSGSPGSAGKTGIVGNKGENGYPGKRGIDGDNGIPGSKG------EEGETGIKGHAGRP---------GNLGKSGLQGLRGEYGVKGDLGIQGIPGRKGVMGDPGPNGYAMIGSKGDKGIKGLPGIYGAKGDKGRPGYIGIPGF----------KGETGLIGRSGLKGDQGEIGEKGIKGFTFISNNPGDRGLLGNKGLKGFPGELGNKGQVG----VCTVRGDQGLRGYSGLIGDMGMKGEQGSKGIVGDYGAASRSGIMGRTGKIGNQGLPGDQXXXXXXXXXXXXXXXXYIGIPGFEGDRGEKGNKGFPGFPGDIGQPGRLGNPGIS----TEGVXXXXXXXXXXXXXXXXXXXXXXXXXXKQGDSGISIPGRQGIKGEDGTIGLPGE----MGEPGPRGDFGQKGNIGITGEFGLQGNRGDDGLKG---------------------------DDGIPGLNGPRGFIGDIGFVGFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXELGLDGSMGGKGDNGPRGFNGPTGIPGSKGFEGDKGIRGDIG---VKGFQGQHG----------EIGFPGLKGVSGENGRQ 3812
            G  G+ G +G     G  GFSG  GD G  G   + G  +PG+ G+ G +G +G KG  G+     +G +G  G  GL+G KG  G++G         + G PG+KG++G  G  GV   GIPG   L G  G  G  G  G   +            +G KGP G  G  G PG  G  G +G +G +G PG  G+ G +G+PG KG       EG  G+KG  GRP         GN+G  G++G  G  G KGD G QG PG    M +         G +G  G KG+ G+ G+KG  G PG +G+PG           KGETG  G  G +G  GE+G  GI GF   +   G RG  G  G  G PGE G  G +G       + G++G +G  G  G  G +G  G KG  GD G     G++G  G+ G +G PG QG  G  G +         G PG  G  GEKG+ GFPG PG  G PG  G  G+     T+G+                            G  G  I G +G KG  G  G PGE    +G PGP G  G +G+ G+ G  GL G  G  GL G                             G+P   G +G IGD+G  G                         G KG  G  G  G  GL G  G KG  G  GF G  G+ G +G +G KG+RGDIG   +KG  GQ G          E G+PG  G+ G  G Q
Sbjct:  716 GLKGIKGDRGTDSLPGPPGFSGQRGDRGNAGLPGLPG--VPGLSGKPGFKGVQGEKGSVGDRLGAPSGEQGNTGLPGLQGLKGTQGDQGIPGLQGKVGTPGTPGNKGIKGSPGAPGV--PGIPGPAALFGFPGMPGNPGTPGPQGSMGPPGPPGQRGDEGEKGPPGPAGMKGLPGELGVGGFIGVRGRHGNPGIPGLVGMHGLPGVKGIKGSPGMEGFQGMKGAKGRPAWRGLKGPSGNIGFPGVKGGNGTSGTKGDRGEQGPPGDPPKMPEMMLLTKGETGDQGVSGFKGISGLKGSKGMPGPPGQLGLPGLPGLRSFEFGDKGETGTPGVIGNQGILGEVGPDGIIGFPGFT---GPRGTPGISGFPGVPGERGKYGDIGERGDTIDLPGERGTKGQGGTPGLPGQRGIHGEKGTTGDEGFRGIEGVIGEHGQTGEKGFPGQQGLVGFPGSQ---------GFPGLPGVPGEKGSSGFPGLPGQHGFPGIRGIAGLDGLPGTKGI---------------------------NGQPGADIIGLKGFKGLSGGKGQPGEASTIVGMPGPAGSKGAEGDQGLPGLIGLPGTVGVRGLPGFSNKTGLLGDVGPPGPPGLPGFPGPIGRPGLPSKPGVKGVIGDLGLQG-----------------------NYGAKGIPGDEGKVGVPGLAGIPGAKGLKGSAGFQGFVGVSGYRGDQGPKGLRGDIGEYGLKGPPGQPGPMSEPPLITAEQGYPGAHGIIGHQGVQ 1415          

HSP 11 Score: 137.502 bits (345), Expect = 1.286e-31
Identity = 168/471 (35.67%), Postives = 208/471 (44.16%), Query Frame = 3
Query:  198 FGNKGRQGFPGPRGYQGVSGDKGDVGQFGMPGPKGYKGFTGAIGPQGRKGERGIPGSPGYPGKMGEMG-------FPGIRGDIGEKGLTGCDGQQG---------DFGNPGMNGLVGRTGQPGERGDDGDRGLSIIPKYGLKGNKGSRGLLGRYGRKGEKGFKGIKGYSGIFGIKGNKGYVGPMGRRGPKGDSLGTVIIQSEKGSKGDKGLKGQSGIPCKGFQIEGRMYGRVGSDGPIGDKGIKGEKGLMGEIGQSGIDG------------------------------------ARGLNGEKGLPGEAGPRGERGDRGNPGFPGDPGASGADGTRGRQGERGPKGVHGISGADGPRGSRGD------KGPSGS---------LLSCPGRKGEKGFFGIPGIKGDIGNKGYQGHDGDIGEIGFKGEKGYEGPLGPSCSEVEQGFRGTKGESGFPGLRGAKGQRGYSGNKG 1409
            FG+KG  G PG  G QG+ G+ G         P G  GF G  GP+G  G  G PG PG  GK G++G        PG RG  G+ G  G  GQ+G         D G  G+ G++G  GQ GE+G  G +GL      G  G++G  GL G  G KG  GF G+ G  G  GI+G  G  G  G +G  G     +I     G KG KGL G  G P +   I G M G  GS G  GD+G+ G  GL G +G  G+ G                                     +G+ G+ GL G  G +G  GD G  G PG  G  GA G +G  G +G  GV G  G  GP+G RGD      KGP G          + +  G  G  G  G  G++GD+G KG  G  G  G+ G +G  G  G   P  S  EQG  G  G +GF G  G  G+ G  G  G
Sbjct: 1032 FGDKGETGTPGVIGNQGILGEVG---------PDGIIGFPGFTGPRGTPGISGFPGVPGERGKYGDIGERGDTIDLPGERGTKGQGGTPGLPGQRGIHGEKGTTGDEGFRGIEGVIGEHGQTGEKGFPGQQGL-----VGFPGSQGFPGLPGVPGEKGSSGFPGLPGQHGFPGIRGIAGLDGLPGTKGINGQPGADII-----GLKGFKGLSGGKGQPGEASTIVG-MPGPAGSKGAEGDQGLPGLIGLPGTVGVRGLPGFSNKTGLLGDVGPPGPPGLPGFPGPIGRPGLPSKPGVKGVIGDLGLQGNYGAKGIPGDEGKVGVPGLAGIPGAKGLKGSAGFQGFVGVSGYRGDQGPKGLRGDIGEYGLKGPPGQPGPMSEPPLITAEQGYPGAHGIIGHQGVQGDMGPKGLVGTPGAPGQTGKEGLPGVPGWPAPPGSRGEQGPMGRTGPNGFKGASGVPGRAGLPGMPG 1482          

HSP 12 Score: 122.479 bits (306), Expect = 5.090e-27
Identity = 150/412 (36.41%), Postives = 197/412 (47.82%), Query Frame = 3
Query:  201 GNKGRQGFPGPRGYQGVSGDKGDVGQFGMPGPKGYKGFTGAIGPQGRKGERGIPGSPGYPGKMGEMGFPGIRGDIGEKGLTGCDGQQGDFGNPGMNGLVGRTGQPGERGDDGDRGLSIIPKYGLKGNKGSRG-------LLGRYGRKGEKGFKGIKGYSGIFGIKGNKGYVGPMGRRGPKGDSLGTVIIQSEKGSKGDKGLKGQSGIPCKGFQIEGRMYGRVGSDGPIGDKGIKGEKGLMGEIGQSGIDGARGLNGEKGLPG---------EAGPRGERGD------RGNPGFPGD-------------PGASGADGTRGRQGERGPKGVHGISGADGPRGSRGDKGPSGSLLSCPGRKGEK---------GFFGIPGIKGDIGNKGYQGHDGDIGEIGFKGEKGYEGPLGP 1304
            G KG+ G PG  G +G+ G+KG  G       +G++G  G IG  G+ GE+G PG  G  G  G  GFPG+ G  GEKG +G  G  G  G PG+ G+ G  G PG +G +G  G  II   G KG  G +G       ++G  G  G KG +G +G  G+ G+ G  G  G  G     G  LG V      G  G  G  G+ G+P K   ++G + G +G  G  G KGI G++G +G  G +GI GA+GL G  G  G         + GP+G RGD      +G PG PG              PGA G  G +G QG+ GPKG+ G  GA G  G  G  G  G   + PG +GE+         GF G  G+ G  G  G  G   +IG +  K  +  E P+ P
Sbjct: 1103 GTKGQGGTPGLPGQRGIHGEKGTTGD------EGFRGIEGVIGEHGQTGEKGFPGQQGLVGFPGSQGFPGLPGVPGEKGSSGFPGLPGQHGFPGIRGIAGLDGLPGTKGINGQPGADIIGLKGFKGLSGGKGQPGEASTIVGMPGPAGSKGAEGDQGLPGLIGLPGTVGVRGLPGFSNKTG-LLGDVGPPGPPGLPGFPGPIGRPGLPSK-PGVKG-VIGDLGLQGNYGAKGIPGDEGKVGVPGLAGIPGAKGLKGSAGFQGFVGVSGYRGDQGPKGLRGDIGEYGLKGPPGQPGPMSEPPLITAEQGYPGAHGIIGHQGVQGDMGPKGLVGTPGAPGQTGKEGLPGVPG-WPAPPGSRGEQGPMGRTGPNGFKGASGVPGRAGLPGMPGRSVNIGYLLVKHSQTDEEPMCP 1504          

HSP 13 Score: 77.411 bits (189), Expect = 2.963e-13
Identity = 76/193 (39.38%), Postives = 95/193 (49.22%), Query Frame = 3
Query: 3990 IRGLQGRKGSTGLRGN-IGIPGERGD------KGIPGLQGKVGNKGVKGDIGDKGFSGNIGDKGYS---GISGDKGSFGVKGDKGFQGDVGMLGKSGLQGDRGQKGIIGFRGTRGIPGSMGLPGEIGEKGDVGPSGIGVKGLKGYQ----------------NAVGIKGRKGEKGLPGFPGRPGKVGDQGDKG 4490
            + G +G+ G  G RG+ I +PGERG        G+PG +G  G KG  GD G +G  G IG+ G +   G  G +G  G  G +GF G  G+ G+ G  G  G  G  GF G RGI G  GLPG  G  G  G   IG+KG KG                     G KG +G++GLPG  G PG VG +G  G
Sbjct: 1079 VPGERGKYGDIGERGDTIDLPGERGTKGQGGTPGLPGQRGIHGEKGTTGDEGFRGIEGVIGEHGQTGEKGFPGQQGLVGFPGSQGFPGLPGVPGEKGSSGFPGLPGQHGFPGIRGIAGLDGLPGTKGINGQPGADIIGLKGFKGLSGGKGQPGEASTIVGMPGPAGSKGAEGDQGLPGLIGLPGTVGVRGLPG 1271          

HSP 14 Score: 74.3294 bits (181), Expect = 2.110e-12
Identity = 77/203 (37.93%), Postives = 96/203 (47.29%), Query Frame = 3
Query: 3984 ESIRGLQGRKGSTGLRGNIGIPGERGDKGIPGLQGKVGNKGVKGDIGDKGFSGNIGDKGYSGISGDKGSFGVKGDKGFQGD-----VGMLGKSGLQGDRGQKG----IIGF---RGTRGIPGSMGLPGEIGEKGDVGPSGIGVKGLKGYQNAVGI---------------KGRKGEKGLPGFPGRPGKVGDQGDKGPKGMKNM 4511
            E  RG++G  G  G  G  G PG++G  G PG QG  G  GV G+ G  GF G  G  G+ GI G  G  G+ G KG  G      +G+ G  GL G +GQ G    I+G     G++G  G  GLPG IG  G V     GV+GL G+ N  G+                G  G  GLP  PG  G +GD G +G  G K +
Sbjct: 1129 EGFRGIEGVIGEHGQTGEKGFPGQQGLVGFPGSQGFPGLPGVPGEKGSSGFPGLPGQHGFPGIRGIAGLDGLPGTKGINGQPGADIIGLKGFKGLSGGKGQPGEASTIVGMPGPAGSKGAEGDQGLPGLIGLPGTV-----GVRGLPGFSNKTGLLGDVGPPGPPGLPGFPGPIGRPGLPSKPGVKGVIGDLGLQGNYGAKGI 1326          

HSP 15 Score: 72.0182 bits (175), Expect = 1.258e-11
Identity = 77/218 (35.32%), Postives = 99/218 (45.41%), Query Frame = 3
Query:  168 RICTPDKCQCFGNKGRQGFPGPRGYQGVSGDKGDVGQFGMPGPKGYKGFTGAIGPQGRKGERGIPGSPGYPGKMGEMGFPGIRGDIGEKGLTGCDGQQGDFGNPGMNGLVGRTGQPGERGDDGDRGLSIIPKYGLKGNKGSRGLLGRYGRKGEKGFKGIKGYSGIFGIKGNKGYVGPMGRRGPKGDSLGTVIIQSEKGSKGDKGLKGQSGIPCKGFQI 821
            R   P K    G  G  G  G  G +G+ GD+G VG  G+ G  G KG  G+ G QG  G  G           G+ G  G+RGDIGE GL G  GQ G    P +  +    G PG  G        II   G++G+ G +GL+G  G  G+ G +G+ G  G     G++G  GPMGR GP G           KG+ G  G  G  G+P +   I
Sbjct: 1299 RPGLPSKPGVKGVIGDLGLQGNYGAKGIPGDEGKVGVPGLAGIPGAKGLKGSAGFQGFVGVSGY---------RGDQGPKGLRGDIGEYGLKGPPGQPGPMSEPPL--ITAEQGYPGAHG--------IIGHQGVQGDMGPKGLVGTPGAPGQTGKEGLPGVPGWPAPPGSRGEQGPMGRTGPNG----------FKGASGVPGRAGLPGMPGRSVNI 1487          

HSP 16 Score: 60.077 bits (144), Expect = 5.000e-8
Identity = 60/156 (38.46%), Postives = 78/156 (50.00%), Query Frame = 3
Query: 4101 KGVKGDIGDKGFSGNIGDKGYSGISGDKGSFGVKGDKGFQGDVGMLGKSGLQGDRGQKGIIGFRGTRGIPGSMGLPGEIGEKGDVGPSGI-----GVKGLKGYQNAVGIKGRKG---------------EKGLPG-FPGRPGKVGDQGDKGPKGMK 4505
            KG KGD G+KG   N GDKG   ++G+KG  G+ G  G +G  G  G SG  G+      IGF G  G+PG  G  G+ GE GD+GP G      G +  KGY+  +G  G  G               + G P  FPG+ G  G +G +GPKG +
Sbjct:  272 KGAKGDQGEKG---NPGDKGQPAVTGEKGEEGITGFPGQRGFPGNDGNSGASGE------IGFPGANGVPGLPGTKGKKGEVGDLGPQGPVTFVNGQQKRKGYEGEIGFPGLNGVYGDDGDPGDPGFPGQNGSPSRFPGQTGDTGLKGQRGPKGYQ 418          

HSP 17 Score: 55.4546 bits (132), Expect = 1.146e-6
Identity = 81/274 (29.56%), Postives = 106/274 (38.69%), Query Frame = 3
Query: 3993 RGLQGRKGSTGLRGNIGIPGERGDKGIPGLQGKVGNKG----------VKGDIGDKGFSGNIGDKGYSGI-------------------------SGDKGSFGVKGDKGFQGDVGML----GKSGLQGDRGQ----------------KGIIGF---RGTRGIPGSMGLPGEIGEKGDVGPSGIGVKGLKGYQNAVGIKGRKGEKGLPGFPGRPGKVGDQGDKGPKGMKNMNTXXXXXXXXXXXXXXXXXXXXXXXXXLPGDMGEIGPNGPIGY 4640
            RG  G  G++G  G IG PG  G  G+PG +GK G  G          V G    KG+ G IG  G +G+                         +GD G  G +G KG+QGD G+     G  G+ G  G+                KG+ GF    G RG PGS GL G  GE+G+        +  +G +   G  G  G  G PGF G  G+ G+ GD+G +G                               LPG  G +G  GP G+
Sbjct:  308 RGFPGNDGNSGASGEIGFPGANGVPGLPGTKGKKGEVGDLGPQGPVTFVNGQQKRKGYEGEIGFPGLNGVYGDDGDPGDPGFPGQNGSPSRFPGQTGDTGLKGQRGPKGYQGDTGLPAFQPGPPGIDGAPGKEGPPGQPGYPGGRIGMKGLPGFPGRDGQRGAPGSRGLRGIKGEQGEC-------RCYEGDEAGRGPAGEPGPVGFPGFQGHAGRKGEAGDRGVQG-------------------------------LPGAPGTVGLAGPAGF 543          

HSP 18 Score: 55.0694 bits (131), Expect = 1.619e-6
Identity = 55/141 (39.01%), Postives = 69/141 (48.94%), Query Frame = 3
Query: 4065 KGIPGLQGKVGNKGVKGDIGDKGF---SGNIGDKGYSGISGDKGSFGVKGDKGFQGDVGMLGKSGLQGDRGQKGIIGFRGTRGIPGSMGLPGEIGEKGDVGPSGIGVKGLKGYQNAVGIKGRKGEKGLPGFPGRPGKVGDQ 4478
             G PGL G  G +G KGD G++GF   +G  GDKG SG++G  G+ GV G  G  G  G  G  G  G +G  G+ G  G+RG PG  G              G G KG KG    V I+ +   +G  G PG  G +G Q
Sbjct:   85 SGPPGLIGIAGLQGRKGDKGERGFPGVTGPSGDKGQSGVTGFPGADGVPGHTGQGGPRGKPGHDGCNGTQGDAGVGGSHGSRGPPGISG--------------GFGAKGQKGEPFHVSIEVKNRLRGPRGSPGTAGFIGPQ 211          
BLAST of Collagen IV NC1 domain-containing protein vs. Ensembl Mouse
Match: Col4a6 (collagen, type IV, alpha 6 [Source:MGI Symbol;Acc:MGI:2152695])

HSP 1 Score: 279.641 bits (714), Expect = 3.001e-75
Identity = 431/1239 (34.79%), Postives = 536/1239 (43.26%), Query Frame = 3
Query:  201 GNKGRQGFPGPRGYQGVSGDKGDVGQFGMPGPKGYKGFTGAIGPQGRKGERGIPGS-----------PGYPGKMGEMGFPGIRGDIGEKGLTGCDGQQGDFGNPGMNGLVGRTGQPGERGDDGDRGLSIIPKYGLKG-----------------------------NKGSRGLLGRYGRKGEKGFKGIKGYSGIFGIKGNKGYVGPMGRRGPKGDSLGTVIIQSEKGSKGDKGLKGQSGIPCKGFQIEGRMYGRVGSDGPIGDKGIKGEKGLMGEIGQSGIDGARGLNGEKGLPGEAGPRGERGDRGNPGFPGDPGASGADGTRGRQGERGPKGVHGISG--------------------------ADGPRGSRGDKGPSGSLLSC--PGRKGEKGFFGIPGIKGDIGNKGYQGHDGDIGEIGFKGEKGYEGPLGPSCSEVEQGFRGTKGESGFPGLRGAKGQRGYSGNKGIKGKPNF--GTGINNPGETGSYGNLGVPGEKGNKGFIGDTGEKGFSG-TGKQGPEGPRGDKGDD------------------GVNGQVGMIGMPGIKGDKGSTYPICPFCEKGYKGIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEGRMGLLGSKGRQGYKGGKGFSGSMGDAGEIGYVTISGTT-IPGVKGEKGNQGPKGNKGEFGEAGSRGRKGYSGLKGFKGLIGERGTSFSSGDPGDKGLRGENGKDGVSFAGIP-------GEKGLKGDKGNRGI---------------------LGDVGSLSNCATRPITSKGFKGPQGAKGTSGSPGSAGKTGIVGNKGENGYPGKRGIDGDNGIPGSKGEEGET-GIKGHAGRPGNLGKSGLQGLRGEYGVKGDLGIQGIPG---RKGVMGDPG-PNGYAMIGSKGDKGIKGLPGIYGAKGDKGRPG---YIGIPGFKGETGLIGRSGLKGDQGEIGEKGIKGFTFISNNPGDRGLLGNKGLKGFPGELGNKGQVGVCTVRGDQGLRGYSGLIGDMGMKGEQGSKGIVGDYGAASRSGIMGRTGKIGNQGLPGDQXXXXXXXXXXXXXXXX---------YIGIPGFEGDRGEKGNKGFPGFPGDIGQPGRLGNPGISTEGVXXXXXXXXXXXXXXXXXXXXXXXXXXKQGDSGISIPGRQGIKGEDGTIGLPGEMGEPGPRGDFGQKGNIGITGEFGLQGNRGDDG---------LKGDDGIPGLNGPRGFIGDIG 3485
            G KG  G PGPRG  G  G +G  G+ G  G  G+ G  G  G +G KG+ G+ G             GYPG  G +G PG+RGD G +G  G  G  G     G+ G +G  G PG +GD G+ G +   + GL G                               G  GL G  G KG +G KG+KG SG    +G    +GP G  G  G   G + +Q  KG+KGD G +G SG             G  G  GP G  G+KG+KG       S + G +G  G +G PG AG     G  G PG PG PG  G DG  G  GERG  G+ G  G                           DG  G +G +G  G  L C  PG  G  GF G PG  G  G +G  G  G  G  G KG  G  G +         GF G +GE G PG  G  G+ GY G  G  G P F    G     E G+ G  G+ G  G+KGF GD+G  G  G  GK G  GP+G++G+                   G+ G  G  G PG+ G  G           G KG                                G +G  GS G++G  G KG  G  G  G +G   +SG T +PG++G+KG +G  G  G  G  G  G  G  GLKGF G  G+ G    +G  G+KG RG+ G  G+S    P       GEKG +G  G+ G                       G   ++     RP  S G  G +G  G  GS G AG  G+ G  G  G  G  G+ G  GIPG KG++G+T GI G  G  G  G+ G +G++G+ G+ GD G  G  G   + G+ GDPG P    + G  G  G  GLPG  G  G  GRPG    IG  GF G  GL G +GL G +G  G  G      I+  PG  GL G KG +G PG            V GD G +G  G  GD G  G QG  G  G  G +  S I G+ G  G  GL G++G PG  G  G  G            + GIPG +G +G +G  GF G  G++G  G  G PG+   G  G  G  G PG  G  G  G  G  G QG  G   P  + ++   G +GLPG  G PG  GD G +G++G+ G  GL G  G DG         + GD G+PGL GP GF G  G
Sbjct:  288 GEKGILGLPGPRGPMGSEGIQGHPGRQGKKGTSGFPGINGFPGIKGEKGDIGVRGPDSFTDADGAVISGYPGDPGVLGLPGLRGDEGVQGQRGPSGTPGLPSLTGLPGALGPQGFPGLKGDQGNSGRTTFGEAGLPGRVGLPGLPGLPGPSGPPGRTFETGHLSNIEPGFPGLQGEQGPKGHQGLKGVKGDSGFCACEGGAPNIGPHGEPGLPGIQ-GPIGLQGFKGTKGDPGSRGASG-----------PAGTPGLFGPRGQTGLKGKKGEPTVSRGSKMSGDKGDPGPQGTPGLAG---TPGKDGRPGLPGLPGIQG-DGGSGFPGERGLPGLPGEKGHDGPIGPPGIGLPGPPGPRGLPGDKGVDGLPGQQGLRGAQGVTLPCIIPGSYGPSGFPGAPGFPGSKGARGLPGIPGKPGTHGSKGGPGSPGLM---HLPGLPGFPGVRGEKGLPGFPGLPGKDGYPGKAGSPGLPGFKGAAGDIFGAENGASGEQGLQGLPGDKGFPGDSGLPGPKGLNGKPGMLGPKGERGNPGTSGPPGQPGPSGSTDPFGIKGTSGFPGAPGLPGISG---------HPGKKG------------------------------QRGDIGQPGSTGKRGLPGIKGLPGPQGSPGFLGSPGLSGVTGLPGIEGQKGEKGSSGPVGFPGLPGLPGLPGADGLKGFSGSFGKVGQPGQTGTSGEKGDRGDPGPVGISSPRPPMLNLWFKGEKGSRGSAGSDGFPGPRGDKGEPGIPGLPGPPGATGQTNTIKGLNGRP-GSPGSMGRRGLPGLKGSLGIAGFPGMPGKSGSQGLTGTSGLLGATGIPGLKGDQGQTLGISGSPGPKGQPGELGFKGVKGKDGLVGDRGYPGNKGDGGKVGITGDPGFPGSPGLQGISGMNGDPGLPGSSGHLGSIGRPGPSGLIGPKGFPGAPGLHGLNGLPGTKGTHGTPGAS----ITGVPGPAGLPGPKGERGVPG-----------IVIGDPGKQGSKGQKGDQGSPGLQGPAGTPGAPGISLPSVIAGQPGDPGRPGLDGERGRPGPPGPPGPPGPSSDQGDPGDSGFPGIPGLQGFKGNQGLPGFSGLSGELGLKGMRGEPGLM--GTPGKIGQPGDPGFPGMKGKAGPRGFSGPQGAPG-HTPIAEAMQVPPGPLGLPGIDGIPGLIGDPGSQGSVGLQGSKGLPGIPGKDGPSGLPGPSGILGDPGLPGLQGPPGFEGAPG 1449          

HSP 2 Score: 258.07 bits (658), Expect = 1.387e-68
Identity = 385/1064 (36.18%), Postives = 477/1064 (44.83%), Query Frame = 3
Query:  201 GNKGRQGFPGPRGYQGVSGDKGDVG----QFGMP--GPKGYKGFTGAIGPQGRKGERGIPGSPGYPGKMGEMGFPGIRGDIGEKGLTGCDGQ---------QGDFGNPGMNGLVGRTGQPGERGDDGDRGLSIIPKYGLKGNKGSRGLLGRYGRKGEKGF--------------------KGIKGYSGIFGIKGNKGYVGPMGRRGPKGDSLGTVIIQSEKGSKGDKGLKGQSGIP-CKGFQIEGRMYGRVGSDGPIGDKGIKGEKGLMGEIGQSGIDGARGLNGEKGLPG-----------EAGPRGERGDRGNP---GFPGDPGASGADGTRGRQGERGPKGVHGISGADGPRGSRGDKGPSGSLLSCPGRKGEKGFFGIPGIKGDIGNKGYQGHDGDIGEIGFKGEKGYEGPLGPSCSEVEQGFRGTKGESGFPGLRGAKGQRGYSGNKGIKG--------KPNFGTGINNPGETGSYGNLGVPGEKGNKGFIGDTGEKGFSGTGKQGPEGPRGD---KGDDGVNGQVGMIGMPGIKGDKGSTYPICPFCEKGYKGIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEGRMGLLGSKGRQGYKGGKGFSGSMGDAGEIGYVTISGTT-IPGVKGEKGNQGPKGNKGEFGEAGSRGRKGYSGLKGFKGLIGERGTSFSSGDPGDKGLRGENGKDGVSFAGIPGEKGLKGDKGNRGILGDVGSLSNCATRPITSKGFKGPQGAKGTSGSPGSAGKTGIVGNKGENGYPGK--RGIDGDNGIPGSKGEEGETGIKGHAGRPGNLGKSGLQGLRGEYGVKGDLGIQGIPGRK------GVMGDPGPNGY-------------------AMIGSKGDKGIKGLPGIYGAKGDKGRPGYIGIPGFKGETGLIGRSGLKGDQGEIGEKGIKGFTFISNNPGDRGLLGNKGLKGFPGELGNKGQVGVCTVRGDQGLRGYSGLIGDMGMKGE---QGSKGIVGDYGAASRSGIMGRTGKIGNQGLPGDQXXXXXXXXXXXXXXXXYIGIPGFEGDRGEKGNKGFPGFPGD 3116
            G  G QG  GP+G+QG+ G KGD G    + G P  GP G  G  G  GP G +G +G  G PG  G  G  G PG+ G  G+ GL G  G+          GD G+PG  G  G  G PG+ G  G  GL  I   G  G  G RGL G  G KG  G                     KG+ G  G  G++G +G   P    G  G S G        GSKG +GL G  G P   G +      G +   G  G  G++GEKGL G  G  G DG  G  G  GLPG           E G  GE+G +G P   GFPGD G  G  G  G+ G  GPKG  G  G  GP G  G  G +       G KG  GF G PG+ G  G+ G +G  GDIG+ G  G++G  G  G    +   GF G+ G SG  GL G +GQ+G  G+ G  G              G+   G +GS+G +G PG+ G  G  GD G+ G  G     P  P  +   KG+ G  G  G  G PG +GDKG           G  G                N +KG  G  G PG  GR GL G KG  G  G  G  G  G  G  G   + G T IPG+KG++G     G  G  G  G  G  G+ G+KG  GL+G+RG   + GD G  G+ G+ G     F G PG +G+ G  G+ G+ G  G L +     I   G  G  G KG  G+PG  G  G+ G KG +G PG    G+ G  G+PG KGE G  GI    G PG  G  G +G +G  G++G  G  G PG        G  GDPG  G                    +  G  GD G  G+PG+ G KG++G PG+ G+ G  G  G+ G  GL G  G+IG+ G  GF  +    G RG  G +G  G    +    QV    + G  G+ G  GLIGD G +G    QGSKG+ G  G    SG+ G +G +G+ GLPG Q                  G PGFEG  G +G  G PG PG 
Sbjct:  456 GFPGLQGEQGPKGHQGLKGVKGDSGFCACEGGAPNIGPHGEPGLPGIQGPIGLQGFKGTKGDPGSRGASGPAGTPGLFGPRGQTGLKGKKGEPTVSRGSKMSGDKGDPGPQGTPGLAGTPGKDGRPGLPGLPGIQGDGGSGFPGERGLPGLPGEKGHDGPIGPPGIGLPGPPGPRGLPGDKGVDGLPGQQGLRGAQGVTLPCIIPGSYGPS-GFPGAPGFPGSKGARGLPGIPGKPGTHGSKGGPGSPGLMHLPGLPGFPGVRGEKGLPGFPGLPGKDGYPGKAGSPGLPGFKGAAGDIFGAENGASGEQGLQGLPGDKGFPGDSGLPGPKGLNGKPGMLGPKGERGNPGTSGPPGQPGPSGSTDPF----GIKGTSGFPGAPGLPGISGHPGKKGQRGDIGQPGSTGKRGLPGIKGLPGPQGSPGFLGSPGLSGVTGLPGIEGQKGEKGSSGPVGFPGLPGLPGLPGADGLK--GFSGSFGKVGQPGQTGTSGEKGDRGDPGPVGI--SSPRPPMLNLWFKGEKGSRGSAGSDGFPGPRGDKGEPGIPGLPGPPGATG--------------QTNTIKGLNGRPGSPGSMGRRGLPGLKGSLGIAGFPGMPGKSGSQGLTGTSGLLGATGIPGLKGDQGQT--LGISGSPGPKGQPGELGFKGVKGKDGLVGDRGYPGNKGDGGKVGITGDPG-----FPGSPGLQGISGMNGDPGLPGSSGHLGS-----IGRPGPSGLIGPKGFPGAPGLHGLNGLPGTKGTHGTPGASITGVPGPAGLPGPKGERGVPGIV--IGDPGKQGSKGQKGDQGSPGLQGPAGTPGAPGISLPSVIAGQPGDPGRPGLDGERGRPGPPGPPGPPGPSSDQGDPGDSGFPGIPGLQGFKGNQGLPGFSGLSGELGLKGMRGEPGLMGTPGKIGQPGDPGFPGMKGKAGPRGFSGPQGAPGH-TPIAEAMQVPPGPL-GLPGIDGIPGLIGDPGSQGSVGLQGSKGLPGIPGKDGPSGLPGPSGILGDPGLPGLQ------------------GPPGFEGAPGNQGPIGQPGMPGH 1462          

HSP 3 Score: 256.914 bits (655), Expect = 2.522e-68
Identity = 520/1530 (33.99%), Postives = 652/1530 (42.61%), Query Frame = 3
Query:  189 CQCFGNKGRQGFPGPRGYQGVSGDKGDVGQFGMPGPKGYKGFTGAIGPQGRKGERGIPGSPGYPGKMGEMGFPGIRGDIGEKGLTGCDGQQGDFGNPGMNGLVGRTGQPGERGDDGDRGLSIIPKYGLKGNKGSRGLLGRYGRKGEKGFKGIKGYSGI-----------------------FGIKGNKGYVGPMGRRGPKGDSLGTVIIQSEKGSKGDKGLKGQSGIPCKGFQIEGRMYGRVGSDGPIGDKGIKGEKGLMGEIGQSGIDGARGLNGEK---GLPGEAGPRGERGDRGNPGFPGDPGASGADGTRGRQGERGPKGVHGISGADGPRGSRGDKGPSG-----SLLSCPGRKGEKGFFGIPGIKGDIGNKGY--------------------------------QGHDGDIGEIGFKGEKGYEGPLGPSCSEVEQGFRGTKGESGF---------------PGLRGAKGQRGYSGNKGIKGKPNFGTGINNPGETGSYGNLGVPGEKGNKGFIGDTGEKG---------FSG-TGKQGPEGPRGDKGDDGVNGQVGMIGMPGIKGDKGSTYPICPFCEKGYKGIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEGRMGL------------------LGSKGRQGYKGGKGFSGSMGDAGEIGYVTISGTT----------------IPGVKGEKGNQGPKGNKGEFGEAGSRGRKGYSGLKGFKGLIGER--GTSFSSGDPGDKGLRGENGKDGVSFAGIPGEKGLKGDKGNRGILGDVGS-LSNCATRPITSKGFKGPQGAKGTSGSPGSAGKTGIVGNKGENGYPGKRGIDGDNGIPGSKGEEGETGIKGHAGRPGNLGKSGLQGLRGEYGVKGDLGIQGIPGRKGVMGDPGPNGYA----------------MIGSKGDKGIKGLPGIYGAKGDKGRPGYIGIPG---------FKGETGLIGRSGLKGDQGEIGEKG-------------------IKGFTFISNNPGDRGLLGNKGLKGFPGELGNKGQVGVCTVRGDQGLRGYSGLIGDM---GMKGEQG-SKGIVGDYGAASRSGIMGRTGKIGNQGLPGDQXXXXXXXXXXXXXXXXYIGIPGFEGDRGEKGNKGFPGFPGDIGQPGRLGNPGISTEGVXXXXXXXXXXXXXXXXXXXXXXXXXXKQGDSGIS-IPGRQGIKGEDGT--IGLPGEMGEPGPRGDFGQKGNIGITGEFGLQGNRGDDGLKGDDGIPGLNGPRGFIGDIGFVGFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXELGLDGSMGGKGDNGPRGFNGPTGIPGSKGFEGD---KGIRGDIGVKGFQ---GQHGEIGFPGLKGVSGENGRQXXXXXXXXXXXXXXXXVCMQPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEVGESIRGLQGRKGSTGLRGNIGIPGERGDKGIPGLQGKVGNKGVKGDIGDKGFSGNIGDKGYSGISGDKGSFGVKGDKGFQGDVG 4232
            C CF  KG +G PGP G QG +G +G  G  G+ G KG +G  G +GP G KG++G  G PG+ G  G  G PG  G  G  G  GC+G QG  G PG +G  G  G PG  G  G +G  +  +  + G +G  GL G  G  G  G  G  G +G                         G +G KG  G +G  GP G    T  ++     KG KG KG+ G P              GS G  G+KGI G  G  G +G  GI G  G  G+K   G PG  G  G +G++G+ G  G    + ADG     G  G  GV G+ G  G  G +G +GPSG     SL   PG  G +GF   PG+KGD GN G                                  GH  +I E GF G +G +GP G       QG +G KG+SGF               PGL G +G  G  G KG KG         +PG  G+ G  G PG  G +G  G  G+KG          SG  G  GP+G  G  G  G +G+ G+ G+PGI+GD GS +P     E+G  G+                GL G  G +GLPGD+G  GL                   GS G  G+ G  GF GS G  G  G     GT                 +PG  G +G +G  G  G  G+ G  G+ G  GL GFKG  G+     + +SG+ G +GL G+ G  G S  G+PG KGL G  G  G  G+ G+  ++         G   P G KGTSG PG+ G  GI      +G+PGK+G  GD G PGS G+ G  GIKG        G  G  G  G  G+ G  G+ GI G+KG  G  GP G+                   GS G  G  G  G  G KGD+G PG +GI           FKGE G  G +G  G  G  G+KG                   IKG   ++  PG  G +G +GL G  G LG  G  G+    G QGL G SGL+G     G+KG+QG + GI G  G   + G +G  G  G  GL GD+G+PG+KG  G  G  G  G PG  G +G  G  G PG PG  G  G +G PG S                    GL G  G PG  G  G++ +PG +G  G  G    G+PG  G PGP+G+ G  G +      G  G +G  G KGD G PGL GP G  G  G      S                 +G  G  G  G  G   + G  G  G  G  G +GF G  G+PG  G  G+   KG+RG+ G+ G     GQ G+ GFPG+KG +G  G  G  G  G         V   P                                      I G+ G  G  G +G++G+ G +G  GIPG  G  G  G  G +GD G  G  G  G+ G  G++G  G  G  G    VG
Sbjct:   40 CTCFPEKGARGHPGPIGTQGPAGPEGFTGPTGLSGLKGERGSPGPLGPYGSKGDKGPIGVPGFVGISGIPGHPGQPGPRGPPGPDGCNGTQGAVGFPGPDGYPGILGPPGLPGHKGAKGEPVPFQGSITGIRGDPGLPGLDGIPGPSGSSGSPGDAGPIGPPGLQGPPGLPGLPGPEGNMGLGFQGEKGVKGDVGLPGPAGPPPSTGELEFMGFPKGKKGSKGEPGPPGFPGMSGPPGVPEFGSTGEKGEKGILGLPGPRGPMGSEGIQGHPGRQGKKGTSGFPGINGFPGIKGEKGDIGVRGPDSFTDADGAV-ISGYPGDPGVLGLPGLRGDEGVQGQRGPSGTPGLPSLTGLPGALGPQGF---PGLKGDQGNSGRTTFGEAGLPGRVGLPGLPGLPGPSGPPGRTFETGHLSNI-EPGFPGLQGEQGPKG------HQGLKGVKGDSGFCACEGGAPNIGPHGEPGLPGIQGPIGLQGFKGTKG---------DPGSRGASGPAGTPGLFGPRGQTGLKGKKGEPTVSRGSKMSGDKGDPGPQGTPGLAGTPGKDGRPGLPGLPGIQGDGGSGFP----GERGLPGLP-GEKGHDGPIGPPGIGLPGPPGPRGLPGDKGVDGLPGQQGLRGAQGVTLPCIIPGSYGPSGFPGAPGFPGSKGARGLPGIPGKPGTHGSKGGPGSPGLMHLPGLPGFPGVRGEKGLPGFPGLPGKDGYPGKAGSPGLPGFKGAAGDIFGAENGASGEQGLQGLPGDKGFPGDS--GLPGPKGLNGKPGMLGPKGERGNPGTSGPPGQPGPSGSTDPFGIKGTSGFPGAPGLPGI------SGHPGKKGQRGDIGQPGSTGKRGLPGIKGLP------GPQGSPGFLGSPGLSGVTGLPGIEGQKGEKGSSGPVGFPGLPGLPGLPGADGLKGFSGSFGKVGQPGQTGTSGEKGDRGDPGPVGISSPRPPMLNLWFKGEKGSRGSAGSDGFPGPRGDKGEPGIPGLPGPPGATGQTNTIKG---LNGRPGSPGSMGRRGLPGLKGSLGIAGFPGMPGKSGSQGLTGTSGLLGATGIPGLKGDQGQTLGISGSPGPKGQPGELGFKGVKGKDGLVGDRGYPGNKGDGGKVGITGDPGFPGSPGLQGISGMNGDPGLPGSSGHLGSIGRPGPS--------------------GLIGPKGFPGAPGLHGLNGLPGTKGTHGTPGASITGVPGPAGLPGPKGERGVPGIV-----IGDPGKQGSKGQKGDQGSPGLQGPAGTPGAPGIS--LPSVIAGQPGDPGRPGLDGERGRPGPPGPPGPPGPSSDQGDPGDSGFPGIPGLQGFKGNQGLPGFSGLSGELGLKGMRGEPGLMGTPGKIGQPGDPGFPGMKGKAGPRGFSGPQGAPGHTPIAEAMQVPPGPLGL---------------------------------PGIDGIPGLIGDPGSQGSVGLQGSKGLPGIPGKDGPSGLPGPSGILGDPGLPGLQGPPGFEGAPGNQGPIGQPGMPGHGVRVG 1467          

HSP 4 Score: 256.529 bits (654), Expect = 4.282e-68
Identity = 184/508 (36.22%), Postives = 248/508 (48.82%), Query Frame = 3
Query: 3981 GESIRGLQGRKGSTGLRGNIGIPG-------------ERGDKGIPGLQGKVGNKGVKGDIGDKGFSGNIGDKGYSGISGD---------KGSFGVKGDKGFQGDVGMLGKSGLQGDRGQKGIIGF---------RGTRGIPGSMGLPGEIGEKGDVGPSGI----GVKGLKGYQNAVG-------IKGRKGEKGLPGFPGRPGKVGDQGDKGPKGM-----------KNMNTXXXXXXXXXXXXXXXXXXXXXXXXXLPGDMGEIGPNGPIGY-ADNGFLYATHSQSKDFPPCHGGGSPLYNGYSLLAIHGDIDSVTMDLGTPGSCLKNFSTIPFVNCFLERNTFYGGRCHVNMRNSRSYWLSTLQSYMSSPQPPSKMDDYISRCSVCQTKTTVMAFHSQKSDWQMTKCPYGWQKLWAGFSFPMAVQASRSGSNQPFSSPGSCLKHFRSLPFIECNNHNSNCNHWRDGVSYYMTAVDSENQFVKAQGKVLKSQTDIMNSISKCVVCQR 5342
            G SI G+ G  G  G +G  G+PG             ++GD+G PGLQG  G  G  G       +G  GD G  G+ G+          G  G   D+G  GD G  G  GLQG +G +G+ GF         +G RG PG MG PG+IG+ GD G  G+    G +G  G Q A G       ++   G  GLPG  G PG +GD G +G  G+           K+  +G  G  G  G  G  G++G  G +G PG+ G IG  G  G+    G+    HSQS+  P C  G S L+ GYSLL + G   +   DLG  GSCL  FST+PF+ C +         CH   RN +SYWLST       P   +++  YISRCSVC+  +  +A HSQ  D  + +CP GW  LW G+SF M   A   G  Q   SPGSCL+ FR+ PFIEC+     C+++ +  S+++T V+   QF +           +   +S+C VC +
Sbjct: 1190 GASITGVPGPAGLPGPKGERGVPGIVIGDPGKQGSKGQKGDQGSPGLQGPAGTPGAPGISLPSVIAGQPGDPGRPGLDGERGRPGPPGPPGPPGPSSDQGDPGDSGFPGIPGLQGFKGNQGLPGFSGLSGELGLKGMRGEPGLMGTPGKIGQPGDPGFPGMKGKAGPRGFSGPQGAPGHTPIAEAMQVPPGPLGLPGIDGIPGLIGDPGSQGSVGLQGSKGLPGIPGKDGPSGLPGPSGILGDPGLPGLQGPPGFEGAPGNQGPIGQPGMPGHGVRVGYTLVKHSQSEQVPLCPTGMSRLWVGYSLLFVEGQEKAHNQDLGFAGSCLPRFSTMPFIYCNINE------VCHYARRNDKSYWLSTTAPIPMMPVGQTQIPQYISRCSVCEAPSQAIAVHSQ--DIIVPQCPLGWHSLWIGYSFLMHTAAGAEGGGQSLVSPGSCLEDFRATPFIECSGARGTCHYFANKYSFWLTTVEERGQFREEPVSETLKTGQLHTRVSRCQVCMK 1689          

HSP 5 Score: 235.343 bits (599), Expect = 1.177e-61
Identity = 361/1076 (33.55%), Postives = 450/1076 (41.82%), Query Frame = 3
Query:  189 CQC------FGNKGRQGFPG---PRGYQGVSGDKGDVGQFGMPGPKGYKGFTGAIGPQGRKGERGIP---------GSPGYPGKMGEMGFPGIRGDIGEKGLTGCDGQQGDFGNPGMNGLVGRTGQPGERGDDG--------------------DRGLSIIP-KYGLKGNKGSRGLLGRYGRKGEKGFKGIKGYSGIFGIKGNKGYVGPMGRRGPKGDSLGTVIIQSE-----KGSKGDKGLKGQSGIPCK-GFQIEGRMYGRVGSDGPIGD-----KGIKGEKGLMGEIGQSGIDGARGLNGEKGL---PGEAGPRGERGD---------------------RGNPGFPGDPGASGADGTRGRQGERGPKGVHGISGADGPRGSRGDKGPSGS--LLSCPGRKGEKGFFGIPGIKGDIGN---------------------KGYQGHDGDIGEIG------FKGEKGYEGPLGPSCSEV---------EQGFRGTKGESGFPGLRGAKGQRGYSGNKG---IKGKPNFGTGIN-NPGETGSYGNLGVPGEKGNKGFIGDTGEKGFSGTGKQGPEGPRGDKGDDGVNGQVGMIGMPGIKGDKGSTYPICPFCEKGYKGIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEGRMGLLGSKGRQGYKGGKGFSGSMGDAGEIGYVTISGTT-IPGVKGEKGNQGPKGNKGEFGEAGSRGRKGYSGLKGFKGLIGERGTSFSSGDPGDKGLRGENGKDGVSFAGIPGEKGLKGDKGNRGILGDVGSLSNCATRPITSKGFKGPQGAKGTSGSPGSAGKTGIVGN---------KGENGYPGKRGIDG------------------DNGIPGSKGEEGETGIKGHAGRPGNLGKSGLQGLRGEYGVKGDLGIQGIPGRKGVMGDPG---------PNGY--------------AMIGSKGDKGIKGLPGIYGAKGDKGRPGYIG---------IPGFKGETGLIGRSGLKGDQGEIGEKGIKGFTFISNNPGDRGLLGNKGLKGFPGELG-------NKGQVGVCTVRGDQGLRGYSGLI 2867
            C C       G  G  G PG   P G QG  G KGD G  G  GP G  G  G  G  G KG++G P         G  G PG  G  G  G  G  G  GL G  G QGD G+ G  G  G  G PGE+G DG                    D+G+  +P + GL+G +G        G  G  GF G  G+ G  G +G  G  G  G  G KG      ++         G +G+KGL G  G+P K G+  +    G  G  G  GD      G  GE+GL G  G  G  G  GL G KGL   PG  GP+GERG+                     +G  GFPG PG  G  G  G++G+RG  G  G +G  G  G +G  GP GS   L  PG  G  G  GI G KG+ G+                     KG+ G  G +G+ G       KG++G  GP+G S             E+G RG+ G  GFPG RG KG+ G  G  G     G+ N   G+N  PG  GS G  G+PG KG+ G  G  G  G SG+           +G  G +G +G  G+PG+KGD+G T  I      G KG                                G +G  G KG+ G  G +G+ G+ GD G++G     G    PG++G  G  G  G  G  G  GS GR G SGL G KG  G  G    +G PG KG    +G  G S  G+PG  GL G KG RG+ G V          I   G +G +G KG  GSPG  G  G  G           G+ G PG+ G+DG                  D G PG  G  G  G++G  G  G  G SGL G  G  G++G+ G+ G PG+ G  GDPG         P G+              AM    G  G+ G+ GI G  GD G  G +G         IPG  G +GL G SG+ GD G  G +G  GF      PG++G +G  G+ G    +G          QV +C     +   GYS L 
Sbjct:  482 CACEGGAPNIGPHGEPGLPGIQGPIGLQGFKGTKGDPGSRGASGPAGTPGLFGPRGQTGLKGKKGEPTVSRGSKMSGDKGDPGPQGTPGLAGTPGKDGRPGLPGLPGIQGDGGS-GFPGERGLPGLPGEKGHDGPIGPPGIGLPGPPGPRGLPGDKGVDGLPGQQGLRGAQGVTLPCIIPGSYGPSGFPGAPGFPGSKGARGLPGIPGKPGTHGSKGGPGSPGLMHLPGLPGFPGVRGEKGLPGFPGLPGKDGYPGKAGSPGLPGFKGAAGDIFGAENGASGEQGLQGLPGDKGFPGDSGLPGPKGLNGKPGMLGPKGERGNPGTSGPPGQPGPSGSTDPFGIKGTSGFPGAPGLPGISGHPGKKGQRGDIGQPGSTGKRGLPGIKGLPGPQGSPGFLGSPGLSGVTGLPGIEGQKGEKGSSGPVGFPGLPGLPGLPGADGLKGFSGSFGKVGQPGQTGTSGEKGDRGDPGPVGISSPRPPMLNLWFKGEKGSRGSAGSDGFPGPRGDKGEPGIPGLPGPPGATGQTNTIKGLNGRPGSPGSMGRRGLPGLKGSLGIAGFPGMPGKSGS-----------QGLTGTSGLLGATGIPGLKGDQGQTLGIS--GSPGPKG------------------------------QPGELGFKGVKGKDGLVGDRGYPGNKGDGGKVGITGDPGFPGSPGLQGISGMNGDPGLPGSSGHLGSIGRPGPSGLIGPKGFPGAPGLHGLNGLPGTKG---THGTPGASITGVPGPAGLPGPKGERGVPGIV----------IGDPGKQGSKGQKGDQGSPGLQGPAGTPGAPGISLPSVIAGQPGDPGRPGLDGERGRPGPPGPPGPPGPSSDQGDPGDSGFPGIPGLQGFKGNQGLPGFSGLSGELGLKGMRGEPGLMGTPGKIGQPGDPGFPGMKGKAGPRGFSGPQGAPGHTPIAEAMQVPPGPLGLPGIDGIPGLIGDPGSQGSVGLQGSKGLPGIPGKDGPSGLPGPSGILGDPGLPGLQGPPGF---EGAPGNQGPIGQPGMPGHGVRVGYTLVKHSQSEQVPLCPTGMSRLWVGYSLLF 1497          

HSP 6 Score: 176.022 bits (445), Expect = 1.619e-43
Identity = 426/1310 (32.52%), Postives = 540/1310 (41.22%), Query Frame = 3
Query:  432 KGLTGCDGQQGDFGNPGMNGLVGRTGQPGERGDDGDRGLSIIPKYGLKGNKGSRGLLGRYGRKGEKGFKGIKGYSGI---------------------------FGIKGNKGY---VGPMGRRGPKGDSLGTVIIQ-SEKGSKGDKGLKGQSGIPCKGFQIEGRMYGRVGSDGPIGDK---------------GIKGEKGLMGEIGQSGIDGARGLNGEKGLPGEAGPRGERGDRGNPGFPGDPGASGADGTR--GRQGERGPKGVHGISGADGPRGSRGDKGPSGSLLSCPGRKGEKGFFGIPGIKGDIGNKGYQGHDGDIGEIGFKGEKGYEGPLGPSCSEVEQGFRGTKGESGFPGLRGAKGQRGYSGNKGIKGKPNFGTGINNPGETGSYGNLGVPGEKGNKGFIGDT--GEKGFSG---------------------------------TGKQGPEGPRGDKGDDGVNGQVGMIGMPGIKGDKGSTYPICPFCEKGYKGIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEGRMGLLGSKGRQGYKGGKGFSGSMGDAGEIGYVTISGTTIPGVKGE---------KGNQGPKGNKGEFGEAGSRGRKGYSGLKGFKGLIGERGTSFSSGDPGDKGLRGENGKDGVS---------------------FAGIPGEKGLKGDKGNRGILGDVGSLSNCATRPITSKGFKGPQGAKGTSGSPGSAGKTGIVGNKGENGYPGKRGIDGDNGIPGSKGEEGETGIKGHAGRPGNLGKSGLQGLRGEYGVKGDLGIQGIPGRKGVMGDPGPNGYAMIGSKGDKGIKGLPGIYGAKGDKGRPGYIGIPGFKGETGLIGRSGLKGDQGE------------------IGEKGIKGF------TFISNNP------GDRGLLGNKGLKGFPGELGNKGQVGVCTVRGDQGLRGYSGLIGDMGMKGEQGSKGIV---------------GDYGAASRSGIMGRTGKIGNQGLPGDQXXXXXXXXXXXXXXXXYIGIPGFEGDRGEKGNKGFPGFPGDIGQPGRLGNPGISTEGVXXXXXXXXXXXXXXXXXXXXXXXXXXKQGDSGIS----IPGRQGIKGEDGTIGLPGEMGEPGPRGDFGQKGNI-------GITGEFGLQGNRGDDGLKGDDGIP---------GLNGPRGFIGDIGFVGFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEL-GLDGSMGGKGDNGP-----RGFNGPTGIPGSKGFEGDKGIR-GDIGVKGFQGQHGEIGFPGLKGVSGENG 3806
             G+  C  ++G  G+PG    +G  G  G  G  G  GLS     GLKG +GS G LG YG KG+KG  G+ G+ GI                            G  G  GY   +GP G  G KG     V  Q S  G +GD GL G  GIP                   +                  G +GEKG+ G++G  G  G     GE    G   P+G++G +G PG PG PG SG  G    G  GE+G KG+ G+ G  GP GS G +G        PGR+G+KG  G PGI       G+ G  G+ G+IG +G   +    G     V  G+ G  G  G PGLRG +G +G  G  G  G P+  TG+      G+ G  G PG KG++G  G T  GE G  G                                  G QG +GP+G +G  GV G  G          +G    I P  E G  GIQ                              G +GL G KG +G  G +G SG  G  G  G    +G  + G KGE          G++G  G +G  G AG+ G+ G  GL G  G+ G+ G+ F  G+ G  GL GE G DG                         G+PG++GL+G +G               T P    G  GP G  G  G PGS G  G+ G  G+ G  G +G  G  G+    G  G  G++G  G PG        GL G+ G  G  G  G+PG KG  GD      A  G+ G++G++GLPG      DKG PG  G+PG KG  G  G  G KG++G                    G KG  GF        IS +P      GD G  G+ G +G PG  G  G  G     G  GL G +GL G  G KGE+GS G V               G  G +   G +G+ G+ G  G  GD+G PG  G    +     +   G +G RG  G+ GFPG  GD G+   +               + GL G  G PG  G  G PG +G  GI+    +PG+ G +G  GT GL G  G PG +GD GQ   I       G  GE G +G +G DGL GD G P         G+ G  GF G  G  G  G  G+ G  G  G  G   +                 L GL+G  G KG +G       G  GP G+PG KG  G  GI  GD G +G +GQ G+ G PGL+G +G  G
Sbjct:   37 HGVCTCFPEKGARGHPGP---IGTQGPAGPEGFTGPTGLS-----GLKGERGSPGPLGPYGSKGDKGPIGVPGFVGISGIPGHPGQPGPRGPPGPDGCNGTQGAVGFPGPDGYPGILGPPGLPGHKGAKGEPVPFQGSITGIRGDPGLPGLDGIPGPSGSSGSPGDAGPIGPPGLQGPPGLPGLPGPEGNMGLGFQGEKGVKGDVGLPGPAGPPPSTGELEFMGF--PKGKKGSKGEPGPPGFPGMSGPPGVPEFGSTGEKGEKGILGLPGPRGPMGSEGIQG-------HPGRQGKKGTSGFPGIN------GFPGIKGEKGDIGVRGPDSFTDADG----AVISGYPGDPGVLGLPGLRGDEGVQGQRGPSGTPGLPSL-TGL-----PGALGPQGFPGLKGDQGNSGRTTFGEAGLPGRVGLPGLPGLPGPSGPPGRTFETGHLSNIEPGFPGLQGEQGPKGHQGLKGVKGDSGFCAC------EGGAPNIGPHGEPGLPGIQ------------------------------GPIGLQGFKGTKGDPGSRGASGPAGTPGLFGPRGQTG--LKGKKGEPTVSRGSKMSGDKGDPGPQGTPGLAGTPGKDGRPGLPGLPGIQGDGGSGFP-GERGLPGLPGEKGHDGPIGPPGIGLPGPPGPRGLPGDKGVDGLPGQQGLRGAQG--------------VTLPCIIPGSYGPSGFPGAPGFPGSKGARGLPGIPGKPGTHGSKGGPGSPGLMHLPGLPGFPGVRGEKGLPG------FPGLPGKDGYPGKAGSPGLPGFKGAAGD---IFGAENGASGEQGLQGLPG------DKGFPGDSGLPGPKGLNGKPGMLGPKGERGNPGTSGPPGQPGPSGSTDPFGIKGTSGFPGAPGLPGISGHPGKKGQRGDIGQPGSTGKRGLPGIKGLPGPQGSPGFLGSPGLSGVTGLPGIEGQKGEKGSSGPVGFPGLPGLPGLPGADGLKGFSGSFGKVGQPGQTGTSGEKGDRGDPGPVGISSPRPPMLNLWFKGEKGSRGSAGSDGFPGPRGDKGE-PGIPGLPGPPGATGQTNTIKGLNGRPGSPGSMGRRGLPGLKGSLGIAGFPGMPGKSGSQGLTGTSGLLGATGIPGLKGDQGQTLGISGSPGPKGQPGELGFKGVKGKDGLVGDRGYPGNKGDGGKVGITGDPGFPGSPGLQGISGMNGDPGLPGSSGHLGSIGRPGPSGLIGPKGFPGAPGLHGLNGLPGTKGTHGTPGASITGVPGPAGLPGPKGERGVPGIVIGDPGKQGSKGQKGDQGSPGLQGPAGTPG 1244          

HSP 7 Score: 134.42 bits (337), Expect = 8.768e-31
Identity = 182/544 (33.46%), Postives = 238/544 (43.75%), Query Frame = 3
Query:  168 RICTPDKCQCFGNKGRQGFPGPRG------------YQGVSGDKGDVGQFGMPGPKGYKGFTGAIGPQGRKGE-------RGIPGSPGYPGKMGEMGFPGIRGDIGEKGLTGCDGQQGDFGNPGMNGLVGRTGQPGERGDDGDR-GLSIIP-------KYGLKGNKGSRGLLGRYGRKGEKG------------------FKGIKGYSGIFGIKGNKGYVGPMGRRGPKGDSLGTVIIQSEKGSKGDKGLKGQSGIP-------CKGFQIEGRMYGRVGSDGPIGDKGIKG----EKGLMGEIGQSGIDGARGLNGEKGLPGEAG---PRGERGDRGNPGFPG------------------------DPGASGADGTRGRQGERGPKGVHGISGADGPRGSRGDKGPSGSLLSCPGRKGEKGFFGIPGIKGDIGNKGYQGHDGDIGE-------------IGFKGEKGYEGPLGPSCSEVEQGFRGTKGESGFP------GLRGAKGQRGYSGNKGIKGKPNFGTGINNPGETGSYGNLGVPGE 1493
            ++  P +    G KG +G PGP G            ++G  G +G  G  G PGP+G KG  G  G  G  G        +G+ G PG PG MG  G PG++G +G  G  G  G+ G  G  G +GL+G TG PG +GD G   G+S  P       + G KG KG  GL+G  G  G KG                   +GI G +G  G+ G+ G++G +GR GP G       +   KG  G  GL G +G+P         G  I G + G  G  GP G++G+ G    + G  G  GQ G  G+ GL G  G PG  G   P    G  G+PG PG                        DPG SG  G  G QG +G +G+ G SG  G  G +G +G  G L+  PG+ G+ G  G PG+KG  G +G+ G  G  G              +G  G  G  G +G   S+   G +G+KG  G P      GL G  G  G  G  G++G P F      PG  G  G  G+PG 
Sbjct:  931 KVGQPGQTGTSGEKGDRGDPGPVGISSPRPPMLNLWFKGEKGSRGSAGSDGFPGPRGDKGEPGIPGLPGPPGATGQTNTIKGLNGRPGSPGSMGRRGLPGLKGSLGIAGFPGMPGKSGSQGLTGTSGLLGATGIPGLKGDQGQTLGISGSPGPKGQPGELGFKGVKGKDGLVGDRGYPGNKGDGGKVGITGDPGFPGSPGLQGISGMNGDPGLPGSSGHLGSIGRPGPSG-------LIGPKGFPGAPGLHGLNGLPGTKGTHGTPGASITG-VPGPAGLPGPKGERGVPGIVIGDPGKQGSKGQKGDQGSPGLQGPAGTPGAPGISLPSVIAGQPGDPGRPGLDGERGRPGPPGPPGPPGPSSDQGDPGDSGFPGIPGLQGFKGNQGLPGFSGLSGELGLKGMRGEPG-LMGTPGKIGQPGDPGFPGMKGKAGPRGFSGPQGAPGHTPIAEAMQVPPGPLGLPGIDGIPGLIGDPGSQGSVGLQGSKGLPGIPGKDGPSGLPGPSGILGDPGLPGLQGPPGF---EGAPGNQGPIGQPGMPGH 1462          

HSP 8 Score: 79.337 bits (194), Expect = 5.123e-14
Identity = 75/180 (41.67%), Postives = 93/180 (51.67%), Query Frame = 3
Query: 3990 IRGLQGRKGST----GLRGNIGIPGERGDKGIPGLQGKVGNKGVKGDIGDKGFSGNIGDKGYSGISGDKGSFGVKGDKGFQGDVGMLGKSGLQGDRGQKGIIGFRGTRGIPGSMGLPGEIGEKGDVGPSGIGVKGLKGYQNAVGIKGRKGEKGLPGF----PGRPGKVGDQGDKGPKGMK 4505
            I GL+G +G T    G  G  G PGE G KG+ G  G VG++G  G+ GD G  G  GD G+ G  G +G  G+ GD G  G  G LG  G  G  G  G  GF G  G+ G  GLPG  G  G  G S  GV G        G+ G KGE+G+PG     PG+ G  G +GD+G  G++
Sbjct: 1064 IPGLKGDQGQTLGISGSPGPKGQPGELGFKGVKGKDGLVGDRGYPGNKGDGGKVGITGDPGFPGSPGLQGISGMNGDPGLPGSSGHLGSIGRPGPSGLIGPKGFPGAPGLHGLNGLPGTKGTHGTPGASITGVPG------PAGLPGPKGERGVPGIVIGDPGKQGSKGQKGDQGSPGLQ 1237          

HSP 9 Score: 77.7962 bits (190), Expect = 1.396e-13
Identity = 75/199 (37.69%), Postives = 93/199 (46.73%), Query Frame = 3
Query: 4023 GLRGNIGIPGERGDKGIPGLQGKVGNKGVKGDIGDKGFSGNIGDK--GYSGISGDKGSFGVKGDKGFQGDVGMLGKSGLQGDRGQ------------------------------KGIIGFRGTRGIPGSMGLPGEIGEKGDVGPSGI-------GVKGLKGYQNAVGIKGRKGEKGLPGFPGRPGKVGDQGDKGPKGM 4502
            GL G  G+ GE+G  G PGL GK G  G  G  G  GF G  GD     +G SG++G  G+ GDKGF GD G+ G  GL G  G                               KG  GF G  G+PG  G PG+ G++GD+G  G        G+KGL G Q + G  G  G  G+ G PG  G+ G++G  GP G 
Sbjct:  709 GLPGFPGVRGEKGLPGFPGLPGKDGYPGKAGSPGLPGFKGAAGDIFGAENGASGEQGLQGLPGDKGFPGDSGLPGPKGLNGKPGMLGPKGERGNPGTSGPPGQPGPSGSTDPFGIKGTSGFPGAPGLPGISGHPGKKGQRGDIGQPGSTGKRGLPGIKGLPGPQGSPGFLGSPGLSGVTGLPGIEGQKGEKGSSGPVGF 907          

HSP 10 Score: 77.0258 bits (188), Expect = 2.257e-13
Identity = 188/658 (28.57%), Postives = 235/658 (35.71%), Query Frame = 3
Query: 2187 LSNCATRPITSKGFKGPQGAKGTSGSPGSAGKTGIVGNKGENGYPGKRGIDGDNGIPGSKGEEGETGIKGHAGRPGNLGKSGLQGLRGEYGVKGDLGIQGIP------------------GRKGVMGDPGPNGYAMIGSKGDKGIKGLPGIYGAKGDKGRPGYI--GIPGFKGETGLIGRSGLKGDQ-----------------------------------GEIGEKGIKGFTFISNNPGDRGLLGNKGLKGFP------------------------GELGNKGQVGVCTVRGDQGLRGYSGLIGDMGMKGEQGSKGIVGDYGAASRSGIMGRTGKIGNQGLPGDQXXXXXXXXXXXXXXXXYIGIPGFEGD---RGEKGNKGFPGFPGDIGQPGRLGNPGISTEGVXXXXXXXXXXXXXXXXXXXXXXXXXXKQGDSGISIPGRQGIKG---------------------EDGTI-----GLPGEMGEPGPRGDFGQKGNIGITGEFGLQGNRGDDGLKGDDGIPGLNGPRGFIGDIGFVGFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXELGLDGSMGGKGDNGPRGFNGPTGIPGSKGFEGDKGIRGDIG---------VKGFQGQHGEIGFPGLKGVSGENGR 3809
            +S C T+ +   G K   G     GS    G       KG  G+PG  G  G  G  G  G  G +G+KG  G PG LG  G +G +G  GV G +GI GIP                  G +G +G PGP+GY         GI G PG+ G KG KG P      I G +G+ GL G  G+ G                                     G  GEKG+KG   +    G     G     GFP                         E G+ G+ G   + G  G RG  G  G  G  G QG KG  G  G     GI G  G IG +G P            G+ G  G +G+PG  GD   +G++G  G PG P   G PG LG  G                            G  G QG+SG +  G  G+ G                     E G +     G PG  GE GP+G  G KG  G +G    +G   + G  G+ G+PG+ GP      IG  GF+                                            G KGD G RG +GP G PG  G  G  G++G  G         + G +G  G  G PGL G  G++GR
Sbjct:   10 VSLCLTKELAESGQKMSYGKP--CGSRDCHGVCTCFPEKGARGHPGPIGTQGPAGPEGFTGPTGLSGLKGERGSPGPLGPYGSKGDKGPIGVPGFVGISGIPGHPGQPGPRGPPGPDGCNGTQGAVGFPGPDGYP--------GILGPPGLPGHKGAKGEPVPFQGSITGIRGDPGLPGLDGIPGPSGSSGSPGDAGPIGPPGLQGPPGLPGLPGPEGNMGLGFQGEKGVKGDVGLPGPAGPPPSTGELEFMGFPKGKKGSKGEPGPPGFPGMSGPPGVPEFGSTGEKGEKGILGLPGPRGPMGSEGIQGHPGRQGKKGTSGFPGINGFPGIKGEKGDIGVRG-PDSFTDADGAVISGYPGDPGVLGLPGLRGDEGVQGQRGPSGTPGLPSLTGLPGALGPQGFP--------------------------GLKGDQGNSGRTTFGEAGLPGRVGLPGLPGLPGPSGPPGRTFETGHLSNIEPGFPGLQGEQGPKGHQGLKGVKGDSGFCACEGGAPNIGPHGEPGLPGIQGP------IGLQGFK--------------------------------------------GTKGDPGSRGASGPAGTPGLFGPRGQTGLKGKKGEPTVSRGSKMSGDKGDPGPQGTPGLAGTPGKDGR 580          

HSP 11 Score: 71.633 bits (174), Expect = 1.017e-11
Identity = 81/229 (35.37%), Postives = 102/229 (44.54%), Query Frame = 3
Query: 3990 IRGLQGRKGSTGLRGNIGIPGERGDKGIPGLQGKVGN-----------KGVKGDIGDKGFSGNIGDKGYSGISGDKG---------------------------SFGVKGDKGFQGDVGMLGKSGLQGDRGQKGIIGFRGT---RGIPGSMGLPGEIGEKGDVGPSGI-GVKGLKGYQNAVGIKGRKG---------------EKGLPGFPGRPGKVGDQGDKGPKGMK 4505
            +RG +G  G  GL G  G PG+ G  G+PG +G  G+           +G++G  GDKGF G+ G  G  G++G  G                            FG+KG  GF G  G+ G SG  G +GQ+G IG  G+   RG+PG  GLPG  G  G +G  G+ GV GL G +   G KG  G                 GL GF G  GKVG  G  G  G K
Sbjct:  716 VRGEKGLPGFPGLPGKDGYPGKAGSPGLPGFKGAAGDIFGAENGASGEQGLQGLPGDKGFPGDSGLPGPKGLNGKPGMLGPKGERGNPGTSGPPGQPGPSGSTDPFGIKGTSGFPGAPGLPGISGHPGKKGQRGDIGQPGSTGKRGLPGIKGLPGPQGSPGFLGSPGLSGVTGLPGIEGQKGEKGSSGPVGFPGLPGLPGLPGADGLKGFSGSFGKVGQPGQTGTSGEK 944          

HSP 12 Score: 69.3218 bits (168), Expect = 6.067e-11
Identity = 71/169 (42.01%), Postives = 90/169 (53.25%), Query Frame = 3
Query: 3990 IRGLQGRKGSTGLRGNIGIPG---ERGDKGIPGLQGKVGNKGVKGDIGDKGFSGNIGDKGYSGISGDKGSFGVKGDKGFQGDVGMLGKSGLQGDRGQKGIIGFRGT---RGIPGSMGLPGEIGEKGDVGPSGIGVKGLKGYQNAVGIKGRKGEKGLPGFPGRPGKVGDQ 4478
            I+G  G  G+ GL G  G PG   +RGD G PG  GK G  G+KG  G +G  G +G  G SG++G  G  G KG+KG  G VG  G  GL G  G  G+ GF G+    G PG  G  GE G++GD GP  +G+   +     +  KG KG +G  G  G PG  GD+
Sbjct:  823 IKGTSGFPGAPGLPGISGHPGKKGQRGDIGQPGSTGKRGLPGIKGLPGPQGSPGFLGSPGLSGVTGLPGIEGQKGEKGSSGPVGFPGLPGLPGLPGADGLKGFSGSFGKVGQPGQTGTSGEKGDRGDPGP--VGISSPRPPMLNLWFKGEKGSRGSAGSDGFPGPRGDK 989          

HSP 13 Score: 68.5514 bits (166), Expect = 8.497e-11
Identity = 72/200 (36.00%), Postives = 94/200 (47.00%), Query Frame = 3
Query: 3993 RGLQGRKGSTGLRGNIGIPGERGDKGIPGLQGKVGNKG---------------VKGDIGDKGFSGNIGDKGYSGISGDKGSFGVKGDKGFQGDVGMLGKSGLQGDRGQKGIIGFRGTRGIPGSMGLPGEIGEKGDVGPSG-------------IGVKGLKGYQNAVGIKGRKGEKGLPGFPGRPGKVGDQGDKGPKGMKN 4508
            +GLQG  G  G  G+ G+PG +G  G PG+ G  G +G                    G KG SG  G  G  GISG  G  G +GD G  G  G  G  G++G  G +G  GF G+ G+ G  GLPG  G+KG+ G SG              G  GLKG+  + G  G+ G+       G  G+ GD+GD GP G+ +
Sbjct:  764 QGLQGLPGDKGFPGDSGLPGPKGLNGKPGMLGPKGERGNPGTSGPPGQPGPSGSTDPFGIKGTSGFPGAPGLPGISGHPGKKGQRGDIGQPGSTGKRGLPGIKGLPGPQGSPGFLGSPGLSGVTGLPGIEGQKGEKGSSGPVGFPGLPGLPGLPGADGLKGFSGSFGKVGQPGQT------GTSGEKGDRGDPGPVGISS 957          

HSP 14 Score: 65.4698 bits (158), Expect = 8.400e-10
Identity = 74/189 (39.15%), Postives = 91/189 (48.15%), Query Frame = 3
Query: 3996 GLQGRKGSTGLRGNIGIPGERGD------------KGIPGLQGKVGNKGVKGDIGDKGFSGNIGDKGYSGISGDKGSFGVKGDKGFQGDVGMLGKSGLQGDRGQKGIIGFRGTRGIPGSMGLPGEIGEKGDVG-----PSGIGVKGLKGYQNAVGIKGRKGEKGLPGF---------PGRPGKVGDQGD 4484
            G +G KG  GL G+ G PG +GD             G PGLQG     G+ GD G  G SG++G  G  G S      G+ G KGF G  G+ G +GL G +G  G  G   T G+PG  GLPG  GE+G  G     P   G KG KG Q + G++G  G  G PG          PG PG+ G  G+
Sbjct: 1091 GFKGVKGKDGLVGDRGYPGNKGDGGKVGITGDPGFPGSPGLQGI---SGMNGDPGLPGSSGHLGSIGRPGPS------GLIGPKGFPGAPGLHGLNGLPGTKGTHGTPGASIT-GVPGPAGLPGPKGERGVPGIVIGDPGKQGSKGQKGDQGSPGLQGPAGTPGAPGISLPSVIAGQPGDPGRPGLDGE 1269          

HSP 15 Score: 63.1586 bits (152), Expect = 4.304e-9
Identity = 75/201 (37.31%), Postives = 93/201 (46.27%), Query Frame = 3
Query: 4005 GRKGSTGLRGNIGIPGERGDKGIPGLQGKVGNKGVKGDIGDKGFSGNIGDKGYSGISGDKGSFGVKGD-----------KGFQGDVGMLGKSGLQGD------RGQKGIIGFRGTRGIPGSMGLPGEIGEKGDVGPSGIGVKGLKGYQNAV------------GIKGRKGEKGL-----PGFPGRPGKVGDQGDKGPKGMK 4505
            G  G  G +G +G+PG RG  G  G+QG  G +G       KG SG  G  G+ GI G+KG  GV+G             G+ GD G+LG  GL+GD      RG  G  G     G+PG++G  G  G KGD G SG    G  G    V            G  GR  E G      PGFPG  G+ G +G +G KG+K
Sbjct:  282 GSTGEKGEKGILGLPGPRGPMGSEGIQGHPGRQG------KKGTSGFPGINGFPGIKGEKGDIGVRGPDSFTDADGAVISGYPGDPGVLGLPGLRGDEGVQGQRGPSGTPGLPSLTGLPGALGPQGFPGLKGDQGNSGRTTFGEAGLPGRVGLPGLPGLPGPSGPPGRTFETGHLSNIEPGFPGLQGEQGPKGHQGLKGVK 476          

HSP 16 Score: 61.6178 bits (148), Expect = 1.265e-8
Identity = 76/225 (33.78%), Postives = 98/225 (43.56%), Query Frame = 3
Query: 3990 IRGLQGRKGSTGLRGNIGIPGERGDK---GIPGLQGKVGNKGVKGDIGDKG-----------FSGNIGDKGYSGISGDKGSFGVKGDKGFQGDVGMLGKSGLQGDRGQKGIIGFRGTRG-----IPGSMGLPG---------------------EIGEKGDVGPSGIGVKGLKGYQNAVGIKGRKGEKGL---------------PGFPGRPGKVGDQGDKGPKG 4499
            I GL G +G  G  G  G PG +G K   G PG+ G  G KG KGDIG +G            SG  GD G  G+ G +G  GV+G +G  G  G+   +GL G  G +G  G +G +G       G  GLPG                     E G   ++ P   G++G +G +   G+KG KG+ G                PG PG  G +G QG KG KG
Sbjct:  292 ILGLPGPRGPMGSEGIQGHPGRQGKKGTSGFPGINGFPGIKGEKGDIGVRGPDSFTDADGAVISGYPGDPGVLGLPGLRGDEGVQGQRGPSGTPGLPSLTGLPGALGPQGFPGLKGDQGNSGRTTFGEAGLPGRVGLPGLPGLPGPSGPPGRTFETGHLSNIEPGFPGLQGEQGPKGHQGLKGVKGDSGFCACEGGAPNIGPHGEPGLPGIQGPIGLQGFKGTKG 516          

HSP 17 Score: 61.6178 bits (148), Expect = 1.353e-8
Identity = 71/200 (35.50%), Postives = 87/200 (43.50%), Query Frame = 3
Query: 3996 GLQGRKGSTGLRGNIGIPGERGDKGIPGLQGKVGNKGVKGDIGDKGFSGNIGDKGYSGISGDKGSFGVKGDKGFQGDVGMLGKSGLQGDRGQKGIIGFRGT--RGIPGSMGLPGEIGEKG-----------------------DVGPSGI-GVKGLKGYQN------------------AVGIKGRKGEKGLPGFPGRPG 4463
            G  G  G  G++G IG+ G +G KG PG +G  G  G  G  G +G +G  G KG   +S      G KGD G QG  G+ G  G  G  G  G+ G +G    G PG  GLPG  GEKG                       D G  G+ G +GL+G Q                   A G  G KG +GLPG PG+PG
Sbjct:  492 GPHGEPGLPGIQGPIGLQGFKGTKGDPGSRGASGPAGTPGLFGPRGQTGLKGKKGEPTVSRGSKMSGDKGDPGPQGTPGLAGTPGKDGRPGLPGLPGIQGDGGSGFPGERGLPGLPGEKGHDGPIGPPGIGLPGPPGPRGLPGDKGVDGLPGQQGLRGAQGVTLPCIIPGSYGPSGFPGAPGFPGSKGARGLPGIPGKPG 691          

HSP 18 Score: 61.2326 bits (147), Expect = 1.472e-8
Identity = 76/224 (33.93%), Postives = 96/224 (42.86%), Query Frame = 3
Query: 3984 ESIRGLQGRKGSTGLRGNIGIPGERGDKGIPGLQGKV------------GNKGVKGDIGDKGFSGNIGDKG-------------------YSGISGDKGSFGVKGDKGFQGDVGMLGKSGLQGDRGQKGIIGFRGTRGIPGSMGLPGEIGEKGDV-------GPSG----IGVKGLKGYQNAVGIKGRKGEK---------GLPGFPGRPGKVGDQGDKGPKGM 4502
            + ++G  G  G  G  G  G  GE+GD+G PG  G              G KG +G  G  GF G  GDKG                     G++G  GS G  G +G  G  G LG +G  G  G+ G  G  GT G+ G+ G+PG  G++G         GP G    +G KG+KG    VG +G  G K         G PGFPG PG  G  G  G  G+
Sbjct:  920 DGLKGFSGSFGKVGQPGQTGTSGEKGDRGDPGPVGISSPRPPMLNLWFKGEKGSRGSAGSDGFPGPRGDKGEPGIPGLPGPPGATGQTNTIKGLNGRPGSPGSMGRRGLPGLKGSLGIAGFPGMPGKSGSQGLTGTSGLLGATGIPGLKGDQGQTLGISGSPGPKGQPGELGFKGVKGKDGLVGDRGYPGNKGDGGKVGITGDPGFPGSPGLQGISGMNGDPGL 1143          

HSP 19 Score: 60.077 bits (144), Expect = 4.043e-8
Identity = 83/211 (39.34%), Postives = 103/211 (48.82%), Query Frame = 3
Query: 3993 RGLQGRKGSTGLRGNIGI---PGERGDKGI---PGLQGKVGNKGVKGDIGDKGFSGNIGDKGYSGISGDKGSFGVKGDKGFQGDV---GMLGKSGLQGDRGQKGIIGF---------------RGTRGIPGSMGLPGEIGEKGDVGPSGIG-----------VKGLKGYQNAVGIKGR------KGEKGLPGFPGRPGKVGDQGDKGPKGM 4502
            RG  G+ GSTG RG  GI   PG +G  G    PGL G  G  G++G  G+KG SG +G  G  G+ G  G+ G+KG  G  G V   G  G SG +GDRG  G +G                +G+RG  GS G PG  G+KG+ G  G+            +KGL G   + G  GR      KG  G+ GFPG PGK G QG  G  G+
Sbjct:  848 RGDIGQPGSTGKRGLPGIKGLPGPQGSPGFLGSPGLSGVTGLPGIEGQKGEKGSSGPVGFPGLPGLPGLPGADGLKGFSGSFGKVGQPGQTGTSGEKGDRGDPGPVGISSPRPPMLNLWFKGEKGSRGSAGSDGFPGPRGDKGEPGIPGLPGPPGATGQTNTIKGLNGRPGSPGSMGRRGLPGLKGSLGIAGFPGMPGKSGSQGLTGTSGL 1058          

HSP 20 Score: 58.5362 bits (140), Expect = 1.111e-7
Identity = 85/259 (32.82%), Postives = 114/259 (44.02%), Query Frame = 3
Query: 3984 ESIRGLQGRKGSTGLRGNIGIPGERGDKGIPGLQGKVGNKGVKGDIGDKGFSGNIG--------------------------DKGYSGISGDKGSFGVKGDKGFQGD------------VGMLGKSGLQGDRGQKGIIGFRGTRGIPGSMGLPGEIGEKGDVGPSG-IGVKGLKGYQNAV------GIKGRKGEKGLPGFPGRPGKVGDQGDKGPKGMKNMNTXXXXXXXXXXXXXXXXXXXXXXXXXLPGDMGEIGPN 4625
            E ++G +G  G+ GL    G+PG  G +G PGL+G  GN G +   G+ G  G +G                          + G+ G+ G++G  G +G KG +GD            +G  G+ GL G +G  G+ GF+GT+G PGS G  G  G  G  GP G  G+KG KG           G KG  G +G PG  G PGK G  G  G  G++                   G  G  GE+GLPG  GE G +
Sbjct:  373 EGVQGQRGPSGTPGLPSLTGLPGALGPQGFPGLKGDQGNSG-RTTFGEAGLPGRVGLPGLPGLPGPSGPPGRTFETGHLSNIEPGFPGLQGEQGPKGHQGLKGVKGDSGFCACEGGAPNIGPHGEPGLPGIQGPIGLQGFKGTKGDPGSRGASGPAGTPGLFGPRGQTGLKGKKGEPTVSRGSKMSGDKGDPGPQGTPGLAGTPGKDGRPGLPGLPGIQG-----------------DGGSGFPGERGLPGLPGEKGHD 613          

HSP 21 Score: 56.6102 bits (135), Expect = 3.798e-7
Identity = 73/210 (34.76%), Postives = 91/210 (43.33%), Query Frame = 3
Query: 3984 ESIRGLQGRKGSTGLRGNIGIPGERGDKGIPGLQGKVGNKGVKGDIGDKGFSGN------IGDKGYSGISGDKGSFGVKGDKGFQGDVGMLGKSGLQGDRGQKGIIGFRGT--------RGIPGSMGLPGEIGEKGDVGPSGI-GVKGLKGYQNAVGIKGRKGE---------------------KGLPGFPGRPGKVGDQGDKGPKGMK 4505
            + + G QG +G+ G+     IPG  G  G PG  G  G+KG +G  G  G  G        G  G   + G  G  GV+G+KG  G  G+ GK G  G  G  G+ GF+G          G  G  GL G  G+KG  G SG+ G KGL G    +G KG +G                      KG  GFPG PG  G  G  G KG +
Sbjct:  639 DGLPGQQGLRGAQGVTLPCIIPGSYGPSGFPGAPGFPGSKGARGLPGIPGKPGTHGSKGGPGSPGLMHLPGLPGFPGVRGEKGLPGFPGLPGKDGYPGKAGSPGLPGFKGAAGDIFGAENGASGEQGLQGLPGDKGFPGDSGLPGPKGLNGKPGMLGPKGERGNPGTSGPPGQPGPSGSTDPFGIKGTSGFPGAPGLPGISGHPGKKGQR 848          

HSP 22 Score: 55.4546 bits (132), Expect = 8.889e-7
Identity = 72/216 (33.33%), Postives = 95/216 (43.98%), Query Frame = 3
Query: 3990 IRGLQGRKGS--TGLRGNIGIPGERG-----------------------DKGIPGLQGKVGNKGVKGDIGDKGFSGNIGDKGYSGISGDKGSFGVKGDKGFQGDVG---------------MLGKSGLQGDRGQKGIIGFRGT------RGIPGSMGLPGEIGEKGDVGPSGIGVKGLKGYQNAVGIKGRKGEKGLP---GFPGRPGKVGDQGDKG 4490
            + G+QG  GS   G RG  G+PGE+G                       DKG+ GL G+ G +G +G        G+ G  G+ G  G  GS G +G  G  G  G               + G  G  G RG+KG+ GF G        G  GS GLPG  G  GD+  +  G  G +G Q   G KG  G+ GLP   G  G+PG +G +G++G
Sbjct:  586 LPGIQGDGGSGFPGERGLPGLPGEKGHDGPIGPPGIGLPGPPGPRGLPGDKGVDGLPGQQGLRGAQGVTLPCIIPGSYGPSGFPGAPGFPGSKGARGLPGIPGKPGTHGSKGGPGSPGLMHLPGLPGFPGVRGEKGLPGFPGLPGKDGYPGKAGSPGLPGFKGAAGDIFGAENGASGEQGLQGLPGDKGFPGDSGLPGPKGLNGKPGMLGPKGERG 801          

HSP 23 Score: 54.6842 bits (130), Expect = 1.424e-6
Identity = 73/197 (37.06%), Postives = 90/197 (45.69%), Query Frame = 3
Query: 3981 GESIRGLQGRKGSTGLRGNIGIPGERGDKGIPGLQGKVGNKGVKGDIGDKGFSGNIGDKGYSGISG-----------------DKGSFGVKGDKGFQGDVGML------GKSGLQGDRGQKGIIGFRGTRGIPGSMGLPGEIGEKGDVGPSGIGVKGLKGYQNAVGIKGRKGEKGLPGFPGRPGKVGDQGDKGPKGM 4502
            G  + G +G  G  G  G  G PG+ G  G+PGL G  G+ G  G  G++G  G  G+KG+ G  G                 DKG  G+ G +G +G  G+       G  G  G  G  G  G +G RG+PG  G PG  G K      G G  GL       G  G +GEKGLPGFPG PGK G  G  G  G+
Sbjct:  553 GSKMSGDKGDPGPQGTPGLAGTPGKDGRPGLPGLPGIQGDGG-SGFPGERGLPGLPGEKGHDGPIGPPGIGLPGPPGPRGLPGDKGVDGLPGQQGLRGAQGVTLPCIIPGSYGPSGFPGAPGFPGSKGARGLPGIPGKPGTHGSK-----GGPGSPGLMHLPGLPGFPGVRGEKGLPGFPGLPGKDGYPGKAGSPGL 743          
BLAST of Collagen IV NC1 domain-containing protein vs. Ensembl Mouse
Match: Col4a6 (collagen, type IV, alpha 6 [Source:MGI Symbol;Acc:MGI:2152695])

HSP 1 Score: 279.641 bits (714), Expect = 3.001e-75
Identity = 431/1239 (34.79%), Postives = 536/1239 (43.26%), Query Frame = 3
Query:  201 GNKGRQGFPGPRGYQGVSGDKGDVGQFGMPGPKGYKGFTGAIGPQGRKGERGIPGS-----------PGYPGKMGEMGFPGIRGDIGEKGLTGCDGQQGDFGNPGMNGLVGRTGQPGERGDDGDRGLSIIPKYGLKG-----------------------------NKGSRGLLGRYGRKGEKGFKGIKGYSGIFGIKGNKGYVGPMGRRGPKGDSLGTVIIQSEKGSKGDKGLKGQSGIPCKGFQIEGRMYGRVGSDGPIGDKGIKGEKGLMGEIGQSGIDGARGLNGEKGLPGEAGPRGERGDRGNPGFPGDPGASGADGTRGRQGERGPKGVHGISG--------------------------ADGPRGSRGDKGPSGSLLSC--PGRKGEKGFFGIPGIKGDIGNKGYQGHDGDIGEIGFKGEKGYEGPLGPSCSEVEQGFRGTKGESGFPGLRGAKGQRGYSGNKGIKGKPNF--GTGINNPGETGSYGNLGVPGEKGNKGFIGDTGEKGFSG-TGKQGPEGPRGDKGDD------------------GVNGQVGMIGMPGIKGDKGSTYPICPFCEKGYKGIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEGRMGLLGSKGRQGYKGGKGFSGSMGDAGEIGYVTISGTT-IPGVKGEKGNQGPKGNKGEFGEAGSRGRKGYSGLKGFKGLIGERGTSFSSGDPGDKGLRGENGKDGVSFAGIP-------GEKGLKGDKGNRGI---------------------LGDVGSLSNCATRPITSKGFKGPQGAKGTSGSPGSAGKTGIVGNKGENGYPGKRGIDGDNGIPGSKGEEGET-GIKGHAGRPGNLGKSGLQGLRGEYGVKGDLGIQGIPG---RKGVMGDPG-PNGYAMIGSKGDKGIKGLPGIYGAKGDKGRPG---YIGIPGFKGETGLIGRSGLKGDQGEIGEKGIKGFTFISNNPGDRGLLGNKGLKGFPGELGNKGQVGVCTVRGDQGLRGYSGLIGDMGMKGEQGSKGIVGDYGAASRSGIMGRTGKIGNQGLPGDQXXXXXXXXXXXXXXXX---------YIGIPGFEGDRGEKGNKGFPGFPGDIGQPGRLGNPGISTEGVXXXXXXXXXXXXXXXXXXXXXXXXXXKQGDSGISIPGRQGIKGEDGTIGLPGEMGEPGPRGDFGQKGNIGITGEFGLQGNRGDDG---------LKGDDGIPGLNGPRGFIGDIG 3485
            G KG  G PGPRG  G  G +G  G+ G  G  G+ G  G  G +G KG+ G+ G             GYPG  G +G PG+RGD G +G  G  G  G     G+ G +G  G PG +GD G+ G +   + GL G                               G  GL G  G KG +G KG+KG SG    +G    +GP G  G  G   G + +Q  KG+KGD G +G SG             G  G  GP G  G+KG+KG       S + G +G  G +G PG AG     G  G PG PG PG  G DG  G  GERG  G+ G  G                           DG  G +G +G  G  L C  PG  G  GF G PG  G  G +G  G  G  G  G KG  G  G +         GF G +GE G PG  G  G+ GY G  G  G P F    G     E G+ G  G+ G  G+KGF GD+G  G  G  GK G  GP+G++G+                   G+ G  G  G PG+ G  G           G KG                                G +G  GS G++G  G KG  G  G  G +G   +SG T +PG++G+KG +G  G  G  G  G  G  G  GLKGF G  G+ G    +G  G+KG RG+ G  G+S    P       GEKG +G  G+ G                       G   ++     RP  S G  G +G  G  GS G AG  G+ G  G  G  G  G+ G  GIPG KG++G+T GI G  G  G  G+ G +G++G+ G+ GD G  G  G   + G+ GDPG P    + G  G  G  GLPG  G  G  GRPG    IG  GF G  GL G +GL G +G  G  G      I+  PG  GL G KG +G PG            V GD G +G  G  GD G  G QG  G  G  G +  S I G+ G  G  GL G++G PG  G  G  G            + GIPG +G +G +G  GF G  G++G  G  G PG+   G  G  G  G PG  G  G  G  G  G QG  G   P  + ++   G +GLPG  G PG  GD G +G++G+ G  GL G  G DG         + GD G+PGL GP GF G  G
Sbjct:  288 GEKGILGLPGPRGPMGSEGIQGHPGRQGKKGTSGFPGINGFPGIKGEKGDIGVRGPDSFTDADGAVISGYPGDPGVLGLPGLRGDEGVQGQRGPSGTPGLPSLTGLPGALGPQGFPGLKGDQGNSGRTTFGEAGLPGRVGLPGLPGLPGPSGPPGRTFETGHLSNIEPGFPGLQGEQGPKGHQGLKGVKGDSGFCACEGGAPNIGPHGEPGLPGIQ-GPIGLQGFKGTKGDPGSRGASG-----------PAGTPGLFGPRGQTGLKGKKGEPTVSRGSKMSGDKGDPGPQGTPGLAG---TPGKDGRPGLPGLPGIQG-DGGSGFPGERGLPGLPGEKGHDGPIGPPGIGLPGPPGPRGLPGDKGVDGLPGQQGLRGAQGVTLPCIIPGSYGPSGFPGAPGFPGSKGARGLPGIPGKPGTHGSKGGPGSPGLM---HLPGLPGFPGVRGEKGLPGFPGLPGKDGYPGKAGSPGLPGFKGAAGDIFGAENGASGEQGLQGLPGDKGFPGDSGLPGPKGLNGKPGMLGPKGERGNPGTSGPPGQPGPSGSTDPFGIKGTSGFPGAPGLPGISG---------HPGKKG------------------------------QRGDIGQPGSTGKRGLPGIKGLPGPQGSPGFLGSPGLSGVTGLPGIEGQKGEKGSSGPVGFPGLPGLPGLPGADGLKGFSGSFGKVGQPGQTGTSGEKGDRGDPGPVGISSPRPPMLNLWFKGEKGSRGSAGSDGFPGPRGDKGEPGIPGLPGPPGATGQTNTIKGLNGRP-GSPGSMGRRGLPGLKGSLGIAGFPGMPGKSGSQGLTGTSGLLGATGIPGLKGDQGQTLGISGSPGPKGQPGELGFKGVKGKDGLVGDRGYPGNKGDGGKVGITGDPGFPGSPGLQGISGMNGDPGLPGSSGHLGSIGRPGPSGLIGPKGFPGAPGLHGLNGLPGTKGTHGTPGAS----ITGVPGPAGLPGPKGERGVPG-----------IVIGDPGKQGSKGQKGDQGSPGLQGPAGTPGAPGISLPSVIAGQPGDPGRPGLDGERGRPGPPGPPGPPGPSSDQGDPGDSGFPGIPGLQGFKGNQGLPGFSGLSGELGLKGMRGEPGLM--GTPGKIGQPGDPGFPGMKGKAGPRGFSGPQGAPG-HTPIAEAMQVPPGPLGLPGIDGIPGLIGDPGSQGSVGLQGSKGLPGIPGKDGPSGLPGPSGILGDPGLPGLQGPPGFEGAPG 1449          

HSP 2 Score: 258.07 bits (658), Expect = 1.387e-68
Identity = 385/1064 (36.18%), Postives = 477/1064 (44.83%), Query Frame = 3
Query:  201 GNKGRQGFPGPRGYQGVSGDKGDVG----QFGMP--GPKGYKGFTGAIGPQGRKGERGIPGSPGYPGKMGEMGFPGIRGDIGEKGLTGCDGQ---------QGDFGNPGMNGLVGRTGQPGERGDDGDRGLSIIPKYGLKGNKGSRGLLGRYGRKGEKGF--------------------KGIKGYSGIFGIKGNKGYVGPMGRRGPKGDSLGTVIIQSEKGSKGDKGLKGQSGIP-CKGFQIEGRMYGRVGSDGPIGDKGIKGEKGLMGEIGQSGIDGARGLNGEKGLPG-----------EAGPRGERGDRGNP---GFPGDPGASGADGTRGRQGERGPKGVHGISGADGPRGSRGDKGPSGSLLSCPGRKGEKGFFGIPGIKGDIGNKGYQGHDGDIGEIGFKGEKGYEGPLGPSCSEVEQGFRGTKGESGFPGLRGAKGQRGYSGNKGIKG--------KPNFGTGINNPGETGSYGNLGVPGEKGNKGFIGDTGEKGFSGTGKQGPEGPRGD---KGDDGVNGQVGMIGMPGIKGDKGSTYPICPFCEKGYKGIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEGRMGLLGSKGRQGYKGGKGFSGSMGDAGEIGYVTISGTT-IPGVKGEKGNQGPKGNKGEFGEAGSRGRKGYSGLKGFKGLIGERGTSFSSGDPGDKGLRGENGKDGVSFAGIPGEKGLKGDKGNRGILGDVGSLSNCATRPITSKGFKGPQGAKGTSGSPGSAGKTGIVGNKGENGYPGK--RGIDGDNGIPGSKGEEGETGIKGHAGRPGNLGKSGLQGLRGEYGVKGDLGIQGIPGRK------GVMGDPGPNGY-------------------AMIGSKGDKGIKGLPGIYGAKGDKGRPGYIGIPGFKGETGLIGRSGLKGDQGEIGEKGIKGFTFISNNPGDRGLLGNKGLKGFPGELGNKGQVGVCTVRGDQGLRGYSGLIGDMGMKGE---QGSKGIVGDYGAASRSGIMGRTGKIGNQGLPGDQXXXXXXXXXXXXXXXXYIGIPGFEGDRGEKGNKGFPGFPGD 3116
            G  G QG  GP+G+QG+ G KGD G    + G P  GP G  G  G  GP G +G +G  G PG  G  G  G PG+ G  G+ GL G  G+          GD G+PG  G  G  G PG+ G  G  GL  I   G  G  G RGL G  G KG  G                     KG+ G  G  G++G +G   P    G  G S G        GSKG +GL G  G P   G +      G +   G  G  G++GEKGL G  G  G DG  G  G  GLPG           E G  GE+G +G P   GFPGD G  G  G  G+ G  GPKG  G  G  GP G  G  G +       G KG  GF G PG+ G  G+ G +G  GDIG+ G  G++G  G  G    +   GF G+ G SG  GL G +GQ+G  G+ G  G              G+   G +GS+G +G PG+ G  G  GD G+ G  G     P  P  +   KG+ G  G  G  G PG +GDKG           G  G                N +KG  G  G PG  GR GL G KG  G  G  G  G  G  G  G   + G T IPG+KG++G     G  G  G  G  G  G+ G+KG  GL+G+RG   + GD G  G+ G+ G     F G PG +G+ G  G+ G+ G  G L +     I   G  G  G KG  G+PG  G  G+ G KG +G PG    G+ G  G+PG KGE G  GI    G PG  G  G +G +G  G++G  G  G PG        G  GDPG  G                    +  G  GD G  G+PG+ G KG++G PG+ G+ G  G  G+ G  GL G  G+IG+ G  GF  +    G RG  G +G  G    +    QV    + G  G+ G  GLIGD G +G    QGSKG+ G  G    SG+ G +G +G+ GLPG Q                  G PGFEG  G +G  G PG PG 
Sbjct:  456 GFPGLQGEQGPKGHQGLKGVKGDSGFCACEGGAPNIGPHGEPGLPGIQGPIGLQGFKGTKGDPGSRGASGPAGTPGLFGPRGQTGLKGKKGEPTVSRGSKMSGDKGDPGPQGTPGLAGTPGKDGRPGLPGLPGIQGDGGSGFPGERGLPGLPGEKGHDGPIGPPGIGLPGPPGPRGLPGDKGVDGLPGQQGLRGAQGVTLPCIIPGSYGPS-GFPGAPGFPGSKGARGLPGIPGKPGTHGSKGGPGSPGLMHLPGLPGFPGVRGEKGLPGFPGLPGKDGYPGKAGSPGLPGFKGAAGDIFGAENGASGEQGLQGLPGDKGFPGDSGLPGPKGLNGKPGMLGPKGERGNPGTSGPPGQPGPSGSTDPF----GIKGTSGFPGAPGLPGISGHPGKKGQRGDIGQPGSTGKRGLPGIKGLPGPQGSPGFLGSPGLSGVTGLPGIEGQKGEKGSSGPVGFPGLPGLPGLPGADGLK--GFSGSFGKVGQPGQTGTSGEKGDRGDPGPVGI--SSPRPPMLNLWFKGEKGSRGSAGSDGFPGPRGDKGEPGIPGLPGPPGATG--------------QTNTIKGLNGRPGSPGSMGRRGLPGLKGSLGIAGFPGMPGKSGSQGLTGTSGLLGATGIPGLKGDQGQT--LGISGSPGPKGQPGELGFKGVKGKDGLVGDRGYPGNKGDGGKVGITGDPG-----FPGSPGLQGISGMNGDPGLPGSSGHLGS-----IGRPGPSGLIGPKGFPGAPGLHGLNGLPGTKGTHGTPGASITGVPGPAGLPGPKGERGVPGIV--IGDPGKQGSKGQKGDQGSPGLQGPAGTPGAPGISLPSVIAGQPGDPGRPGLDGERGRPGPPGPPGPPGPSSDQGDPGDSGFPGIPGLQGFKGNQGLPGFSGLSGELGLKGMRGEPGLMGTPGKIGQPGDPGFPGMKGKAGPRGFSGPQGAPGH-TPIAEAMQVPPGPL-GLPGIDGIPGLIGDPGSQGSVGLQGSKGLPGIPGKDGPSGLPGPSGILGDPGLPGLQ------------------GPPGFEGAPGNQGPIGQPGMPGH 1462          

HSP 3 Score: 256.914 bits (655), Expect = 2.522e-68
Identity = 520/1530 (33.99%), Postives = 652/1530 (42.61%), Query Frame = 3
Query:  189 CQCFGNKGRQGFPGPRGYQGVSGDKGDVGQFGMPGPKGYKGFTGAIGPQGRKGERGIPGSPGYPGKMGEMGFPGIRGDIGEKGLTGCDGQQGDFGNPGMNGLVGRTGQPGERGDDGDRGLSIIPKYGLKGNKGSRGLLGRYGRKGEKGFKGIKGYSGI-----------------------FGIKGNKGYVGPMGRRGPKGDSLGTVIIQSEKGSKGDKGLKGQSGIPCKGFQIEGRMYGRVGSDGPIGDKGIKGEKGLMGEIGQSGIDGARGLNGEK---GLPGEAGPRGERGDRGNPGFPGDPGASGADGTRGRQGERGPKGVHGISGADGPRGSRGDKGPSG-----SLLSCPGRKGEKGFFGIPGIKGDIGNKGY--------------------------------QGHDGDIGEIGFKGEKGYEGPLGPSCSEVEQGFRGTKGESGF---------------PGLRGAKGQRGYSGNKGIKGKPNFGTGINNPGETGSYGNLGVPGEKGNKGFIGDTGEKG---------FSG-TGKQGPEGPRGDKGDDGVNGQVGMIGMPGIKGDKGSTYPICPFCEKGYKGIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEGRMGL------------------LGSKGRQGYKGGKGFSGSMGDAGEIGYVTISGTT----------------IPGVKGEKGNQGPKGNKGEFGEAGSRGRKGYSGLKGFKGLIGER--GTSFSSGDPGDKGLRGENGKDGVSFAGIPGEKGLKGDKGNRGILGDVGS-LSNCATRPITSKGFKGPQGAKGTSGSPGSAGKTGIVGNKGENGYPGKRGIDGDNGIPGSKGEEGETGIKGHAGRPGNLGKSGLQGLRGEYGVKGDLGIQGIPGRKGVMGDPGPNGYA----------------MIGSKGDKGIKGLPGIYGAKGDKGRPGYIGIPG---------FKGETGLIGRSGLKGDQGEIGEKG-------------------IKGFTFISNNPGDRGLLGNKGLKGFPGELGNKGQVGVCTVRGDQGLRGYSGLIGDM---GMKGEQG-SKGIVGDYGAASRSGIMGRTGKIGNQGLPGDQXXXXXXXXXXXXXXXXYIGIPGFEGDRGEKGNKGFPGFPGDIGQPGRLGNPGISTEGVXXXXXXXXXXXXXXXXXXXXXXXXXXKQGDSGIS-IPGRQGIKGEDGT--IGLPGEMGEPGPRGDFGQKGNIGITGEFGLQGNRGDDGLKGDDGIPGLNGPRGFIGDIGFVGFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXELGLDGSMGGKGDNGPRGFNGPTGIPGSKGFEGD---KGIRGDIGVKGFQ---GQHGEIGFPGLKGVSGENGRQXXXXXXXXXXXXXXXXVCMQPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEVGESIRGLQGRKGSTGLRGNIGIPGERGDKGIPGLQGKVGNKGVKGDIGDKGFSGNIGDKGYSGISGDKGSFGVKGDKGFQGDVG 4232
            C CF  KG +G PGP G QG +G +G  G  G+ G KG +G  G +GP G KG++G  G PG+ G  G  G PG  G  G  G  GC+G QG  G PG +G  G  G PG  G  G +G  +  +  + G +G  GL G  G  G  G  G  G +G                         G +G KG  G +G  GP G    T  ++     KG KG KG+ G P              GS G  G+KGI G  G  G +G  GI G  G  G+K   G PG  G  G +G++G+ G  G    + ADG     G  G  GV G+ G  G  G +G +GPSG     SL   PG  G +GF   PG+KGD GN G                                  GH  +I E GF G +G +GP G       QG +G KG+SGF               PGL G +G  G  G KG KG         +PG  G+ G  G PG  G +G  G  G+KG          SG  G  GP+G  G  G  G +G+ G+ G+PGI+GD GS +P     E+G  G+                GL G  G +GLPGD+G  GL                   GS G  G+ G  GF GS G  G  G     GT                 +PG  G +G +G  G  G  G+ G  G+ G  GL GFKG  G+     + +SG+ G +GL G+ G  G S  G+PG KGL G  G  G  G+ G+  ++         G   P G KGTSG PG+ G  GI      +G+PGK+G  GD G PGS G+ G  GIKG        G  G  G  G  G+ G  G+ GI G+KG  G  GP G+                   GS G  G  G  G  G KGD+G PG +GI           FKGE G  G +G  G  G  G+KG                   IKG   ++  PG  G +G +GL G  G LG  G  G+    G QGL G SGL+G     G+KG+QG + GI G  G   + G +G  G  G  GL GD+G+PG+KG  G  G  G  G PG  G +G  G  G PG PG  G  G +G PG S                    GL G  G PG  G  G++ +PG +G  G  G    G+PG  G PGP+G+ G  G +      G  G +G  G KGD G PGL GP G  G  G      S                 +G  G  G  G  G   + G  G  G  G  G +GF G  G+PG  G  G+   KG+RG+ G+ G     GQ G+ GFPG+KG +G  G  G  G  G         V   P                                      I G+ G  G  G +G++G+ G +G  GIPG  G  G  G  G +GD G  G  G  G+ G  G++G  G  G  G    VG
Sbjct:   40 CTCFPEKGARGHPGPIGTQGPAGPEGFTGPTGLSGLKGERGSPGPLGPYGSKGDKGPIGVPGFVGISGIPGHPGQPGPRGPPGPDGCNGTQGAVGFPGPDGYPGILGPPGLPGHKGAKGEPVPFQGSITGIRGDPGLPGLDGIPGPSGSSGSPGDAGPIGPPGLQGPPGLPGLPGPEGNMGLGFQGEKGVKGDVGLPGPAGPPPSTGELEFMGFPKGKKGSKGEPGPPGFPGMSGPPGVPEFGSTGEKGEKGILGLPGPRGPMGSEGIQGHPGRQGKKGTSGFPGINGFPGIKGEKGDIGVRGPDSFTDADGAV-ISGYPGDPGVLGLPGLRGDEGVQGQRGPSGTPGLPSLTGLPGALGPQGF---PGLKGDQGNSGRTTFGEAGLPGRVGLPGLPGLPGPSGPPGRTFETGHLSNI-EPGFPGLQGEQGPKG------HQGLKGVKGDSGFCACEGGAPNIGPHGEPGLPGIQGPIGLQGFKGTKG---------DPGSRGASGPAGTPGLFGPRGQTGLKGKKGEPTVSRGSKMSGDKGDPGPQGTPGLAGTPGKDGRPGLPGLPGIQGDGGSGFP----GERGLPGLP-GEKGHDGPIGPPGIGLPGPPGPRGLPGDKGVDGLPGQQGLRGAQGVTLPCIIPGSYGPSGFPGAPGFPGSKGARGLPGIPGKPGTHGSKGGPGSPGLMHLPGLPGFPGVRGEKGLPGFPGLPGKDGYPGKAGSPGLPGFKGAAGDIFGAENGASGEQGLQGLPGDKGFPGDS--GLPGPKGLNGKPGMLGPKGERGNPGTSGPPGQPGPSGSTDPFGIKGTSGFPGAPGLPGI------SGHPGKKGQRGDIGQPGSTGKRGLPGIKGLP------GPQGSPGFLGSPGLSGVTGLPGIEGQKGEKGSSGPVGFPGLPGLPGLPGADGLKGFSGSFGKVGQPGQTGTSGEKGDRGDPGPVGISSPRPPMLNLWFKGEKGSRGSAGSDGFPGPRGDKGEPGIPGLPGPPGATGQTNTIKG---LNGRPGSPGSMGRRGLPGLKGSLGIAGFPGMPGKSGSQGLTGTSGLLGATGIPGLKGDQGQTLGISGSPGPKGQPGELGFKGVKGKDGLVGDRGYPGNKGDGGKVGITGDPGFPGSPGLQGISGMNGDPGLPGSSGHLGSIGRPGPS--------------------GLIGPKGFPGAPGLHGLNGLPGTKGTHGTPGASITGVPGPAGLPGPKGERGVPGIV-----IGDPGKQGSKGQKGDQGSPGLQGPAGTPGAPGIS--LPSVIAGQPGDPGRPGLDGERGRPGPPGPPGPPGPSSDQGDPGDSGFPGIPGLQGFKGNQGLPGFSGLSGELGLKGMRGEPGLMGTPGKIGQPGDPGFPGMKGKAGPRGFSGPQGAPGHTPIAEAMQVPPGPLGL---------------------------------PGIDGIPGLIGDPGSQGSVGLQGSKGLPGIPGKDGPSGLPGPSGILGDPGLPGLQGPPGFEGAPGNQGPIGQPGMPGHGVRVG 1467          

HSP 4 Score: 256.529 bits (654), Expect = 4.282e-68
Identity = 184/508 (36.22%), Postives = 248/508 (48.82%), Query Frame = 3
Query: 3981 GESIRGLQGRKGSTGLRGNIGIPG-------------ERGDKGIPGLQGKVGNKGVKGDIGDKGFSGNIGDKGYSGISGD---------KGSFGVKGDKGFQGDVGMLGKSGLQGDRGQKGIIGF---------RGTRGIPGSMGLPGEIGEKGDVGPSGI----GVKGLKGYQNAVG-------IKGRKGEKGLPGFPGRPGKVGDQGDKGPKGM-----------KNMNTXXXXXXXXXXXXXXXXXXXXXXXXXLPGDMGEIGPNGPIGY-ADNGFLYATHSQSKDFPPCHGGGSPLYNGYSLLAIHGDIDSVTMDLGTPGSCLKNFSTIPFVNCFLERNTFYGGRCHVNMRNSRSYWLSTLQSYMSSPQPPSKMDDYISRCSVCQTKTTVMAFHSQKSDWQMTKCPYGWQKLWAGFSFPMAVQASRSGSNQPFSSPGSCLKHFRSLPFIECNNHNSNCNHWRDGVSYYMTAVDSENQFVKAQGKVLKSQTDIMNSISKCVVCQR 5342
            G SI G+ G  G  G +G  G+PG             ++GD+G PGLQG  G  G  G       +G  GD G  G+ G+          G  G   D+G  GD G  G  GLQG +G +G+ GF         +G RG PG MG PG+IG+ GD G  G+    G +G  G Q A G       ++   G  GLPG  G PG +GD G +G  G+           K+  +G  G  G  G  G  G++G  G +G PG+ G IG  G  G+    G+    HSQS+  P C  G S L+ GYSLL + G   +   DLG  GSCL  FST+PF+ C +         CH   RN +SYWLST       P   +++  YISRCSVC+  +  +A HSQ  D  + +CP GW  LW G+SF M   A   G  Q   SPGSCL+ FR+ PFIEC+     C+++ +  S+++T V+   QF +           +   +S+C VC +
Sbjct: 1190 GASITGVPGPAGLPGPKGERGVPGIVIGDPGKQGSKGQKGDQGSPGLQGPAGTPGAPGISLPSVIAGQPGDPGRPGLDGERGRPGPPGPPGPPGPSSDQGDPGDSGFPGIPGLQGFKGNQGLPGFSGLSGELGLKGMRGEPGLMGTPGKIGQPGDPGFPGMKGKAGPRGFSGPQGAPGHTPIAEAMQVPPGPLGLPGIDGIPGLIGDPGSQGSVGLQGSKGLPGIPGKDGPSGLPGPSGILGDPGLPGLQGPPGFEGAPGNQGPIGQPGMPGHGVRVGYTLVKHSQSEQVPLCPTGMSRLWVGYSLLFVEGQEKAHNQDLGFAGSCLPRFSTMPFIYCNINE------VCHYARRNDKSYWLSTTAPIPMMPVGQTQIPQYISRCSVCEAPSQAIAVHSQ--DIIVPQCPLGWHSLWIGYSFLMHTAAGAEGGGQSLVSPGSCLEDFRATPFIECSGARGTCHYFANKYSFWLTTVEERGQFREEPVSETLKTGQLHTRVSRCQVCMK 1689          

HSP 5 Score: 235.343 bits (599), Expect = 1.177e-61
Identity = 361/1076 (33.55%), Postives = 450/1076 (41.82%), Query Frame = 3
Query:  189 CQC------FGNKGRQGFPG---PRGYQGVSGDKGDVGQFGMPGPKGYKGFTGAIGPQGRKGERGIP---------GSPGYPGKMGEMGFPGIRGDIGEKGLTGCDGQQGDFGNPGMNGLVGRTGQPGERGDDG--------------------DRGLSIIP-KYGLKGNKGSRGLLGRYGRKGEKGFKGIKGYSGIFGIKGNKGYVGPMGRRGPKGDSLGTVIIQSE-----KGSKGDKGLKGQSGIPCK-GFQIEGRMYGRVGSDGPIGD-----KGIKGEKGLMGEIGQSGIDGARGLNGEKGL---PGEAGPRGERGD---------------------RGNPGFPGDPGASGADGTRGRQGERGPKGVHGISGADGPRGSRGDKGPSGS--LLSCPGRKGEKGFFGIPGIKGDIGN---------------------KGYQGHDGDIGEIG------FKGEKGYEGPLGPSCSEV---------EQGFRGTKGESGFPGLRGAKGQRGYSGNKG---IKGKPNFGTGIN-NPGETGSYGNLGVPGEKGNKGFIGDTGEKGFSGTGKQGPEGPRGDKGDDGVNGQVGMIGMPGIKGDKGSTYPICPFCEKGYKGIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEGRMGLLGSKGRQGYKGGKGFSGSMGDAGEIGYVTISGTT-IPGVKGEKGNQGPKGNKGEFGEAGSRGRKGYSGLKGFKGLIGERGTSFSSGDPGDKGLRGENGKDGVSFAGIPGEKGLKGDKGNRGILGDVGSLSNCATRPITSKGFKGPQGAKGTSGSPGSAGKTGIVGN---------KGENGYPGKRGIDG------------------DNGIPGSKGEEGETGIKGHAGRPGNLGKSGLQGLRGEYGVKGDLGIQGIPGRKGVMGDPG---------PNGY--------------AMIGSKGDKGIKGLPGIYGAKGDKGRPGYIG---------IPGFKGETGLIGRSGLKGDQGEIGEKGIKGFTFISNNPGDRGLLGNKGLKGFPGELG-------NKGQVGVCTVRGDQGLRGYSGLI 2867
            C C       G  G  G PG   P G QG  G KGD G  G  GP G  G  G  G  G KG++G P         G  G PG  G  G  G  G  G  GL G  G QGD G+ G  G  G  G PGE+G DG                    D+G+  +P + GL+G +G        G  G  GF G  G+ G  G +G  G  G  G  G KG      ++         G +G+KGL G  G+P K G+  +    G  G  G  GD      G  GE+GL G  G  G  G  GL G KGL   PG  GP+GERG+                     +G  GFPG PG  G  G  G++G+RG  G  G +G  G  G +G  GP GS   L  PG  G  G  GI G KG+ G+                     KG+ G  G +G+ G       KG++G  GP+G S             E+G RG+ G  GFPG RG KG+ G  G  G     G+ N   G+N  PG  GS G  G+PG KG+ G  G  G  G SG+           +G  G +G +G  G+PG+KGD+G T  I      G KG                                G +G  G KG+ G  G +G+ G+ GD G++G     G    PG++G  G  G  G  G  G  GS GR G SGL G KG  G  G    +G PG KG    +G  G S  G+PG  GL G KG RG+ G V          I   G +G +G KG  GSPG  G  G  G           G+ G PG+ G+DG                  D G PG  G  G  G++G  G  G  G SGL G  G  G++G+ G+ G PG+ G  GDPG         P G+              AM    G  G+ G+ GI G  GD G  G +G         IPG  G +GL G SG+ GD G  G +G  GF      PG++G +G  G+ G    +G          QV +C     +   GYS L 
Sbjct:  482 CACEGGAPNIGPHGEPGLPGIQGPIGLQGFKGTKGDPGSRGASGPAGTPGLFGPRGQTGLKGKKGEPTVSRGSKMSGDKGDPGPQGTPGLAGTPGKDGRPGLPGLPGIQGDGGS-GFPGERGLPGLPGEKGHDGPIGPPGIGLPGPPGPRGLPGDKGVDGLPGQQGLRGAQGVTLPCIIPGSYGPSGFPGAPGFPGSKGARGLPGIPGKPGTHGSKGGPGSPGLMHLPGLPGFPGVRGEKGLPGFPGLPGKDGYPGKAGSPGLPGFKGAAGDIFGAENGASGEQGLQGLPGDKGFPGDSGLPGPKGLNGKPGMLGPKGERGNPGTSGPPGQPGPSGSTDPFGIKGTSGFPGAPGLPGISGHPGKKGQRGDIGQPGSTGKRGLPGIKGLPGPQGSPGFLGSPGLSGVTGLPGIEGQKGEKGSSGPVGFPGLPGLPGLPGADGLKGFSGSFGKVGQPGQTGTSGEKGDRGDPGPVGISSPRPPMLNLWFKGEKGSRGSAGSDGFPGPRGDKGEPGIPGLPGPPGATGQTNTIKGLNGRPGSPGSMGRRGLPGLKGSLGIAGFPGMPGKSGS-----------QGLTGTSGLLGATGIPGLKGDQGQTLGIS--GSPGPKG------------------------------QPGELGFKGVKGKDGLVGDRGYPGNKGDGGKVGITGDPGFPGSPGLQGISGMNGDPGLPGSSGHLGSIGRPGPSGLIGPKGFPGAPGLHGLNGLPGTKG---THGTPGASITGVPGPAGLPGPKGERGVPGIV----------IGDPGKQGSKGQKGDQGSPGLQGPAGTPGAPGISLPSVIAGQPGDPGRPGLDGERGRPGPPGPPGPPGPSSDQGDPGDSGFPGIPGLQGFKGNQGLPGFSGLSGELGLKGMRGEPGLMGTPGKIGQPGDPGFPGMKGKAGPRGFSGPQGAPGHTPIAEAMQVPPGPLGLPGIDGIPGLIGDPGSQGSVGLQGSKGLPGIPGKDGPSGLPGPSGILGDPGLPGLQGPPGF---EGAPGNQGPIGQPGMPGHGVRVGYTLVKHSQSEQVPLCPTGMSRLWVGYSLLF 1497          

HSP 6 Score: 176.022 bits (445), Expect = 1.619e-43
Identity = 426/1310 (32.52%), Postives = 540/1310 (41.22%), Query Frame = 3
Query:  432 KGLTGCDGQQGDFGNPGMNGLVGRTGQPGERGDDGDRGLSIIPKYGLKGNKGSRGLLGRYGRKGEKGFKGIKGYSGI---------------------------FGIKGNKGY---VGPMGRRGPKGDSLGTVIIQ-SEKGSKGDKGLKGQSGIPCKGFQIEGRMYGRVGSDGPIGDK---------------GIKGEKGLMGEIGQSGIDGARGLNGEKGLPGEAGPRGERGDRGNPGFPGDPGASGADGTR--GRQGERGPKGVHGISGADGPRGSRGDKGPSGSLLSCPGRKGEKGFFGIPGIKGDIGNKGYQGHDGDIGEIGFKGEKGYEGPLGPSCSEVEQGFRGTKGESGFPGLRGAKGQRGYSGNKGIKGKPNFGTGINNPGETGSYGNLGVPGEKGNKGFIGDT--GEKGFSG---------------------------------TGKQGPEGPRGDKGDDGVNGQVGMIGMPGIKGDKGSTYPICPFCEKGYKGIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEGRMGLLGSKGRQGYKGGKGFSGSMGDAGEIGYVTISGTTIPGVKGE---------KGNQGPKGNKGEFGEAGSRGRKGYSGLKGFKGLIGERGTSFSSGDPGDKGLRGENGKDGVS---------------------FAGIPGEKGLKGDKGNRGILGDVGSLSNCATRPITSKGFKGPQGAKGTSGSPGSAGKTGIVGNKGENGYPGKRGIDGDNGIPGSKGEEGETGIKGHAGRPGNLGKSGLQGLRGEYGVKGDLGIQGIPGRKGVMGDPGPNGYAMIGSKGDKGIKGLPGIYGAKGDKGRPGYIGIPGFKGETGLIGRSGLKGDQGE------------------IGEKGIKGF------TFISNNP------GDRGLLGNKGLKGFPGELGNKGQVGVCTVRGDQGLRGYSGLIGDMGMKGEQGSKGIV---------------GDYGAASRSGIMGRTGKIGNQGLPGDQXXXXXXXXXXXXXXXXYIGIPGFEGDRGEKGNKGFPGFPGDIGQPGRLGNPGISTEGVXXXXXXXXXXXXXXXXXXXXXXXXXXKQGDSGIS----IPGRQGIKGEDGTIGLPGEMGEPGPRGDFGQKGNI-------GITGEFGLQGNRGDDGLKGDDGIP---------GLNGPRGFIGDIGFVGFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEL-GLDGSMGGKGDNGP-----RGFNGPTGIPGSKGFEGDKGIR-GDIGVKGFQGQHGEIGFPGLKGVSGENG 3806
             G+  C  ++G  G+PG    +G  G  G  G  G  GLS     GLKG +GS G LG YG KG+KG  G+ G+ GI                            G  G  GY   +GP G  G KG     V  Q S  G +GD GL G  GIP                   +                  G +GEKG+ G++G  G  G     GE    G   P+G++G +G PG PG PG SG  G    G  GE+G KG+ G+ G  GP GS G +G        PGR+G+KG  G PGI       G+ G  G+ G+IG +G   +    G     V  G+ G  G  G PGLRG +G +G  G  G  G P+  TG+      G+ G  G PG KG++G  G T  GE G  G                                  G QG +GP+G +G  GV G  G          +G    I P  E G  GIQ                              G +GL G KG +G  G +G SG  G  G  G    +G  + G KGE          G++G  G +G  G AG+ G+ G  GL G  G+ G+ G+ F  G+ G  GL GE G DG                         G+PG++GL+G +G               T P    G  GP G  G  G PGS G  G+ G  G+ G  G +G  G  G+    G  G  G++G  G PG        GL G+ G  G  G  G+PG KG  GD      A  G+ G++G++GLPG      DKG PG  G+PG KG  G  G  G KG++G                    G KG  GF        IS +P      GD G  G+ G +G PG  G  G  G     G  GL G +GL G  G KGE+GS G V               G  G +   G +G+ G+ G  G  GD+G PG  G    +     +   G +G RG  G+ GFPG  GD G+   +               + GL G  G PG  G  G PG +G  GI+    +PG+ G +G  GT GL G  G PG +GD GQ   I       G  GE G +G +G DGL GD G P         G+ G  GF G  G  G  G  G+ G  G  G  G   +                 L GL+G  G KG +G       G  GP G+PG KG  G  GI  GD G +G +GQ G+ G PGL+G +G  G
Sbjct:   37 HGVCTCFPEKGARGHPGP---IGTQGPAGPEGFTGPTGLS-----GLKGERGSPGPLGPYGSKGDKGPIGVPGFVGISGIPGHPGQPGPRGPPGPDGCNGTQGAVGFPGPDGYPGILGPPGLPGHKGAKGEPVPFQGSITGIRGDPGLPGLDGIPGPSGSSGSPGDAGPIGPPGLQGPPGLPGLPGPEGNMGLGFQGEKGVKGDVGLPGPAGPPPSTGELEFMGF--PKGKKGSKGEPGPPGFPGMSGPPGVPEFGSTGEKGEKGILGLPGPRGPMGSEGIQG-------HPGRQGKKGTSGFPGIN------GFPGIKGEKGDIGVRGPDSFTDADG----AVISGYPGDPGVLGLPGLRGDEGVQGQRGPSGTPGLPSL-TGL-----PGALGPQGFPGLKGDQGNSGRTTFGEAGLPGRVGLPGLPGLPGPSGPPGRTFETGHLSNIEPGFPGLQGEQGPKGHQGLKGVKGDSGFCAC------EGGAPNIGPHGEPGLPGIQ------------------------------GPIGLQGFKGTKGDPGSRGASGPAGTPGLFGPRGQTG--LKGKKGEPTVSRGSKMSGDKGDPGPQGTPGLAGTPGKDGRPGLPGLPGIQGDGGSGFP-GERGLPGLPGEKGHDGPIGPPGIGLPGPPGPRGLPGDKGVDGLPGQQGLRGAQG--------------VTLPCIIPGSYGPSGFPGAPGFPGSKGARGLPGIPGKPGTHGSKGGPGSPGLMHLPGLPGFPGVRGEKGLPG------FPGLPGKDGYPGKAGSPGLPGFKGAAGD---IFGAENGASGEQGLQGLPG------DKGFPGDSGLPGPKGLNGKPGMLGPKGERGNPGTSGPPGQPGPSGSTDPFGIKGTSGFPGAPGLPGISGHPGKKGQRGDIGQPGSTGKRGLPGIKGLPGPQGSPGFLGSPGLSGVTGLPGIEGQKGEKGSSGPVGFPGLPGLPGLPGADGLKGFSGSFGKVGQPGQTGTSGEKGDRGDPGPVGISSPRPPMLNLWFKGEKGSRGSAGSDGFPGPRGDKGE-PGIPGLPGPPGATGQTNTIKGLNGRPGSPGSMGRRGLPGLKGSLGIAGFPGMPGKSGSQGLTGTSGLLGATGIPGLKGDQGQTLGISGSPGPKGQPGELGFKGVKGKDGLVGDRGYPGNKGDGGKVGITGDPGFPGSPGLQGISGMNGDPGLPGSSGHLGSIGRPGPSGLIGPKGFPGAPGLHGLNGLPGTKGTHGTPGASITGVPGPAGLPGPKGERGVPGIVIGDPGKQGSKGQKGDQGSPGLQGPAGTPG 1244          

HSP 7 Score: 134.42 bits (337), Expect = 8.768e-31
Identity = 182/544 (33.46%), Postives = 238/544 (43.75%), Query Frame = 3
Query:  168 RICTPDKCQCFGNKGRQGFPGPRG------------YQGVSGDKGDVGQFGMPGPKGYKGFTGAIGPQGRKGE-------RGIPGSPGYPGKMGEMGFPGIRGDIGEKGLTGCDGQQGDFGNPGMNGLVGRTGQPGERGDDGDR-GLSIIP-------KYGLKGNKGSRGLLGRYGRKGEKG------------------FKGIKGYSGIFGIKGNKGYVGPMGRRGPKGDSLGTVIIQSEKGSKGDKGLKGQSGIP-------CKGFQIEGRMYGRVGSDGPIGDKGIKG----EKGLMGEIGQSGIDGARGLNGEKGLPGEAG---PRGERGDRGNPGFPG------------------------DPGASGADGTRGRQGERGPKGVHGISGADGPRGSRGDKGPSGSLLSCPGRKGEKGFFGIPGIKGDIGNKGYQGHDGDIGE-------------IGFKGEKGYEGPLGPSCSEVEQGFRGTKGESGFP------GLRGAKGQRGYSGNKGIKGKPNFGTGINNPGETGSYGNLGVPGE 1493
            ++  P +    G KG +G PGP G            ++G  G +G  G  G PGP+G KG  G  G  G  G        +G+ G PG PG MG  G PG++G +G  G  G  G+ G  G  G +GL+G TG PG +GD G   G+S  P       + G KG KG  GL+G  G  G KG                   +GI G +G  G+ G+ G++G +GR GP G       +   KG  G  GL G +G+P         G  I G + G  G  GP G++G+ G    + G  G  GQ G  G+ GL G  G PG  G   P    G  G+PG PG                        DPG SG  G  G QG +G +G+ G SG  G  G +G +G  G L+  PG+ G+ G  G PG+KG  G +G+ G  G  G              +G  G  G  G +G   S+   G +G+KG  G P      GL G  G  G  G  G++G P F      PG  G  G  G+PG 
Sbjct:  931 KVGQPGQTGTSGEKGDRGDPGPVGISSPRPPMLNLWFKGEKGSRGSAGSDGFPGPRGDKGEPGIPGLPGPPGATGQTNTIKGLNGRPGSPGSMGRRGLPGLKGSLGIAGFPGMPGKSGSQGLTGTSGLLGATGIPGLKGDQGQTLGISGSPGPKGQPGELGFKGVKGKDGLVGDRGYPGNKGDGGKVGITGDPGFPGSPGLQGISGMNGDPGLPGSSGHLGSIGRPGPSG-------LIGPKGFPGAPGLHGLNGLPGTKGTHGTPGASITG-VPGPAGLPGPKGERGVPGIVIGDPGKQGSKGQKGDQGSPGLQGPAGTPGAPGISLPSVIAGQPGDPGRPGLDGERGRPGPPGPPGPPGPSSDQGDPGDSGFPGIPGLQGFKGNQGLPGFSGLSGELGLKGMRGEPG-LMGTPGKIGQPGDPGFPGMKGKAGPRGFSGPQGAPGHTPIAEAMQVPPGPLGLPGIDGIPGLIGDPGSQGSVGLQGSKGLPGIPGKDGPSGLPGPSGILGDPGLPGLQGPPGF---EGAPGNQGPIGQPGMPGH 1462          

HSP 8 Score: 79.337 bits (194), Expect = 5.123e-14
Identity = 75/180 (41.67%), Postives = 93/180 (51.67%), Query Frame = 3
Query: 3990 IRGLQGRKGST----GLRGNIGIPGERGDKGIPGLQGKVGNKGVKGDIGDKGFSGNIGDKGYSGISGDKGSFGVKGDKGFQGDVGMLGKSGLQGDRGQKGIIGFRGTRGIPGSMGLPGEIGEKGDVGPSGIGVKGLKGYQNAVGIKGRKGEKGLPGF----PGRPGKVGDQGDKGPKGMK 4505
            I GL+G +G T    G  G  G PGE G KG+ G  G VG++G  G+ GD G  G  GD G+ G  G +G  G+ GD G  G  G LG  G  G  G  G  GF G  G+ G  GLPG  G  G  G S  GV G        G+ G KGE+G+PG     PG+ G  G +GD+G  G++
Sbjct: 1064 IPGLKGDQGQTLGISGSPGPKGQPGELGFKGVKGKDGLVGDRGYPGNKGDGGKVGITGDPGFPGSPGLQGISGMNGDPGLPGSSGHLGSIGRPGPSGLIGPKGFPGAPGLHGLNGLPGTKGTHGTPGASITGVPG------PAGLPGPKGERGVPGIVIGDPGKQGSKGQKGDQGSPGLQ 1237          

HSP 9 Score: 77.7962 bits (190), Expect = 1.396e-13
Identity = 75/199 (37.69%), Postives = 93/199 (46.73%), Query Frame = 3
Query: 4023 GLRGNIGIPGERGDKGIPGLQGKVGNKGVKGDIGDKGFSGNIGDK--GYSGISGDKGSFGVKGDKGFQGDVGMLGKSGLQGDRGQ------------------------------KGIIGFRGTRGIPGSMGLPGEIGEKGDVGPSGI-------GVKGLKGYQNAVGIKGRKGEKGLPGFPGRPGKVGDQGDKGPKGM 4502
            GL G  G+ GE+G  G PGL GK G  G  G  G  GF G  GD     +G SG++G  G+ GDKGF GD G+ G  GL G  G                               KG  GF G  G+PG  G PG+ G++GD+G  G        G+KGL G Q + G  G  G  G+ G PG  G+ G++G  GP G 
Sbjct:  709 GLPGFPGVRGEKGLPGFPGLPGKDGYPGKAGSPGLPGFKGAAGDIFGAENGASGEQGLQGLPGDKGFPGDSGLPGPKGLNGKPGMLGPKGERGNPGTSGPPGQPGPSGSTDPFGIKGTSGFPGAPGLPGISGHPGKKGQRGDIGQPGSTGKRGLPGIKGLPGPQGSPGFLGSPGLSGVTGLPGIEGQKGEKGSSGPVGF 907          

HSP 10 Score: 77.0258 bits (188), Expect = 2.257e-13
Identity = 188/658 (28.57%), Postives = 235/658 (35.71%), Query Frame = 3
Query: 2187 LSNCATRPITSKGFKGPQGAKGTSGSPGSAGKTGIVGNKGENGYPGKRGIDGDNGIPGSKGEEGETGIKGHAGRPGNLGKSGLQGLRGEYGVKGDLGIQGIP------------------GRKGVMGDPGPNGYAMIGSKGDKGIKGLPGIYGAKGDKGRPGYI--GIPGFKGETGLIGRSGLKGDQ-----------------------------------GEIGEKGIKGFTFISNNPGDRGLLGNKGLKGFP------------------------GELGNKGQVGVCTVRGDQGLRGYSGLIGDMGMKGEQGSKGIVGDYGAASRSGIMGRTGKIGNQGLPGDQXXXXXXXXXXXXXXXXYIGIPGFEGD---RGEKGNKGFPGFPGDIGQPGRLGNPGISTEGVXXXXXXXXXXXXXXXXXXXXXXXXXXKQGDSGISIPGRQGIKG---------------------EDGTI-----GLPGEMGEPGPRGDFGQKGNIGITGEFGLQGNRGDDGLKGDDGIPGLNGPRGFIGDIGFVGFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXELGLDGSMGGKGDNGPRGFNGPTGIPGSKGFEGDKGIRGDIG---------VKGFQGQHGEIGFPGLKGVSGENGR 3809
            +S C T+ +   G K   G     GS    G       KG  G+PG  G  G  G  G  G  G +G+KG  G PG LG  G +G +G  GV G +GI GIP                  G +G +G PGP+GY         GI G PG+ G KG KG P      I G +G+ GL G  G+ G                                     G  GEKG+KG   +    G     G     GFP                         E G+ G+ G   + G  G RG  G  G  G  G QG KG  G  G     GI G  G IG +G P            G+ G  G +G+PG  GD   +G++G  G PG P   G PG LG  G                            G  G QG+SG +  G  G+ G                     E G +     G PG  GE GP+G  G KG  G +G    +G   + G  G+ G+PG+ GP      IG  GF+                                            G KGD G RG +GP G PG  G  G  G++G  G         + G +G  G  G PGL G  G++GR
Sbjct:   10 VSLCLTKELAESGQKMSYGKP--CGSRDCHGVCTCFPEKGARGHPGPIGTQGPAGPEGFTGPTGLSGLKGERGSPGPLGPYGSKGDKGPIGVPGFVGISGIPGHPGQPGPRGPPGPDGCNGTQGAVGFPGPDGYP--------GILGPPGLPGHKGAKGEPVPFQGSITGIRGDPGLPGLDGIPGPSGSSGSPGDAGPIGPPGLQGPPGLPGLPGPEGNMGLGFQGEKGVKGDVGLPGPAGPPPSTGELEFMGFPKGKKGSKGEPGPPGFPGMSGPPGVPEFGSTGEKGEKGILGLPGPRGPMGSEGIQGHPGRQGKKGTSGFPGINGFPGIKGEKGDIGVRG-PDSFTDADGAVISGYPGDPGVLGLPGLRGDEGVQGQRGPSGTPGLPSLTGLPGALGPQGFP--------------------------GLKGDQGNSGRTTFGEAGLPGRVGLPGLPGLPGPSGPPGRTFETGHLSNIEPGFPGLQGEQGPKGHQGLKGVKGDSGFCACEGGAPNIGPHGEPGLPGIQGP------IGLQGFK--------------------------------------------GTKGDPGSRGASGPAGTPGLFGPRGQTGLKGKKGEPTVSRGSKMSGDKGDPGPQGTPGLAGTPGKDGR 580          

HSP 11 Score: 71.633 bits (174), Expect = 1.017e-11
Identity = 81/229 (35.37%), Postives = 102/229 (44.54%), Query Frame = 3
Query: 3990 IRGLQGRKGSTGLRGNIGIPGERGDKGIPGLQGKVGN-----------KGVKGDIGDKGFSGNIGDKGYSGISGDKG---------------------------SFGVKGDKGFQGDVGMLGKSGLQGDRGQKGIIGFRGT---RGIPGSMGLPGEIGEKGDVGPSGI-GVKGLKGYQNAVGIKGRKG---------------EKGLPGFPGRPGKVGDQGDKGPKGMK 4505
            +RG +G  G  GL G  G PG+ G  G+PG +G  G+           +G++G  GDKGF G+ G  G  G++G  G                            FG+KG  GF G  G+ G SG  G +GQ+G IG  G+   RG+PG  GLPG  G  G +G  G+ GV GL G +   G KG  G                 GL GF G  GKVG  G  G  G K
Sbjct:  716 VRGEKGLPGFPGLPGKDGYPGKAGSPGLPGFKGAAGDIFGAENGASGEQGLQGLPGDKGFPGDSGLPGPKGLNGKPGMLGPKGERGNPGTSGPPGQPGPSGSTDPFGIKGTSGFPGAPGLPGISGHPGKKGQRGDIGQPGSTGKRGLPGIKGLPGPQGSPGFLGSPGLSGVTGLPGIEGQKGEKGSSGPVGFPGLPGLPGLPGADGLKGFSGSFGKVGQPGQTGTSGEK 944          

HSP 12 Score: 69.3218 bits (168), Expect = 6.067e-11
Identity = 71/169 (42.01%), Postives = 90/169 (53.25%), Query Frame = 3
Query: 3990 IRGLQGRKGSTGLRGNIGIPG---ERGDKGIPGLQGKVGNKGVKGDIGDKGFSGNIGDKGYSGISGDKGSFGVKGDKGFQGDVGMLGKSGLQGDRGQKGIIGFRGT---RGIPGSMGLPGEIGEKGDVGPSGIGVKGLKGYQNAVGIKGRKGEKGLPGFPGRPGKVGDQ 4478
            I+G  G  G+ GL G  G PG   +RGD G PG  GK G  G+KG  G +G  G +G  G SG++G  G  G KG+KG  G VG  G  GL G  G  G+ GF G+    G PG  G  GE G++GD GP  +G+   +     +  KG KG +G  G  G PG  GD+
Sbjct:  823 IKGTSGFPGAPGLPGISGHPGKKGQRGDIGQPGSTGKRGLPGIKGLPGPQGSPGFLGSPGLSGVTGLPGIEGQKGEKGSSGPVGFPGLPGLPGLPGADGLKGFSGSFGKVGQPGQTGTSGEKGDRGDPGP--VGISSPRPPMLNLWFKGEKGSRGSAGSDGFPGPRGDK 989          

HSP 13 Score: 68.5514 bits (166), Expect = 8.497e-11
Identity = 72/200 (36.00%), Postives = 94/200 (47.00%), Query Frame = 3
Query: 3993 RGLQGRKGSTGLRGNIGIPGERGDKGIPGLQGKVGNKG---------------VKGDIGDKGFSGNIGDKGYSGISGDKGSFGVKGDKGFQGDVGMLGKSGLQGDRGQKGIIGFRGTRGIPGSMGLPGEIGEKGDVGPSG-------------IGVKGLKGYQNAVGIKGRKGEKGLPGFPGRPGKVGDQGDKGPKGMKN 4508
            +GLQG  G  G  G+ G+PG +G  G PG+ G  G +G                    G KG SG  G  G  GISG  G  G +GD G  G  G  G  G++G  G +G  GF G+ G+ G  GLPG  G+KG+ G SG              G  GLKG+  + G  G+ G+       G  G+ GD+GD GP G+ +
Sbjct:  764 QGLQGLPGDKGFPGDSGLPGPKGLNGKPGMLGPKGERGNPGTSGPPGQPGPSGSTDPFGIKGTSGFPGAPGLPGISGHPGKKGQRGDIGQPGSTGKRGLPGIKGLPGPQGSPGFLGSPGLSGVTGLPGIEGQKGEKGSSGPVGFPGLPGLPGLPGADGLKGFSGSFGKVGQPGQT------GTSGEKGDRGDPGPVGISS 957          

HSP 14 Score: 65.4698 bits (158), Expect = 8.400e-10
Identity = 74/189 (39.15%), Postives = 91/189 (48.15%), Query Frame = 3
Query: 3996 GLQGRKGSTGLRGNIGIPGERGD------------KGIPGLQGKVGNKGVKGDIGDKGFSGNIGDKGYSGISGDKGSFGVKGDKGFQGDVGMLGKSGLQGDRGQKGIIGFRGTRGIPGSMGLPGEIGEKGDVG-----PSGIGVKGLKGYQNAVGIKGRKGEKGLPGF---------PGRPGKVGDQGD 4484
            G +G KG  GL G+ G PG +GD             G PGLQG     G+ GD G  G SG++G  G  G S      G+ G KGF G  G+ G +GL G +G  G  G   T G+PG  GLPG  GE+G  G     P   G KG KG Q + G++G  G  G PG          PG PG+ G  G+
Sbjct: 1091 GFKGVKGKDGLVGDRGYPGNKGDGGKVGITGDPGFPGSPGLQGI---SGMNGDPGLPGSSGHLGSIGRPGPS------GLIGPKGFPGAPGLHGLNGLPGTKGTHGTPGASIT-GVPGPAGLPGPKGERGVPGIVIGDPGKQGSKGQKGDQGSPGLQGPAGTPGAPGISLPSVIAGQPGDPGRPGLDGE 1269          

HSP 15 Score: 63.1586 bits (152), Expect = 4.304e-9
Identity = 75/201 (37.31%), Postives = 93/201 (46.27%), Query Frame = 3
Query: 4005 GRKGSTGLRGNIGIPGERGDKGIPGLQGKVGNKGVKGDIGDKGFSGNIGDKGYSGISGDKGSFGVKGD-----------KGFQGDVGMLGKSGLQGD------RGQKGIIGFRGTRGIPGSMGLPGEIGEKGDVGPSGIGVKGLKGYQNAV------------GIKGRKGEKGL-----PGFPGRPGKVGDQGDKGPKGMK 4505
            G  G  G +G +G+PG RG  G  G+QG  G +G       KG SG  G  G+ GI G+KG  GV+G             G+ GD G+LG  GL+GD      RG  G  G     G+PG++G  G  G KGD G SG    G  G    V            G  GR  E G      PGFPG  G+ G +G +G KG+K
Sbjct:  282 GSTGEKGEKGILGLPGPRGPMGSEGIQGHPGRQG------KKGTSGFPGINGFPGIKGEKGDIGVRGPDSFTDADGAVISGYPGDPGVLGLPGLRGDEGVQGQRGPSGTPGLPSLTGLPGALGPQGFPGLKGDQGNSGRTTFGEAGLPGRVGLPGLPGLPGPSGPPGRTFETGHLSNIEPGFPGLQGEQGPKGHQGLKGVK 476          

HSP 16 Score: 61.6178 bits (148), Expect = 1.265e-8
Identity = 76/225 (33.78%), Postives = 98/225 (43.56%), Query Frame = 3
Query: 3990 IRGLQGRKGSTGLRGNIGIPGERGDK---GIPGLQGKVGNKGVKGDIGDKG-----------FSGNIGDKGYSGISGDKGSFGVKGDKGFQGDVGMLGKSGLQGDRGQKGIIGFRGTRG-----IPGSMGLPG---------------------EIGEKGDVGPSGIGVKGLKGYQNAVGIKGRKGEKGL---------------PGFPGRPGKVGDQGDKGPKG 4499
            I GL G +G  G  G  G PG +G K   G PG+ G  G KG KGDIG +G            SG  GD G  G+ G +G  GV+G +G  G  G+   +GL G  G +G  G +G +G       G  GLPG                     E G   ++ P   G++G +G +   G+KG KG+ G                PG PG  G +G QG KG KG
Sbjct:  292 ILGLPGPRGPMGSEGIQGHPGRQGKKGTSGFPGINGFPGIKGEKGDIGVRGPDSFTDADGAVISGYPGDPGVLGLPGLRGDEGVQGQRGPSGTPGLPSLTGLPGALGPQGFPGLKGDQGNSGRTTFGEAGLPGRVGLPGLPGLPGPSGPPGRTFETGHLSNIEPGFPGLQGEQGPKGHQGLKGVKGDSGFCACEGGAPNIGPHGEPGLPGIQGPIGLQGFKGTKG 516          

HSP 17 Score: 61.6178 bits (148), Expect = 1.353e-8
Identity = 71/200 (35.50%), Postives = 87/200 (43.50%), Query Frame = 3
Query: 3996 GLQGRKGSTGLRGNIGIPGERGDKGIPGLQGKVGNKGVKGDIGDKGFSGNIGDKGYSGISGDKGSFGVKGDKGFQGDVGMLGKSGLQGDRGQKGIIGFRGT--RGIPGSMGLPGEIGEKG-----------------------DVGPSGI-GVKGLKGYQN------------------AVGIKGRKGEKGLPGFPGRPG 4463
            G  G  G  G++G IG+ G +G KG PG +G  G  G  G  G +G +G  G KG   +S      G KGD G QG  G+ G  G  G  G  G+ G +G    G PG  GLPG  GEKG                       D G  G+ G +GL+G Q                   A G  G KG +GLPG PG+PG
Sbjct:  492 GPHGEPGLPGIQGPIGLQGFKGTKGDPGSRGASGPAGTPGLFGPRGQTGLKGKKGEPTVSRGSKMSGDKGDPGPQGTPGLAGTPGKDGRPGLPGLPGIQGDGGSGFPGERGLPGLPGEKGHDGPIGPPGIGLPGPPGPRGLPGDKGVDGLPGQQGLRGAQGVTLPCIIPGSYGPSGFPGAPGFPGSKGARGLPGIPGKPG 691          

HSP 18 Score: 61.2326 bits (147), Expect = 1.472e-8
Identity = 76/224 (33.93%), Postives = 96/224 (42.86%), Query Frame = 3
Query: 3984 ESIRGLQGRKGSTGLRGNIGIPGERGDKGIPGLQGKV------------GNKGVKGDIGDKGFSGNIGDKG-------------------YSGISGDKGSFGVKGDKGFQGDVGMLGKSGLQGDRGQKGIIGFRGTRGIPGSMGLPGEIGEKGDV-------GPSG----IGVKGLKGYQNAVGIKGRKGEK---------GLPGFPGRPGKVGDQGDKGPKGM 4502
            + ++G  G  G  G  G  G  GE+GD+G PG  G              G KG +G  G  GF G  GDKG                     G++G  GS G  G +G  G  G LG +G  G  G+ G  G  GT G+ G+ G+PG  G++G         GP G    +G KG+KG    VG +G  G K         G PGFPG PG  G  G  G  G+
Sbjct:  920 DGLKGFSGSFGKVGQPGQTGTSGEKGDRGDPGPVGISSPRPPMLNLWFKGEKGSRGSAGSDGFPGPRGDKGEPGIPGLPGPPGATGQTNTIKGLNGRPGSPGSMGRRGLPGLKGSLGIAGFPGMPGKSGSQGLTGTSGLLGATGIPGLKGDQGQTLGISGSPGPKGQPGELGFKGVKGKDGLVGDRGYPGNKGDGGKVGITGDPGFPGSPGLQGISGMNGDPGL 1143          

HSP 19 Score: 60.077 bits (144), Expect = 4.043e-8
Identity = 83/211 (39.34%), Postives = 103/211 (48.82%), Query Frame = 3
Query: 3993 RGLQGRKGSTGLRGNIGI---PGERGDKGI---PGLQGKVGNKGVKGDIGDKGFSGNIGDKGYSGISGDKGSFGVKGDKGFQGDV---GMLGKSGLQGDRGQKGIIGF---------------RGTRGIPGSMGLPGEIGEKGDVGPSGIG-----------VKGLKGYQNAVGIKGR------KGEKGLPGFPGRPGKVGDQGDKGPKGM 4502
            RG  G+ GSTG RG  GI   PG +G  G    PGL G  G  G++G  G+KG SG +G  G  G+ G  G+ G+KG  G  G V   G  G SG +GDRG  G +G                +G+RG  GS G PG  G+KG+ G  G+            +KGL G   + G  GR      KG  G+ GFPG PGK G QG  G  G+
Sbjct:  848 RGDIGQPGSTGKRGLPGIKGLPGPQGSPGFLGSPGLSGVTGLPGIEGQKGEKGSSGPVGFPGLPGLPGLPGADGLKGFSGSFGKVGQPGQTGTSGEKGDRGDPGPVGISSPRPPMLNLWFKGEKGSRGSAGSDGFPGPRGDKGEPGIPGLPGPPGATGQTNTIKGLNGRPGSPGSMGRRGLPGLKGSLGIAGFPGMPGKSGSQGLTGTSGL 1058          

HSP 20 Score: 58.5362 bits (140), Expect = 1.111e-7
Identity = 85/259 (32.82%), Postives = 114/259 (44.02%), Query Frame = 3
Query: 3984 ESIRGLQGRKGSTGLRGNIGIPGERGDKGIPGLQGKVGNKGVKGDIGDKGFSGNIG--------------------------DKGYSGISGDKGSFGVKGDKGFQGD------------VGMLGKSGLQGDRGQKGIIGFRGTRGIPGSMGLPGEIGEKGDVGPSG-IGVKGLKGYQNAV------GIKGRKGEKGLPGFPGRPGKVGDQGDKGPKGMKNMNTXXXXXXXXXXXXXXXXXXXXXXXXXLPGDMGEIGPN 4625
            E ++G +G  G+ GL    G+PG  G +G PGL+G  GN G +   G+ G  G +G                          + G+ G+ G++G  G +G KG +GD            +G  G+ GL G +G  G+ GF+GT+G PGS G  G  G  G  GP G  G+KG KG           G KG  G +G PG  G PGK G  G  G  G++                   G  G  GE+GLPG  GE G +
Sbjct:  373 EGVQGQRGPSGTPGLPSLTGLPGALGPQGFPGLKGDQGNSG-RTTFGEAGLPGRVGLPGLPGLPGPSGPPGRTFETGHLSNIEPGFPGLQGEQGPKGHQGLKGVKGDSGFCACEGGAPNIGPHGEPGLPGIQGPIGLQGFKGTKGDPGSRGASGPAGTPGLFGPRGQTGLKGKKGEPTVSRGSKMSGDKGDPGPQGTPGLAGTPGKDGRPGLPGLPGIQG-----------------DGGSGFPGERGLPGLPGEKGHD 613          

HSP 21 Score: 56.6102 bits (135), Expect = 3.798e-7
Identity = 73/210 (34.76%), Postives = 91/210 (43.33%), Query Frame = 3
Query: 3984 ESIRGLQGRKGSTGLRGNIGIPGERGDKGIPGLQGKVGNKGVKGDIGDKGFSGN------IGDKGYSGISGDKGSFGVKGDKGFQGDVGMLGKSGLQGDRGQKGIIGFRGT--------RGIPGSMGLPGEIGEKGDVGPSGI-GVKGLKGYQNAVGIKGRKGE---------------------KGLPGFPGRPGKVGDQGDKGPKGMK 4505
            + + G QG +G+ G+     IPG  G  G PG  G  G+KG +G  G  G  G        G  G   + G  G  GV+G+KG  G  G+ GK G  G  G  G+ GF+G          G  G  GL G  G+KG  G SG+ G KGL G    +G KG +G                      KG  GFPG PG  G  G  G KG +
Sbjct:  639 DGLPGQQGLRGAQGVTLPCIIPGSYGPSGFPGAPGFPGSKGARGLPGIPGKPGTHGSKGGPGSPGLMHLPGLPGFPGVRGEKGLPGFPGLPGKDGYPGKAGSPGLPGFKGAAGDIFGAENGASGEQGLQGLPGDKGFPGDSGLPGPKGLNGKPGMLGPKGERGNPGTSGPPGQPGPSGSTDPFGIKGTSGFPGAPGLPGISGHPGKKGQR 848          

HSP 22 Score: 55.4546 bits (132), Expect = 8.889e-7
Identity = 72/216 (33.33%), Postives = 95/216 (43.98%), Query Frame = 3
Query: 3990 IRGLQGRKGS--TGLRGNIGIPGERG-----------------------DKGIPGLQGKVGNKGVKGDIGDKGFSGNIGDKGYSGISGDKGSFGVKGDKGFQGDVG---------------MLGKSGLQGDRGQKGIIGFRGT------RGIPGSMGLPGEIGEKGDVGPSGIGVKGLKGYQNAVGIKGRKGEKGLP---GFPGRPGKVGDQGDKG 4490
            + G+QG  GS   G RG  G+PGE+G                       DKG+ GL G+ G +G +G        G+ G  G+ G  G  GS G +G  G  G  G               + G  G  G RG+KG+ GF G        G  GS GLPG  G  GD+  +  G  G +G Q   G KG  G+ GLP   G  G+PG +G +G++G
Sbjct:  586 LPGIQGDGGSGFPGERGLPGLPGEKGHDGPIGPPGIGLPGPPGPRGLPGDKGVDGLPGQQGLRGAQGVTLPCIIPGSYGPSGFPGAPGFPGSKGARGLPGIPGKPGTHGSKGGPGSPGLMHLPGLPGFPGVRGEKGLPGFPGLPGKDGYPGKAGSPGLPGFKGAAGDIFGAENGASGEQGLQGLPGDKGFPGDSGLPGPKGLNGKPGMLGPKGERG 801          

HSP 23 Score: 54.6842 bits (130), Expect = 1.424e-6
Identity = 73/197 (37.06%), Postives = 90/197 (45.69%), Query Frame = 3
Query: 3981 GESIRGLQGRKGSTGLRGNIGIPGERGDKGIPGLQGKVGNKGVKGDIGDKGFSGNIGDKGYSGISG-----------------DKGSFGVKGDKGFQGDVGML------GKSGLQGDRGQKGIIGFRGTRGIPGSMGLPGEIGEKGDVGPSGIGVKGLKGYQNAVGIKGRKGEKGLPGFPGRPGKVGDQGDKGPKGM 4502
            G  + G +G  G  G  G  G PG+ G  G+PGL G  G+ G  G  G++G  G  G+KG+ G  G                 DKG  G+ G +G +G  G+       G  G  G  G  G  G +G RG+PG  G PG  G K      G G  GL       G  G +GEKGLPGFPG PGK G  G  G  G+
Sbjct:  553 GSKMSGDKGDPGPQGTPGLAGTPGKDGRPGLPGLPGIQGDGG-SGFPGERGLPGLPGEKGHDGPIGPPGIGLPGPPGPRGLPGDKGVDGLPGQQGLRGAQGVTLPCIIPGSYGPSGFPGAPGFPGSKGARGLPGIPGKPGTHGSK-----GGPGSPGLMHLPGLPGFPGVRGEKGLPGFPGLPGKDGYPGKAGSPGL 743          
BLAST of Collagen IV NC1 domain-containing protein vs. Ensembl Mouse
Match: Col1a2 (collagen, type I, alpha 2 [Source:MGI Symbol;Acc:MGI:88468])

HSP 1 Score: 269.24 bits (687), Expect = 1.993e-72
Identity = 374/1014 (36.88%), Postives = 459/1014 (45.27%), Query Frame = 3
Query:  201 GNKGRQGFPGPRGYQGVSGDKGDVGQFGMPGPKGYKGFTGAIGPQGRKGERGIPGSPGYPGKMGEMGFPGIRGDIGEKGLTGCDGQQGDFGNPGMNGLVGRTGQPGERGDDGDRGLSIIP----KYGLKGNKGSRGLLGRYGRKGEKGFKGIKGYSGI---------FGIKGNKGYVGPMGRRGPKG-----------DSLGTVIIQSEKGSKGDKGLKGQSGIP-CKGFQIEGRMYGR------VGSDGPIGDKGIKGEKGLMGEIGQSGIDGARGLNGEKGLPGEAGPRGERGDRGNPGFPGDPGASGADGTRGRQGERGPKGVHGISGADGPRGSRGDKGPSGSLLSCPGRKGEKGFFGIPGIKGDIGNKGYQGHDGDIGEIGFKGEKGYEGPLGPSCSEVEQGFRGTK---------GESGFPGLRGAKGQRGYSGNKGIKGKP---NFGTGINNPGETGSYGNLGVPGEKGNKGFIGDTGEKGFSGT-GKQGPEGPRGDKGDDGVNGQVGMIGMPGIKGDKGSTYPICPFCEKGYKGIQXXXXXXXXXXXXXXXXXXXXXXXXXXXX------DEGRMGLLGSKGRQGYKGGKGFSGSMGDAGEIGYVTISGTTIP-GVKGEKGNQGPKGNKGEF------------GEAGSRGRKGYSGLKGFKGLIGERGTSFSSGDPGDKGLRGENGKDGVS-FAGIPG---------------------EKGLKGDKGNRGILGDVGSLSNCATRPITSKGFKGPQGAKGTSGSPGSAGKTGIVGNKGENGYPGKRGIDGDNGIPGSKGEEGETGIK---GHAGRPGNLGKSGLQGLRGEYGVKGDLGIQGIPGRKGVMGDPGPNGYAMIGSKGDKGIKGLPGIYGAKGDKGRPGYIGIPGFKGETGLIGRSGLKGDQGEIGEKGIKGFTFISNNPGDRGLLGNKGLKGFPGELGNKGQVGVCTVRGDQGLRGYSGLIGDMGMKGEQGSKGIVGDYGAASRSGIMGRTGKIGNQG 2978
            G  G  G PGP+G+QG +G+ G+ GQ G  GP+G  G  G  G  G  G+ G PG  G  G  G  GFPG  G  G KG+ G  G  G  G PG  G+ G  G PGE G  G  G   +P    + G  G  G+RG  G  G  G  G  G  G  G           G  GN G  GP G RG  G            + GT  +   KG+ G  G+ G  G+P  +G        G       VG  GP G KG  G KG  G +G  G  G  G  G++G PGEA   G  G  G PG  G PG+ G  G  GR G  GP G  G +G  G RG  GD           GR GE G  G  G+ G  GN G  G +G +G  G  G  G  GP GP       GF G K         GE G PGL GA+G  G  GN G +G P       G    G  G  G  G+PG  G  G +G  GE+G  G  G  GP GPRG++G  G +G  G  G  G +G  G+  P     E G  G  G  G  G  G  G  G  G  G KG  G      D G  G  G++G  G  G  G +G+ GD GE G    SG   P G  GE+G  GP G  G              GE G++G KG +G+ G  G +G  G S  +G PG  G RG+ G  G++ F G  G                     ++G++G +G++G +G  G     A+ P    G KGP G  GT+G+PG+AG  G++G  G  G PG RG  G  GI G+ GE G  GI    G  G PG +G  G+ G  GE G  G+ G  G PGR G  G  G  GY   GS G  G  G PG +G+ G  G+ G  G PG  G  G +G  G +G  G  G +G KG       PGD+G  G  GLKG+    G +G  G+  + GDQG     G +G  G +G  G  G VG  G + + G +G  G  G+QG
Sbjct:  106 GPPGAVGAPGPQGFQGPAGEPGEPGQTGPAGPRGPAGSPGKAGEDGHPGKPGRPGERGVVGPQGARGFPGTPGLPGFKGVKGHSGMDGLKGQPGAQGVKGEPGAPGENGTPGQAGARGLPGERGRVGAPGPAGARGSDGSVGPVGPAGPIGSAGPPGFPGAPGPKGELGPVGNPGPAGPAGPRGEVGLPGLSGPVGPPGNPGTNGLTGAKGATGLPGVAGAPGLPGPRGIPGPAGAAGATGARGLVGEPGPAGSKGESGNKGEPGSVGAQGPPGPSGEEGKRGSPGEA---GSAGPAGPPGLRGSPGSRGLPGADGRAGVMGPPGNRGSTGPAGIRGPNGDA----------GRPGEPGLMGPRGLPGSPGNVGPSGKEGPVGLPGIDGRPGPIGPAGPRGEAGNIGFPGPKGPSGDPGKPGERGHPGLAGARGAPGPDGNNGAQGPPGPQGVQGGKGEQGPAGPPGFQGLPGPSGTTGEVGKPGERGLPGEFGLPGPAGPRGERGTPGESGAAGPSGPIGSRGPSGAPGPDGNKGEAGAVGAPGSAGASGPGGLPGERGAAGIPGGKGEKGETGLRGDTGNTGRDGARGIPGAVGAPGPAGASGDRGEAGAAGPSGPAGPRGSPGERGEVGPAGPNGFAGPAGAAGQPGAKGEKGTKGPKGENGIVGPTGSVGAAGPSGPNGPPGPVGSRGDGGPPGMTGFPGAAGRTGPPGPSGIAGPPGPPGAAGKEGIRGPRGDQGPVGRTGETG--ASGPPGFVGEKGPSGEPGTAGAPGTAGPQGLLGAPGILGLPGSRGERGLPGIAGALGEPGPLGISGPPGARGPPGAVGSPGVNGAPGEAGRDGNPGSDGPPGRDGQPGHKGERGYP--GSIGPTGAAGAPGPHGSVGPAGKHGNRGEPGPAGSVGPVGAVGPRGPSGPQGIRGDKG------EPGDKGHRGLPGLKGY---SGLQGLPGLAGLHGDQGA---PGPVGPAGPRGPAGPSGPVGKDGRSGQPGPVGPAGVRGSQG 1090          

HSP 2 Score: 239.965 bits (611), Expect = 2.437e-63
Identity = 388/1138 (34.09%), Postives = 480/1138 (42.18%), Query Frame = 3
Query:  306 KGFTGAIGPQGRKGERGIPGSPGYPGKMGEMGFPGIRGDIGEKGLTGCDGQQGDFGNPGMNGLVGRTGQPGERGDDGDRGLSIIPKYGLKGNKGSRGLLGRYGRKGEKGFKGIKGYSGIFGIKGNKGYVGPMGRRGPKGDSLGTVIIQSEKGSKGDKGLKGQSGIPCKGFQIEGRMYGRVGSDGPIGDKGIKGEKGLMGEIGQSGIDGARGLN---------GEKGLPGEAGPRGERGDRGNPGFPGDPGASGADGTRGRQGERGPKGVHGISGADGPRGSRG--------DKGPSGSLLSCPGRKGEKGFFGIPGIKGDIGNKGYQGHDGDIGEIGFKGEKGYEGPLGPSCSEVEQGFRGTKGESGFPGLRGAKGQRGYSGNKGIKGKPNFGTGINNPGETGSYGNLGVPGEKGNKGFIGDTGEKGFSGT-GKQGPEGPRGDKGDDGVNGQVGMIGMPGIKGDKGSTYPICPFCEKGYKGIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEGRMGLLGSKGRQGYKGGKGFSGSMGDAGEIGYVTISGTTIPGVKGEKGNQGPKGNKGEFG---EAGSRGRKGYSGLKGFKGLIGERGTSFSSGDPGDKGLRGENGK-------DGVSFAGIPGEKGLKG------DKGNRGILGDVGSLSNCATRPIT-SKGFKGPQGAKGTSGSPGSAGKTGIVGNKGENGYPGKRGIDGDN---------------GIPGSKGEEGETGIKGHAGRPGNLGKSGLQGL------RGEYGVKGDLGIQGIPGR------------------------KGVMGDPGPNGYAMIGSKGDKGIKGLPGIYGAKGDKGRPGYIGIPGFKGETGLIGRSGLKGDQGEIGEKGIKGFTFISNNPGDRGL------------LGNKGLKGFPGELGNKGQVGVCTVRGDQGLRGYSGLIGDMGMKGEQGSKGIVGDYGAASRSGIMGRTGKIGNQGLPGDQXXXXXXXXXXXXXXXXYIGIPGFEGDRGEKGNKGFPGFPGDIGQPGRLGNPGISTEGVXXXXXXXXXXXXXXXXXXXXXXXXXXKQGDSGIS-IPGRQGIKGEDGTIGLPGEMGEPGPRGDFGQKGNIGITGEFGLQGNRGDDGLKGDDG 3440
            KG +   GP G  G RG PG+ G PG  G   F G  G+ GE G TG  G +G  G+PG  G  G  G+PG  G+            G+ G +G+RG     G  G  GFKG+KG+SG+ G+KG  G  G                ++ E G+ G+ G  GQ+G   +G   E    GRVG+ GP G +G  G  G +G  G  G  G  G           G  G PG AGP G RG+ G PG  G  G  G  GT G  G +G  G+ G++GA G  G RG            +  L+  PG  G KG  G  G  G +G +G  G  G+ G+ G  GE G  GP GP       G RG  G  G  G+ G  G RG +G  GI+G PN   G   PGE G  G  G+PG  GN G  G  G  G  G  G+ GP GP G +G      + G IG PG KG  G   P  P  E+G+ G+ G  G  G                      +G  G  G  G QG +GGKG  G  G  G  G    SGTT     GE G  G +G  GEFG    AG RG +G  G  G  G  G  G+   SG PG  G +GE G              G+PGE+G  G      +KG  G+ GD G+      R I  + G  GP GA G  G  G+AG +G  G +G  G  G+ G  G N               G  G+KG +GE GI G  G  G  G SG  G       RG+ G  G  G  G  GR                        +G  GD GP     +G  G+ G  G PG  G KG  G PG  G PG  G  GL+G  G+ G  G  GE+G+ G       PG  G+            +G+ G+ G PGE G  G  G        G  G  G  G  G +G  GS G  G  GA    G +G  GK GN+G PG  G  G  G  G +G  G  GI G +G+ G+KG++G PG                                                +G SG+  +PG  G+ G+ G    PG +G  GPRG  G  G +G  G  G  G  G  G++G  G
Sbjct:   90 KGVSSGPGPMGLMGPRGPPGAVGAPGPQG---FQGPAGEPGEPGQTGPAGPRGPAGSPGKAGEDGHPGKPGRPGE-----------RGVVGPQGARGF---PGTPGLPGFKGVKGHSGMDGLKGQPGAQG----------------VKGEPGAPGENGTPGQAG--ARGLPGE---RGRVGAPGPAGARGSDGSVGPVGPAGPIGSAGPPGFPGAPGPKGELGPVGNPGPAGPAGPRGEVGLPGLSGPVGPPGNPGTNGLTGAKGATGLPGVAGAPGLPGPRGIPGPAGAAGATGARGLVGEPGPAGSKGESGNKGEPGSVGAQGPPGPSGEEGKRGSPGEAGSAGPAGPPGLRGSPGSRGLPGADGRAGVMGPPGNRGSTGPAGIRG-PNGDAG--RPGEPGLMGPRGLPGSPGNVGPSGKEGPVGLPGIDGRPGPIGPAGPRG------EAGNIGFPGPKGPSGD--PGKP-GERGHPGLAGARGAPG---------------------PDGNNGAQGPPGPQGVQGGKGEQGPAGPPGFQGLPGPSGTT-----GEVGKPGERGLPGEFGLPGPAGPRGERGTPGESGAAGPSGPIGSRGPSGAPGPDGNKGEAGAVGAPGSAGASGPGGLPGERGAAGIPGGKGEKGETGLRGDTGNTGRDGARGIPGAVGAPGPAGASGDRGEAGAAGPSGPAGPRGSPGERGEVGPAGPNGFAGPAGAAGQPGAKGEKGTKGPKGENGIVGPTGSVGAAGPSGPNGPPGPVGSRGDGGPPGMTGFPGAAGRTGPPGPSGIAGPPGPPGAAGKEGIRGPRGDQGP-----VGRTGETGASGPPGFVGEKGPSGEPGTAGAPGTAGPQGLLGAPGILGLPGSRGERGLPGIAGALGEPGPLGISGPPGARGPPGAVGSPGVNGAPGEAGRDGNPG------SDGPPGRDGQPGHKGERGYPGSIGPTGAAGAPGPHGSVGPAGKHGNRGEPGPAGSVGPVGAVGPRGPSGPQGIRGDKGEPGDKGHRGLPGL-----------------------------------------------KGYSGLQGLPGLAGLHGDQGA---PGPVGPAGPRGPAGPSGPVGKDGRSGQPGPVGPAGVRGSQG 1090          

HSP 3 Score: 216.468 bits (550), Expect = 4.842e-56
Identity = 359/1105 (32.49%), Postives = 447/1105 (40.45%), Query Frame = 3
Query:  567 GLKGNKGSRGLLGRYGRKGEKGFKGIKGYSGIFGIKGNKGYVGPMGRRGPKGDS--LGTVIIQSEKGSKGDKGLKGQSGIPCKGFQIEGRMYGRVGSDGPIGDKGIKGEKG---LMGEIGQSGIDGARGLNGEKGLPGEAGPRGERGDRGNPGFPGDPGASGADGTRGRQG---------------------ERGPKGVHGISGADGPRGSRGDKGPSGSLLS-----CPGRKGEKGFFGIPGIKGDIGNKGYQG---------------------HDGDIGEIGFKGEKGYEGPLGPSCSEVEQGFRGTKGESGFPGLRGAKGQRGYSGNKGIKGKPNFGTGINNPGETGSYGNLGVPGEKGNKGFIGDTGEKGFSG----TGKQGPEGPRGDKGDDGVNGQVGMIGMPGIKGDKGSTYPICPFCEKGYKGIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEGRMGLLGSKGRQGYKGGKGFSGSMGDAGEIGYVTISGTTIPGVKGEKGNQGPKGNKGEFGEAGSRGRKGYSGLKGFKGLIGERGTSFSSGDPGDKGLRGENGKDGVSFAGIPGEKGLKGDKGNRGILGDVGSLSNCATRPITSKGFKGPQGAKGTSGSPGSAGKTG------------IVGNKGENGYPGKRG------IDGDNGIPGSKGEEGETGIKGHAGRPGNLGKSGLQGLRGEYGVKGDLGIQGIPGRKGVMGDPGPNGYAMI----------GSKGDKGIKGLPGIYG---------------------AKGDKGRPGYIGIPGFKGETGLI------------------GRSGLKGDQGEIGEKGIKGFTFISNNPGDRGLLGNKGLKGFPGELGNKGQVGVCTVRGDQGLRGYSGLIGDMGMKGEQGSKGIVGDYGAAS------RSGIMGRTGKIGNQGLPGDQXXXXXXXXXXXXXXXXYIGIPGFEGDRGEKGNKGFPGFPGDIGQPGRLGNPGISTEGVXXXXXXXXXXXXXXXXXXXXXXXXXXKQGDSGISIPGRQGIKGEDGTIGLPGEMGEPGPRGDFGQKGNIGITGEFGLQGNRGDDGLKGDDGIPGLNGPRGFIGDIGFVG 3494
            G+    G  GL+G  G  G  G  G +G+ G  G  G  G  GP G RGP G     G      + G  G++G+ G  G   +GF          G+ G  G KG+KG  G   L G+ G  G+ G  G  GE G PG+AG RG  G+RG  G PG  GA G+DG+ G  G                     E GP G  G +G  GPRG  G  G SG +         G  G KG  G+PG+ G  G  G +G                       G  GE G KGE G  G  GP     E+G RG+ GE+G  G  G  G RG  G++G+            PG  G  G +G PG +G+ G  G  G  G +G     G  GP G  G  G+ G +G+ G +G+PGI G  G   PI P                                           G  G  G  G+ G KG SG  G  GE G+  ++G    G  G  GN G +G  G  G  G +G +G +G  GF+GL G  GT+   G PG++GL GE G  G   AG  GE+G  G+ G  G  G +GS              +GP GA G  G+ G AG  G            + G +G  G PG +G      + GD G   + G +G  GI G  G PG  G SG +G  G  G  G  G +G PG +G +G  GPNG+A            G KG KG KG  GI G                     ++GD G PG  G PG  G TG                    G  G +GDQG +G  G  G +      G++G  G  G  G PG  G +G +G   + G  G RG  GL G  G  GE G  GI G  GA          G+ G  G+ G  G PG                    G PG +G  G KG +G+PG    IG  G  G PG                                  G  G +  G+ G +GE G  G  G +G  GPRG  G +G  G  GE G +G+RG  GLKG  G+ GL G  G  GD G  G
Sbjct:   91 GVSSGPGPMGLMGPRGPPGAVGAPGPQGFQGPAGEPGEPGQTGPAGPRGPAGSPGKAGEDGHPGKPGRPGERGVVGPQG--ARGFP---------GTPGLPGFKGVKGHSGMDGLKGQPGAQGVKGEPGAPGENGTPGQAGARGLPGERGRVGAPGPAGARGSDGSVGPVGPAGPIGSAGPPGFPGAPGPKGELGPVGNPGPAGPAGPRGEVGLPGLSGPVGPPGNPGTNGLTGAKGATGLPGVAGAPGLPGPRGIPGPAGAAGATGARGLVGEPGPAGSKGESGNKGEPGSVGAQGPPGPSGEEGKRGSPGEAGSAGPAGPPGLRGSPGSRGL------------PGADGRAGVMGPPGNRGSTGPAGIRGPNGDAGRPGEPGLMGPRGLPGSPGNVGPSGKEGPVGLPGIDGRPG---PIGP------------------------------------------AGPRGEAGNIGFPGPKGPSGDPGKPGERGHPGLAGAR--GAPGPDGNNGAQGPPGPQGVQGGKGEQGPAGPPGFQGLPGPSGTTGEVGKPGERGLPGEFGLPGP--AGPRGERGTPGESGAAGPSGPIGS--------------RGPSGAPGPDGNKGEAGAVGAPGSAGASGPGGLPGERGAAGIPGGKGEKGETGLRGDTG---NTGRDGARGIPGAVGAPGPAGASGDRGEAGAAGPSGPAGPRGSPGERGEVGPAGPNGFAGPAGAAGQPGAKGEKGTKGPKGENGIVGPTGSVGAAGPSGPNGPPGPVGSRGDGGPPGMTGFPGAAGRTGPPGPSGIAGPPGPPGAAGKEGIRGPRGDQGPVGRTGETGASGPPGFVGEKGPSGEPGTAGAPGTAGPQGLLGAPGILGLPGSRGERGLPGIAGALGEPGPLGISGPPGARGPPGAVGSPGVNGAPGEAGRDGNPGSD------------------GPPGRDGQPGHKGERGYPG---SIGPTGAAGAPG--------------------------------PHGSVGPA--GKHGNRGEPGPAGSVGPVGAVGPRGPSGPQGIRGDKGEPGDKGHRGLPGLKGYSGLQGLPGLAGLHGDQGAPG 1051          

HSP 4 Score: 209.534 bits (532), Expect = 6.855e-54
Identity = 357/1092 (32.69%), Postives = 451/1092 (41.30%), Query Frame = 3
Query:  849 SDGPIGDKGIKGEKGLMGEIGQSGIDGARGLNGEKGLPGEAGPRGERGDRGNPGFPGDPGASGADGTRGRQGERGPKGVHGISGADGPRGSRGDKGPSGS--LLSCPGRKGEKGFFGIPGIKGDIGNKGYQGHDGDIGEIGFKGEKGYEGP------------------------------LGPSCSEVEQGFRGTKGESGFPGLR------GAKGQRGYSGNKGIKGKPNFGTGINNPGETG------------SYGNLGVPGEKGNKGFIGDTGEKGFSGTGKQGPEGPRGDKGDDGVNGQVGMIGMPGIKGDKGSTYPICPFCEKGYKGIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEGRMGLLGSKGRQGYKGGKGFSGSMGDAGEIGYVTISGTTIPGVKGEKGNQGPKGNKGEFGEAGSRGRKGYSGLKGFKGLIGERGTSFSSGDPGDKGLRGENGKDGVSFAGIPGEKGLKGDKGNRGILGDVGSLSNCATRPITSKGFKGPQGAKGTSGSPGSAGKTGIVGNKGENGYPGKRGIDGDNGIPGSKGEEGETGIKGHAGRPGNLGKSGLQGLRGEYGVKGDLGIQG---------------IPGRKGVMGDPGPNGYAM-------IGSKGDKGIKGLPGIYGAKGDKGRPGYIGIPGFKGETGLIGRSGLKGDQGEIGEKGIKGFTFISNNPGDRGLLGNKGLKGFPGE---LGNKGQVGVC------------TVRGDQGLRGYSGLIGDMGMK------------------GEQGSKGIVGDYGAASRSGIMGRTGKIGNQGLPGDQXXXXXXXXXXXXXXXXYIGIPGFEGDRGEKGNKGFPGFPGDIGQPGRLGNPGISTEGVXXXXXXXXXXXXXXXXXXXXXXXXXXKQGDSGIS-IPGRQGIKGEDGTIGLPGEMGEPGPRGDFGQKGNIGITGEFGLQGNRGDDGLKGDDGIPGLNGPRGFIGDIGFVGFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXELGLDGSMGGKGDNGPRGFNGPTGIPGSKGFEGDKGIRGDIGVKGFQGQHGEIGFPGLKGVSGENG 3806
            S GP G  G+ G +G  G +G  G  G +G  GE G PG+ GP G RG  G+PG  G+ G  G  G  G +G  GP+G  G  G  G  G +G KG SG   L   PG +G KG  G PG  G  G  G +G  G+ G +G  G  G  G                               LGP  +    G  G +GE G PGL       G  G  G +G KG  G P        PG  G            + G +G PG  G+KG  G+ GE G    G QGP GP G++G  G  G+ G  G  G  G +GS          G +G+ G                            +GR G++G  G +G  G  G  G  GDAG  G         PG+ G +G  G  GN G  G+ G  G  G  G  G  G  G RG + + G PG KG  G+ GK        PGE+G  G  G RG  G  G  +N A  P   +G +G +G +G +G PG  G  G  G  GE G PG+RG+ G+ G+PG  G  GE G  G +G  G  G  G +G  G  G  G+ G  G               +PG +G  G PG  G           G+ G  G +G+PG  GA G  G  G  G  G  G +G  G  G  G++GE+G  G  GF   +   G  G  G KG KG  GE   +G  G VG                RGD G  G +G  G  G                    G++G +G  GD G   R+G  G +G  G  G  G  G PG+ G  G  G +G +G PG  G  G +G +G PG  G +G+PG L   GIS                      PG  G PG  G  G++  PG  G  G  G+ G PG  G+PG +G+ G  G+IG TG  G  G  G  G  G  G  G  GP G +G +G VG                                        G  G  G +GD G  G  G  G+PG KG+ G +G+ G  G+ G QG  G +G  G +G +G +G
Sbjct:   93 SSGP-GPMGLMGPRGPPGAVGAPGPQGFQGPAGEPGEPGQTGPAGPRGPAGSPGKAGEDGHPGKPGRPGERGVVGPQGARGFPGTPGLPGFKGVKGHSGMDGLKGQPGAQGVKGEPGAPGENGTPGQAGARGLPGERGRVGAPGPAGARGSDGSVGPVGPAGPIGSAGPPGFPGAPGPKGELGPVGNPGPAGPAGPRGEVGLPGLSGPVGPPGNPGTNGLTGAKGATGLPGVAGAPGLPGPRGIPGPAGAAGATGARGLVGEPGPAGSKGESGNKGEPGS--VGAQGPPGPSGEEGKRGSPGEAGSAGPAGPPGLRGS---------PGSRGLPGA---------------------------DGRAGVMGPPGNRGSTGPAGIRGPNGDAGRPGE--------PGLMGPRGLPGSPGNVGPSGKEGPVGLPGIDGRPGPIGPAGPRGEAGNIGFPGPKGPSGDPGK--------PGERGHPGLAGARGAPGPDG--NNGAQGPPGPQGVQGGKGEQGPAGPPGFQGLPGPSGTTGEVGKPGERGLPGEFGLPGPAGPRGERGTPGESGAAGPSGPIGSRGPSGAPGPDGNKGEAGAVGAPGSAGASGPGGLPGERGAAGIPGGKGEKGETGLRGDTGNTGRDGARGIPGAVGAPGPAGASGDRGEAGAAGPSGPAGPRGSPGERGEVGPAGPNGFAGPAGAAGQPGAKGEKGTKGPKGENGIVGPTGSVGAAGPSGPNGPPGPVGSRGDGGPPGMTGFPGAAGRTGPPGPSGIAGPPGPPGAAGKEGIRGPRGDQGPVGRTGETGASGPPGFVGEKGPSGEPGTAGAPGTAGPQGLLGAPGILGLPGSRGERGLPGIAGALGEPGPL---GISGP--------------------PGARGPPGAVGSPGVNGAPGEAGRDGNPGSDGPPGRDGQPGHKGERGYPGSIGPTGAAGAPGPHGSVGPAGKHGNRGEPGPAGSVGPVGAVG--------------------------------------PRGPSGPQGIRGDKGEPGDKGHRGLPGLKGYSGLQGLPGLAGLHGDQGAPGPVGPAGPRGPAGPSG 1066          

HSP 5 Score: 180.259 bits (456), Expect = 8.001e-45
Identity = 340/1044 (32.57%), Postives = 426/1044 (40.80%), Query Frame = 3
Query: 1788 EGRMGLLGSKGRQGYKGGKGFSGSMGDAGEIGYVTISGTTIPGVKGEKGNQGPKGNKGEFGEAGSRGRKGYSGLKGFKGLIGERGTSFSSGDPGDKGLRGENGKDGVS----FAGIPGEKGLKGDKGNRGILGDVGSLSNCATR-------------PITSKGFKGPQGAKGTSGSPG------------------SAGKTGIVGNKGENGYPGKRGI---------------------------DGDNGIPGSKGEEGETGIKGHAGRPGNLGKSGLQGLRGEYGVKGDLGIQGIPG---RKGVMGDPG------------PNGYA-MIGSKGDKGIKGLPGIYGAKGDKGRPGYIGIPGFKGETGLIGRSGLKGDQGEIGEKGIKGFTFISNNPGDRGLLGNKGLKGFPGELGNKGQVGVCTVRGDQGLRGYSGLIGDMGMKGEQGSKGIVGDYGAASRSGIMGRTGKIGNQGLPGDQXXXXXXXXXXXXXXXXYIGIPGFEGDRGEKGNKGFPGFPGDIGQPGRLGNPGIS-TEGVXXXXXXXXXXXXXXXXXXXXXXXXXXKQGDSGIS----------IPGRQGIKGEDGTIGLPGEMGEPGPRGDFGQKGNIGITGEFGLQGNRGDDGLKGDDGIPGLNGPRGFIGDIGFVGFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXELGLDGSMGGK---------------GDNGPRGFNGPTGIPGSKGF---------------------EGDKGIRGD---IGVKGFQGQHGEIGFPGLKGVSGENGRQXXXXXXXXXXXXXXXXVCMQPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEVGESIRGLQGRKGSTGLRGNIGIP------------GERGDKGIPGLQGKVGNKGVKGDIGDKGFSGNIGDKGYSGISGDKGSFGVKGDKGFQGDVGMLGKSGLQGDRGQKGIIGFRGTRGIPGSMGLPGEIGEKGDVGPSGIGVKGLKGYQNAVGIKGRKGEKGLPGFPGRPGKVGDQGDKGPKG 4499
            +G  G  G  G+ G  G +G +GS G AGE G+    G   PG +G  G QG +G  G  G  G +G KG+SG+ G KG  G +G     G PG+ G  G+ G  G+       G PG  G +G  G+ G +G  G + +                 P+ + G  GP G +G  G PG                  + G TG+ G  G  G PG RGI                            G+ G PGS G +G  G  G  G+ G+ G++G  G  G  G++G  G +G+PG   R GVMG PG            PNG A   G  G  G +GLPG  G  G  G+ G +G+PG  G  G IG +G +G+ G IG  G KG +     PG+RG  G  G +G PG  GN             G +G  G  G  G KGEQG  G  G  G    SG  G  GK G +GLPG+                   G+PG  G RGE+G    PG  G  G  G +G+ G S   G  G+ G AG  G  G  G  G  G PG++G +GI           + G  G  G DG  G+PG +G PGP G  G +G  G  G  G  G                  PRG  G+ G VG  G  G  G  G  G+ G + +        +  +     +G  GS+G                 GD GP G    TG PG+ G                      EG +G RGD   +G  G  G  G  GF G KG SGE G  G+ G  G  G  G  G+   P                                G  GE  RGL G  G+ G  G +GI             G  G  G PG  G+ GN G  G  G  G  G+ G++GY G  G  G+ G  G  G  G  G  G  G  G  G  G +G  G RG  G  G+ G+ GE GD G  G+   GLKGY    G++G  G  GL G  G PG VG  G +GP G
Sbjct:  120 QGPAGEPGEPGQTGPAGPRGPAGSPGKAGEDGHPGKPGR--PGERGVVGPQGARGFPGTPGLPGFKGVKGHSGMDGLKGQPGAQGVKGEPGAPGENGTPGQAGARGLPGERGRVGAPGPAGARGSDGSVGPVGPAGPIGSAGPPGFPGAPGPKGELGPVGNPGPAGPAGPRGEVGLPGLSGPVGPPGNPGTNGLTGAKGATGLPGVAGAPGLPGPRGIPGPAGAAGATGARGLVGEPGPAGSKGESGNKGEPGSVGAQGPPGPSGEEGKRGSPGEAGSAGPAGPPGLRGSPGSRGLPGADGRAGVMGPPGNRGSTGPAGIRGPNGDAGRPGEPGLMGPRGLPGSPGNVGPSGKEGPVGLPGIDGRPGPIGPAGPRGEAGNIGFPGPKGPSGDPGKPGERGHPGLAGARGAPGPDGN------------NGAQGPPGPQGVQGGKGEQGPAGPPGFQGLPGPSGTTGEVGKPGERGLPGE------------------FGLPGPAGPRGERGT---PGESGAAGPSGPIGSRGPSGAPGPDGNKGEAGAVGAPGSAGASGPGGLPGERGAAGIPGGKGEKGETGLRGDTGNTGRDGARGIPGAVGAPGPAGASGDRGEAGAAGPSGPAG------------------PRGSPGERGEVGPAGPNGFAGPAGAAGQPGAKGEKGTKGPKGENGI-----VGPTGSVGAAGPSGPNGPPGPVGSRGDGGPPGM---TGFPGAAGRTGPPGPSGIAGPPGPPGAAGKEGIRGPRGDQGPVGRTGETGASGPPGFVGEKGPSGEPGTAGAPGTAGPQGLLGAPGILGLP--------------------------------GSRGE--RGLPGIAGALGEPGPLGISGPPGARGPPGAVGSPGVNGAPGEAGRDGNPGSDGPPGRDGQPGHKGERGYPGSIGPTGAAGAPGPHGSVGPAGKHGNRGEPGPAGSVGPVGAVGPRGPSGPQGIRGDKGEPGDKGHRGL--PGLKGYS---GLQGLPGLAGLHGDQGAPGPVGPAGPRGPAG 1063          

HSP 6 Score: 167.548 bits (423), Expect = 5.156e-41
Identity = 250/749 (33.38%), Postives = 313/749 (41.79%), Query Frame = 3
Query:  972 GPRGERGDRGNPGFPGDPGASGADGTR-------------------------------------GRQGERGPKGVHGISGADGPRGSRGDKGPSGSLLSCPGRKGEKGFFGIPGIKGDIGNKGYQGHDGDIGEIGFKGEKGYEGPLGPSCSEVEQGFRGTKGESGFPGLRGAKGQRGYSGNKGIKGKPNFGTGINNPGETGSYGNLGVPGEKGNKGFIGDTGEKGFSGTGKQGPEGPRGDKGDDGVNGQVGMIGMP---------------GIKGDKGSTYPICPFCEKGYKGIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEGRMGLLGSKGRQGYKGGKGFSGSMG-DAGEIGYVTISGTTIPGVKGEKGNQGPKGNKGEFGEAGSRGRKGYSGLKGFKGLIGERGTSFSS------GDPGDKGLRGENGKDGVSFAGIPGEKGLKGDKGNRGILGDVGSLSNCATRPITSKGFKGPQGAKGTSGSPGSAGKTGIVGNKGENGYPGKRGIDGDNGIPGSKGEEGETGIKGHAGRPGNLGKSGLQGLRGEYGVKGDLGIQGIPGRKGVMGDPGPNGYAMIGSKGDKGIKGLPGIYGAKGDKGRPGYIGIPGFKGETGLIGRSGLKGDQGEIGEKGIKGFTFISNNPGDRGLLGNKGLKGFPGELGNKGQVGVC------------TVRGDQGLRGYS---------GLIGDMGMKGEQGSKGIVGDYGAASRSGIMGRTGKIGNQG 2978
            GP G+RG RG  G  G  G  G DG                                       G  G  GP+G  G  GA GP+G +G            G  GE G  G  G +G  G+ G  G DG  G+ G  GE+G  GP         QG RG  G  G PG +G K   G+SG  G+KG+P    G+   GE G+ G  G PG+ G +G  G+ G       G  GP G RG  G  G  G  G IG                 G  G+ G   P  P  E G  G+                   G  G  G PG  G  G  G+ G  G  G  G  G  G               + G  G  G++G  GNKGE G  G++G  G SG +G +G  GE G++  +      G PG +GL G +G+ GV   G PG +G  G  G RG  GD G       RP    G  GP+G  G+ G+ G +GK G VG  G +G PG  G  G  G  G+ G  G  G  G  G+PG  G  GL G RG  G  G+ G QG PG +GV G     G    G  G  G +GLPG  G  G+ G+PG  G+P   GE GL G +G +G++G  GE G  G +         G +G++G  G PG  GNKG+ G               + G++G  G           GL GD G  G  G++GI G  GA   +G  G  G+ G  G
Sbjct:   33 GPTGDRGPRGQRGPAGPRGRDGVDGPMGPPGPPGSPGPPGSPAPPGLTGNFAAQYSDKGVSSGPGPMGLMGPRGPPGAVGAPGPQGFQGPA----------GEPGEPGQTGPAGPRGPAGSPGKAGEDGHPGKPGRPGERGVVGP---------QGARGFPGTPGLPGFKGVK---GHSGMDGLKGQPGA-QGVK--GEPGAPGENGTPGQAGARGLPGERGR-----VGAPGPAGARGSDGSVGPVGPAGPIGSAGPPGFPGAPGPKGELGPVGNPGPAGPAGPRGEVGLPGLS------------------GPVGPPGNPGTNGLTGAKGATGLPGVAGAPGLPGPRGIPGPAGAAGATGARGLVGEPGPAGSKGESGNKGEPGSVGAQGPPGPSGEEGKRGSPGEAGSAGPAGPPGLRGSPGSRGLPGADGRAGV--MGPPGNRGSTGPAGIRGPNGDAG-------RP-GEPGLMGPRGLPGSPGNVGPSGKEGPVGLPGIDGRPGPIGPAGPRGEAGNIGFPGPKGPSGDPGKPGERGHPGLAGARGAPGPDGNNGAQGPPGPQGVQG-----GKGEQGPAGPPGFQGLPGPSGTTGEVGKPGERGLP---GEFGLPGPAGPRGERGTPGESGAAGPS---------GPIGSRGPSGAPGPDGNKGEAGAVGAPGSAGASGPGGLPGERGAAGIPGGKGEKGETGLRGDTGNTGRDGARGIPGAVGAPGPAGASGDRGEAGAAG 706          

HSP 7 Score: 150.599 bits (379), Expect = 8.666e-36
Identity = 271/803 (33.75%), Postives = 344/803 (42.84%), Query Frame = 3
Query: 1314 EVEQGFRGTKGESGFPGLRGAKGQRGYSGNKGIKGKP----------------NFGTGINNPGETGSYGNLGVPGEKGNKGFIGDTGEKGFSG-------TGKQGPEGPRGDKGDDGVNGQVGMIGMPGIKGDKGST-------YPICPFCE--KGYKGIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEGRMGLLGSKGRQGYKGGKGFSGSMGDAGEIGYVTISGTT----IPGVKGEKGNQGPKGNKGEFGEAGSRGRKGY---------------SGLKGFKGLIGERGTSFSSGDPGDKGL----RGENGKDGVSFAGIPGEKGLKGDKGNRGILGDVGSLSNCATRPITSKGFKGPQGAKGTSGSPGSAGKTGIVGNKGENGYPGKRGIDGDN------GIPGSKGEEGETGIK---GHAGRPGNLGKSGLQGLRGEYGVKGDLGIQGIPGRKGVMGDPGPNGYAMIGSKGDKGIKGLPGIYGAKGDKGRPGYIGIPGFKGETGLIGRSGLKGDQGEIGEKGIKGFTFISNNPGDRGLLGNKGLKGFPGELGNKGQVGVCTVRGDQGLRGYSGLIGDMGMKGEQGSKGIVGDYGAASRSGIMGRTGKIGNQGLPGDQXXXXXXXXXXXXXXXXYIGIPGFEGDRGEKGNKGFP---------GFPGDIGQPGRLGNPGISTEGVXXXXXXXXXXXXXXXXXXXXXXXXXXKQGDSGISIPGRQGIKGEDGTIGLPGEMGEPGPRGDFGQKGNIGITGE---------FGLQGNRGDDGLKGDDGIPGLNGPRGFIG 3476
             V +G  G +G  G  G  G +G+ G  G  G  G P                NF    ++ G +   G +G+ G +G  G +G  G +GF G        G+ GP GPRG  G  G  G+ G  G PG  G++G         +P  P     KG KG  G  G +G+ G  G+ G  G  G  G PG  G  GL G +GR G  G  G  GS G  G +G     G+      PG  G KG  GP GN G  G AG RG  G                +GL G KG  G  G + + G PG +G+                G PG  G KG+ GN+G  G VG           ++G  GP G +G  GSPG AG  G  G  G  G PG RG+ G +      G PG++G  G  GI+   G AGRPG  G  G +GL G  G  G  G +G  G  G+ G PGP G A  G +G+ G  G PG  G  GD G+PG  G PG  G  G  G  G  G QG  G +G++G        G++G  G  G +G PG  G  G+VG     G++GL G  GL G  G +GE+G+    G+ GAA  SG +G  G  G  G  G++G  G+ G  G  G+ G  G+P      GE+G  G P         G  GD G  GR G  GI                                     +  PG  G  G+ G  G  G  G  GPRG  G++G +G  G           G  G +G+ G KG  G  G+ GP G +G
Sbjct:   29 SVRKGPTGDRGPRGQRGPAGPRGRDGVDGPMGPPGPPGSPGPPGSPAPPGLTGNFAAQYSDKGVSSGPGPMGLMGPRGPPGAVGAPGPQGFQGPAGEPGEPGQTGPAGPRGPAGSPGKAGEDGHPGKPGRPGERGVVGPQGARGFPGTPGLPGFKGVKGHSGMDGLKGQPGAQGVKGEPGAPGENGTPGQAGARGLPGERGRVGAPGPAGARGSDGSVGPVGPAGPIGSAGPPGFPGAPGPKGELGPVGNPGPAGPAGPRGEVGLPGLSGPVGPPGNPGTNGLTGAKGATGLPGVAGAPGLPGPRGIPGPAGAAGATGARGLVGEPGPAGSKGESGNKGEPGSVG-----------AQGPPGPSGEEGKRGSPGEAGSAGPAGPPGLRGSPGSRGLPGADGRAGVMGPPGNRGSTGPAGIRGPNGDAGRPGEPGLMGPRGLPGSPGNVGPSGKEGPVGLPGIDGRPGPIGPA--GPRGEAGNIGFPGPKGPSGDPGKPGERGHPGLAGARGAPGPDGNNGAQGPPGPQGVQGGK------GEQGPAGPPGFQGLPGPSGTTGEVGKP---GERGLPGEFGLPGPAGPRGERGTP---GESGAAGPSGPIGSRGPSGAPGPDGNKGEAGAVGAPGSAGASGPGGLP------GERGAAGIPGGKGEKGETGLRGDTGNTGRDGARGIP----------------------------------GAVGAPGPAGASGDRGEAGAAGPSGPAGPRGSPGERGEVGPAGPNGFAGPAGAAGQPGAKGEKGTKGPKGENGIVGPTGSVG 766          

HSP 8 Score: 139.813 bits (351), Expect = 1.809e-32
Identity = 231/732 (31.56%), Postives = 281/732 (38.39%), Query Frame = 3
Query: 1791 GRMGLLGSKGRQGYKGGKGFSGSMGDAGEIGYVTISGTTIPGVKGEKGNQGPKGNKGEFGEAGSRGRKGYSGLKGFKGLIGERGTSFSSGDPGDKGLRGENGKDGVSFAGIPGEKGLKGDKGNRGILGDVGSLSNCATRPITSKGFKGPQGAKGTSGSPGSAGKTGIVGNKGENGYPGKRGIDGDNGIPGSKG---------------------EEGETGIKGHAGRPGNLGKSGLQGLRG---------EYGVKGDLGIQGIPGRKGVMGDPGPNGYAMIGSKGDKG----IKGLPGIYGAKGDKGRPGYIGIPGFKGETGLIGRSGLKGDQGEIGEKGIKGFTFISNNPGDRGLLGNKGLKGFPGELGNKGQVGVCTVRG---DQGLRGYSGLIGDMGMKGEQGSKGIVGDYGAASRSGIMGRTGKIGNQGLPGDQXXXXXXXXXXXXXXXXYIGIPGFEGDRGEKGNKGFPGF---PGDIGQPGRLGNPGISTEGVXXXXXXXXXXXXXXXXXXXXXXXXXXKQGDSGIS-IPGRQGI---KGEDGTIGLPGEMGEPGPRGDFGQKGNIGITGEFGLQGNRGDDGLKGDDGIPGLNGPRGFIGDIGFVGFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXELGLDGSMGGKGDNGPRGFNGPTGIPGSKGFEGDKGI------RGDIGVKGFQGQHGEIGFPG---------LKGVSGENGR 3809
            G MGL+G +G  G  G  G  G  G AGE           PG  G+ G  GP+G  G  G+AG  G  G  G  G +G++G +G     G PG                 +PG KG+KG  G  G+ G  G+           +G KG  GA G +G+PG AG  G+ G +G  G PG  G  G +G  G  G                     E G  G  G AG  G  G+ GL GL G           G+ G  G  G+PG  G  G PGP G               + G PG  G+KG+ G  G  G  G +G  G  G  G +G  GE G  G  G   +  +PG RGL G  G  G  G  GN+G  G   +RG   D G  G  GL+G  G+ G  G+ G  G  G     GI GR G IG  G                               RGE GN GFPG     GD G+PG  G+PG++                       G  G PG  G++G    PG QG+   KGE G  G PG  G PGP G          TGE G  G RG   L G+ G+PG  GPRG                                               E G  G  G  G +GP G  GP+G PG  G +G+ G        G  G  G  G+ G  G PG         L+G +G  GR
Sbjct:   97 GPMGLMGPRGPPGAVGAPGPQGFQGPAGE-----------PGEPGQTGPAGPRGPAGSPGKAGEDGHPGKPGRPGERGVVGPQGARGFPGTPG-----------------LPGFKGVKGHSGMDGLKGQPGA-----------QGVKGEPGAPGENGTPGQAGARGLPGERGRVGAPGPAGARGSDGSVGPVGPAGPIGSAGPPGFPGAPGPKGELGPVGNPGPAGPAGPRGEVGLPGLSGPVGPPGNPGTNGLTGAKGATGLPGVAGAPGLPGPRGIPGPAGAAGATGARGLVGEPGPAGSKGESGNKGEPGSVGAQGPPGPSGEEGKRGSPGEAGSAGPAGPPGLRGSPGSRGLPGADGRAGVMGPPGNRGSTGPAGIRGPNGDAGRPGEPGLMGPRGLPGSPGNVGPSGKEGPVGLPGIDGRPGPIGPAG------------------------------PRGEAGNIGFPGPKGPSGDPGKPGERGHPGLA-----------------------GARGAPGPDGNNGAQGPPGPQGVQGGKGEQGPAGPPGFQGLPGPSG---------TTGEVGKPGERG---LPGEFGLPGPAGPRG-----------------------------------------------ERGTPGESGAAGPSGPIGSRGPSGAPGPDGNKGEAGAVGAPGSAGASGPGGLPGERGAAGIPGGKGEKGETGLRGDTGNTGR 677          

HSP 9 Score: 133.265 bits (334), Expect = 1.939e-30
Identity = 227/632 (35.92%), Postives = 287/632 (45.41%), Query Frame = 3
Query: 2046 SFSSGDPGDKGLRGE------NGKDGV--------------------------SFAGIPGEKGLKGDKGNRGILGDVGSLSNCATRPITSKGFKGPQGAKGTSGSPGSAGKTGIVGNKGENGYPGKRGIDGDNGIPGSKGEEGETGIKGHAGRPGNLGKSGLQGLRGEYGVKGDLGIQGIPGRKGVMGDPGPNGYAMIGSKGDKGIKGLPGIYGAKGDKGRPGYIGIPGFKGETGLIGRSGLKGDQGEIGEKGIKGFTFISNNPGDRGLLGNKGLKGFPGELGNKGQVGVCTVRGDQGLRGYSGLIGDMGMKGEQGSKGIVGDYGAASRSGIMGRTGKIGNQGLPGDQXXXXXXXXXXXXXXXXYIGIPGFEGDRGEKGNKGFPGF------PGDIGQPGRLGNPGIS-TEGVXXXXXXXXXXXXXXXXXXXXXXXXXXKQGDSGISIPGRQGIKGEDGTIGLPGEMGEPGPRGDFGQKGNIGITGEFGLQGNRGDDGLKGDDGIPGLNGPRGFIGDIGFVGFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXELGLDGSMGGKGDNGPRGFNGPTGIPGSKGFEGDKGIRGDIGVKGFQ------GQHGEIGFPGLKGVSGENG 3806
            S   G  GD+G RG+       G+DGV                          +FA    +KG+    G  G++G  G        P  + G  GPQG +G +G PG  G+TG  G +G  G PGK G DG  G PG  GE G  G +G  G PG  G  G +G++G  G+    G++G PG +GV G+P           G  G  G PG  GA+G  G  G +G PG  G  G  G  G  G  G IG  G  GF       G+ G +GN G     G  G +G+VG+             GL G +G  G  G+ G+ G  GA    G+ G  G  G +G+PG        G  G  G++G +G PG  G +GE GNKG PG       PG  G+ G+ G+PG + + G  G PGL G PG  G PG  G  G  G  G+ G +  G  GI+G +G  G PGE G  GPRG  G  GN+G +G+       G  GL G DG PG  GP G  G+ G +GF                        G KG  G  G  GE G  G  G +G  GP G NG  G PG +G +G KG +G  G  GFQ      G  GE+G PG +G+ GE G
Sbjct:   29 SVRKGPTGDRGPRGQRGPAGPRGRDGVDGPMGPPGPPGSPGPPGSPAPPGLTGNFAAQYSDKGVSSGPGPMGLMGPRG--------PPGAVGAPGPQGFQGPAGEPGEPGQTGPAGPRGPAGSPGKAGEDGHPGKPGRPGERGVVGPQGARGFPGTPGLPGFKGVKGHSGMD---GLKGQPGAQGVKGEP-----------GAPGENGTPGQAGARGLPGERGRVGAPGPAGARGSDGSVGPVGPAGPIGSAGPPGFPGAPGPKGELGPVGNPGPA---GPAGPRGEVGL------------PGLSGPVGPPGNPGTNGLTGAKGATGLPGVAGAPGLPGPRGIPGPA------GAAGATGARGLVGEPGPAGSKGESGNKGEPGSVGAQGPPGPSGEEGKRGSPGEAGSAGPAGPPGLRGSPGSRGLPGADGRAGVMGPPGNRGST--GPAGIRGPNGDAGRPGEPGLMGPRGLPGSPGNVGPSGK------EGPVGLPGIDGRPGPIGPAGPRGEAGNIGF-----------------------PGPKGPSGDPGKPGERGHPGLAGARGAPGPDGNNGAQGPPGPQGVQGGKGEQGPAGPPGFQGLPGPSGTTGEVGKPGERGLPGEFG 586          

HSP 10 Score: 130.568 bits (327), Expect = 1.019e-29
Identity = 204/643 (31.73%), Postives = 256/643 (39.81%), Query Frame = 3
Query: 1992 KGYSGLKGFKGLIGERGTSFSSGDPGDKGLRGENGKDGVSFAGIPGEKGLKGDKGNRGILGDVGSLSNCAT-----RPITSKGFKGPQGAKGTSGSPGSAGKTGIVGNKGENGY---PGKRGIDGDNGIPGSKGEEGETGIKGHAGRPGNLGKSGLQGLRGEYGVKGDLGIQGIPGRK---------------GVMGDPGPNGYAMIGSKGDKGIKGLP------------GIYGAKGDKGRPGYIGIPGFKGETG---------------LIGRSGLKGDQGEIGEKGIKGFTFISNNPGDRGLLGNKGLKGFPGELGNKGQVGVCTVRGDQGLRGYSGLIGDMGMKGEQGSKGIVGDYGAASRSGIMGRTGKIGNQGLPGDQXXXXXXXXXXXXXXXXYIGIPGFEGDRGEKGNKGFPGFPGDIGQPGRLGNPGISTEGVXXXXXXXXXXXXXXXXXXXXXXXXXXKQGDSGISIPGRQGIKGEDGTIGLPGEMGEPGPRGDFGQKGNIGITGEFGLQGNRGDDGLKGDDGIPGLNGPRGFIGDIGFVGFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXELGLDGSMGGKGDNGPRGFNGPTGIPGSKGFEGDKGIRGDIGVKGFQGQHGEIG 3770
            KG S   G  GL+G RG   + G PG +G +G         AG PGE G  G  G RG  G  G            RP   +G  GPQGA+G  G+PG  G  G+ G+ G +G    PG +G+ G+ G PG  G  G+ G +G  G  G +G  G  G RG  G  G +G  G  G                 G +G+PGP G A  G +G+ G+ GL             G+ GAKG  G PG  G PG  G  G               L+G  G  G +GE G KG  G       PG  G    +G +G PGE G+ G  G   +RG  G RG  G  G  G+ G  G++G  G  G    +G  GR G+ G  G                       G+PG  G+ G  G +G  G PG  G+PG +G                                                G +GE G IG PG  G  G  G  G++G+ G+ G  G  G  G++G +G  G  G+ G +G  G  G  GF                    +G+ G  G  G VG  GE GL G  G  G  GPRG  G  G  G+ G  G  G RG  G  G  G  GE G
Sbjct:   90 KGVSSGPGPMGLMGPRGPPGAVGAPGPQGFQGP--------AGEPGEPGQTGPAGPRGPAGSPGKAGEDGHPGKPGRP-GERGVVGPQGARGFPGTPGLPGFKGVKGHSGMDGLKGQPGAQGVKGEPGAPGENGTPGQAGARGLPGERGRVGAPGPAGARGSDGSVGPVGPAGPIGSAGPPGFPGAPGPKGELGPVGNPGPAGPA--GPRGEVGLPGLSGPVGPPGNPGTNGLTGAKGATGLPGVAGAPGLPGPRGIPGPAGAAGATGARGLVGEPGPAGSKGESGNKGEPGSVGAQGPPGPSG---EEGKRGSPGEAGSAGPAGPPGLRGSPGSRGLPGADGRAGVMGPPGNRGSTGPAGIRGPNGDAGRPGEPGLMG---------------------PRGLPGSPGNVGPSGKEGPVGLPGIDGRPGPIGP----------------------------------------------AGPRGEAGNIGFPGPKGPSGDPGKPGERGHPGLAGARGAPGPDGNNGAQGPPGPQGVQGGKGEQGPAGPPGF--------------------QGLPGPSGTTGEVGKPGERGLPGEFGLPGPAGPRGERGTPGESGAAGPSGPIGSRGPSGAPGPDGNKGEAG 631          

HSP 11 Score: 89.3521 bits (220), Expect = 3.757e-17
Identity = 183/577 (31.72%), Postives = 229/577 (39.69%), Query Frame = 3
Query: 2814 GVCTVRGDQGLRGYSGLIGDMGMKGEQGSKGIVGDYGAASRSGIMGRTGKIGNQGLPGDQXXXXXXXXXXXXXXXXYIGIPGFEGDRGEKGNKGFPGFPGDIGQPGRLGNPGISTEGVXXXXXXXXXXXXXXXXXXXXXXXXXXKQGDSGISIPGRQGIKGEDGTIGLPGEMGEPGPRGDFGQKGNIGITGEFGLQGNRGDDGLKGDDGIPGLNGPRGFIGDIGFVGFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXELGLDGSMGGKGDNGPRGFNGPTGIPGSKGFEGDKGIRGDIGVKGFQGQHGEIGFPGLKGVSGENGRQXXXXXXXXXXXXXXXXVCMQPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEVGESIRGLQGRKGSTGLRGNIGIPGERGDKGIPGLQGKVGNKG---VKGDIGDKGFSGNIGDKGYSGISGDKGSFGVKGDKGFQGDVGMLGKSGLQGDRGQKGIIGFRGTRGIPGSMGLPGEIGEKGDVGPSG-------IGVKGLKGYQNAVGIKGRKGEKGLPGFPGRPGKVGDQGDKGPKGMKNMN 4514
            GV +  G  GL G  G  G +G  G QG +G  G+ G   ++G  G  G  G+ G  G+ G               + G PG  G+RG  G +G  GFPG  G PG  G                                    +G SG+      G+KG+ G  G+ GE G PG  G  GQ G  G+ GE      RG  G  G  G  G +G  G +G  G +G                         G  GF G  G KGELG  G+ G  G  GPRG     G+PG     G  G  G+ G  G  G  G  G PG+ G  G  G +G  G  G  G  G +G+  +P                                   GES  G +G  GS G +G  G  GE G +G PG  G  G  G   ++G  G +G  G  G  G  G  G++GS G  G +G  GD G  G+ GL G RG  G  G  G  G  G +GLPG  G  G +GP+G       IG  G KG     G  G +G  GL G  G PG  G+ G +GP G + + 
Sbjct:   91 GVSSGPGPMGLMGPRGPPGAVGAPGPQGFQGPAGEPGEPGQTGPAGPRGPAGSPGKAGEDG---------------HPGKPGRPGERGVVGPQGARGFPGTPGLPGFKG-----------------------------------VKGHSGM-----DGLKGQPGAQGVKGEPGAPGENGTPGQAGARGLPGE------RGRVGAPGPAGARGSDGSVGPVGPAGPIG-----------------------SAGPPGFPGAPGPKGELGPVGNPGPAGPAGPRGE---VGLPG---LSGPVGPPGNPGTNGLTGAKGATGLPGVAGAPGLPGPRGIPGPAGAAGATGARGLVGEPGPAGSK-----------------------------GES--GNKGEPGSVGAQGPPGPSGEEGKRGSPGEAGSAGPAGPPGLRGSPGSRGLPGADGRAGVMGPPGNRGSTGPAGIRGPNGDAGRPGEPGLMGPRGLPGSPGNVGPSGKEGPVGLPGIDGRPGPIGPAGPRGEAGNIGFPGPKGPSGDPGKPGERGHPGLAGARGAPGPDGNNGAQGPPGPQGVQ 546          

HSP 12 Score: 77.7962 bits (190), Expect = 1.446e-13
Identity = 80/221 (36.20%), Postives = 100/221 (45.25%), Query Frame = 3
Query: 3993 RGLQGRKGSTGLRGNIGIPGE---RGDKGIPGLQGKVGNKGVKGDIGDKGFSGNIGDKGYSGISGDKGSFGVKGDKGFQGDVGMLGK---SGLQGDRGQKGIIGFRGTRGIPGSMGLPGEIGEKGDVGPSGIGVKGLKGYQNAVGIKGRKGEKGLPGFPGRPGKVGDQGDKGPKGMKNMNTXXXXXXXXXXXXXXXXXXXXXXXXXLPGDMGEIGPNGPIG 4637
            RG  G  G  G  G+ G PGE    G +G+PG  G VG  G +G +G  G  G  G  G +G  G+ G+ G  G KG  GD G  G+    GL G RG  G  G  G +G PG  G+ G  GE+G  GP G   +GL G     G  G+ GE+GLPG  G PG  G +G++G                                   PG+ G  GP+GPIG
Sbjct:  429 RGSTGPAGIRGPNGDAGRPGEPGLMGPRGLPGSPGNVGPSGKEGPVGLPGIDGRPGPIGPAGPRGEAGNIGFPGPKGPSGDPGKPGERGHPGLAGARGAPGPDGNNGAQGPPGPQGVQGGKGEQGPAGPPGF--QGLPGPSGTTGEVGKPGERGLPGEFGLPGPAGPRGERG----------------------------------TPGESGAAGPSGPIG 613          

HSP 13 Score: 73.1738 bits (178), Expect = 3.253e-12
Identity = 67/172 (38.95%), Postives = 89/172 (51.74%), Query Frame = 3
Query: 3996 GLQGRKGSTGLRGNIGIPGERGDKGIPGLQGK---VGNKGVKGDIGDKGFSGNIGDKGYSGISGDKGSFGVKGDKGFQGDVGMLGKSGLQGDRGQKGIIGFRGTRGIPGSMGLPGEIGEKGDVGPSGIGVKGLKGYQNAVGIKGRKGEKGLPGFPGRPGKVGDQGDKGPKGM 4502
            GL G +G  G  GN+G  G+ G  G+PG+ G+   +G  G +G+ G+ GF G  G  G  G  G++G  G+ G +G  G  G  G  G  G +G +G  G +G  G PG  GLPG  G  G+VG    G +GL G     G  G +GE+G PG  G  G  G  G +GP G 
Sbjct:  451 GLMGPRGLPGSPGNVGPSGKEGPVGLPGIDGRPGPIGPAGPRGEAGNIGFPGPKGPSGDPGKPGERGHPGLAGARGAPGPDGNNGAQGPPGPQGVQGGKGEQGPAGPPGFQGLPGPSGTTGEVG--KPGERGLPGEFGLPGPAGPRGERGTPGESGAAGPSGPIGSRGPSGA 620          

HSP 14 Score: 72.4034 bits (176), Expect = 5.972e-12
Identity = 81/239 (33.89%), Postives = 102/239 (42.68%), Query Frame = 3
Query: 3996 GLQGRKGSTGLRGNIGIPGERGDKGIPGLQGK---------------------VGNKGVKGDIGDKGFSGNIGDKGYSGISGDKGSFGVKGDKGFQGDVGMLGKSGLQGDRGQKGIIGFRGTRGIPG---SMGLPGEIGEKGDVGPSGI-GVKGLKGYQNAVGIKGRKGEKGLPGFPGRPGKVGDQGDKGPKGMKNMNTXXXXXXXXXXXXXXXXXXXXXXXXXLPGDMGEIGPNGPIG 4637
            G  G +G  G  G +G+PG RG++G+PG+ G                      VG+ GV G  G+ G  GN G  G  G  G  G    KG++G+ G +G  G +G  G  G  G  G  G RG PG   S+G  G +G +G  GP GI G KG  G +   G+ G KG  GL G PG  G  GDQG  GP G                                 G  G  GP+GP+G
Sbjct:  865 GTAGPQGLLGAPGILGLPGSRGERGLPGIAGALGEPGPLGISGPPGARGPPGAVGSPGVNGAPGEAGRDGNPGSDGPPGRDGQPGH---KGERGYPGSIGPTGAAGAPGPHGSVGPAGKHGNRGEPGPAGSVGPVGAVGPRGPSGPQGIRGDKGEPGDKGHRGLPGLKGYSGLQGLPGLAGLHGDQGAPGPVGPA-------------------------------GPRGPAGPSGPVG 1069          

HSP 15 Score: 70.8626 bits (172), Expect = 1.850e-11
Identity = 64/173 (36.99%), Postives = 86/173 (49.71%), Query Frame = 3
Query: 3996 GLQGRKGSTGLRGNIGIPGERGDKGIPGLQGKVGNKGVKGDIGDKGFSGNIGDKGYSGISGDKGSFGVKGDKGFQGDVGMLGKSGLQGDRGQKGIIGFR---GTRGIPGSMGLPGEIGEKGDVGPSGIGVKGLKGYQNAVGIKGRKGEKGLPGFPGRPGKVGDQGDKGPKGMK 4505
            G  G  GS G  G  G PG +G++G PG  G  G  G  G  G  G +G  G++G  G +G  G  G  G +G  G  G+ G  G  GD+G +G+ G +   G +G+PG  GL G+ G  G VGP+  G +G  G    VG  GR G+         PG VG  G +G +G +
Sbjct:  931 GRDGNPGSDGPPGRDGQPGHKGERGYPGSIGPTGAAGAPGPHGSVGPAGKHGNRGEPGPAGSVGPVGAVGPRGPSGPQGIRGDKGEPGDKGHRGLPGLKGYSGLQGLPGLAGLHGDQGAPGPVGPA--GPRGPAGPSGPVGKDGRSGQ---------PGPVGPAGVRGSQGSQ 1092          

HSP 16 Score: 70.8626 bits (172), Expect = 2.047e-11
Identity = 73/198 (36.87%), Postives = 91/198 (45.96%), Query Frame = 3
Query: 3984 ESIRGLQGRKGSTGLRGNIGIPGERGDKGIPGLQGKVGNKGVKGDIGDKGFSGNIGDKGYSGISGDKGSFGVKGDKGFQGDVGMLGKSGL---------------QGDRGQKGIIGFRGTRGI------PGSMGLPGEIGEKGDVGPSGI-GVKGLKGYQNAVGIKGRKGEKGLPGFPGRPGKVGDQGDKGPKGMKNM 4511
            E  RG  G  GS G  G  G+ G  G +G+PG  G+ G  G  G+ G  G +G  G  G +G  G+ G  G +G  G  G+VG  GK G                 G RG+ G IGF G +G       PG  G PG  G +G  GP G  G +G  G Q   G KG +G  G PGF G PG  G  G+ G  G + +
Sbjct:  384 EGKRGSPGEAGSAGPAGPPGLRGSPGSRGLPGADGRAGVMGPPGNRGSTGPAGIRGPNGDAGRPGEPGLMGPRGLPGSPGNVGPSGKEGPVGLPGIDGRPGPIGPAGPRGEAGNIGFPGPKGPSGDPGKPGERGHPGLAGARGAPGPDGNNGAQGPPGPQGVQGGKGEQGPAGPPGFQGLPGPSGTTGEVGKPGERGL 581          

HSP 17 Score: 67.781 bits (164), Expect = 1.550e-10
Identity = 72/213 (33.80%), Postives = 92/213 (43.19%), Query Frame = 3
Query: 4026 LRGNIGIPGERGDKGI---PGLQGKVGNKGVKGDIGDKGFSGNIGDKGYSGISGDKGSFGVKGDKGFQGDVGMLGKSGLQGDRGQKGIIGFRGTRGIPGSMGLPGEIGEKGDVGPSGI----GVKGLKGYQNAVGIKGRKGEKGLPGFPGRPGKVGDQGDKGPKGMKNMNTXXXXXXXXXXXXXXXXXXXXXXXXXLPGDMGEIGPNGPIGYA 4643
            L GN     +  DKG+   PG  G +G +G  G +G  G  G  G  G  G  G  G  G +G  G  G  G  G  G  G  G++G++G +G RG PG+ GLPG  G KG  G  G+    G +G+KG   A G  G  G+ G  G PG  G+VG  G  G +G                                 G +G +GP GPIG A
Sbjct:   79 LTGNFAA--QYSDKGVSSGPGPMGLMGPRGPPGAVGAPGPQGFQGPAGEPGEPGQTGPAGPRGPAGSPGKAGEDGHPGKPGRPGERGVVGPQGARGFPGTPGLPGFKGVKGHSGMDGLKGQPGAQGVKGEPGAPGENGTPGQAGARGLPGERGRVGAPGPAGARGSD-------------------------------GSVGPVGPAGPIGSA 258          

HSP 18 Score: 66.2402 bits (160), Expect = 4.265e-10
Identity = 67/182 (36.81%), Postives = 87/182 (47.80%), Query Frame = 3
Query: 3993 RGLQGRKGSTGLRGNIGIPGERGDKGIPGLQGKVGNKGVKGDIGDKGFSGNIGDKGYSGISGDKGSFGVKGDKGFQ------GDVGMLGKSGLQGDRGQKGIIGFRGTRGIPGSMGLPGEIGEK---GDVGPSGIGVKGLKGYQNAVGIKGRKGEKGLPGFPGRPGKVGDQGDKGPKGMKNM 4511
            +G  GR G TG  G  G  GE+G  G PG  G  G  G +G +G  G  G  G +G  G+ G  G+ G  G  G        G  G +G  G+ G  G+ G  G  G+ G PG  G PG  GE+   G +GP+  G  G  G   +VG  G+ G +G PG  G  G VG  G +GP G + +
Sbjct:  831 QGPVGRTGETGASGPPGFVGEKGPSGEPGTAGAPGTAGPQGLLGAPGILGLPGSRGERGLPGIAGALGEPGPLGISGPPGARGPPGAVGSPGVNGAPGEAGRDGNPGSDGPPGRDGQPGHKGERGYPGSIGPT--GAAGAPGPHGSVGPAGKHGNRGEPGPAGSVGPVGAVGPRGPSGPQGI 1010          

HSP 19 Score: 55.0694 bits (131), Expect = 1.233e-6
Identity = 46/109 (42.20%), Postives = 59/109 (54.13%), Query Frame = 3
Query: 3993 RGLQGRKGSTGLRGNIGIPGERGDKGIPGLQGKVGNKGVKGDIGDKGFSGNIGDKGYSGISGDKGSFGVKGDKGFQGDVGMLGKSGLQGDRGQKGIIGFRGTRGIPGSM 4319
            RG  G  GS G  G +G  G  G +GI G +G+ G+KG +G  G KG+SG  G  G +G+ GD+G+ G  G  G +G  G  G  G  G  GQ G +G  G RG  GS 
Sbjct:  984 RGEPGPAGSVGPVGAVGPRGPSGPQGIRGDKGEPGDKGHRGLPGLKGYSGLQGLPGLAGLHGDQGAPGPVGPAGPRGPAGPSGPVGKDGRSGQPGPVGPAGVRGSQGSQ 1092          
BLAST of Collagen IV NC1 domain-containing protein vs. Ensembl Mouse
Match: Col4a2 (collagen, type IV, alpha 2 [Source:MGI Symbol;Acc:MGI:88455])

HSP 1 Score: 249.98 bits (637), Expect = 3.572e-66
Identity = 166/470 (35.32%), Postives = 221/470 (47.02%), Query Frame = 3
Query: 3999 LQGRKGSTGLRGNIGIPGERGDKGIPGLQGKVGNKGVKGDIGDKGFSGNIGDKGYSGISGDKGSFGVKGDKGFQGDVGMLGKSGLQGDRG----QKGIIGFRGTRGIPGSMGLPGEI------------GEKGDVGPSGIG----VKGLKGYQNAVGIKGRKGEKGLPGFPGRPGKVGDQGDKGPKGMKNMNTXXXXXXXXXXXXXXXXXXXXXXXXXLPGDMGEIGPNGPIGYADNGFLYATHSQSKDFPPCHGGGSPLYNGYSLLAIHGDIDSVTMDLGTPGSCLKNFSTIPFVNCFLERNTFYGGRCHVNMRNSRSYWLSTLQSYMSSPQPPSKMDDYISRCSVCQTKTTVMAFHSQKSDWQMTKCPYGWQKLWAGFSFPMAVQASRSGSNQPFSSPGSCLKHFRSLPFIECNNHNSNCNHWRDGVSYYMTAVDSENQFVKAQGKVLKSQTDIMNSISKCVVCQRDM 5348
            L G KG  G  G  G PG++G  G PG QG+ G  G+ G+ G KG  G +G+ G SG  GD+G  G KGD+GF G  G +G  G+ G       Q G +G +G RG+PG++G   EI            G  G  GP G G    V G +G Q  +G +G  G++G PG PG PG  G                                        +PG    IG           +L   HSQ+   P C  G + L++GYSLL   G   +   DLG  GSCL  FST+PF+ C        G  C+   RN +SYWLST       P    ++  YISRCSVC+     +A HSQ  D  +  CP GW+ LW G+SF M   A   G  Q   SPGSCL+ FR+ PFIECN     C+++ +  S+++T +  +N         LK+   I   IS+C VC +++
Sbjct: 1301 LPGIKGDEGSSGAAGFPGQKGWVGDPGPQGQPGVLGLPGEKGPKGEQGFMGNTGPSGAVGDRGPKGPKGDQGFPGAPGSMGSPGIPGIPQKIAVQPGTLGPQGRRGLPGALG---EIGPQGPPGDPGFRGAPGKAGPQGRGGVSAVPGFRGDQGPMGHQGPVGQEGEPGRPGSPGLPG----------------------------------------MPGRSVSIG-----------YLLVKHSQTDQEPMCPVGMNKLWSGYSLLYFEGQEKAHNQDLGLAGSCLARFSTMPFLYCN------PGDVCYYASRNDKSYWLSTTAPLPMMPVAEEEIKPYISRCSVCEAPAVAIAVHSQ--DTSIPHCPAGWRSLWIGYSFLMHTAAGDEGGGQSLVSPGSCLEDFRATPFIECNGGRGTCHYFANKYSFWLTTIPEQNFQSTPSADTLKAGL-IRTHISRCQVCMKNL 1707          

HSP 2 Score: 243.047 bits (619), Expect = 5.843e-64
Identity = 309/880 (35.11%), Postives = 390/880 (44.32%), Query Frame = 3
Query:  582 KGSRGLLGRYGRKGEKGFKGIKGYSGIFGIKGNKGYVGPMGRRGPKGDS----------------------LGTVIIQSEKGSKGDKGLKGQSGIPCKGFQIEGRMYGRVGSDGPIGDKGIKGEKGLMGEIGQSGIDGARGLNGEKGLPGEAGPRGE------------RGDRGNPGFPG---------DPGASGADGTRGRQGERGPKGVHGISGADGPRGSRGDKGPSG--SLLSC------PGRKGEKGFFGIPGIKGDIGNKGYQGHDGDIGEIG-----------FKGEKGYEGPLGPSCSEVEQGFRGTKGESGFPGLRGAKGQRGYSGNKGIKGKPNFGTGINNPGETGSYGNLGVPGEKGNKGFIGDTGEKGFSGTGKQGPEGPRGDKGDDGVNGQVGMIGMPGIKGDKGSTYPICPFCEKGYKGIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEGRMGLLGSKGRQGYKGGKGFSGSMGDAGEIGYVTISGTT----IPGVKGEKGN------QGPKGNKGEFGEAGSRGRKGYSGLKGFKGLIGERGTSFSSGDPGDKGLRGENGKDGVSFAGIPGEKGLKGDKGNRGIL-GDVGSLSNCATRPITSKGFKGPQGAKGTSGSPGSAGKTGIVGNKGENGYPGKRGIDG---------DNGIPGSKGEEGETGI------KGHAGRPGNLGKSGLQGLRGEYGVKGDLGIQGIPGRKGVMGDPGPNGYAMIGSKGDKGIKGLPGIYGAKGDKGRPGYIGIPGFKGETGLIGRSGLKGDQGEIGEKGIKGFTFISNNPGDRGLLGNKGLKGFPGELGNKGQVGVCTV---RGDQGLRGYSGLIGDMGMKGEQGSKGIVGDYGAASRSGIM 2948
            KG RG+ G  G  GE+G KG  G  G  G  G  G++GP G +G  G                        +   ++ ++ G++GD GL GQ G+  KG   E    G  GS G  G  G+KG+ G  G  GQ G  G  G +G  G PG  GP G+            RG+ G+PG PG         D G +G  G RG  G  G KG+ G+ G  G +G RG  G  G   +L        PG KGE GFFG+PG+KG  G  G +G+ GD G  G            KGEKG EGP+G       +G+ G KG  G PG+ G       SG  G+ G+P F  G+         G++GVPG  G  GF G +G  G   TG  G  G RG+KG  GV G  G  G  G  GD G T  +                                          G  GL G +G  G  G KGF G  G AG+IG+  I+G       PG+KG+ G       QGP+G  G  G  G +G  G+ G+ G  G  G RG S   G PG KG  G  G D     G PG  G +GD+G    L G VG       R   + G +GP G+ G  G PG +  + I G+ G+ G PG  G+ G          N +PG KG+EG +G       KG  G PG  G+ G+ GL GE G KG+ G  G  G  G +GD GP G      KGD+G  G PG  G+ G  G P  I +    G  G  GR GL G  GEIG +G  G               + G +G PG+ G +G+ GV  V   RGDQG  G+ G +G  G  G  GS G+ G  G +   G +
Sbjct:  696 KGVRGMPGFPGASGEQGLKGFPGDPGREGFPGPPGFMGPRGSKGTTGLPGPDGPPGPIGLPGPAGPPGDRGIPGEVLGAQPGTRGDAGLPGQPGL--KGLPGETGAPGFRGSQGMPGMPGLKGQPGFPGPSGQPGQSGPPGQHGFPGTPGREGPLGQPGSPGLGGLPGDRGEPGDPGVPGPVGMKGLSGDRGDAGMSGERGHPGSPGFKGMAGMPGIPGQKGDRGSPGMDGFQGMLGLKGRQGFPGTKGEAGFFGVPGLKGLPGEPGVKGNRGDRGPPGPPPLILPGMKDIKGEKGDEGPMG------LKGYLGLKGIQGMPGVPGV------SGFPGLPGRPGFIKGVK--------GDIGVPGTPGLPGFPGVSGPPGI--TGFPGFTGSRGEKGTPGVAGVFGETGPTGDFGDIGDTVDL-----------------------------------------PGSPGLKGERGITGIPGLKGFFGEKGAAGDIGFPGITGMAGAQGSPGLKGQTGFPGLTGLQGPQGEPGRIGIPGDKGDFGWPGVPGLPGFPGIRGISGLHGLPGTKGFPGSPGVDAHGDPGFPGPTGDRGDRGEANTLPGPVGVPGQKGER--GTPGERGPAGSPGLQGFPGISPPSNISGSPGDVGAPGIFGLQGYQGPPGPPGPNALPGIKGDEGSSGAAGFPGQKGWVGDPGPQGQPGVLGLPGEKGPKGEQGFMGNTGPSGAVGDRGPKG-----PKGDQGFPGAPGSMGSPGIPGIPQKIAV--QPGTLGPQGRRGLPGALGEIGPQGPPG---------------DPGFRGAPGKAGPQGRGGVSAVPGFRGDQGPMGHQGPVGQEGEPGRPGSPGLPGMPGRSVSIGYL 1486          

HSP 3 Score: 214.927 bits (546), Expect = 2.613e-55
Identity = 279/803 (34.74%), Postives = 356/803 (44.33%), Query Frame = 3
Query:  201 GNKGRQGFPGPRGYQGVSGDKGDVGQFGMPGPKGYKGFTGAIGPQGRKG---------ERGIPGSPGYPGKMGEMGFPGIRGDIGEKGLTGCDGQQGDFGNPGMNGLVGRTGQPGERGDDGDRGLSIIPKYGLKGNKGSRGLLGRYGRKGEKGFKGIKGYSGIFGIKGNKGYVGPMGRRGPKGDSLGTVIIQSEKGSKGDKGLKGQSGIPCKGFQIEGRMYGRVGSDGPIGDKGIKGEKGLMGEIGQSGIDGARGLNGE----KGLPGEAGPRGERGDRGNPGFPGDPGASGADGTRGRQGERGPKGVHGISGADGPRGSRGDKGPSGSLLSCPGRKGEKGFFGIPGIKGDIGNKGYQGHDGDIGEIGFKGEKGYEGPLGPSCSEVEQGFRGTKGESGFPGLRGAKGQRGYSGNKGIKG-KPNFG-TGINN-PGETGSYGNLGVPGEKGNKGFIGDTGEKGFSGTGKQGPEGPRGDKGDDGVNGQVGMIGMPGIKGDKGSTYPICPFCEKGYKGIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEGRMGLLGSKGRQGYKG---GKGFSGSMGDAGEIGYVTISG----------TTIPGVKGEKGNQGPK---GNKGEFGEAGSRGRKGYSGLKGFKGLIGERGTSFSSGDPGDKGLRGENGKDGVSFAGIPGEKGLKGDKGNRGILGDVGSLSNCATRPITSKGFKGPQGAKGTSGSPGSAGKTGIVGNKGENGYPGKRGIDGDNGIPGSKGEEGETGIKGHAGRPGNLGKSGLQGLRGEYGVKGDLGIQGIPGRKGVMG 2513
            G++G  G PG +G  G  G  G  GQ G PG  G+ G  G  GP G+ G         +RG PG PG PG +G  G  G RGD       G  G++G  G+PG  G+ G  G PG++GD              +G+ G  G  G  G KG +GF G KG +G FG+ G KG  G                   E G KG++G +G  G P         + G  G +GP+G KG  G KG+ G  G  G+ G  GL G     KG+ G+ G  G  G  G PG  G PG +G  G  G +GE+G  GV G+ G  GP G  GD G +  L   PG KGE+G  GIPG+KG  G KG        G+IGF G  G  G          QG  G KG++GFPGL G +G +G  G  GI G K +FG  G+   PG  G  G  G+ G  G KGF G  G       G  GP G RGD+G+   N   G +G+PG KG++G+                                              G  G  GS G QG+ G       SGS GD G  G   + G            +PG+KG++G+ G     G KG  G+ G +G+ G  GL G KG  GE+G   ++G  G  G RG  G          G++G  G  G+ G  G  G     A +P    G  GPQG +G  G+ G  G  G  G+ G  G PGK G  G  G+         + + G  G  G +G  G  G  GE G  G  G+ G+PGR   +G
Sbjct:  804 GSQGMPGMPGLKGQPGFPGPSGQPGQSGPPGQHGFPGTPGREGPLGQPGSPGLGGLPGDRGEPGDPGVPGPVGMKGLSGDRGD------AGMSGERGHPGSPGFKGMAGMPGIPGQKGD--------------RGSPGMDGFQGMLGLKGRQGFPGTKGEAGFFGVPGLKGLPG-------------------EPGVKGNRGDRGPPGPPPLILPGMKDIKGEKGDEGPMGLKGYLGLKGIQGMPGVPGVSGFPGLPGRPGFIKGVKGDIGVPGTPGLPGFPGVSGPPGITGFPGFTGSRGEKGTPGVAGVFGETGPTGDFGDIGDTVDLPGSPGLKGERGITGIPGLKGFFGEKGA------AGDIGFPGITGMAG---------AQGSPGLKGQTGFPGLTGLQGPQGEPGRIGIPGDKGDFGWPGVPGLPGFPGIRGISGLHGLPGTKGFPGSPGVDAHGDPGFPGPTGDRGDRGE--ANTLPGPVGVPGQKGERGTP---------------------------------------------GERGPAGSPGLQGFPGISPPSNISGSPGDVGAPGIFGLQGYQGPPGPPGPNALPGIKGDEGSSGAAGFPGQKGWVGDPGPQGQPGVLGLPGEKGPKGEQGFMGNTGPSGAVGDRGPKGPK--------GDQGFPGAPGSMGSPGIPGIPQKIAVQP----GTLGPQGRRGLPGALGEIGPQGPPGDPGFRGAPGKAGPQGRGGV---------SAVPGFRGDQGPMGHQGPVGQEGEPGRPGSPGLPGMPGRSVSIG 1484          

HSP 4 Score: 212.231 bits (539), Expect = 1.502e-54
Identity = 296/820 (36.10%), Postives = 374/820 (45.61%), Query Frame = 3
Query:  927 GARGLNGEKGLPGEAGPRGERGDRGNPGFPGDPGASGADGTRGRQ--------------------------------GERGPKGVHGISGADGPRGSRGDKGPSGSLLSCPGRKGEKGFFGIPGIKGDIG---NKGYQGHDGDIGEIGFKGEKGYEGPLGPSCSEVEQGFRGTKGESGFPGLRGAKGQRGYSGNKGIKGKPNFGTGINNPGETGSYGNLGVPGEKGNKGFIGDTGEKGFSGT-GKQGPEGPRGDKGDDGVNGQVGMIGMPGIKGDKGSTYPICPFCEKGYKGIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEGRMGL---LGSKGRQGYKGGKGFSGSMGDAGEIGYVT-----ISGTTIPGVKGEKGNQGPKGNKGEFGEAGSRGRKGYSGLKGFKGLIGERGTSFSSGD----PGDKGLRGENGKDGVS-FAGIPGEKGLKGDKGNRGILGDVGSLSNCATRPITS----KGFKGPQGAKGTSGSPGSAGKTGIVGNKGENGYPGKRGIDGDNGIPGSKGEEGETGIKGHAGRPGNLGKSGLQGLRGEYGVKGDLGIQGIPGRKGVMGDPGPNGYAMIGSKGDKGIKGLPGIY------GAKGDKGRPGYIGIPGFKGETGLIGRSGLKGDQGEIGEKGIKGFTFISNNPGDRGLLGNKGLKGFPGELGNKGQVGVCTVRGDQGLRGYSGLIGDMGMKGEQGSKGIVGDYGAASRSGIMG-------RTGKIGNQGLPGDQXXXXXXXXXXXXXXXXYIGIPGFEGDRGEKGNKGFPGFPGDI------------GQPGRLGNPGI 3152
            G RG+ G  G  GE G +G  GD G  GFPG PG  G  G++G                                   + G +G  G+ G  G +G  G+ G        PG +G +G  G+PG+KG  G     G  G  G  G+ GF G  G EGPLG   S    G  G +GE G PG+ G  G +G SG++G  G         +PG  G  G  G+PG+KG++G  G  G +G  G  G+QG  G +G+ G  GV G  G+ G PG+KG++G                                 L G K  KG  GDEG MGL   LG KG QG  G  G SG  G  G  G++      I     PG+ G  G  GP G  G  G  GSRG KG  G+ G  G  G  G     GD    PG  GL+GE G  G+    G  GEKG  GD G  GI G  G+  +   +  T      G +GPQG  G  G PG  G  G  G  G  G+PG RGI G +G+PG+KG  G  G+  H G PG  G +G +G RGE       G  G+PG+KG  G PG  G A     G  G++G PGI       G+ GD G PG  G+ G++G  G  G + L G +G+ G  G  GF      PG +G +G+ G +G PG LG  G+ G    +G  G  G SG +GD G KG +G +G  G  G+    GI G       + G +G QG  G  G  G  G +G  G  G+ G PG  G +G  G    PGF GD             G+PGR G+PG+
Sbjct:  697 GVRGMPGFPGASGEQGLKGFPGDPGREGFPGPPGFMGPRGSKGTTGLPGPDGPPGPIGLPGPAGPPGDRGIPGEVLGAQPGTRGDAGLPGQPGLKGLPGETG-------APGFRGSQGMPGMPGLKGQPGFPGPSGQPGQSGPPGQHGFPGTPGREGPLGQPGSPGLGGLPGDRGEPGDPGVPGPVGMKGLSGDRGDAGMSGERGHPGSPGFKGMAGMPGIPGQKGDRGSPGMDGFQGMLGLKGRQGFPGTKGEAGFFGVPGLKGLPGEPGVKGNRGDRG----------------------PPGPPPLILPGMKDIKGEKGDEGPMGLKGYLGLKGIQGMPGVPGVSGFPGLPGRPGFIKGVKGDIGVPGTPGLPGFPGVSGPPGITGFPGFTGSRGEKGTPGVAGVFGETGPTGDFGDIGDTVDLPGSPGLKGERGITGIPGLKGFFGEKGAAGDIGFPGITGMAGAQGSPGLKGQTGFPGLTGLQGPQGEPGRIGIPGDKGDFGWPGVPGLPGFPGIRGISGLHGLPGTKGFPGSPGVDAH-GDPGFPGPTGDRGDRGEANTL--PGPVGVPGQKGERGTPGERGPA-----GSPGLQGFPGISPPSNISGSPGDVGAPGIFGLQGYQGPPGPPGPNALPGIKGDEGSSGAAGF------PGQKGWVGDPGPQGQPGVLGLPGEKGPKGEQGFMGNTGPSGAVGDRGPKGPKGDQGFPGAPGSMGSPGIPGIPQKIAVQPGTLGPQGRRGLPGALGEIGPQGPPGDPGFRGAPGKAGPQGRGGVSAVPGFRGDQGPMGHQGPVGQEGEPGRPGSPGL 1473          

HSP 5 Score: 199.134 bits (505), Expect = 1.397e-50
Identity = 299/850 (35.18%), Postives = 386/850 (45.41%), Query Frame = 3
Query:  987 RGDRGNPGFPGDPGASGADGTRGRQGERGPKGVHGISGADGPRGSRGDKG-------------------------PSGSLLSCPGRKGEKGFFGIPGIKG---DIGNKGYQGHDGDIGEIGFKGEKGYEGPLGPSCSEVEQGFRGTKGESGFPGLRGAKGQRGYSGNKGIKGKPNFGTGINNPGETGSYGNLGVPGEKGNKGFIGDTGEKGFSGTGKQGPEGPRGDKGDDGVNGQVGMIGMPGIKGDKGSTYPICPFCEKGYKGIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEGRMGLLGSKGRQGYKGGKGFSGSMGDAGEIGYVTISGTTIPGVKGEKGNQGPKGNKGEFGEAGSRGRKGYSGLKGFKGLIGE-------RGTSFSSGDPGDKGLRGENGKDGVS-FAGIPGEKGLKGDKGNRGILGDVGSLSNCAT--RPITSKGFKGPQGAKGTSGSPGSAGKTGIVGNKGENGYPGKRGIDGDNGIPGSKGEEGETGIKGHAGRPGNLGKSGLQGLRGEYGVKGDLGIQGIPGRKGV---MGDPGPNGYAMIGSKGDKGIKGLPGIYGAKGDKGR----PGYIGIPGFKGETGLIGRSGLKGDQGEIGEKGIKGFTFISNNPGDRGLLGNKGLKGFPGELGNKGQVGVCTVRGDQGLRGYSGL------IGDMGMKGEQGSKGIVGDYGAASRSGIMGRTGKIGNQGLPGDQXXXXXXXXXXXXXXXXYIGIPGFEGDRGEKGNKGFPGFPGDIG-QPGRLGNPGISTEGVXXXXXXXXXXXXXXXXXXXXXXXXXXKQGDSGIS-IPGRQGIKGEDGTIGLPGEMGEPGPRGDFGQKGNIG 3377
            +G RG PGFPG   ASG  G +G  G+ G +G  G  G  GPRGS+G  G                         P   L + PG +G+ G  G PG+KG   + G  G++G  G  G  G KG+ G+ GP G      + G  G  G+ GFPG  G +G  G  G+               PG+ G  G+ GVPG  G KG  GD G+ G SG         RG  G  G  G  GM G+PG KGD+GS          G  G QG LG +G  G  G                +G  G  G  G +G  G  G  G+ GD G  G   +    +  +KGEKG++GP G KG  G  G +G  G  G+ GF GL G        +G     G PG  G  G +G  G++ F G  G +G KG  G  G+ G+ G   +       +   G  G +G +G +G PG  G  G  G  G+ G+PG  G+ G  G PG KG+ G  G+ G  G  G  G+ G+ G +G++G  G  G+ G PG +G+    G PG  G+         G  G PG  G +GD+G     PG +G+PG KGE G  G  G  G  G  G  GI   + IS +PGD G  G  GL+G+ G  G  G   +  ++GD+G  G +G       +GD G +G+ G  G+ G+ G     G MG TG  G  G  G +G                 G  GF G  G  G+ G PG P  I  QPG LG  G    G+ G  G  G  GP G+PG  G  GK G QG  G+S +PG +G +G  G  G  G+ GEPG  G  G  G  G
Sbjct:  696 KGVRGMPGFPG---ASGEQGLKGFPGDPGREGFPGPPGFMGPRGSKGTTGLPGPDGPPGPIGLPGPAGPPGDRGIPGEVLGAQPGTRGDAGLPGQPGLKGLPGETGAPGFRGSQGMPGMPGLKGQPGFPGPSG------QPGQSGPPGQHGFPGTPGREGPLGQPGSP---------GLGGLPGDRGEPGDPGVPGPVGMKGLSGDRGDAGMSGE--------RGHPGSPGFKGMAGMPGIPGQKGDRGSP---------GMDGFQGMLGLKGRQGFPG---------------TKGEAGFFGVPGLKGLPGEPGVKGNRGDRGPPGPPPLILPGMKDIKGEKGDEGPMGLKGYLGLKGIQGMPGVPGVSGFPGLPGRPGFIKGVKGDIGVPGTPGLPGFPGVSGPPGITGFPGFTGSRGEKGTPGVAGVFGETGPTGDFGDIGDTVDLPGSPGLKGERGITGIPGLKGFFGEKGAAGDIGFPGITGMAGAQGSPGLKGQTGFPGLTGLQGPQGEPGRIGIPGDKGDFGWPGVPGLPGFPGIRGISGLHGLPGTKGFPGSPGVDAHGDPGFPGPTGDRGDRGEANTLPGPVGVPGQKGERGTPGERGPAGSPGLQGFPGISPPSNISGSPGDVGAPGIFGLQGYQGPPGPPGPNALPGIKGDEGSSGAAGFPGQKGWVGDPGPQGQPGVLGLPGEKGPKGEQGFMGNTGPSGAVGDRGPKGPK---------------GDQGFPGAPGSMGSPGIPGIPQKIAVQPGTLGPQG--RRGLPGALGEIGPQGPPGDPGFRGAPGKAGPQGRGGVSAVPGFRGDQGPMGHQGPVGQEGEPGRPGSPGLPGMPG 1478          

HSP 6 Score: 196.052 bits (497), Expect = 1.266e-49
Identity = 297/867 (34.26%), Postives = 374/867 (43.14%), Query Frame = 3
Query:  342 KGERGIPGSPGYPGKMGEMGFPGIRGDIGEKGLTGCDGQQGDFGNPGMN------------------------GLVGRT--GQPGERGD---DGDRGLSIIP-KYGLKGNKGSRGLLGRYGRKGEKGFKGIKGYSGIFGIKGNKGYVGPMGRRGPKGDSLGTVIIQSEKGSKGDKGLKGQSGIPCKGFQIEGRMYGRVGSDGPIGDKGIKGEKGLMGEIGQSGIDGARGLNGEKGLPGEAGPRGERGDRGNPGFPGDPGASGADGTRGRQGERGPKGVHGISGADGPRGSRGDKGPSGSLLSCPGR-------KGEKGFFGIPGIKGDIGNKGYQGHDGDIGEIGFKGEKGYEGPLGPSCSEVEQGFRGTKGESGFPGLRGAKGQR---GYSGNKGIKGKPNFGTGINNPGETGSYGNL-------GVPGEKGNKGFIGDTGEKGFSGTGKQGPEGPRGDKGDDGVNGQVGMIGMPGIKGDKGSTYPICPFCEKGYKGIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEGRMGLLGSKGRQGYKGGKGFSGSMGDAGEIGYVTISGTT----IPGV--KGEKGNQGPKGNKGEFGEAGSR-GRKGYSGLKGFKGLIGERGTSFSSGDPGDKGLRGENGKDGVSFAGIPGEKGLKGDKGNRGILGDVGSLSNCATRPITSKGFKGPQGAKGTSGSPGSAGKTGIVGNKGENGYPGKRGIDGDNGIPGSKGEEGETGIKGHAGRPGNLGKSGLQGLRGEYGVKGDLGIQGIPGRKGVMGDPG-PNGYAM-IGSKGDKGIKGLPGIYGA------------------KGDKGRPGYIGIPGFKGETGLIGRSGLKGDQGEIGEKGIKGF 2720
            KG RG+   PG+PG  GE G  G  GD G +G  G  G  G  G+ G                          G+ G     QPG RGD    G  GL  +P + G  G +GS+G+ G  G KG+ GF G  G  G  G  G  G+ G  GR GP    LG        G  GD+G  G  G+P                 GP+G KG+ G++G  G  G+ G  G+ G  G  G+PG  G +G+RG  G  GF G  G  G  G  G +GE G  GV G+ G  G  G +G++G  G     P         KGEKG  G  G+KG +G KG QG  G  G  GF G  G  G +     + + G  GT G  GFPG+ G  G     G++G++G KG P         G TG +G++       G PG KG +G  G  G KGF G      +G  GD G  G+ G  G  G PG+KG  G  +P       G  G+Q                        G  G+ GR+G+ G KG  G+ G  G  G  G  G  G   + GT      PGV   G+ G  GP G++G+ GEA +  G  G  G KG +G  GERG    +G PG +G  G +    +S        G  GD G  GI G  G           +          G  G  GS+G  G  G KG  G PG +G  G  G+PG KG +GE G        GN G SG  G RG  G KGD G  G PG  G  G PG P   A+  G+ G +G +GLPG  G                    G +GR G   +PGF+G+ G +G  G  G +GE G  G  G 
Sbjct:  696 KGVRGM---PGFPGASGEQGLKGFPGDPGREGFPGPPGFMGPRGSKGTTGLPGPDGPPGPIGLPGPAGPPGDRGIPGEVLGAQPGTRGDAGLPGQPGLKGLPGETGAPGFRGSQGMPGMPGLKGQPGFPGPSGQPGQSGPPGQHGFPGTPGREGP----LGQPGSPGLGGLPGDRGEPGDPGVP-----------------GPVGMKGLSGDRGDAGMSGERGHPGSPGFKGMAGMPGIPGQKGDRGSPGMDGFQGMLGLKGRQGFPGTKGEAGFFGVPGLKGLPGEPGVKGNRGDRGPPGPPPLILPGMKDIKGEKGDEGPMGLKGYLGLKGIQGMPGVPGVSGFPGLPGRPGFI--KGVKGDIGVPGTPGLPGFPGVSGPPGITGFPGFTGSRGEKGTPGVAGVFGETGPTGDFGDIGDTVDLPGSPGLKGERGITGIPGLKGFFGE-----KGAAGDIGFPGITGMAGAQGSPGLKGQTG--FP-------GLTGLQ------------------------GPQGEPGRIGIPGDKGDFGWPGVPGLPGFPGIRGISGLHGLPGTKGFPGSPGVDAHGDPGFPGPTGDRGDRGEANTLPGPVGVPGQKGERGTPGERG---PAGSPGLQGFPGISPPSNIS--------GSPGDVGAPGIFGLQGYQGPPGPPGPNA--------LPGIKGDEGSSGAAGFPGQKGWVGDPGPQGQPGVLGLPGEKGPKGEQGFM------GNTGPSGAVGDRGPKGPKGDQGFPGAPGSMGSPGIPGIPQKIAVQPGTLGPQGRRGLPGALGEIGPQGPPGDPGFRGAPGKAGPQGRGGVSAVPGFRGDQGPMGHQGPVGQEGEPGRPGSPGL 1473          

HSP 7 Score: 190.66 bits (483), Expect = 6.353e-48
Identity = 404/1270 (31.81%), Postives = 497/1270 (39.13%), Query Frame = 3
Query:  579 NKGSRGLLGRYGRKGEKGFKGIKGYSGIFGIKGNKGYVGPMGRRGPKGDSLGTVIIQSEKGSKGDKGLKGQSGIPCKGFQIEGRMYGRVGSDGPIGDKGIKGEKGLMGEIGQSGIDGARGLNGEKGLPGEAGPRGERGDRGNPGFPGDPGASGADGTRGRQGER-----------------------------GPKGVHGISGADGPRGSRGD---KGPSGSLLSCPGRKGEKGFFGIPGIKGDIGNKGYQGHDGDIGEIGFKGEKGYEGPLGPSCSEVEQGFRGTKGESGFPGLRGAKGQRGYSGNKGIKGKPNFGTGINNPGETGSYGNLGVPGEKGNKGFIGDTGEKGFSGTGKQGPEGPRGDKGDDGVNGQVGMIGMPGIKGDKG-STYPICPFCEKGYKGIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEGRMGLLGSKGRQGYKGGKGFSGSMGDAGEIGYVTISGTTIPGVKGEKGNQGPKGNKGEFGEAGSRGRKGYSGLKGFKGLIGERG------------TSFSSGDPGDKGLRGENGKDGVS---------------------------FAGIPGEKGLKGD-----------KGNRGILGDVGSLS-----------------NCAT---RPI--------------------TSKGFKGPQGAKGTSGSPGSAGKTGIVGNKGENGYPGKRGIDGDNGIPGSKGEEGET-----------------------------------GIKGHAGRPGNLGKSGLQGLRGEYGVKGDLGIQGIPGRKGVMGDPGPNGYA-MIGSKGDKGIKGLPGIYGAKG------------DKGRPGYIGIPG---FKGETGLIGRSGLKGDQGEIGEKGIKGFTFISNNPGDRGLLGNKGLKGFPGELGNKGQVGVCTVRGDQGLRGYSGLIGDMGMKGEQGSKGIVGDYGAASRSG--------IMGRTGKIGNQGLPGDQXXXXXXXXXXXXXXXXYIGIPGFEGDRGEKGNKGFPGFPG----------DIGQPGRLGNPGISTEGVXXXXXXXXXXXXXXXXXXXXXXXXXXKQGDSGIS-IPGRQGIKGEDGTIGLPGEMGEPGPRGDFGQKGN-IGITGEFGLQGNRGDDGLKGDDGIPGLNGPRGFIGDIGFVGFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXELGLDGSMGGKGDNGPRGFNGPTGIPGSKGFEGDKGIRGDIGVKGFQGQHGEIGFPGLKGVSGENG 3806
             KG+RG  G  G +G  G  G++G+ G+ G KG+KG  G  G  GPKGD           G++G  G  G  GIP  G   +G   GR G DG  G +G  G +G  G  G  G+ G +G  G+KG P           RG PG PG  G  G  G  G  G+                              G KG  G  G  GP G   D    GP+ S +     KGEKG  G  GI G I         G+ G +GF G +G+ G       + E+G  G KG  G  G +G  G RG  G +G +G P  G  + +P  + + G  G PG +G  G  G  GE G  GT   GP GP        V  +  M G+PG  G KG S  P  P    G  G  G  G +G  G  G  G  G          EGR+G  G  G  G +G KG+ G  GD  + G V      +PG KG  G  G  G KG+ G+ G  G  G+ G KG  G+ G  G            T    G PG  G+ G  G DGV                              G+PG KG  GD           KG RG  GD G                    +C T   RPI                       G  GP GAKG  G PG  G +G  G KG  G PG+ G  G  G  G +G +G T                                   G +G AG PG  G  GL G  G  G +G  G+ G+PG KG  G PGP+G     G  G  G  G PG  G  G            D+G PG  G+PG    KG +G  G +G+ G++G  G  G KG   +   PG +G  G+ G+ GF G LG KG+ G    +G+ G  G  GL    G+ GE G KG  GD G              I G  G  G  GL G                  Y+G+ G +G  G  G  GFPG PG          DIG PG  G PG    GV                            G  GI+  PG  G +GE GT G+ G  GE GP GDFG  G+ + + G  GL+G RG  G+ G   + G  G +G  GDIGF G                                        G+ G+ G  G  G  GF G TG+ G +G  G  GI GD G  G+ G  G  GFPG++G+SG +G
Sbjct:   56 EKGARGQPGAVGPQGYNGPPGLQGFPGLQGRKGDKGERGVPGPTGPKGDV----------GARGVSGFPGADGIP--GHPGQGGPRGRPGYDGCNGTRGDAGPQGPSGSGGFPGLPGPQGPKGQKGEPYALSKEDRDKYRGEPGEPGLVGYQGPPGRPGPIGQMGPMGAPGRPGPPGPPGPKGQPGNRGLGFYGQKGEKGDIGQPGPNGIPSDITLVGPTTSTIHPDLYKGEKGDEGEQGIPGVI-------SKGEEGIMGFPGIRGFPG------LDGEKGVVGQKGSRGLDGFQGPSGPRGPKGERGEQGPP--GPSVYSPHPSLAKGARGDPGFQGAHGEPGSRGEPGEPGT--AGPPGPS-------VGDEDSMRGLPGEMGPKGFSGEPGSPARYLGPPGADGRPGPQGVPGPAGPPGPDGFLFGLKG--SEGRVGYPGPSGFPGTRGQKGWKGEAGDC-QCGQVIGGLPGLPGPKGFPGVNGELGKKGDQGDPGLHGIPGFPGFKGAPGVAGAPGPKGIKGDSRTITTKGERGQPGIPGVHGMKGDDGVPGRDGLDGFPGLPGPPGDGIKGPPGDAGLPGVPGTKGFPGDIGPPGQGLPGPKGERGFPGDAGLPGPPGFPGPPGPPGTPGQRDCDTGVKRPIGGGQQVVVQPGCIEGPTGSPGQPGPPGPTGAKGVRGMPGFPGASGEQGLKGFPGDPGREGFPGPPGFMGPRGSKGTTGLPGPDGPPGPIGLPGPAGPPGDRGIPGEVLGAQPGTRGDAGLPGQPGLKGLPGETGAPGFRGSQGMPGMPGLKGQPGFPGPSGQPGQSGPPGQHGFPGTPGREGPLGQPGSPGLGGLPGDRGEPGDPGVPGPVGMKGLSGDRGDAGMSGERGHPGSPGFKGMAGMPGIPGQKGDRGSPGMDGFQGMLGLKGRQGFPGTKGEAGFFGVPGL---KGLPGEPGVKGNRGDRGPPGPPPLILPGMKDIKGEKGDEGPMGLKG------------------YLGLKGIQGMPGVPGVSGFPGLPGRPGFIKGVKGDIGVPGTPGLPGFP--GV---------------------------SGPPGITGFPGFTGSRGEKGTPGVAGVFGETGPTGDFGDIGDTVDLPGSPGLKGERGITGIPG---LKGFFGEKGAAGDIGFPGI--------------------------------------TGMAGAQGSPGLKGQTGFPGLTGLQGPQGEPGRIGIPGDKGDFGWPGVPGLPGFPGIRGISGLHG 1195          

HSP 8 Score: 189.504 bits (480), Expect = 1.241e-47
Identity = 311/898 (34.63%), Postives = 410/898 (45.66%), Query Frame = 3
Query: 1179 KGFFGIPGIKGDIGNKGYQGHDGDIGEIGFKGEKGYEGPLGPSCSEVEQGFRGTKGESGFPGLRGAKGQRGYSGNKGIKGKPNFGTGINNPGETGSYGNLGVPGEKGNKGFIGDTGEKGFSGTGKQGPEGPRGDKGDDGVNGQVGMIGMPGIKGDKGSTYPICPFCEKGYKGIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEGRMGLLGSKGRQGYKGGKGFSGSMGDAGEIGYVTISGTTIPGVKGEKGNQGPKGNKGEFGEAGSRGRKGYSGLKGFKGLIGERGTSFSSGDPGDKGLRGENGKDGVSFAGIPGEKGLKGDKGNRGILGDVGSLSNCATRPITSKGFKGPQGAKGTSGSPGSAGKTGIV-GNKGENGYPGKRGIDGDNGI---PGSKGEEGETGIKGHAGRPGNLGKSGLQGLRGEYGVKGDL----GIQGIPGRKGVMGDPGPNGYAMIGSKGDKGIKGLPGIYGAKGDKGRPGYIGIPGFKGETGLIGRSGLKGDQGEIGEKGIKGFTFISNNPGDRGLLGNKGLKGFPGELGNKGQVGVCTVRGDQGLRGYSGL--IGDMGMKGEQGSKGIVGDYGAASRSGIMGRTGKIGNQGLPGDQXXXXXXXXXXXXXXXXYIGIPGFEGDRGEKGNKGFPGFPGDIGQPGRLGNPGISTEGVXXXXXXXXXXXXXXXXXXXXXXXXXXKQGDSGIS-IPGRQGIKGEDGTIGLPGEMGEPGPRGDFGQKGNIGITGEFGLQGNRGDDGLKGDDGIPGLNGPRGFIGDIGFVGFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXELGLDGSM---------------GGKGDNGPRGFNGPTGIPGSKGFEGDKGIRGDIGVKGFQGQHGEIGFPGLKGVS 3794
            KG  G+PG  G  G +G +G  GD G  GF G  G+ GP         +G +GT G  G  G  G  G  G +G  G +G P    G     + G+ G+ G+PG+ G KG  G+TG  GF           RG +G  G+ G  G  G PG  G  G + P       G  G  G  G  G  G  G  GL G  G++G PGD G  G +G KG  G +G  G SG  G  G  G+  ++G  +PG+ G+KG++G  G  G  G  G +GR+G+ G KG  G  G  G     G+PG KG RG+ G  G     +PG K +KG+KG+ G +G  G L          KG +G  G  G SG PG  G+ G + G KG+ G PG  G+ G  G+   PG  G  G TG +G  G PG  G  G  G  G++G  GD     G  G+ G +G+ G PG  G+   G KG  G  G PGI G  G +G PG       KG+TG  G +GL+G QGE G  GI         PGD+G  G  G+ G PG  G +G  G+  + G +G  G  G+   GD G  G  G +G  G+  A +  G +G  G+ G +G PG++G                 G PG +G  G        G PGD+G PG  G  G                   G PG   L G  G +G SG +  PG++G  G+ G  G PG +G PG +G  G++G +G TG  G  G+RG  G KGD G PG  G  G  G  G                           +      G +G +G  GL G++               G  G  GP+G  G + +PG +G +G  G +G +G +G  G+ G  G PG+ G S
Sbjct:  696 KGVRGMPGFPGASGEQGLKGFPGDPGREGFPGPPGFMGP---------RGSKGTTGLPGPDGPPGPIGLPGPAGPPGDRGIPGEVLGA----QPGTRGDAGLPGQPGLKGLPGETGAPGF-----------RGSQGMPGMPGLKGQPGFPGPSGQPGQSGP------PGQHGFPGTPGREGPLGQPGSPGLGGLPGDRGEPGDPGVPGPVGMKGLSGDRGDAGMSGERGHPGSPGFKGMAG--MPGIPGQKGDRGSPGMDGFQGMLGLKGRQGFPGTKGEAGFFGVPGLKGLPGEPGVKGNRGDRGPPGPPPLILPGMKDIKGEKGDEGPMGLKGYLG--------LKGIQGMPGVPGVSGFPGLPGRPGFIKGVKGDIGVPGTPGLPGFPGVSGPPGITGFPGFTGSRGEKGTPGVAGVFGETGPTGDFGDIGDTVDLPGSPGLKGERGITGIPGLKGF--FGEKGAAGDIGFPGITGMAGAQGSPG------LKGQTGFPGLTGLQGPQGEPGRIGI---------PGDKGDFGWPGVPGLPGFPGIRGISGLHGLPGTKGFPGSPGVDAHGDPGFPGPTGDRGDRGE--ANTLPGPVGVPGQKGERGTPGERGP---------------AGSPGLQGFPGISPPSNISGSPGDVGAPGIFGLQGYQGP--------------PGPPGPNALPGIKGDEGSSGAAGFPGQKGWVGDPGPQGQPGVLGLPGEKGPKGEQGFMGNTGPSGAVGDRGPKGPKGDQGFPGAPGSMGSPGIPGI-------------------------PQKIAVQPGTLGPQGRRGLPGALGEIGPQGPPGDPGFRGAPGKAGPQGRGGVSAVPGFRGDQGPMGHQGPVGQEGEPGRPGSPGLPGMPGRS 1480          

HSP 9 Score: 189.119 bits (479), Expect = 1.741e-47
Identity = 449/1322 (33.96%), Postives = 547/1322 (41.38%), Query Frame = 3
Query:   72 KFKNSYHYL---LLLIMVSQSYYAQDSDPDPFKCLRIC----TPDKCQCFGNKGRQGFPGPRGYQGVSGDKGDVGQFGMPGPKGYKGFTGAIGPQGRKGERGIPGSPGYPGKMGEMGFPGIRGDIGEKGLTGCDGQQGDFGNPGMNGLVGRTGQPGERGDDGDRGLSIIPKYGLKGNKGSRGLLGRYGRKGEKGFKGIKGYSGIFGIKGNKGYVGPMGRRGPKGDSLGT----------VIIQSEKGSKGDKGLKGQSGIPCKGFQIEGRMYGRVGSDGPIGDKGIKGEKGLMGEIGQSGIDGARGLNGEKGLPGEAGPRGERGDRGNPGFPGDPGASGADGTRGRQGERGPKGVHGISGADGPRGSRGDKGPSGSLLSCPGRKGEKGFFGIPGIKGDIGNKGYQGHDGDIGEIGFKGEKGYEGPLGPSCSEVEQGFRGTKGESGFPGLRGAKGQRG-YSGNKGIKGKPNFGTGINNPGETGSYGNLGVPGEKGNKGFIGDTGEKGFSGTGKQGPEGPRGDKGDDGVNGQV--GMIGMPGIKGDKGSTYPICPFCEKGYKGIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEGRMGLLGSKGRQGYKGGKGFSGSMGDAGEIGYVTISGTTIPGVKGEKGNQGPKGNKGEFGEAGSRGRKGYSGLKGFKGLI--------------GERGTSFSSGDPGDKGLRGENGKDGVSFAGIPGEKGLKGDKG----------------------NRGILGDVGSLSNCATRP---------ITSKGFKGPQGAKGTSGSPGSAGKTGIVGNKGENGYPGKRGIDGDNGIPGSKGEEGETGIKGHAGRPGNLGKSGLQGLRGEYGVKGD-LGIQGIPGRKGVMGDPGPNGYAMIGSKGDKGIKGLPGIYGAKGDKGRPGYIGIPGFKGETGLIGRSGLKGDQGEIGEKGIKGFTFISNNPGDRGLLGNKGLKGFPGELGNKGQVGVCTVRGDQGLRGYSGLIGDMGMKGEQGSKGIVGDYGAASRSGIMGRTGKIGNQGLPGDQXXXXXXXXXXXXXXXXYIGIPGFEGDRGEKGNKGFPGFPGDIGQPGRLGNPGISTEGVXXXXXXXXXXXXXXXXXXXXXXXXXXKQGDSGIS-------------IPGRQG-IKGEDGTIGLPGEMGEPGPRGDFGQKGNIGITGEFGLQGNRGDDGLKGDDGIPGLNGPRGFIGDIGFVGFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXELGLDGSMGGKGDNGPRGFNGPTGIPGSKGFEGDKGIRGDIGVKGFQGQHGEIGFPGLKGVSG 3797
            +FK S   L   LLL  V+    AQ       K    C        CQC+  KG +G PG  G QG +G  G  G  G+ G KG KG  G  GP G KG+ G  G  G+PG  G  G PG  G  G  G  GC+G +GD G  G +G  G  G PG +G  G +G      Y L           R   +GE G  G+ GY G  G  G  G +GPMG  G  G               +    +KG KGD G  G +GIP     + G     +  D   G+KG +GE+G+ G I                       +GE G  G PG  G PG  G  G  G++G RG  G  G SG  GP+G RG++GP G  +  P     KG  G PG         +QG  G+ G  G  GE G  GP GPS  + E   RG  GE G  G  G  G    Y G  G  G+P         G  G  G L   G KG++G +G  G  GF GT  +G +G +G+ GD    GQV  G+ G+PG KG  G         E G KG                              D+G  GL G  G  G+KG  G +G+ G  G              +KG+      KG +G+ G  G  G KG  G+ G  GL               G  G +   G PG KG  G+ G  G    G  GE+G  GD G                      + G+   +G       +P             G  GP GAKG  G PG  G +G  G KG  G PG+ G  G  G  G +G +G TG+ G  G PG +G  G  G  G+ G+ G+ LG Q  PG +G  G PG             G+KGLPG  GA G +G  G  G+PG KG+ G  G SG  G  G  G+ G  G       PG  G LG  G  G  G  G++G+ G   V G  G++G SG  GD GM GE+G  G  G  G A   GI G+ G  G+ G+ G Q            G  G  G  GF G +GE G  G PG  G  G+PG  GN G           L G+    GE G  G +G  G  G  GI              +PGR G IKG  G IG+PG  G P   G  G  G  GITG  G  G+RG+ G  G  G+ G  GP G  GDIG                                          + L GS G KG+   RG    TGIPG KGF G+KG  GDIG  G  G  G  G PGLKG +G
Sbjct:    5 RFKASGPPLRGWLLLATVTVGLLAQSVLGGVKKLDVPCGGRDCSGGCQCYPEKGARGQPGAVGPQGYNGPPGLQGFPGLQGRKGDKGERGVPGPTGPKGDVGARGVSGFPGADGIPGHPGQGGPRGRPGYDGCNGTRGDAGPQGPSGSGGFPGLPGPQGPKGQKGEP----YALSKED-------RDKYRGEPGEPGLVGYQGPPGRPGPIGQMGPMGAPGRPGPPGPPGPKGQPGNRGLGFYGQKGEKGDIGQPGPNGIPSD-ITLVGPTTSTIHPDLYKGEKGDEGEQGIPGVIS----------------------KGEEGIMGFPGIRGFPGLDGEKGVVGQKGSRGLDGFQGPSGPRGPKGERGEQGPPGPSVYSPHPSLAKGARGDPG---------FQGAHGEPGSRGEPGEPGTAGPPGPSVGD-EDSMRGLPGEMGPKGFSGEPGSPARYLGPPGADGRPGPQGVPGPAGPPGPDGFLF--GLKGSEGRVGYPGPSGFPGT--RGQKGWKGEAGDCQC-GQVIGGLPGLPGPKGFPGVN------GELGKKG------------------------------DQGDPGLHGIPGFPGFKGAPGVAGAPGPKG--------------IKGDSRTITTKGERGQPGIPGVHGMKGDDGVPGRDGLDGFPGLPGPPGDGIKGPPGDAGLPGVPGTKGFPGDIGPPGQGLPGPKGERGFPGDAGLPGPPGFPGPPGPPGTPGQRDCDTGVKRPIGGGQQVVVQPGCIEGPTGSPGQPGPPGPTGAKGVRGMPGFPGASGEQGLKGFPGDPGREGFPGPPGFMGPRGSKGTTGLPGPDGPPGPIGLPGPAGPPGDRGIPGEVLGAQ--PGTRGDAGLPG-----------QPGLKGLPGETGAPGFRGSQGMPGMPGLKGQPGFPGPSGQPGQSGPPGQHGFPG------TPGREGPLGQPGSPGLGGLPGDRGEPGDPGVPGPVGMKGLSGDRGDAGMSGERGHPGSPGFKGMAGMPGIPGQKGDRGSPGMDGFQ------------GMLGLKGRQGFPGTKGEAGFFGVPGLKGLPGEPGVKGNRGDRGPPGPPPLILPGMKDIKGEKGDEGPMGLKGYLGLKGIQGMPGVPGVSGFPGLPGRPGFIKGVKGDIGVPGTPGLP---GFPGVSGPPGITGFPGFTGSRGEKGTPGVAGVFGETGPTGDFGDIG----------------------------------------DTVDLPGSPGLKGE---RGI---TGIPGLKGFFGEKGAAGDIGFPGITGMAGAQGSPGLKGQTG 1147          

HSP 10 Score: 172.94 bits (437), Expect = 1.688e-42
Identity = 240/706 (33.99%), Postives = 316/706 (44.76%), Query Frame = 3
Query: 1809 GSKGRQGYKGGKGFSGSMGDAGEIGYVTISGTTIPGVKGEKGNQGPKGNKGEFGEAGSRGRKGYSGLKGFKGLIGERGTSFSSGDPGDKGLRGENGKDGVSFAGIPGEKGLKGDKGNRGILGDVGSLSNCATRPITSKGFKGPQGAKGTSGSPGSAGKTGIVGNKGENGYPGKRGIDGDNGIPGSKGEEGETGIKGHAGR-----------------PGNLGKSGLQGLRGEYGVKGDLGIQGIPGRKGVMGDPGPNGYAMIGSKGDKGIKGLPGIYGAKGDKGRPGYIGIPGF---KGETGLIGRSGLKGDQGEIGEKGIKGFTFISNNPGDRGLLGNKGLKGFPGELGNKGQVGVCTVRGDQGLRGYSGLIGDMGMKGEQGSKGIVGDYGAASRSGIMGRTGKIGNQGLPGDQXXXXXXXXXXXXXXXXYIGIPGFEGDRGEKGNKGFPGFPGDIGQPGRLGNPGISTEGVXXXXXXXXXXXXXXXXXXXXXXXXXXKQGDSGI--SIPGRQGIKGEDGTIGLPGEMGEPG------------PRGDFGQKGNIGITGEFGLQGNRGDDGLKGDDGIPGLNGPRGFIGDIGFVGFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXELGLDGSMGGKGDNGPRGFNGPTGIPGSK------GFEGDKGIRGDIGVKGFQGQHGEIGFPGLKGVSGENG 3806
            G++G  G  G  G  G  G+ G  G+    G  +PG+ G KG  G  G  G+ G++G  G+ G+ G  G +G +G+ G+    G PGD   RGE G  GV   G  G KGL GD+G+ G+ G+ G   +   + +   G  G  G KG  GSPG  G  G++G KG  G+PG +G  G  G+PG KG  GE G+KG+ G                   G  G  G  GL+G  G+KG  G+ G+PG  G  G PG  G+ + G KGD G+ G PG+ G  G  G PG  G PGF   +GE G  G +G+ G+ G  G+ G  G T   + PG  GL G +G+ G PG  G           G++G  G  G  G  GM G QGS G+ G  G    +G+ G  G+ G  G+PGD+G  G            + G+PG  G  G +G  G  G PG  G PG   +PG+   G                   PG  G  G +GD G   ++PG  G+ G+ G  G PGE G  G            P    G  G++G  G FGLQG +G  G  G + +PG+ G  G  G  GF                                             G  G  GD GP+G  G  G+PG K      GF G+ G  G +G +G +G  G+ GFPG  G  G  G
Sbjct:  777 GTRGDAGLPGQPGLKGLPGETGAPGFRGSQG--MPGMPGLKGQPGFPGPSGQPGQSGPPGQHGFPGTPGREGPLGQPGSPGLGGLPGD---RGEPGDPGVP--GPVGMKGLSGDRGDAGMSGERGHPGSPGFKGMA--GMPGIPGQKGDRGSPGMDGFQGMLGLKGRQGFPGTKGEAGFFGVPGLKGLPGEPGVKGNRGDRGPPGPPPLILPGMKDIKGEKGDEGPMGLKGYLGLKGIQGMPGVPGVSGFPGLPGRPGF-IKGVKGDIGVPGTPGLPGFPGVSGPPGITGFPGFTGSRGEKGTPGVAGVFGETGPTGDFGDIGDTV--DLPGSPGLKGERGITGIPGLKG---------FFGEKGAAGDIGFPGITGMAGAQGSPGLKGQTGFPGLTGLQGPQGEPGRIGIPGDKGDFG------------WPGVPGLPGFPGIRGISGLHGLPGTKGFPG---SPGVDAHG------------------DPGFPGPTGDRGDRGEANTLPGPVGVPGQKGERGTPGERGPAGSPGLQGFPGISPPSNISGSPGDVGAPGIFGLQGYQGPPGPPGPNALPGIKGDEGSSGAAGF--------------------------------------------PGQKGWVGDPGPQGQPGVLGLPGEKGPKGEQGFMGNTGPSGAVGDRGPKGPKGDQGFPGAPGSMGSPG 1384          

HSP 11 Score: 139.043 bits (349), Expect = 3.777e-32
Identity = 235/686 (34.26%), Postives = 292/686 (42.57%), Query Frame = 3
Query: 1914 GVKGEKGNQGPKGNKGEFGEAGSRGRKGYSGLKGFKGLIGERGTSFSSGD---------------------PGDKGLRGENGKDGVSFAGIPGEKGLKGDKGNRGILGDVGSLSNCATRPITSKGFKGPQGAKGTSGSPGSAGKTGIVGNKGENGYPGKRGIDGDNG---IPGSKGEEGETGIKGHAGRPGNLGKSGLQGLRGEYGVKGDLGIQGIPGRKGVMGDPGPNGYAMIGSKGDKGIKGLPGIYGAKGDKGRPGYIGIPGFKGETGLIGRSGLKGDQGEIGEKGIKG-----------FTFISNNPGDRGLLGNKGLKGFPGELGNKGQVGVCTVRGDQGLRGYSGLIGDMGMKGEQGSKGIVGDYGAASRSGIMGRTGKIGNQGLPGDQXXXXXXXXXXXXXXXXYIGIPGFEGDRGEKGNKGFPGFPGDIGQPGRLGNPGISTEGVXXXXXXXXXXXXXXXXXXXXXXXXXXKQGDSGIS-IPGRQGIKGEDGT---IGLPGEMGEPGPRGDFGQKGNIGITGEFGLQGNRGDDGL------KGDDGIPGLNGPRGFIGDIGFVGFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXELGLDGSMGGKGDNG-PRGFNGPTGIPGSKGFEGDKGIRGDIGVKGFQ------------GQHGEIGFPGLKGVSG 3797
            GV+G  G  G  G +G  G  G  GR+G+ G  GF G  G +GT+   G                      PG+  L  + G  G   AG+PG+ GLKG  G  G  G  GS           +G  G  G KG  G PG +G+ G  G  G++G+PG  G +G  G    PG  G  G+ G  G  G PG +G  GL G RG+ G+ G+ G  G PG KG+ G PG     + G KGD+G  G+ G  G  G KGR G+   PG KGE G  G  GLKG  GE G KG +G              + +  G++G  G  GLKG+ G  G +G  GV  V G  GL G  G I           KG+ GD G     G+ G  G  G  G+                      G PGF G RGEKG  G  G  G+ G  G  G+ G + +                      L G PG +G+ GI+ IPG +G  GE G    IG PG  G  G +G  G KG  G  G  GLQG +G+ G       KGD G PG+ G  GF G  G  G  G  G +G  G  G   H                   + G  G  G +GD G      GP G+PG KG  G  G RG  G  G Q            G  G++G PG+ G+ G
Sbjct:  697 GVRGMPGFPGASGEQGLKGFPGDPGREGFPGPPGFMGPRGSKGTTGLPGPDGPPGPIGLPGPAGPPGDRGIPGEV-LGAQPGTRGD--AGLPGQPGLKGLPGETGAPGFRGS-----------QGMPGMPGLKGQPGFPGPSGQPGQSGPPGQHGFPGTPGREGPLGQPGSPGLGGLPGDRGEPGDPGVPGPVGMKGLSGDRGDAGMSGERGHPGSPGFKGMAGMPG-----IPGQKGDRGSPGMDGFQGMLGLKGRQGF---PGTKGEAGFFGVPGLKGLPGEPGVKGNRGDRGPPGPPPLILPGMKDIKGEKGDEGPMGLKGYLGLKGIQGMPGVPGVSGFPGLPGRPGFI-----------KGVKGDIGVPGTPGLPGFPGVSGPPGI---------------------TGFPGFTGSRGEKGTPGVAGVFGETGPTGDFGDIGDTVD----------------------LPGSPGLKGERGITGIPGLKGFFGEKGAAGDIGFPGITGMAGAQGSPGLKGQTGFPGLTGLQGPQGEPGRIGIPGDKGDFGWPGVPGLPGFPGIRGISGLHGLPGTKGFPGSPGVDAHG------------------DPGFPGPTGDRGDRGEANTLPGPVGVPGQKGERGTPGERGPAGSPGLQGFPGISPPSNISGSPGDVGAPGIFGLQG 1288          

HSP 12 Score: 122.865 bits (307), Expect = 2.940e-27
Identity = 145/393 (36.90%), Postives = 185/393 (47.07%), Query Frame = 3
Query:  198 FGNKGRQGFPGPRGYQGVSGDKGDVGQFGMPGPKGYKGFTGAIGPQGRKGERGIPGSPG---YPGKMGEMGFPGIRGDIGEKGLTGCDGQQGDFGNPGMNGLVGRTGQPGERGDDGDRG-LSIIP-KYGLKGNKGSRGLLGRYGRKGEKGFKGIKGYSGIFGIKGNKGYVGPMGRRGPKG--DSLGTVIIQSEKGSKGDKGLKGQSGIPCKGFQIEGRMYGRVGSDGPIGDKGIKGEKGLMGEIGQSGIDGARGLNGEKGLPGEAGPRGERGDRGNPGFPGDPGASGADGTRGRQGERGPKGVHGISGADGPRGSRGDKGPSGSLLS-----------CPGRKGEK---GFFGIPGIKGDIGNKGYQGHDGDIGEIGFKGEKGYEGPLGPSCS 1313
            FG KG  G     G+ G++G  G  G  G+ G  G+ G TG  GPQG  G  GIPG  G   +PG  G  GFPGIRG     GL G  G +G  G+PG++   G  G PG  GD GDRG  + +P   G+ G KG RG  G  G  G  G +G  G S    I G+ G VG  G  G +G     G     +  G KGD+G  G +G P              G  G +GD G +G+ G++G  G+ G  G +G  G  G  G  G RG +G +G+ GFPG PG+ G+ G  G      P+ +    G  GP+G RG  G  G +              PG+ G +   G   +PG +GD G  G+QG  G  GE G  G  G  G  G S S
Sbjct: 1116 FGEKGAAGD---IGFPGITGMAGAQGSPGLKGQTGFPGLTGLQGPQGEPGRIGIPGDKGDFGWPGVPGLPGFPGIRGI---SGLHGLPGTKGFPGSPGVDAH-GDPGFPGPTGDRGDRGEANTLPGPVGVPGQKGERGTPGERGPAGSPGLQGFPGISPPSNISGSPGDVGAPGIFGLQGYQGPPGPPGPNALPGIKGDEGSSGAAGFP--------------GQKGWVGDPGPQGQPGVLGLPGEKGPKGEQGFMGNTGPSGAVGDRGPKGPKGDQGFPGAPGSMGSPGIPGI-----PQKIAVQPGTLGPQGRRGLPGALGEIGPQGPPGDPGFRGAPGKAGPQGRGGVSAVPGFRGDQGPMGHQGPVGQEGEPGRPGSPGLPGMPGRSVS 1482          

HSP 13 Score: 98.2117 bits (243), Expect = 8.744e-20
Identity = 128/339 (37.76%), Postives = 158/339 (46.61%), Query Frame = 3
Query:  168 RICTPDKCQCFGNKGRQGFPGPRGYQGVSGDKGDVGQFGMPGPKGY--KGFTGAIGPQGRKGERG----IPGSPGYPGKMGEMGFPGIRGDIGEKGLTG---------CDGQQGDFGNPGMNGLVGR---------TGQPGERGDDGDRGLSIIP-KYGLKGNKGSRGLLGRYGRKGEKGFKGIKGYSGIFGIKGNKGYVGPMGRRGPKGDSLGTVIIQSEKGSKGDKGLKGQSGIPCKGFQIEGRMYGRVGSDGPIGDKGIKGEKGLMGEIGQSGIDGARGLNGEKGLPGEAGPRGERGDRGNPGFPGDPGASGADGTRGRQGERGPKGVHGISGADG 1109
            RI  P     FG  G  G PG  G +G+SG  G  G  G PG  G    G  G  GP G +G+RG    +PG  G PG+ GE G PG RG  G  GL G           G  GD G PG+ GL G             PG +GD+G  G +  P + G  G+ G +G  G  G  GEKG KG +G+    G  G  G VG  G +GPKGD       Q   G+ G  G  G  GIP K       +  + G+ GP      +G +GL G +G+ G  G  G  G +G PG+AGP+G  G    PGF GD G  G  G  G++GE G  G  G+ G  G
Sbjct: 1163 RIGIPGDKGDFGWPGVPGLPGFPGIRGISGLHGLPGTKGFPGSPGVDAHGDPGFPGPTGDRGDRGEANTLPGPVGVPGQKGERGTPGERGPAGSPGLQGFPGISPPSNISGSPGDVGAPGIFGLQGYQGPPGPPGPNALPGIKGDEGSSGAAGFPGQKGWVGDPGPQGQPGVLGLPGEKGPKGEQGF---MGNTGPSGAVGDRGPKGPKGD-------QGFPGAPGSMGSPGIPGIPQK-------IAVQPGTLGP------QGRRGLPGALGEIGPQGPPGDPGFRGAPGKAGPQGRGGVSAVPGFRGDQGPMGHQGPVGQEGEPGRPGSPGLPGMPG 1478          

HSP 14 Score: 83.1889 bits (204), Expect = 3.736e-15
Identity = 77/177 (43.50%), Postives = 97/177 (54.80%), Query Frame = 3
Query: 3990 IRGLQGRKGSTGLRGNIGIPGERGDKGIPGLQGKVGNKGVKGDIGDKGFSGNIGDKGYSGISGDKGSFGVKGDKGFQGDVGM---LGKSGLQGDRGQKGIIGFRGTRGIP---GSMGLPGEIGEKGDVGPSGI----GVKGLKGYQNAVGIKGRKGEKGLPGFPGRPGKVGDQGDKG 4490
            ++GL G  G+ G RG+ G+PG  G KG PG  G  G  G  G  G  GF G  G +G  G  G  G  G+ GD+G  GD G+   +G  GL GDRG  G+ G RG  G P   G  G+PG  G+KGD G  G+    G+ GLKG Q   G KG  G  G+PG  G PG+ G +G++G
Sbjct:  790 LKGLPGETGAPGFRGSQGMPGMPGLKGQPGFPGPSGQPGQSGPPGQHGFPGTPGREGPLGQPGSPGLGGLPGDRGEPGDPGVPGPVGMKGLSGDRGDAGMSGERGHPGSPGFKGMAGMPGIPGQKGDRGSPGMDGFQGMLGLKGRQGFPGTKGEAGFFGVPGLKGLPGEPGVKGNRG 966          

HSP 15 Score: 82.0333 bits (201), Expect = 8.461e-15
Identity = 69/170 (40.59%), Postives = 91/170 (53.53%), Query Frame = 3
Query: 4017 STGLRGNIGIPGERGDKGIPGLQGKVGNKGVKGDIGDKGFSGNIGDKGYSGISGDKGSFGVKGDKGFQGDVGMLGKSGLQGDRGQKGIIGFRGTRGIPGSMGLPGEIGEKGDVGPSGIGVKGLKGYQNAVGIKGRKGEKG-LP---GFPGRPGKVGDQGDKGPKGMKNMN 4514
            +  L G+ G+ GERG  GIPGL+G  G KG  GDIG  G +G  G +G  G+ G  G  G+ G +G QG+ G +G  G +GD G  G+ G  G  GI G  GL G  G KG  G  G+   G  G+    G +G +GE   LP   G PG+ G+ G  G++GP G   + 
Sbjct: 1091 TVDLPGSPGLKGERGITGIPGLKGFFGEKGAAGDIGFPGITGMAGAQGSPGLKGQTGFPGLTGLQGPQGEPGRIGIPGDKGDFGWPGVPGLPGFPGIRGISGLHGLPGTKGFPGSPGVDAHGDPGFPGPTGDRGDRGEANTLPGPVGVPGQKGERGTPGERGPAGSPGLQ 1260          

HSP 16 Score: 78.9518 bits (193), Expect = 6.181e-14
Identity = 70/183 (38.25%), Postives = 94/183 (51.37%), Query Frame = 3
Query: 4053 ERGDKGIPGLQGKVGNKGVKGDIGDKGFSG---NIGDKGYSGISGDKGSFGVKGDKG------FQGDVGMLGKSGLQGDRGQKGIIGFRGTRGIPGSMGLPGE--------------------IGEKGDVGPSGIGVKGLKGYQNAVGIKGRKGEKGLPGFPGRPGKV-GDQGDKGPKGMKNM 4511
            +RG+ G PG+ G VG KG+ GD GD G SG   + G  G+ G++G  G  G KGD+G      FQG +G+ G+ G  G +G+ G  G  G +G+PG  G+ G                      GEKGD GP  +G+KG  G +   G+ G  G  G PG PGRPG + G +GD G  G   +
Sbjct:  862 DRGEPGDPGVPGPVGMKGLSGDRGDAGMSGERGHPGSPGFKGMAGMPGIPGQKGDRGSPGMDGFQGMLGLKGRQGFPGTKGEAGFFGVPGLKGLPGEPGVKGNRGDRGPPGPPPLILPGMKDIKGEKGDEGP--MGLKGYLGLKGIQGMPGVPGVSGFPGLPGRPGFIKGVKGDIGVPGTPGL 1042          

HSP 17 Score: 78.9518 bits (193), Expect = 7.566e-14
Identity = 79/215 (36.74%), Postives = 97/215 (45.12%), Query Frame = 3
Query: 3996 GLQGRKGSTGLRGNIGIPGERGDKGIPGLQGKVGNKGVKGDIGDKGFSGNIGDKGYSGISGDKGSFGV---------------KGDKGFQGDVGMLGKSGLQGDRGQKGIIGFRGTRGIPGSMGLPGEIGEKGDVGPSGI----GVKGLKGYQNAVGIKGRKGEKGLPGFPGRPGKVG--------------------------DQGDKGPKGMK 4505
            GL G+ G  GL G  G PG RG +G+PG+ G  G  G  G  G  G SG  G  G+ G  G +G  G                 GD G  G VGM G SG +GD G  G  G  G+ G  G  G+PG  G+KGD G  G+    G+ GLKG Q   G KG  G  G+PG  G PG+ G                          ++GD+GP G+K
Sbjct:  783 GLPGQPGLKGLPGETGAPGFRGSQGMPGMPGLKGQPGFPGPSGQPGQSGPPGQHGFPGTPGREGPLGQPGSPGLGGLPGDRGEPGDPGVPGPVGMKGLSGDRGDAGMSGERGHPGSPGFKGMAGMPGIPGQKGDRGSPGMDGFQGMLGLKGRQGFPGTKGEAGFFGVPGLKGLPGEPGVKGNRGDRGPPGPPPLILPGMKDIKGEKGDEGPMGLK 997          

HSP 18 Score: 78.1814 bits (191), Expect = 1.134e-13
Identity = 76/195 (38.97%), Postives = 97/195 (49.74%), Query Frame = 3
Query: 3990 IRGLQGRKGSTGLRGNIGIPGE-------RGDKGIPGLQGKVGNKGVKGDIGDKGFSGNIGDKGYSGISGDKGSFGVKGDKGFQGDVG----MLGKSGLQGDRGQKGII---GFRGTRGIPGSMGLPGEIGEKGDVGPSGI-------GVKGLKGYQNA---VGIKGRKGEKGLPGFPGRPGKVGDQGDKGPKGM 4502
            ++G+QG  G  G+ G  G+PG        +GD G+PG  G  G  GV G  G  GF G  G +G  G  G  G FG  G  G  GD+G    + G  GL+G+RG  GI    GF G +G  G +G PG  G  G  G  G+       G+ GL+G Q     +GI G KG+ G PG PG PG  G +G  G  G+
Sbjct: 1002 LKGIQGMPGVPGVSGFPGLPGRPGFIKGVKGDIGVPGTPGLPGFPGVSGPPGITGFPGFTGSRGEKGTPGVAGVFGETGPTGDFGDIGDTVDLPGSPGLKGERGITGIPGLKGFFGEKGAAGDIGFPGITGMAGAQGSPGLKGQTGFPGLTGLQGPQGEPGRIGIPGDKGDFGWPGVPGLPGFPGIRGISGLHGL 1196          

HSP 19 Score: 71.633 bits (174), Expect = 9.854e-12
Identity = 71/199 (35.68%), Postives = 98/199 (49.25%), Query Frame = 3
Query: 3990 IRGLQGRKGSTGL---RGNIGIPGERGDKGIPGLQGKVGNKGVKGDIGDKGFSGNIGDKGYSGISGDKGSFGVKGDKGFQGDVGMLGK--------------------SGLQGDRGQKGIIGFRGTRGIPGSMGLPGEIGEKGDVGPSGI--GVKGLKGYQNAVGIKGRKGEKGLPGFPGRPGKVGDQGDKGPKGMKNM 4511
            ++GL G +G  G+   RG+ G PG +G  G+PG+ G+ G++G  G  G +G  G  G +G+ G  G+ G FGV G KG  G+ G+ G                      G +GD G  G+ G+ G +GI G  G+PG  G  G  G  G   GVKG  G     G+ G  G  G PG  G PG  G +G+KG  G+  +
Sbjct:  877 MKGLSGDRGDAGMSGERGHPGSPGFKGMAGMPGIPGQKGDRGSPGMDGFQGMLGLKGRQGFPGTKGEAGFFGVPGLKGLPGEPGVKGNRGDRGPPGPPPLILPGMKDIKGEKGDEGPMGLKGYLGLKGIQGMPGVPGVSGFPGLPGRPGFIKGVKGDIGVPGTPGLPGFPGVSGPPGITGFPGFTGSRGEKGTPGVAGV 1075          

HSP 20 Score: 69.707 bits (169), Expect = 3.890e-11
Identity = 82/220 (37.27%), Postives = 102/220 (46.36%), Query Frame = 3
Query: 3984 ESIRGLQGRKGSTGLRGNIGIPGERGDKGIPGLQGKVGNKG--------------VKGDIGDKGFSGNIGDKGYSGISGDKGSFGVKGDKGF-------------QGDVGMLGKSGL---QGDRGQKGIIGF------RGTRGIPGSMGLPGEIGEKGDVG--------PSGIGVKGLKGYQNAVGIKGRKGEKGLP---GFPGRPGKVGDQGDKGPKGM 4502
            + + GL+GR+G  G +G  G  G  G KG+PG  G  GN+G              +K   G+KG  G +G KGY G+ G +G  GV G  GF             +GD+G+ G  GL    G  G  GI GF      RG +G PG  G+ GE G  GD G        P   G+KG +G     G+KG  GEKG     GFPG  G  G QG  G KG 
Sbjct:  926 QGMLGLKGRQGFPGTKGEAGFFGVPGLKGLPGEPGVKGNRGDRGPPGPPPLILPGMKDIKGEKGDEGPMGLKGYLGLKGIQGMPGVPGVSGFPGLPGRPGFIKGVKGDIGVPGTPGLPGFPGVSGPPGITGFPGFTGSRGEKGTPGVAGVFGETGPTGDFGDIGDTVDLPGSPGLKGERGITGIPGLKGFFGEKGAAGDIGFPGITGMAGAQGSPGLKGQ 1145          

HSP 21 Score: 65.855 bits (159), Expect = 5.809e-10
Identity = 72/231 (31.17%), Postives = 100/231 (43.29%), Query Frame = 3
Query: 3990 IRGLQGRKGSTGLRGNIGIPGERGDKGIPGLQGKVGNKGVKGDI-----------------------------------GDKGFSGNIGDKGYSGISGDKGSFGVKGDKGFQGDVGMLGKSGLQGDRGQKGIIGFRGTRGIPGSMGLPGEIG---------------EKGDVG-PSGIGVKGLKGYQNAVGIKGRKGEKGLPGF------PGRPGKVGDQGDKGPKGMKNM 4511
            +RG+ G  G++G +G  G PG+ G +G PG  G +G +G KG                                     G +G +G  G  G  G+ G+ G+ G +G +G  G  G+ G+ G  G  GQ G  G  G  G PG+ G  G +G               E GD G P  +G+KGL G +   G+ G +G  G PGF      PG PG+ GD+G  G  G + M
Sbjct:  698 VRGMPGFPGASGEQGLKGFPGDPGREGFPGPPGFMGPRGSKGTTGLPGPDGPPGPIGLPGPAGPPGDRGIPGEVLGAQPGTRGDAGLPGQPGLKGLPGETGAPGFRGSQGMPGMPGLKGQPGFPGPSGQPGQSGPPGQHGFPGTPGREGPLGQPGSPGLGGLPGDRGEPGDPGVPGPVGMKGLSGDRGDAGMSGERGHPGSPGFKGMAGMPGIPGQKGDRGSPGMDGFQGM 928          

HSP 22 Score: 60.8474 bits (146), Expect = 2.082e-8
Identity = 78/224 (34.82%), Postives = 98/224 (43.75%), Query Frame = 3
Query: 4002 QGRKGSTGLRGNIGIPGERGDKGIPGLQGKVGN--------KGVKGDIGDKGFSGNIGDKG-YSGISGDKGS-------------------FGVKGDKGFQGDVGMLGKSGLQGDRGQKGIIG----------FRGTRGIPGSMGLPG---EIGEKGDVGPSGI-GVKGLKGYQNAVGIKG---------------RKGEKGLPGFPGRPGKVGDQGDKGPKGM 4502
            +G +G  G +G  G PG RG+ G PG  G  G         +G+ G++G KGFSG  G    Y G  G  G                    FG+KG    +G VG  G SG  G RGQKG  G            G  G+PG  G PG   E+G+KGD G  G+ G+ G  G++ A G+ G                KGE+G PG PG  G  GD G  G  G+
Sbjct:  357 KGARGDPGFQGAHGEPGSRGEPGEPGTAGPPGPSVGDEDSMRGLPGEMGPKGFSGEPGSPARYLGPPGADGRPGPQGVPGPAGPPGPDGFLFGLKGS---EGRVGYPGPSGFPGTRGQKGWKGEAGDCQCGQVIGGLPGLPGPKGFPGVNGELGKKGDQGDPGLHGIPGFPGFKGAPGVAGAPGPKGIKGDSRTITTKGERGQPGIPGVHGMKGDDGVPGRDGL 577          

HSP 23 Score: 59.6918 bits (143), Expect = 5.438e-8
Identity = 65/184 (35.33%), Postives = 78/184 (42.39%), Query Frame = 3
Query: 3984 ESIRGLQGRKGSTGLRGNIGIPGERGDKGIPG----------------------LQGKVGNKGVKGDIGDKGFSGNIGDKGYSGISGDK-------GSFGVKGDKGFQGDVGMLGKSGLQGDRGQKGIIGFRGTRGIPGSMGLPGEIGEKGDVGPSGIGVKGLKGYQNAVGIKGRKGEKGLPGF 4448
            +S+RGL G  G  G  G  G P      G PG                      L G  G++G  G  G  GF G  G KG+ G +GD        G  G+ G KGF G  G LGK G QGD G  GI GF G +G PG  G PG               KG+KG    +  KG +G+ G+PG 
Sbjct:  395 DSMRGLPGEMGPKGFSGEPGSPARY--LGPPGADGRPGPQGVPGPAGPPGPDGFLFGLKGSEGRVGYPGPSGFPGTRGQKGWKGEAGDCQCGQVIGGLPGLPGPKGFPGVNGELGKKGDQGDPGLHGIPGFPGFKGAPGVAGAPGP--------------KGIKGDSRTITTKGERGQPGIPGV 562          

HSP 24 Score: 58.5362 bits (140), Expect = 1.023e-7
Identity = 64/178 (35.96%), Postives = 79/178 (44.38%), Query Frame = 3
Query: 3990 IRGLQGRKGSTGLRGNIGIPGERGDKG----------------IPGLQGKVGNKGVKGDIGDKGFSGNIGDKGYSGISGDKGSFGVKGDKGFQGDVGMLGKSGLQGDRGQKGIIGFRGTRGIPGSMGLPGEIGEKGDVGPSGIGVKGLKGYQNAVGIKGRKGEKGLPGFPGRPGKVGD 4475
            + GL+G +G  G  G  G PG RG KG                +PGL G  G  GV G++G KG  G+ G  G  G  G KG+ GV G  G +G  G       +G+RGQ GI G  G +   G  G+PG           G+            GIKG  G+ GLPG PG  G  GD
Sbjct:  447 LFGLKGSEGRVGYPGPSGFPGTRGQKGWKGEAGDCQCGQVIGGLPGLPGPKGFPGVNGELGKKGDQGDPGLHGIPGFPGFKGAPGVAGAPGPKGIKGDSRTITTKGERGQPGIPGVHGMK---GDDGVPGR---------DGLDGFPGLPGPPGDGIKGPPGDAGLPGVPGTKGFPGD 612          

HSP 25 Score: 57.3806 bits (137), Expect = 2.670e-7
Identity = 53/140 (37.86%), Postives = 73/140 (52.14%), Query Frame = 3
Query: 4050 GERGDKGIPGL-----QGKVGNKGVKGDIGDKGFSGNIGDKGYSGISGDKGSFGVKGDKGFQGDVGMLGKSGLQGD----RGQKGIIGFRGTRGIPGSMGLPGEIGEKGDVGPSGIGVKGLKGYQNAVGIKGRKGEKGLP 4442
            G+ G++GIPG+     +G +G  G++G  G  G  G +G KG  G+ G +G  G +G KG +G+ G  G S         +G +G  GF+G  G PGS G PGE G  G  GPS      ++G    +G KG  GE G P
Sbjct:  277 GDEGEQGIPGVISKGEEGIMGFPGIRGFPGLDGEKGVVGQKGSRGLDGFQGPSGPRGPKGERGEQGPPGPSVYSPHPSLAKGARGDPGFQGAHGEPGSRGEPGEPGTAGPPGPSVGDEDSMRGLPGEMGPKGFSGEPGSP 416          
BLAST of Collagen IV NC1 domain-containing protein vs. Ensembl Mouse
Match: Col4a1 (collagen, type IV, alpha 1 [Source:MGI Symbol;Acc:MGI:88454])

HSP 1 Score: 241.121 bits (614), Expect = 1.976e-63
Identity = 417/1241 (33.60%), Postives = 517/1241 (41.66%), Query Frame = 3
Query:  240 YQGVSGDKGDVGQFGMPGPKGY-----KGFTGAIGPQGRKGERGIPGSPGY-----PGKMGEMGFPGIRGDIGEKGLTGCDGQQGDFGNPGMNGLVGRTGQPGERGDDGDRGLSIIPKYGLKGNKGSRGLLGRYGRKGEKGFK--------------------GIKGYSGIFGIKGNKGYVGPMGRRGPKG------------------DSLGTVIIQSE----------------KGSKGDKGLKGQSGIPC--KGFQIEGRMYGRVGSDGPIGDKGIKGEKGLMGEIGQSGIDGARGLNGEKGLPGEAGPRGE-------RGDRGNPGFPGDPGASGADGTRGRQGERG---PKGVHGISGADGPRG---------SRGDKGP-----------------------------------SGSLLSCPGRKGEKGFFGIPGIKGDIGNKGYQGHDGDIGEIGFKGE--------KGYEGPLGPSCSEVEQGFRGTKGESGFPGLRGAKGQRGYSGNKGI-----KGKPNFGTGINNPGETGSYGNLGVPGEKGN------KGFIGDTG-----------------------------------------EKGFSGTGKQGPEGPRGDKGDDGVNGQVGMIGMPGIKGDKGSTYPICPFCEKGYKGIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEGRMGLLGSKGRQGYKGGKGFSGSMGDAGEIGYVTISGTT-IPGVKGEKGNQGPKGNKGEFGEAGSRGRKGYSGLKGFKGLIGERGTSFSSGDPGDKGLRGENGKDGVSFAGIPGEKGLKGDKGNRGILGDVGSLSNCATRPITSKGFKGPQGAKGTSGSPGSAGKTGIVGNKGENGYPGKRGIDGDNGIPGSKGEEGETGIKGH--AGRPGNLGKSGLQGLRGEYGVKGDLGIQGIPGRKGVMGDPGPNGYAMIGSKGDKGIKGLPGIYGAKGDKGRPGYIGIPGFKGETGLIGRSGLKGDQGEIGEKGIKGFTFISNNPGDRGLLGNKGLKGFPGELGNKGQVGVCTVRGDQGLRGYSGLIGDMGMKGEQGSKGIVGDYGAASRSGIMGRTGKIGNQGLPGDQXXXXXXXXXXXXXXXXYIGIPGFEGDRGEKGNKGFPGFPGDIGQPGRLGNPGISTEGVXXXXXXXXXXXXXXXXXXXXXXXXXXKQGDSGISIPGRQGIKGEDGTIGLPGEMGEPGPRGDFGQKGNIGITGEFGLQGNRG 3413
            +QG  GDKG+ G  G PG  G      KG     G +G+KGE G PG PGY     PGK G  G PG  G+ GE+G  G  G   D G PG+ G  G  G+ GE G  G  G ++I    L G KG RG  G  G +GE G K                    G  G+ G  G KG++G+ G +   GP G                   + G V  Q                   G  G KG KG+S + C  +G +      G  G  G  G  G KG++GL G  G  G+ G +G  G  G PG  G  GE       +GD+G+PGFPG PG  G  GT GR G  G   PKG  G  G  G RG         SRGD GP                                   +G ++  PG  G  G  G PG  G  G++G+ G  G  G  G KG          G  GP G      E G  G+ G  GF GL G  G +G  G  GI     KG+P        PGE GS G  GVPGE+G       +G  GD G                                         EKGF G       GP+GDKG  G+ G  G  G+PG+ G +G+  P  P    G+ G                               +G MG++G+ G+ G  G  G  G  G+ G+ G    SG    PG KG+KG+ G  G  G          KG  G +G KG IG  G   S GDPG  G+ G++G+     AG PG+ G KGD G  G  G              S G  GP+G+ G  G PGS G+ G+       G PG +G+ G  G  G+KGE+G++G+ G    GRPG+ G  GL G  G  G KG+ G  G PG   + G PGP G     S G+ G  G PG+ G KGDKG PG  G+PG KGE GL G  G  G  G+ GE G  G    +   G++G+ G +G  GFPG  G+KG       +G+ G  G +G  G  G+KGEQG  G  G  G     G  G       +G  GD+G  G  G  G  G  G  G PG  G +G+KGN+G+PG PG    PG  G+PG                                          G  GI G  G  G  G+MG PG  G  GQKG  G+ G  G QG++G
Sbjct:  224 FQGPKGDKGEQGVSGPPGVPGQAQVKEKGDFAPTGEKGQKGEPGFPGVPGYGEKGEPGKQGPRGKPGKDGEKGERGSPGIPG---DSGYPGLPGRQGPQGEKGEAGLPGPPG-TVIGTMPL-GEKGDRGYPGAPGLRGEPGPKGFPGTPGQPGPPGFPTPGQAGAPGFPGERGEKGDQGFPG-VSLPGPSGRDGAPGPPGPPGPPGQPGHTNGIVECQPGPPGDQGPPGTPGQPGLTGEVGQKGQKGESCLACDTEGLRGPPGPQGPPGEIGFPGQPGAKGDRGLPGRDGLEGLPGPQGSPGLIGQPGAKGEPGEIFFDMRLKGDKGDPGFPGQPGMPGRAGTPGRDGHPGLPGPKGSPGSIGLKGERGPPGGVGFPGSRGDIGPPGPPGVGPIGPVGEKGQAGFPGGPGSPGLPGPKGEAGKVVPLPGPPGAAGLPGSPGFPGPQGDRGFPGTPGRPGIPGEKGAVGQPGIGFPGLPGPKGVDGLPGEIGRPGSPGRPGFNGLPGNPGPQGQKGEPGIGLPGLKGQPGLPGIPGTPGEKGSIGGPGVPGEQGLTGPPGLQGIRGDPGPPGVQGPAGPPGVPGIGPPGAMGPPGGQGPPGSSGPPGIKGEKGFPGFPGLDMPGPKGDKGSQGLPGLTGQSGLPGLPGQQGT--PGVP----GFPG------------------------------SKGEMGVMGTPGQPGSPGPAGTPGLPGEKGDHGLPGSSGPRGDPGFKGDKGDVGLPGMPGSMEHVDMGSMKGQKGDQGEKGQIGPTGDKGSRGDPGTPGVPGKDGQ-----AGHPGQPGPKGDPGLSGTPG--------------SPGLPGPKGSVGGMGLPGSPGEKGV------PGIPGSQGVPGSPGEKGAKGEKGQSGLPGIGIPGRPGDKGDQGLAGFPGSPGEKGEKGSAGTPG---MPGSPGPRG-----SPGNIGHPGSPGLPGEKGDKGLPGLDGVPGVKGEAGLPGTPGPTGPAGQKGEPGSDGIPGSAGEKGEQGVPG-RGFPGFPGSKGDKGS------KGEVGFPGLAGSPGIPGVKGEQGFMGPPGPQGQPGLPGTPGHP----VEGPKGDRGPQGQPGLPGHPGPMGPPGFPGINGPKGDKGNQGWPGAPG---VPGPKGDPGFQ----------------------------------------GMPGIGGSPGITGSKGDMGLPGVPGFQGQKGLPGLQGVKGDQGDQG 1335          

HSP 2 Score: 216.468 bits (550), Expect = 7.200e-56
Identity = 349/942 (37.05%), Postives = 422/942 (44.80%), Query Frame = 3
Query:  219 GFPGPRGYQGVSGDKGDVGQFGMPGPKGYKGFTGAIGPQGRKGE-------RGIPGSPGYPGKMGEMGFPGIRGDIGEKGLTGCDGQQGDFGNPGMNGLVGRTGQPGERGDDGDRGLSIIPKYGLKGNKGSRGLLGRYGRKG------EKG-FKGIKGYSGIFGIKGNKGYVGPMGRRGPKGDSLGTVIIQSEKGSKGDKGLKGQSGIP-CKGFQIEGRMYGRVGSDGPIGDKGIKGEKGLMGEIGQSGIDGARGLNGEKGLPGEAGPRGERGDRGNPGFPGDPGASGADGTRGRQGERGPKGVHGISGADGPRGS-----------------------RGDKG-PSGSLLSCPGRKGEKGFFGIPGIKGDIGNKGYQGHDGDIGEIGFKGEKGYEGPLGPSCSEVEQGFRGTKGESGFPGLRGAKGQRGYSGNKGIKGKPNFGTGINNPGETGSYGNLGVPGEKGN---------KGFIGDTGEKGFSGTGKQGPEGPRGDKGDDGVNGQVGMIGMPGIKGDKGSTYPICPFCEKGYKGIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEGRMGLLGSKGRQGYKGGKGFSGSMGDAGEIGYVTISGTT-IPGVKGEKGNQGPKGNKGE--FGEAGSRGRKGYSGLKGFKGLIGERGTSFSSGDPGDKGLRGENGKDGVSFAGIPGEKGLKGDKGNRGILGDVGSLSNCATRPITSKGFKGPQGAKGTSGSPGSAGKTGIVGNKGENGYPGKRGIDGDNGIPGSKGEEGETGIKGHAGRPGNLGKSGLQGLRGEYGVKGDLGIQGIPGRKGVMG------------DPGPNGYAMIGSKGDKGIKGLPGIYGAKGDKGRPGYIGIPGFKGETGLIGRSGLKGDQGEIGEKGIKGFTFISNNPGDRGLLGNKGLKGFPGELGNKGQVGVCTVRGDQGLRGY 2855
            GFPG  G +G  G  G  G  G+PGP+G  G  G  G +G  GE       +G  G PG+PG+ G  G  G  G  G  GL G  G  G  G  G  G  G  G PG RGD G  G   +   G  G KG  G  G  G  G      E G    + G  G  G+ G+ G+ GP G RG  G + G   I  EKG+ G  G+ G  G+P  KG        GR GS G  G  G+ G  G  G+ G+ GI G  GL G+ GLPG  G  GE+G  G PG PG+ G +G  G +G +G+ GP GV G +G  G  G                        +G+KG P    L  PG KG+KG  G+PG+ G  G  G  G  G  G  GF G KG  G +G        G  G+ G +G PGL G KG  G  G+ G +G P F          G  G++G+PG  G+         KG  GD GEKG    G  G +G RGD G  GV G+ G  G PG  G KG                                             D G  G  GS G  G KG  G  G  G  GE G   I G+  +PG  GEKG +G KG  G    G  G  G KG  GL GF G  GE+G   S+G PG  G  G  G  G    G PG  GL G+KG++G+                  G  G  G KG +G PG+ G TG  G KGE          G +GIPGS GE+GE G+ G  G PG  G  G +G +GE G  G  G  GIPG KG  G             PG  G+ + G KGD+G +G PG+ G  G  G PG+ GI G KG+ G  G  G  G  G  G+ G +G   I  +PG  G  G+ GL G PG  G KG  G+  V+GDQG +G 
Sbjct:  489 GFPGQPGAKGDRGLPGRDGLEGLPGPQGSPGLIGQPGAKGEPGEIFFDMRLKGDKGDPGFPGQPGMPGRAGTPGRDGHPGLPGPKGSPGSIGLKGERGPPGGVGFPGSRGDIGPPGPPGVGPIGPVGEKGQAGFPGGPGSPGLPGPKGEAGKVVPLPGPPGAAGLPGSPGFPGPQGDRGFPG-TPGRPGIPGEKGAVGQPGI-GFPGLPGPKGVDGLPGEIGRPGSPGRPGFNGLPGNPGPQGQKGEPGI-GLPGLKGQPGLPGIPGTPGEKGSIGGPGVPGEQGLTGPPGLQGIRGDPGPPGVQGPAGPPGVPGIGPPGAMGPPGGQGPPGSSGPPGIKGEKGFPGFPGLDMPGPKGDKGSQGLPGLTGQSGLPGLPGQQGTPGVPGFPGSKGEMGVMG------TPGQPGSPGPAGTPGLPGEKGDHGLPGSSGPRGDPGF---------KGDKGDVGLPGMPGSMEHVDMGSMKGQKGDQGEKGQ--IGPTGDKGSRGDPGTPGVPGKDGQAGHPGQPGPKG---------------------------------------------DPGLSGTPGSPGLPGPKGSVGGMGLPGSPGEKGVPGIPGSQGVPGSPGEKGAKGEKGQSGLPGIGIPGRPGDKGDQGLAGFPGSPGEKGEKGSAGTPGMPGSPGPRGSPG--NIGHPGSPGLPGEKGDKGL-----------------PGLDGVPGVKGEAGLPGTPGPTGPAGQKGE---------PGSDGIPGSAGEKGEQGVPGR-GFPGFPGSKGDKGSKGEVGFPGLAGSPGIPGVKGEQGFMGPPGPQGQPGLPGTPGHPVEGPKGDRGPQGQPGLPGHPGPMGPPGFPGINGPKGDKGNQGWPGAPGVPGPKGDPGFQGMPGIGGSPGITGSKGDMGLPGVPGFQGQKGLPGLQGVKGDQGDQGV 1336          

HSP 3 Score: 206.068 bits (523), Expect = 1.312e-52
Identity = 337/958 (35.18%), Postives = 410/958 (42.80%), Query Frame = 3
Query:  183 DKCQCFGNKGRQGFPGPRGYQGVSGDKGDVGQFGMPGPKGYKGFTGAIGPQGRKGERGIPGSPGYPGKMGEMGFPGIRGDIGEKGL-TGCDGQQGDFGNPGMNGLVGRTGQPGERGDDGDRGLSIIP-KYGLKGNKGSRGLLGRYGRKG-----------------EKG----------------------FKGIKGYSGIFGIKGNKGYVGPMGRRGPKGDSLGTVIIQSEKGSKGDKGLKGQSGIP-CKGFQIEGRMYGRVGSDGPIGDKGIKGEKGLMGEIGQSGIDGARGLNGEKGLPGEAGPRGERGDRGNPGFPGDPGASGADGTRGRQGERGPKGVHGISGADGPRGS-----------------------RGDKG-PSGSLLSCPGRKGEKGFFGIPGIKGDIGNKGYQGHDGDIGEIGFKGEKGYEGPLGPSCSEVEQGFRGTKGESGFPGLRGAKGQRGYSGNKGIKGKPNFGTGINNPGETGSYGNLGVPGEKGN---------KGFIGDTGEKGFSGTGKQGPEGPRGDKGDDGVNGQVGMIGMPGIKGDKGSTYPICPFCEKGYKGIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEGRMGLLGSKGRQGYKGGKGFSGSMGDAGEIGYVTISGTT-IPGVKGEKGNQGPKGNKGE--FGEAGSRGRKGYSGLKGFKGLIGERGTSFSSGDPGDKGLRGENGKDG-VSFAGIPGEKGLKGDKGNRGILGDVGSLSNCATRPITSKGFKGPQGAKGTSGSPGSAGKTGIVGNKGENGYPGKRGIDGDNGIPGSKGEEGETGIKGHAGRPGNLGKSGLQGLRGEYGVKGDLGIQGIPGR--KGVMGDPGPN----------------GYAMIGSKGDKGIKGLPGIYGAKGDKGRPGYIGIPGFKGETGLIGRS---GLKGDQGEIGEKGIKGFTFISNNPGDRGL 2756
            + C     +G +G        G  G  G++G  G PG KG +G        GR G  G+PG  G PG +G+   PG +G+ GE        G +GD G PG  G+ GR G PG  G  G  G    P   GLKG +G  G +G  G +G                 EKG                         + G  G  G+ G+ G+ GP G RG  G + G   I  EKG+ G  G+ G  G+P  KG        GR GS G  G  G+ G  G  G+ G+ GI G  GL G+ GLPG  G  GE+G  G PG PG+ G +G  G +G +G+ GP GV G +G  G  G                        +G+KG P    L  PG KG+KG  G+PG+ G  G  G  G  G  G  GF G KG  G +G        G  G+ G +G PGL G KG  G  G+ G +G P F          G  G++G+PG  G+         KG  GD GEKG    G  G +G RGD G  GV G+ G  G PG  G KG                                             D G  G  GS G  G KG  G  G  G  GE G   I G+  +PG  GEKG +G KG  G    G  G  G KG  GL GF G  GE+G   S+G PG  G  G  G  G +   G PG  G KGDKG  G+ G  G             G  GP G  G  G PGS G  G  G KGE G PG RG  G  G  G KG +GE G  G AG PG  G  G QG  G  G +G  G+ G PG   +G  GD GP                    + G KGDKG +G PG  G  G KG PG+ G+PG  G  G+ G     GL G  G  G+KG+ G   +  + GD+G+
Sbjct:  465 ESCLACDTEGLRGP------PGPQGPPGEIGFPGQPGAKGDRGLP------GRDGLEGLPGPQGSPGLIGQ---PGAKGEPGEIFFDMRLKGDKGDPGFPGQPGMPGRAGTPGRDGHPGLPGPKGSPGSIGLKGERGPPGGVGFPGSRGDIGPPGPPGVGPIGPVGEKGQAGFPGGPGSPGLPGPKGEAGKVVPLPGPPGAAGLPGSPGFPGPQGDRGFPG-TPGRPGIPGEKGAVGQPGI-GFPGLPGPKGVDGLPGEIGRPGSPGRPGFNGLPGNPGPQGQKGEPGI-GLPGLKGQPGLPGIPGTPGEKGSIGGPGVPGEQGLTGPPGLQGIRGDPGPPGVQGPAGPPGVPGIGPPGAMGPPGGQGPPGSSGPPGIKGEKGFPGFPGLDMPGPKGDKGSQGLPGLTGQSGLPGLPGQQGTPGVPGFPGSKGEMGVMG------TPGQPGSPGPAGTPGLPGEKGDHGLPGSSGPRGDPGF---------KGDKGDVGLPGMPGSMEHVDMGSMKGQKGDQGEKGQ--IGPTGDKGSRGDPGTPGVPGKDGQAGHPGQPGPKG---------------------------------------------DPGLSGTPGSPGLPGPKGSVGGMGLPGSPGEKGVPGIPGSQGVPGSPGEKGAKGEKGQSGLPGIGIPGRPGDKGDQGLAGFPGSPGEKGEKGSAGTPGMPGSPGPRGSPGNIGHPGSPGLPGEKGDKGLPGLDGVPGVKGEAGL-----PGTPGPTGPAGQKGEPGSDGIPGSAGEKGEQGVPG-RGFPGFPGSKGDKGSKGEVGFPGLAGSPGIPGVKGEQGFMGPPGPQGQPGLPGTPGHPVEGPKGDRGPQGQPGLPGHPGPMGPPGFPGINGPKGDKGNQGWPGAPGVPGPKGDPGFQGMPGIGGSPGITGSKGDMGLPGVPGFQGQKGLPGLQGVKGDQGDQGV 1336          

HSP 4 Score: 197.978 bits (502), Expect = 3.701e-50
Identity = 329/920 (35.76%), Postives = 403/920 (43.80%), Query Frame = 3
Query: 1008 GFPGDPGASGADGTRGRQGERGPKGVHGISGADGPRGSRGDKGPSGSLLSCPGRKGEKGFFGIPGIKGDIGNKGYQGHDGDIGEIGFKGEKGYEGPLGPSCSEVEQGFRG-----------------TKGESGFPGLRGAKGQRGYSGNKG----IKGKPNFGTGINNPGETGSYGNLGVPGEKGNKGFIGDTGEKGFSGTGKQGPEGPRGDKGDDGVNGQVGMIGMPGIKGDKGSTYPICPFCEKGYKGIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEGRMGLLGSKGRQGYKGGKGFSGSMGDAG-----------------------------------------EIGYVTISGTTIPGVKGEKGNQGPKGNKGEFGEAGSRGRKGYSGLKGFKGLIGERGTSFSSGDPGDKG------LRGENGKDGVSFAGIP-GEKGLKGDKGNRGILGDVGSLSNCATRPITSKGFKGPQGAKGTSGSPGSAGKTGIVGNKGENGYPGKRGIDGDNGIPGSKGEEGETGIKGHAGRPGNLGKSGLQGLRGEYGVKGDLGIQGIPGRKGVMGDPGPNGYAMIGSKGDKGIKGLPGIYGAKGDKGRPGYIGIPGFKGETGLIGRSGLKGDQGEIGEKGIKGFTFISNNPGDRGLLGNKGLKGFPGELGNKGQVGVCTVRGDQGLRGYSGLIGDMGMKGEQGSKGIVGDYGAASRSGIMGRTGKIGNQGLPGDQXXXXXXXXXXXXXXXXYIGIPGFEGDRGEKGNKGF------PGFPGDIGQPGRLG------------NPGISTEGVXXXXXXXXXXXXXXXXXXXXXXXXXXKQGDSGISIPGRQGIKGEDGTIGLPGEMGEPGPRGDFGQKGNIGITGEFGLQGNRGDDGL------KGDDGIPGLNGPRGFIGDIGF 3488
            GFPG PGA G  G  GR G  G  G  G  G  G  G++G+ G     +   G KG+ GF G PG+ G  G  G  GH G  G  G  G  G +G  GP       G RG                  KG++GFPG  G+ G  G  G  G    + G P       +PG  G  G+ G PG  G  G  G+ G  G  G G  G  GP   KG DG+ G++G  G PG  G  G      P  +KG  GI          G  G+ G  G  G  G PG++G +G  G  G QG  G  G  G  GD G                                         E G+    G  +PG KG+KG+QG  G  G+ G  G  G++G  G+ GF G  GE G   + G PG  G      L GE G  G+  +  P G+ G KGDKG+ G+ G  GS+ +      + KG KG QG KG        G TG  G++G+ G PG  G DG  G PG  G +G+ G+ G  G PG  G  G  G  G  G  G+ G+ GIPG +GV G PG       G+KG+KG  GLPGI             GIPG  G+ G  G +G  G  GE GEKG  G   +  +PG RG  GN G  G PG  G KG  G+       GL G  G+ G+ G+ G  G  G  G  G     GI G  G+ G QG+PG                 G+ G PG +GD+G KG  GF      PG PG  G+ G +G             PG   EG  GD G  G PG  G PG  G  G PG  G            KG+ G  G PG  G PGP+GD G +G  GI G  G+ G++GD GL      +G  G+PGL G +G  GD G 
Sbjct:  489 GFPGQPGAKGDRGLPGRDGLEGLPGPQGSPGLIGQPGAKGEPGEIFFDMRLKGDKGDPGFPGQPGMPGRAGTPGRDGHPGLPGPKGSPGSIGLKGERGPPGGVGFPGSRGDIGPPGPPGVGPIGPVGEKGQAGFPGGPGSPGLPGPKGEAGKVVPLPGPPGAAGLPGSPGFPGPQGDRGFPGTPGRPGIPGEKGAVGQPGIGFPGLPGP---KGVDGLPGEIGRPGSPGRPGFNGLPGNPGPQGQKGEPGI----------GLPGLKGQPGLPGIPGTPGEKGSIGGPGVPGEQGLTGPPGLQGIRGDPGPPGVQGPAGPPGVPGIGPPGAMGPPGGQGPPGSSGPPGIKGEKGFPGFPGLDMPGPKGDKGSQGLPGLTGQSGLPGLPGQQGTPGVPGFPGSKGEMGVMGTPGQPGSPGPAGTPGLPGEKGDHGLPGSSGPRGDPGFKGDKGDVGLPGMPGSMEHVDMG--SMKGQKGDQGEKG------QIGPTGDKGSRGDPGTPGVPGKDGQAGHPGQPGPKGDPGLSGTPGSPGLPGPKGSVGGMGLPGSPGEKGVPGIPGSQGVPGSPG-----EKGAKGEKGQSGLPGI-------------GIPGRPGDKGDQGLAGFPGSPGEKGEKGSAGTPGMPGSPGPRGSPGNIGHPGSPGLPGEKGDKGL------PGLDGVPGVKGEAGLPGTPGPTGPAGQKGEPGSDGIPGSAGEKGEQGVPGR----------------GFPGFPGSKGDKGSKGEVGFPGLAGSPGIPGVKGEQGFMGPPGPQGQPGLPGTPGHPVEGPKGDRGPQGQPGLPGHPGPMGPPGFPGINGP-----------KGDKGNQGWPGAPGVPGPKGDPGFQGMPGIGGSPGITGSKGDMGLPGVPGFQGQKGLPGLQGVKGDQGDQGV 1336          

HSP 5 Score: 196.052 bits (497), Expect = 1.414e-49
Identity = 274/776 (35.31%), Postives = 351/776 (45.23%), Query Frame = 3
Query:  219 GFPGPRGYQGVSGDKGDVGQFGMPGPKGYKGFTGAIGPQGRKGERGIPGSPGYPGKMGEMGFPGIRGDIGEKGLTG---CDGQQGDFGNPGMNGLVGRTGQPGE-----------------------------------RGDDGDRGLSIIPKYGLKGNKGSRGLLGRYGRKGEKGFKGIKGYSGIFGIKGNKGYVGPMGRRGPKGDSLGTVIIQSEKGSKGDKGLKGQSGIPCKGFQIEGRMYGRVGSDGPIGDKGIKGEKGLMGEIGQSGIDGARGLNGEKGLPGEAGPRGERGDRGNPGFPGDPGASGADGTRGRQGERGPKGVHGISGADGPRGSRGDKGPSGSL--LSCPGRKGEKGFFGIPGIKGDIGNKGYQGHDGDIGEIGFKGEKGYEGPLGPSCSEVEQGFRGTKGESGFPGLRGAKGQRGYSGNKGIKGKPNFGTGINNPGETGSYGNLGVPGEKGNKGFIGDTGEKGFSG----TGKQGPEGPRGDKGDDGVNGQVGMIGMPGIKGDKGSTYPICPFC--EKGYKGIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEGRMGLLGSKGRQGYKGGKGFSGSMGDAGEIGYVTISGTTIPGVKGEKGNQ---------------------GPKGNKGEFGEAGSRGRKGYSGLKGFKGLIGERGTSFSSGDPGDKGLRGENGKDGVSFAGIPGEKGLKGDKGNRGILGDVGSLSNCATRPITSKGFKGPQGAKGTSGSPGSAGKTGIVGNKGENGYPGKRGIDGD 2345
            GFPG  G +GV G  G++G+ G PG  G+ G  G  GPQG+KGE GI    G PG  G+ G PGI G  GEKG  G     G+QG  G PG+ G+ G  G PG                                    +G+ G  G   +   G KG+KGS+GL G  G+ G  G  G +G  G+ G  G+KG +G MG  G  G S G        G KGD GL G SG             G  G  G  GD G+ G  G M  +    + G +G  GEKG   + GP G++G RG+PG PG PG    DG  G  G+ GPKG  G+SG  G   S G  GP GS+  +  PG  GEKG  GIPG +G  G+ G +G  G+ G+ G  G  G  G           G +G +G +GFPG  G KG++G +G  G+ G P       +PG  G  G+ G+PGEKG+KG  G  G  G  G     G  GP GP G KG+ G +G  G  G  G +G  G  +P  P    +KG KG                              + G  GL GS G  G KG +GF G  G  G+ G     G  + G KG++G Q                     GPKG+KG  G  G+ G  G  G  GF+G+ G  G+   +G  GD GL G  G  G    G+PG +G+KGD+G++G+ G  G                     KG  G PG  G  G+ G +G  G  G++G+ G 
Sbjct:  690 GFPGLPGPKGVDGLPGEIGRPGSPGRPGFNGLPGNPGPQGQKGEPGI----GLPGLKGQPGLPGIPGTPGEKGSIGGPGVPGEQGLTGPPGLQGIRGDPGPPGVQGPAGPPGVPGIGPPGAMGPPGGQGPPGSSGPPGIKGEKGFPGFPGLDMPGPKGDKGSQGLPGLTGQSGLPGLPGQQGTPGVPGFPGSKGEMGVMGTPGQPG-SPGPAGTPGLPGEKGDHGLPGSSGP-----------RGDPGFKGDKGDVGLPGMPGSMEHVDMGSMKGQKGDQGEKG---QIGPTGDKGSRGDPGTPGVPGK---DGQAGHPGQPGPKGDPGLSGTPG---SPGLPGPKGSVGGMGLPGSPGEKGVPGIPGSQGVPGSPGEKGAKGEKGQSGLPG-IGIPG---------RPGDKGDQGLAGFPGSPGEKGEKGSAGTPGMPGSPGP---RGSPGNIGHPGSPGLPGEKGDKGLPGLDGVPGVKGEAGLPGTPGPTGPAGQKGEPGSDGIPGSAGEKGEQGVPGRGFPGFPGSKGDKGSKG------------------------------EVGFPGLAGSPGIPGVKGEQGFMGPPGPQGQPGLPGTPGHPVEGPKGDRGPQGQPGLPGHPGPMGPPGFPGINGPKGDKGNQGWPGAPGVPGPKGDPGFQGMPGIGGSPGITGSKGDMGLPGVPGFQGQK--GLPGLQGVKGDQGDQGVPGPKGLQGPPGPPGPYDV-------IKGEPGLPGPEGPPGLKGLQGPPGPKGQQGVTGS 1388          

HSP 6 Score: 185.652 bits (470), Expect = 2.180e-46
Identity = 274/727 (37.69%), Postives = 346/727 (47.59%), Query Frame = 3
Query: 1791 GRMGLLGSKGRQGYKGGKGFSGSMGDAG---EIGYVTISGTTIPGVKGEKGNQGPKGNKGEFGEAGSRGRKGYSGLKGFKGLIGERG-----TSFSSGDPGDKGLRGENGKDG-VSFAGIPGEKGLKGDKGNRGILGDVGSLSNCATRPITSKGFKGPQGAKGTSGSPGSAGKTGIVGNKGENGYPGKRGIDGDNGIPGSKGEEGETGIKGHAGRPGNLGKSGLQGLRGEYGVKGDLGIQGIPGRKGVMGDPGPNGYAMIGSKGDKGIKGLPGIYGAKGD---KGRPGYIGIPGFKGETGLI---GRSGLKGDQGEIGEKGIKGFTFISNNPGDRGLLGNKGLKGFPGELGNKGQVGVCTVRGDQGLRGYSGLIGDMGMKG---EQGSKGIVGDYGAASRSGIMGRTGKIGNQGLPGDQXXXXXXXXXXXXXXXXYIGIPGFEGDRGEKGNKGFPGFPGDIGQPGRLGNPGISTEGVXXXXXXXXXXXXXXXXXXXXXXXXXXKQGDSGISIPGRQGIKGEDGTIGLPGEMGEPGPRGDFGQKGNIGITGEFG--------------LQGNRGD---------DGLKGDDGIPGLNGPRGFIGDIGFVGFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXELGLDGSMGGKGDNGPRGFNGPTGIPGSK---GFEGDKGI---------RGDIGVKGFQGQHGEIGFPGLKGVSGENGRQ 3812
            G  GL GS G  G +G +GF G+ G  G   E G V   G   PG+ G KG  G     GE G  GS GR G++GL G  G  G++G          G PG  G+ G  G+ G +   G+PGE+GL G  G +GI GD G                GP GA G  G  G  G +G  G KGE G+PG  G+D   G  G KG +G  G+ G +G PG  G+ G  G+ G  G KG++G+ G PG+ G    PGP G    G  G+KG  GLPG  G +GD   KG  G +G+PG  G    +      G KGDQGE G+ G  G      +PG  G+ G  G  G PG+ G KG  G+    G  GL G  G +G MG+ G   E+G  GI G  G     G  G  G+ G  GLPG                   IGIPG  GD+G++G  GFPG PG+ G+ G  G PG+         G  G  G  G  G PG  G PG++GD G+  PG  G+ G  G  GLPG  G  GP G  G+ G+ GI G  G                G++GD          GL G  GIPG+ G +GF+G  G  G  G  G  G   E  +     +G  G  G  G +G  G  G++G    KGD G +G+ G  G+PG K   GF+G  GI         +GD+G+ G  G  G+ G PGL+GV G+ G Q
Sbjct:  649 GAAGLPGSPGFPGPQGDRGFPGTPGRPGIPGEKGAVGQPGIGFPGLPGPKGVDG---LPGEIGRPGSPGRPGFNGLPGNPGPQGQKGEPGIGLPGLKGQPGLPGIPGTPGEKGSIGGPGVPGEQGLTGPPGLQGIRGDPGPPGVQGPAGPPGVPGIGPPGAMGPPGGQGPPGSSGPPGIKGEKGFPGFPGLD-MPGPKGDKGSQGLPGLTGQSGLPGLPGQQGTPGVPGFPGSKGEMGVMGTPGQPG---SPGPAGTP--GLPGEKGDHGLPGSSGPRGDPGFKGDKGDVGLPGMPGSMEHVDMGSMKGQKGDQGEKGQIGPTGDKGSRGDPGTPGVPGKDGQAGHPGQPGPKGDPGLSGTPGSPGLPGPKGSVGGMGLPGSPGEKGVPGIPGSQGVPGSPGEKGAKGEKGQSGLPG-------------------IGIPGRPGDKGDQGLAGFPGSPGEKGEKGSAGTPGMP--------GSPGPRGSPGNIGHPGSPGLPGEKGDKGL--PGLDGVPGVKGEAGLPGTPGPTGPAGQKGEPGSDGIPGSAGEKGEQGVPGRGFPGFPGSKGDKGSKGEVGFPGLAGSPGIPGVKGEQGFMGPPGPQGQPGLPGTPGHPVEGPKGDRGPQGQPGLPGHPGPMGPPGFPGINGP---KGDKGNQGWPGAPGVPGPKGDPGFQGMPGIGGSPGITGSKGDMGLPGVPGFQGQKGLPGLQGVKGDQGDQ 1334          

HSP 7 Score: 165.236 bits (417), Expect = 3.225e-40
Identity = 406/1314 (30.90%), Postives = 513/1314 (39.04%), Query Frame = 3
Query: 1119 SRGDKGPSGS-LLSCPGRKGEKGFFGIPGIKGDIGNKGYQG---------HDGDIGEIGFKGEKGYEGPLGPSCSEVEQGF------------------RGTKGESG--------------------------------FPGLRGAKGQRGYSGNKGIKGKPNFGTGINNPGETGSYGNLGVPGEKGNKGFIGDTGEKGFSGTGKQGPEGPRGDKGDDGVNGQVGMIGMPGIKGDKGSTYPICPFCEKGYKGIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEGRMGLLGSKGRQGYKGGKGFSGSMGDAGEIGYVTISGTTIP-GVKGEKGNQGPKGNKGEFGEAGSRGRKGYSGLKGFKGLIGERGTSFS--------------SGDPGDKGLRGENGKDGVSFAGIPGEKG--------------------------------------------LKGDKGNRGILGDVGSLSNCATRPITSKGFKGPQGAK-GTSGSPGSAGKTGIVGNKGENGYPGKRGIDGDNGIPGSKGEEGET-------GIKGHAGRPGNLGKSGLQGLRGEYGVKGDLGIQGIPGRKGVMGD-PGPNGYAMIGSKGDKG---------------------------------------IKGLPGIYGAKGDKGRPGYIGIPGFKGETGLIGRSGLKGDQGEIGEKGIKGFTFISNNPGDRGLLGNKGLKGFPGELGNKGQVGVCTVRGDQGLRGYSGLIGDMGMKGEQGSKGIVGDYGAASRSGIMGRTGKIGNQGLPGDQXXXXXXXXXXXXXXXXYIGIPGFEGDRGEKGNKGFPGFPGDIGQPGRLGNPGISTEGVXXXXXXXXXXXXXXXXXXXXXXXXXXKQGDSGISIPGRQGIKGEDGTIGLPGEMGEPGPRGDFGQKGNIGITGEFGLQGNRGDDGLKGDDGIPGLNGPRGFIGDIGFVGFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXELGLDGSMGGKGDNGPRGFNGPTGIPGSKGFEGDKGIRG------DIGVKGFQGQHGEIGFPGLKGVSGENGRQXXXXXXXXXXXXXXXXVCMQPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEVGESIRGLQGRKGSTGLRGNIGIPGERGDKGIPGLQGKVGNKGV--------KGDIGDKGFSGNIGDKGYSGISGDKGSFGVKGDKGFQGDVGMLGKSGLQGDRGQKGIIGFRGTRGIPGSMGLPGEIGEKGDVGPSGIGVKGLKGYQNAVGIKGRKGEKGLP--GFPGRPGKVGDQGDKGPKGMKNM 4511
            ++GD G SG     C G KG+KG  G+PG++G IG  G QG           GD GE G  G KG  GP G +      G                    GTKGE G                                 PG    KG+RG+ G  G+ G P        PG  G  G  G  G  G  G  G  GEKG  G+  QGP   +GDKG+ GV+G  G+ G   +K +KG      P  EKG KG                   +         G++G  G  G +G+ G  G KG  GS G  G+ GY  + G   P G KGE G  GP G        G +G +GY G  G +G  G +G   +              +G PG  G RGE G  G     +PG  G                                            L G+ G +G  G+  S   C T  +           + G  G PG+ G  G+ G  G  G PG +G  G  G PG+KGE GE        G KG  G PG  G  G  G  G  G  G  G +G PG  G+ G+   P G    GS+GD G                                       +  LPG  GA G  G PG+ G  G +G  G  GR G+ G++G +G+ GI GF          GL G KG+ G PGE+G  G           G  G++GL G+ G +G++G  GI                      GLPG +G                 G+PG  G  GEKG+ G PG PG+ G  G  G  GI   G  G PG+ G  GP G PG+          G       G  GIKGE G  G PG +  PGP+GD G +G  G+TG+ GL G  G  G  G  G PG  G  G +G  G  G                                     G  G  G  G KGD+G  G +GP G PG KG +GD G+ G       + +   +GQ G+ G  G  G +G+ G +G  G  G+ G  G  G   QP                      +            G  + G  G KG  G+ G+ G+PG  G+KG  G +G+ G  G+        KGD G  GF G+ G+KG  G +G  G  G  G +G  G++G  G  GL G++G KG+ G  G  G+ G  GLPG  G  G       G KG  G     G  G KGE+G+P  GFPG PG  GD+G KG  G   +
Sbjct:   27 AKGDCGGSGCGKCDCHGVKGQKGERGLPGLQGVIGFPGMQGPEGPHGPPGQKGDAGEPGLPGTKGTRGPPGAAGYPGNPGLPGIPGQDGPPGPPGIPGCNGTKGERGPLGPPGLPGFSGNPGPPGLPGMKGDPGEILGHVPGTL-LKGERGFPGIPGMPGSPGL------PGLQGPVGPPGFTGPPGPPGPPGPPGEKGQMGSSFQGP---KGDKGEQGVSGPPGVPGQAQVK-EKGD---FAPTGEKGQKG-------------------EPGFPGVPGYGEKGEPGKQGPRGKPGKDGEKGERGSPGIPGDSGYPGLPGRQGPQGEKGEAGLPGPPGTVIGTMPLGEKGDRGYPGAPGLRGEPGPKGFPGTPGQPGPPGFPTPGQAGAPGFPGERGEKGDQGFPGVSLPGPSGRDGAPGPPGPPGPPGQPGHTNGIVECQPGPPGDQGPPGTPGQPGLTGEVGQKGQKGE--SCLACDTEGLRGPPGPQGPPGEIGFPGQPGAKGDRGLPGRDGLEGLPGPQGSPGLIGQPGAKGEPGEIFFDMRLKGDKGDPGFPGQPGMPGRAGTPGRDGHPGLPGPKGSPGSIGLKGERGPPGGVGFPGSRGDIGPPGPPGVGPIGPVGEKGQAGFPGGPGSPGLPGPKGEAGKVVPLPGPPGAAGLPGSPGFPGPQGDRGFPGTPGRPGIPGEKGAVGQPGI-GFP---------GLPGPKGVDGLPGEIGRPG---------SPGRPGFNGLPGNPGPQGQKGEPGI----------------------GLPGLKG---------------QPGLPGIPGTPGEKGSIGGPGVPGEQGLTGPPGLQGI--RGDPGPPGVQGPAGPPGVPGIGPPGAMGPPGGQGPPGSSGPPGIKGEKGFPGFPG-LDMPGPKGDKGSQGLPGLTGQSGLPGLPGQQGTPGVPGFPGSKGEMGVMGTPGQPG-----------------------------------SPGPAGTPGLPGEKGDHGLPGSSGPRGDPGFKGDKGDVGLPGMPGSMEHVDMGSMKGQKGDQGEKGQIGPTGDKGSRGDPGTPGVPGKDGQAGHPGQPGPKGDPGLSGTPGSPGLPGPKGSVG----------GMGLPGSPGEKGVPGIPGSQGVPGSPGEKGAKGEKGQSGLPGIGIPGRPGDKGDQGLAGFPGSPGEKGEKGSAGTPGMPGSPGPRGSPGNIGHPGSPGLPGEKGDKGLPGLDGVPGVKGEAGLPGTPGPTGPA-----GQKGEPGSDGIPGSAGEKGEQGVPGRGFPGFPGSKGDKGSKGEVGFPGL 1196          

HSP 8 Score: 90.1225 bits (222), Expect = 2.485e-17
Identity = 83/208 (39.90%), Postives = 104/208 (50.00%), Query Frame = 3
Query: 3993 RGLQGRKGSTGLRGNIGIPGERGDKGIPGLQGKVGNKGVKGDIGDKGFSGNIGDKGYSGISGDKG---SFGVKGDKGFQGDVG------------------MLGKSGLQGDRGQKGIIGFRGTRGIPGSMGL---------PGEIGEKGDVGPSGI----GVKGLKGYQNAVGIKGRKGEKGLPGFPGRPGKVGDQGDKGPKGMKNMN 4514
            +G QG  G TG  G  G+PG++G  G+PG  G  G  GV G  G  G  G  G  G  G  GD G   S G +GD GF+GD G                  M G+ G QG++GQ G  G +G+RG PG+ G+         PG+ G KGD G SG     G+ G KG    +G+ G  GEKG+PG PG  G  G  G+KG KG K  +
Sbjct:  845 KGSQGLPGLTGQSGLPGLPGQQGTPGVPGFPGSKGEMGVMGTPGQPGSPGPAGTPGLPGEKGDHGLPGSSGPRGDPGFKGDKGDVGLPGMPGSMEHVDMGSMKGQKGDQGEKGQIGPTGDKGSRGDPGTPGVPGKDGQAGHPGQPGPKGDPGLSGTPGSPGLPGPKGSVGGMGLPGSPGEKGVPGIPGSQGVPGSPGEKGAKGEKGQS 1052          

HSP 9 Score: 87.0409 bits (214), Expect = 2.567e-16
Identity = 73/172 (42.44%), Postives = 99/172 (57.56%), Query Frame = 3
Query: 3993 RGLQGRKGSTGLRGNIGIPG---ERGDKGIPGLQGKVGNKGVKGDIGDKGFSGNIGDKGYSGISGDKGSFGVKGDKGFQGDVGMLGKSGLQGDRGQKGI---IGFRGTRGIPGSMGLPGEIGEKGDVGPSGIGVKGLKGYQNAVGIKGRKGEKGLPGFPGRPGKVGDQGDKG 4490
            +G +G KG +GL G IGIPG   ++GD+G+ G  G  G KG KG  G  G  G+ G +G  G  G  GS G+ G+KG +G  G+ G  G++G+ G  G     G  G +G PGS G+PG  GEKG+    G+  +G  G+  + G KG KGE G PG  G PG  G +G++G
Sbjct: 1043 KGAKGEKGQSGLPG-IGIPGRPGDKGDQGLAGFPGSPGEKGEKGSAGTPGMPGSPGPRGSPGNIGHPGSPGLPGEKGDKGLPGLDGVPGVKGEAGLPGTPGPTGPAGQKGEPGSDGIPGSAGEKGE---QGVPGRGFPGFPGSKGDKGSKGEVGFPGLAGSPGIPGVKGEQG 1210          

HSP 10 Score: 85.8853 bits (211), Expect = 4.996e-16
Identity = 74/183 (40.44%), Postives = 96/183 (52.46%), Query Frame = 3
Query: 3987 SIRGLQGRKGSTGLRGNIGIPGERGDKGIPGLQGK---VGNKGVKGDIGDKGFSGNIGDKGYSGISGDKGSFGVKGDKGFQGDVGMLGKSGLQGDRGQKGIIGFRGTRGIPGSMGLPGEIGEKGDVG----PSGIGVKGLKGYQNAVGIKGRKGEKGLPGFPGRPGKVGDQGDKGPKGMKNMN 4514
            S++G +G +G  G  G  G  G RGD G PG+ GK    G+ G  G  GD G SG  G  G  G  G  G  G+ G  G +G  G+ G  G+ G  G+KG  G +G  G+PG +G+PG  G+KGD G    P   G KG KG     G+ G  G +G PG  G PG  G  G+KG KG+  ++
Sbjct:  945 SMKGQKGDQGEKGQIGPTGDKGSRGDPGTPGVPGKDGQAGHPGQPGPKGDPGLSGTPGSPGLPGPKGSVGGMGLPGSPGEKGVPGIPGSQGVPGSPGEKGAKGEKGQSGLPG-IGIPGRPGDKGDQGLAGFPGSPGEKGEKGSAGTPGMPGSPGPRGSPGNIGHPGSPGLPGEKGDKGLPGLD 1126          

HSP 11 Score: 82.8037 bits (203), Expect = 3.973e-15
Identity = 125/365 (34.25%), Postives = 154/365 (42.19%), Query Frame = 3
Query:  201 GNKGRQGFPGPRGYQGVSGDKGDVGQFGMPGPKGYKGFTGAIGPQGRKGERGIPGSPGYPGKMGEMGFPGIRGDIGEKGLTGCDGQQGDFGNPGMNGLVGRTGQPGERGDDG------DRGLSIIPKYGLKGNKGSRGLLGRYGRKGEKGFKGIKGYSGIFGIKGNKGYV--------------------GPMGRRGPKGDSLGTVI-----------IQSEKGSKGDKGLKGQSGIP----CKGFQIEGRMYGRVGSDGPIGDKGIKGEKGLMGEIGQSGIDGARGLNGE-------------------------------------KGLPGEAGPRGERGDRGNPGFPGD---PGASGADGTR 1052
            G KG+ G PG  G  G  GDKGD G  G PG  G KG  G+ G  G  G  G  GSPG  G  G  G PG +GD G  GL G  G +G+ G PG  G  G  GQ GE G DG      ++G   +P  G  G  GS+G     G KGE GF G+ G  GI G+KG +G++                    GP G RGP+G                  I   KG KG++G  G  G+P      GFQ    + G  G  G  GD G+ G  G  G+ G  G+ G +G  G+                                     KGL G  GP+G++G  G+ G PG    PG  GA G +
Sbjct: 1047 GEKGQSGLPG-IGIPGRPGDKGDQGLAGFPGSPGEKGEKGSAGTPGMPGSPGPRGSPGNIGHPGSPGLPGEKGDKGLPGLDGVPGVKGEAGLPGTPGPTGPAGQKGEPGSDGIPGSAGEKGEQGVPGRGFPGFPGSKG---DKGSKGEVGFPGLAGSPGIPGVKGEQGFMGPPGPQGQPGLPGTPGHPVEGPKGDRGPQGQPGLPGHPGPMGPPGFPGINGPKGDKGNQGWPGAPGVPGPKGDPGFQGMPGIGGSPGITGSKGDMGLPGVPGFQGQKGLPGLQGVKGDQGDQGVPGPKGLQGPPGPPGPYDVIKGEPGLPGPEGPPGLKGLQGPPGPKGQQGVTGSVGLPGPPGVPGFDGAPGQK 1407          

HSP 12 Score: 78.9518 bits (193), Expect = 6.800e-14
Identity = 142/361 (39.34%), Postives = 183/361 (50.69%), Query Frame = 3
Query:  186 KCQCFGNKGRQGFPGPRGYQGVSGDKGDVGQFGMPGPKGYKGFTGAIGPQGRKGERGIPGSPGYPGKMGEMGFPGIRGDIGEKGLTGCDGQQGD------FGNPGMNGLVGRTGQPGERGDDGDRGLSIIPKYGLKGNKGSRGLLGRYGRKGEKGFKGIKGYSGIFGIKGNKGYVGPMGRRGPKGDSLGTVIIQSEKGSKGDKGLKGQSGIPCKGFQIEGRMYGRVGSDGPIGDKGIKGEKGLMGEIGQSGIDGARGLNGEKGLPGEAGPR------GERGDRGNPGFPGDPGASGADGTRGRQGERGPKGVHGISGADGPRGSRGDKGPSGSLL-SCP-GRKGEKGFFGIPGIKGDIGNK 1226
            KC C G KG++G  G  G QGV G  G  G  G  GP G KG  G  G  G KG RG PG+ GYPG  G  G PG  G  G  G+ GC+G +G+       G PG +G  G  G PG +GD G+  L  +P   LKG +G  G+ G  G  G  G +G  G  G  G  G  G  GP G +G  G S      Q  KG KG++G+ G  G+P +  Q++ +     G   P G+KG KGE G  G  G           GEKG PG+ GPR      GE+G+RG+PG PGD G  G  G +G QGE+G  G+                GP G+++ + P G KG++G+ G PG++G+ G K
Sbjct:   38 KCDCHGVKGQKGERGLPGLQGVIGFPGMQGPEGPHGPPGQKGDAGEPGLPGTKGTRGPPGAAGYPGNPGLPGIPGQDGPPGPPGIPGCNGTKGERGPLGPPGLPGFSGNPGPPGLPGMKGDPGEI-LGHVPGTLLKGERGFPGIPGMPGSPGLPGLQGPVGPPGFTGPPGPPGPPGPPGEKGQMGSSF-----QGPKGDKGEQGVSGPPGVPGQA-QVKEK-----GDFAPTGEKGQKGEPGFPGVPG----------YGEKGEPGKQGPRGKPGKDGEKGERGSPGIPGDSGYPGLPGRQGPQGEKGEAGL---------------PGPPGTVIGTMPLGEKGDRGYPGAPGLRGEPGPK 361          

HSP 13 Score: 74.7146 bits (182), Expect = 1.173e-12
Identity = 36/121 (29.75%), Postives = 57/121 (47.11%), Query Frame = 3
Query: 4653 FLYATHSQSKDFPPCHGGGSPLYNGYS-LLAIHGDIDSVTMDLGTPGSCLKNFSTIPFVNCFLERNTFYGGRCHVNMRNSRSYWLSTLQ--SYMSSPQPPS----KMDDYISRCSVCQTKT 4994
             + A HSQ+   P C  G S L+ GYS ++      +     L +PGSCL+ F + PF+ C       Y         N+ S+WL+T++       P P +    ++  ++SRC VC  +T
Sbjct: 1556 MVMAVHSQTIQIPQCPNGWSSLWIGYSFVMHTSAGAEGSGQALASPGSCLEEFRSAPFIECHGRGTCNY-------YANAYSFWLATIERSEMFKKPTPSTLKAGELRTHVSRCQVCMRRT 1669          

HSP 14 Score: 71.2478 bits (173), Expect = 1.626e-11
Identity = 78/183 (42.62%), Postives = 100/183 (54.64%), Query Frame = 3
Query: 3996 GLQGRKGSTGLRGNIGIPGERGDKGIPGLQGKVGNKGVKGDIGDKGFSGNIGDKGYSGISGD--KGSFGVKGDKGFQGDV---GMLGKSGLQGDRGQKGIIGFRGTRGIPGSMGLPGEI--GEKGDVGPS----GIGVKGLKGYQNAVGIKGRKGEKGLPGFPGRPGKVGDQGDKGPKGMKNM 4511
            GL G KG  GL G  G+PG +G+ G+PG  G  G  G KG+ G  G  G+ G+KG  G+ G    G  G KGDKG +G+V   G+ G  G+ G +G++G +G  G +G PG  G PG    G KGD GP       G  G  G     GI G KG+KG  G+PG PG  G +GD G +GM  +
Sbjct: 1112 GLPGEKGDKGLPGLDGVPGVKGEAGLPGTPGPTGPAGQKGEPGSDGIPGSAGEKGEQGVPGRGFPGFPGSKGDKGSKGEVGFPGLAGSPGIPGVKGEQGFMGPPGPQGQPGLPGTPGHPVEGPKGDRGPQGQPGLPGHPGPMGPPGFPGINGPKGDKGNQGWPGAPGVPGPKGDPGFQGMPGI 1294          

HSP 15 Score: 58.5362 bits (140), Expect = 1.027e-7
Identity = 115/332 (34.64%), Postives = 144/332 (43.37%), Query Frame = 3
Query:  864 GDKGIKGEKGLMGEIGQSGIDGARG---------LNGEKGLPGEAGPRGERGDRGNPGFPGDPGASGADGTRGRQGERGPKGVHGISGADGPRGSRGD---------------------KGPSGSLL-SCPGR--KGEKGFFGIPGIKGDIGNKGYQ---------------------GHDGDIGEI-----GFKGEKGYEGPLG-PSCSEVEQ-------GFRGTKGESGFPGLRGAKGQRGYSGNKGIKGKPNFGTGINNPGETGSYGNLGVPGEKGNKGFIGDTGEKGFSG-TGKQGPEG------PRGDKGDDGVNGQVGMIGMPGIK 1637
            G KG KGE+GL G  G  G  G +G           G+ G PG  G +G RG  G  G+PG+PG  G  G  G  G  G  G +G       +G RG                      KG  G +L   PG   KGE+GF GIPG+ G  G  G Q                     G  G +G       G KGE+G  GP G P  ++V++       G +G KGE GFPG+ G  G++G  G +G +GKP         GE G  G+ G+PG+ G  G  G  G +G  G  G  GP G      P G+KGD G  G  G+ G PG K
Sbjct:   43 GVKGQKGERGLPGLQGVIGFPGMQGPEGPHGPPGQKGDAGEPGLPGTKGTRGPPGAAGYPGNPGLPGIPGQDGPPGPPGIPGCNGT------KGERGPLGPPGLPGFSGNPGPPGLPGMKGDPGEILGHVPGTLLKGERGFPGIPGMPGSPGLPGLQGPVGPPGFTGPPGPPGPPGPPGEKGQMGSSFQGPKGDKGEQGVSGPPGVPGQAQVKEKGDFAPTGEKGQKGEPGFPGVPGY-GEKGEPGKQGPRGKP------GKDGEKGERGSPGIPGDSGYPGLPGRQGPQGEKGEAGLPGPPGTVIGTMPLGEKGDRGYPGAPGLRGEPGPK 361          

HSP 16 Score: 51.9878 bits (123), Expect = 9.533e-6
Identity = 37/79 (46.84%), Postives = 46/79 (58.23%), Query Frame = 3
Query: 4044 IPGERGDKGIPGLQGKVGNKGVKGDIGDKGFSGNIGDKGYSGISGDKGSFGVKGDKGFQGDVGMLGKSGLQGDRGQKGI 4280
            I G +GDKG    QG  G  GV G  GD GF G  G  G  GI+G KG  G+ G  GFQG  G+ G  G++GD+G +G+
Sbjct: 1261 INGPKGDKGN---QGWPGAPGVPGPKGDPGFQGMPGIGGSPGITGSKGDMGLPGVPGFQGQKGLPGLQGVKGDQGDQGV 1336          
BLAST of Collagen IV NC1 domain-containing protein vs. UniProt/SwissProt
Match: sp|P08120|CO4A1_DROME (Collagen alpha-1(IV) chain OS=Drosophila melanogaster OX=7227 GN=Col4a1 PE=1 SV=3)

HSP 1 Score: 559.296 bits (1440), Expect = 5.987e-167
Identity = 671/1924 (34.88%), Postives = 859/1924 (44.65%), Query Frame = 3
Query:   87 YHYLLLLIMVSQSYYAQDS------DPDPFKCLRI---CTPDKCQCFGNKGRQGFPGPRGYQGVSGDKGDVGQFGMPGPKGYKGFTGAIGPQGRKGERGIPGSPGYPGKMGEMGFPGIRGDIGEKGLTGCDGQQGDFGNPGMNGLVGRTGQPGERGDDGDRGLSIIPKYGLKGNKGSRGLL-GRY--GRKGEKGFKGIKGYSGIFGI---KGNKGYVGPMGRRGPKGDSLGTVIIQSEKGSK-------GDKGLKGQSGIPCKGFQIEGRMYGRVGSDGPIGDKGIKGEKGLMGEIGQSGIDGARGLNG---EKGLPGEAGPRG------------ERGDRGNPGFPGDPGASGADGTRGRQGER----------------------------------GPKGVHGISGADGPRGSRGDKGPSGSL-----LSCPGRKGEKGFFGIPGIKGDIGNKGYQGHDGDIGEIGFKGEKGYEGPLGPSCSEVEQGFRGTKGESGFPGLRGAKGQRGYSGNKGIKGKPNFGT-----GINNPGETGSYGNLGVPGEKGNKGFIGDTGEKGFSGTGKQGPEGPRGDKGDDGVNGQVGMIGMPGIKGDKGSTYPICPFCEKGYKGIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEGRMGLLGSKGRQGYKGGKGFSGSMGDAGEIGYVTISGTTIPGVKGEKGNQGPKGNKGEFGEAGSRGRKGYSGLKGFKGLIGERGTSFSSGDPGDKGLRGENGKDGVSFAGIPGEK-----------GLKGDKGNRGILGDVGSLSNCATRPITSKGFKGPQGAKGTSGSPGSAGKTGIV---GNKGENGYPGKRGIDGDNGIPGSK------GEEGETGIKGHAGRPGNLGKSGLQGLRGEYGVKGDLGIQGIPGRKGVMGDPGPNGYAMIGSKGDKGIKGLPGIYGA---------KGDKGRPGYIGIPGF---KGETGLIGRSGLKGDQGEIGEKGIKGFTFISNNPGDRGLLGNKGLKGFPGELGNKGQVGVCTVRGDQGLRGYSGLIGDMGMKGEQGSKGIVGD------YGAASRSGIMGRTGKIGNQGLPGDQXXXXXXXXXXXXXXXXYIGIPGFEGDRGEKGNKGFPGFPGDIGQPGRLGNPGISTEGVXXXXXXXXXXXXXXXXXXXXXXXXXXKQGDSGIS-IPGRQGIKGEDGTIGLPGEMGEPGPRGDFGQKGNIGITG------------EFGLQGNRGDDGLKGDDGIPGLNGPRGFIGDIGFVGFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXELGLDGSMGGKGDNGPRGFNGPTGIPGSKGFE------GDKGIRGDIGVKGFQGQHGEIGFP--------GLKGVSGENGRQXXXXXXXXXXXXXXXXVCMQPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEVGESIRGLQGRKGSTGLRGNIGIPGERGDKGI---PGLQGKVGNKGVKGDIGDKGFSGNIGDKGYSGISGDKGSFGVKGDKGFQGDVGMLGKSGLQGDRGQKGIIGFRGTRGIPGSMGLPGEIGEKGDV---------------GPSG----IGVKGLKGYQNAVGIKGRKGEKGLPGFPGRPGKVGDQGDKGPKGMKNMNTXXXXXXXXXXXXXXXXXXXXXXXXXLPGDMGEIGPNGPIGYAD-NGFLYATHSQSKDFPPCHGGGSPLYNGYSLLAIHGDIDSVTMDLGTPGSCLKNFSTIPFVNCFLERNTFYGGRCHVNMRNSRSYWLSTLQSYMSSPQPPSKMDDYISRCSVCQTKTTVMAFHSQKSDWQMTKCPYGWQKLWAGFSFPMAVQASRSGSNQPFSSPGSCLKHFRSLPFIECNNHNSNCNHWRDGVSYYMTAVDSENQFVKAQGKVLKSQTDIMNSISKCVVCQRDMN 5351
            Y+       +  SY   DS      D  P  C      C P   +C   KG +G PGP G  G+   KG++G  GM GP G KG  G  GP G++G++G  GSPG     G+ G PG++G  G  G  G +G+ G  G  G+ GL G +G PG RG  G        + G KG KG      G Y  G KGE G++G  G +G  G    KG +G  GP G +GP+G+      ++ EKG+        G  G+KG+ G P   F ++          GP GD G KGE GL+G  G+ G +G  GL+G   EKGLPG  G RG            ++GDRG PG  G PG  G  G  GR G                                    GP+G++G+ G  GP+G  G KG +G          PG+KGEKG  G+ G KG IG  G+ G  G  G+ G  G  GY            QG +G  G  G+PGL+G+KG+RG+ GN G  G    G          PG+ G  G  G PG+KG+ G  GD G K  S        GP+GDKG  G+ G  G  G  G  G++G  YP     E+G+ GI                                  G  G  G +G  G  G  G+ G+ G+     +S   I  +KG+KG  G  G KG  G  G+ G  G  G KG  G  GE+G S   G PG+ G  G  G+DG  + GIPG+            G KGDKG+ G  G+ G   +CA   I          AKG  G PG  G  G     G+ GE GY G +G  G  G PG +      G  GE G +G  G PGN GK GL+G+ G  G  G  G  GI  R G MG PG NG  + G KGD+G  G  G  GA         +GD G PG  G PG    KG+ G IG +G+ G  G  G  G++G       PG  GL+G  G KG  G  GN G  G   V G  G RG +G+ G  G KG++G+ G+ G+       G     G+MG  G  G  G PG QG  G  G KG +G  G  G PG  GD  EKG KG PG  G  G  G  G PG   E              +    + G  G PG++GD G S I GR GI GE G  GL G  G+PG +G  G  G  G  G              G  G+RGD G  G  G+PGL G  G +G  GF G                                + G KG  G  G  G KG+ G RG  GP G+ G+KG        G  G+ G  G KG  G  GEIG+P        GL G  G NGRQG  G  GL G+ G  G+  +P +                                VG  + G  G  GS G RG  G PG+ G  G    PGL+G  G +G KG+ G  GF G  GDKG  G+ G  G  G+ G KG  G  G+ G  G  G  G++G  G +G  G  G+ GLPG+ GE G +               GP G     G +GL G Q   G KG +G  G  G  GRPG  GD+G+ G +G +                            GL G  GE G   P       G L   HSQS+  P C  G + L+ GYSLL + G+  +   DLG+PGSC+  FST+P ++C   +N      C+   RN +++WL+T  +    P    ++  YISRC VC+    V+A HSQ    ++  CP GW+ LW G+SF M       G  Q   SPGSCL+ FR+ PFIECN     C+ +    S++M  ++S   F + Q + +K+  +  + +S+C VC ++ +
Sbjct:   42 YNRNEPKFPIDDSYDIVDSAGVARGDLPPKNCTAGYAGCVP---KCIAEKGNRGLPGPLGPTGL---KGEMGFPGMEGPSGDKGQKGDPGPYGQRGDKGERGSPGL---HGQAGVPGVQGPAGNPGAPGINGKDGCDGQDGIPGLEGLSGMPGPRGYAG--------QLGSKGEKGEPAKENGDYAKGEKGEPGWRGTAGLAGPQGFPGEKGERGDSGPYGAKGPRGEH----GLKGEKGASCYGPMKPGAPGIKGEKGEPASSFPVKPTHT----VMGPRGDMGQKGEPGLVGRKGEPGPEGDTGLDGQKGEKGLPGGPGDRGRQGNFGPPGSTGQKGDRGEPGLNGLPGNPGQKGEPGRAGATGKPGLLGPPGPPGGGRGTPGPPGPKGPRGYVGAPGPQGLNGVDGLPGPQGYNGQKGGAGLPGRPGNEGPPGKKGEKGTAGLNGPKGSIGPIGHPGPPGPEGQKGDAGLPGYG----------IQGSKGDAGIPGYPGLKGSKGERGFKGNAGAPGDSKLGRPGTPGAAGAPGQKGDAGRPGTPGQKGDMGIKGDVGGKCSSCR-----AGPKGDKGTSGLPGIPGKDGARGPPGERG--YP----GERGHDGIN---------------------------------GQTGPPGEKGEDGRTGLPGATGEPGKPALCDLS--LIEPLKGDKGYPGAPGAKGVQGFKGAEGLPGIPGPKGEFGFKGEKGLS---GAPGNDGTPGRAGRDG--YPGIPGQSIKGEPGFHGRDGAKGDKGSFGRSGEKGEPGSCALDEIKMP-------AKGNKGEPGQTGMPGPPGEDGSPGERGYTGLKGNTGPQGPPGVEGPRGLNGPRGEKGNQGAVGVPGNPGKDGLRGIPGRNGQPGPRGEPGI-SRPGPMGPPGLNG--LQGEKGDRGPTGPIGFPGADGSVGYPGDRGDAGLPGVSGRPGIVGEKGDVGPIGPAGVAGPPGVPGIDGVRGRDGAKGEPGSPGLVGMPGNKGDRGAPGNDGPKGFAGVTGAPGKRGPAGIPGVSGAKGDKGATGLTGNDGPVGGRGPPGAPGLMGIKGDQGLAGAPGQQGLDGMPGEKGNQGFPGLDGPPGLPGDASEKGQKGEPGPSGLRGDTGPAGTPGWPGE------------KGLPGLAVHGRAGPPGEKGDQGRSGIDGRDGINGEKGEQGLQGVWGQPGEKGSVGAPGIPGAPGMDGLPGAAGAPGAVGYPGDRGDKGEPGLSGLPGLKGETGPVGLQGFTG----------APGPKGERGIRGQPGLPATVPDIRGDKGSQGERGYTGEKGEQGERGLTGPAGVAGAKGDRGLQGPPGASGLNGIPGAKGDIGPRGEIGYPGVTIKGEKGLPGRPGRNGRQGLIGAPGLIGERGLPGLAGEPGL--------------------------------VG--LPGPIGPAGSKGERGLAGSPGQPGQDGFPGAPGLKGDTGPQGFKGERGLNGFEGQKGDKGDRGLQGPSGLPGLVGQKGDTGYPGLNGNDGPVGAPGERGFTGPKGRDGRDGTPGLPGQKGEPGMLPPPGPKGEPGQPGRNGPKGEPGRPGERGLIGIQGERGEKGERGLIGETGNVGRPGPKGDRGEPGERGYEGA-------------------------IGLIGQKGEPGAPAPAALDYLTGILITRHSQSETVPACSAGHTELWTGYSLLYVDGNDYAHNQDLGSPGSCVPRFSTLPVLSCG--QNNV----CNYASRNDKTFWLTTNAAIPMMPVENIEIRQYISRCVVCEAPANVIAVHSQT--IEVPDCPNGWEGLWIGYSFLMHTAVGNGGGGQALQSPGSCLEDFRATPFIECNGAKGTCHFYETMTSFWMYNLESSQPFERPQQQTIKA-GERQSHVSRCQVCMKNSS 1779          

HSP 2 Score: 75.0998 bits (183), Expect = 7.982e-12
Identity = 35/121 (28.93%), Postives = 59/121 (48.76%), Query Frame = 3
Query: 4998 VMAFHSQKSDWQMTKCPYGWQKLWAGFSFPMAVQASRSGSNQPFSSPGSCLKHFRSLPFIECNNHNSNCNHW-RDGVSYYMTAVDSENQFVKAQGKVLKSQTDIMNSISKCVVCQRDMNIV 5357
            ++  HSQ     +  C  G  +LW G+S  + V  +    NQ   SPGSC+  F +LP + C  +N  CN+  R+  ++++T     N  +     +     +I   IS+CVVC+   N++
Sbjct: 1557 LITRHSQSE--TVPACSAGHTELWTGYSL-LYVDGNDYAHNQDLGSPGSCVPRFSTLPVLSCGQNNV-CNYASRNDKTFWLTT----NAAIPM---MPVENIEIRQYISRCVVCEAPANVI 1666          
BLAST of Collagen IV NC1 domain-containing protein vs. UniProt/SwissProt
Match: sp|P17139|CO4A1_CAEEL (Collagen alpha-1(IV) chain OS=Caenorhabditis elegans OX=6239 GN=emb-9 PE=1 SV=5)

HSP 1 Score: 556.984 bits (1434), Expect = 3.652e-166
Identity = 665/1882 (35.33%), Postives = 860/1882 (45.70%), Query Frame = 3
Query:   99 LLLIMVSQSYYAQDS-DPDPFKCLRICTPDKCQCFGNKGRQGFPG---PRGYQGVSGDKGDVGQFGMPGPKGYKGFTGAIGPQGRKGERGIPGSPGYPGKMGEMGFPGIRGDIGEKGLTGCDGQQGDFGNPGMNGLVGRTGQPGERGDDGDRGLSIIPKYGLKGNKGSRGLLGRYGRKGEKGFKGIKGYSGIFGIKGNKG------YVGPMGRRGPKGDSLGTVIIQSEKGSKGDKGLKGQSGIPCKGFQIEGRMYGRVGSDGPIGDKGIKGEKGLMGEIGQSGI------DGARGLNGEKGLPGEAGPRGERGDRGNPGFPGDPGASGADGTRGRQGERGPKGVHGISGADGPRGSRGDKGPSGSLLSCPGRKGEKGFFGIPGIKGDIGNKGYQGHDGDIGEIGFKGEKGYEGPLGPSCSE-----VEQGFRGTKGESGF---PGLRGAKGQRGYSGNKGIKGKPNFGTGINNPGETGSYGNLGVPGEKGNKGFIGDTGEKGFSGTG--KQGPEGPRGDKGDDGVNGQVGMIGMPGIKGDKGSTYPICPFCEKGYKGIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEGRMGLLGSKGRQGYKGGKGFSGSMGDAGEIGYVTISGTT------------IPGVKGEKGNQGPKGN---------------------KGEFGEAGSRGRKGYSGLKGFKGLIGERGTSFSSGDPGDKGLRGENGKDGVSFAGIPGEKGLKGDKGNRGILGDVGSLSNCATRPITS--KGFKGPQGAKGTSGSPGSAGKTGIVGNKGENGYPGKRGIDGDNGIPGSKGEEGETGIKGHAGRPGNLGKSGLQGLRGE-----------YGVKGDLGIQGIPGRKGVMGDPGPNGYAMIGSKGDKGIKGLPGIYGAKGDKGRPGYIGIPGFKGETGLIGRSGLKGDQGEIGEKGIKGFTFISNNPGDRGLLGNKGLKGFPGELGNKGQVGVCTVRGDQGLRGYSGLIGDMGMKGEQGSKGIVGDYGAA----SR--SGIMGRTGKIGNQGLPGDQXXXXXXXXXXXXXXXXYIGIPGFEGDRGEKGNKGFPGFPGDIGQPGRLGNPGISTEGVXXXXXXXXXXXXXXXXXXXXXXXXXXKQGDSGISIPGRQGIKGEDGTIGLPGEMGEPGPRGDFGQKGNIGITGEFGLQGNRGDDGL---KGDDGIPGLNGPRGFIGDIGFVGFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXELGLDGSMGGKGDNGPRGFNGPTGIPGSKGFEGDKGIRGDIGV---KGFQGQHGEIGFPG---LKGVSGENGRQXXXXXXXXXXXXXXXXVCMQPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEVGES-IRGLQGRKGSTGLRGNIG------------------IPGERGDKGIPGLQGKVGN------KGVKGDIGDKGFSGNIGDKGYSGISGDKGSFGVKGDKGFQGDVGMLGKSG---LQGDRGQKGIIGFRGTRGIPGSMGL---PGEIGEKGDVGPSGIGVKGLKGYQNAVGIKGRKGEKGLPGFP------------GRPGKVGDQGDKGPKGMKNMNTXXXXXXXXXXXXXXXXXXXXXXXXXLPGDMGEIGPNGPIGYADN-GFLYATHSQSKDFPPCHGGGSPLYNGYSLLAIHGDIDSVTMDLGTPGSCLKNFSTIPFVNCFLERNTFYGGRCHVNMRNSRSYWLSTLQ--SYMSSPQPPSKMDDYISRCSVCQTKTTVMAFHSQKSDWQMTKCPYGWQKLWAGFSFPMAVQASRSGSNQPFSSPGSCLKHFRSLPFIECNNHNSNCNHWRDGVSYYMTAVDSENQFVKAQGKVLKSQTDIMNSISKCVVCQRD 5345
            L   +V  S + QD    D     + C P  C C G KG +G PG     G+ G  G  G  G  G PG  G +G  G +G +G +G+RG+PGSPG+PG  G  G PG++G   E+G+ GC+G  G    PGM GL G  GQ G+ G+ G  GLS  P  G   ++G +G+ G  GR G  G  G  GY G+ G KG+ G      + G  G +G  G     V  +           +  S  P     IE  +       GP+G  G+KGEKG  G +G  G+       G  GL G+KG  G+AG RG+RG  G PG  G+ G+ G  G  G  G  G KG  G  G  G  G  GD GP G L    G  G  G  G  G++G    KG  GHDG  G +G +G  G  G  G    +      E+G RG  G  GF   PGL G  G  GY G  G+ G    G     PG  G  G  G PG  G+ G  G +GEKGF GTG  K GP G  G  G+ G+ G++G+ G PG  G+ G     C +C  G  G           G+ G  G+ G  G  G  GD G  G+ G+ G+ G  G  G SGS G  G  GY  + G              IPG+KG+ G  G  G                      +GE G AG  G++G  G  G  GL G  G SF  G PG  G +GE G DG+         GL G +G RGI   +  ++  A +P      G  G +GA G  G PG  G  G  G  GE G  G  G  G +G PG +G++GE G  G  G   + G+ GL G  G            +G  G +G  G  G  G  G PGP+GY      G  G+ G PG  G  G  G+ G  G PG +GE+GL+G  G KG  G  G +G  G    S   G  G  G  G  G PG+ G  G  G     G  G+ G  GL+G  G++GE G  G+ G  G      SR   G+ G  G+ G  GLPG                     +PG +G  G  G  G PG PG  GQPG  GN  ++  G  GD G  G  GP G PG  GL G  G++GD+G S PG  G+ G+      PG+ G  G  G  G  G  GITG  GL+G  G  GL   +G+DGIPG  G  G  G+ GF G                                     G+ G  G  G +G+ G  G  G  G+PG +G +G  G++G+ G+    G+ G  G++G PG     G  GENG  G+ G  G  G  G+ G   QP +  +  +                     G  G+ G+    GL G  G+ GL G  G                  +PG  G++G+PGL GK G+       GV G  G  G  G+ G+ GY G  G  GS G  G++G  G  G  G+SG     G  GQ GI G RG  G PG  GL   PG  G +G  GP  + V+   G     G  G  GEKG PG P            G PG  G  G  GP G+  M        G  G  G  G  G+ G  GLPG  G   P  P G+A + GF +A HSQ+   P C  G S L+ GYSLL + G+  +   DLG PGSCL  F+T+PF+ C +         CHV+ RN  S+WLST +  + M +P   + +  YISRC+VC+  T ++A HSQ  D  + +CP GW  +W G+SF M   A   G+ Q   SPGSCL+ FR++PFIEC+   + CN++     ++++ VD + QF K   + LK+   + + +S+C VC ++
Sbjct:    9 LTAAVVLLSSFCQDRIHVDAAAACKGCAP-PCVCPGTKGERGNPGFGGEPGHPGAPGQDGPEGAPGAPGMFGAEGDFGDMGSKGARGDRGLPGSPGHPGLQGLDGLPGLKG---EEGIPGCNGTDG---FPGMPGLAGPPGQSGQNGNPGRPGLSGPPGEGGVNSQGRKGVKGESGRSGVPGLPGNSGYPGLKGAKGDPGPYGLPGFPGVSGLKGRMGVRTSGVKGEKGLPGPPGPPGQPGS-YPWASKPIEMEVL-----QGPVGPAGVKGEKGRDGPVGPPGMLGLDGPPGYPGLKGQKGDLGDAGQRGKRGKDGVPGNYGEKGSQGEQGLGGTPGYPGTKGGAGEPGYPGRPGFEGDCGPEGPLGEGTGEAGPHGAQGFDGVQG---GKGLPGHDGLPGPVGPRGPVGAPGAPGQPGIDGMPGYTEKGDRGEDGYPGFAGEPGLPGEPGDCGYPGEDGLPGYDIQGP----PGLDGQSGRDGFPGIPGDIGDPGYSGEKGFPGTGVNKVGPPGMTGLPGEPGMPGRIGVDGYPGPPGNNGERGEDCGYCPDGVPG---------NAGDPGFPGMNGYPGPPGPNGDHGDCGMPGAPGKPGSAGSDGLSGSPGLPGIPGYPGMKGEAGEIVGPMENPAGIPGLKGDHGLPGLPGRPGSDGLPGYPGGPGQNGFPGLQGEPGLAGIDGKRGRQGSLGIPGLQGPPGDSFP-GQPGTPGYKGERGADGL--------PGLPGAQGPRGIPAPLRIVNQVAGQPGVDGMPGLPGDRGADGLPGLPGPVGPDGYPGTPGERGMDGLPGFPGLHGEPGMRGQQGEVGFNGIDG---DCGEPGLDGYPGAPGAPGAPGETGFGFPGQVGYPGPNGDAGAAGLPGPDGY-----PGRDGLPGTPGYPGEAGMNGQDGAPGQPGSRGESGLVGIDGKKGRDGTPGTRGQDGGPGYSGEAGAPGQNGMDGYPGAPGDQGYPGSPGQDGYPGPSGIPGEDGLVGFPGLRGEHGDNGLPGLEGECGEEGSRGLDGVPGYPGEHGTDGLPG---------------------LPGADGQPGFVGEAGEPGTPGYRGQPGEPGN--LAYPGQPGDVGYPGPDGPPGLPGQDGLPGLNGERGDNGDSYPGNPGLSGQ------PGDAGYDGLDGVPGPPGYPGITGMPGLKGESGLPGLPGRQGNDGIPGQPGLEGECGEDGFPG-----------------------------------SPGQPGYPGQQGREGEKGYPGIPGENGLPGLRGQDGQPGLKGENGLDGQPGYPGSAGQLGTPGDVGYPGAPGENGDNGNQGRDGQPGLRGESGQPGQPGLPGRDGQPGPVGPPGDDGYPGAPGQDIYGPPGQAGQDGYPGLDGLPGAPGLNGEPGSPGQYGMPGLPGGPGESGLPGYPGERGLPGLDGKRGHDGLPGAPGVPGVEGVPGLEGDCGEDGYPGAPGAPGSNGYPGERGLPGVPGQQGRSGDNGYPGAPGQPGIKGPRGDDGFPGRDGLDGLPGRPGREGLPGPMAMAVRNPPG---QPGENGYPGEKGYPGLPGDNGLSGPPGKAGYPGAPGTDGYPGPPGLSGM-------PGHGGDQGFQGAAGRTGNPGLPGTPGY--PGSPGGWAPSRGFTFAKHSQTTAVPQCPPGASQLWEGYSLLYVQGNGRASGQDLGQPGSCLSKFNTMPFMFCNMNS------VCHVSSRNDYSFWLSTDEPMTPMMNPVTGTAIRPYISRCAVCEVPTQIIAVHSQ--DTSVPQCPQGWSGMWTGYSFVMHTAAGAEGTGQSLQSPGSCLEEFRAVPFIECHGRGT-CNYYATNHGFWLSIVDQDKQFRKPMSQTLKA-GGLKDRVSRCQVCLKN 1758          
BLAST of Collagen IV NC1 domain-containing protein vs. UniProt/SwissProt
Match: sp|P27393|CO4A2_ASCSU (Collagen alpha-2(IV) chain OS=Ascaris suum OX=6253 PE=2 SV=1)

HSP 1 Score: 411.379 bits (1056), Expect = 4.830e-116
Identity = 492/1498 (32.84%), Postives = 629/1498 (41.99%), Query Frame = 3
Query: 1332 RGTKGESGFPGLRGAKGQ---------RGYSGNKGIKGKPNFGTGINNPGETGSYGNLGVPGEKGNKGFIGDTGEKGFS---GTGKQGPEGPRGDKGDDGVNGQVGMIGMPGIKGDKGSTYPICPFCEKGYKGIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEGRMGLLGSKGRQGYKGGKGFSGSMGD----------AGEIGYVTISGTTIPGVKGEKGN----QGPKGNKGEFGEAGSRGRKGYSGLKGFKGLIGE---------------RGTSFSSGDPGDKGLRGENGKDGVSFAGIPGEKGLKGDKGNRGILGDVGSLSNCATRPITSKGFKGPQGAKGTSGSPGSAGKTGIVGNKGENGYPGKRGIDGDNGIPGSKGEEGETGIKGHAGRPGNLGKSGLQGLRGEYGVKGDLGIQGIPGRKGVMGDPGPNGYAMIGSKGD-----------------KGIKGLPGIYGAKGDKGRPGYIGIPGFKGETGLIGRSGLKGDQGEIGEKGIKGFTF------------------------ISNNPGDRGLLGNKGLKGFPG---------ELGNKGQVGVCTVRGDQGLRGYSGLIGDMGMKGEQGSKGIVGDYGAASRSGIMGRTGKIGNQGLPGDQXXXXXXXXXXXXXXXXYIGIPGFEGDRGEKGNKGFPGFPGDIGQPGRLGNPGISTEGVXXXXXXXXXXXXXXXXXXXXXXXXXXKQGDSGISIPGRQGIKGEDGTIGLPGEMGEPGPRGDFGQKGNIGITGEFGLQGNRGDDGLKGDDGIPGLNGPRGFIGDIGFVGFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXELGLDGSMGGKGDNG---PRGFNGPTGIPGSKGFEGDKGIRGDIGVKGFQGQHGEIGFPGLKGVSGENGRQXXXXXXXXXXXXXXXXVCMQPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEVGESIRGLQGRKGSTGLRGNIGIPGERGDKGIPGLQGKVGNKGVKGDIGDKGFSGNIGDKGYSGISGDKGSFGVKG---DKGFQGDVGMLGKSGLQGDRGQKGIIGFRGTRGIPGSMGLPGEIGEKGDVGPSGI----GVKGLKGYQNA-----------------------------------VGIKGRKGEKGLPGF---------------------PGRPGKVGDQGDKGPKGMKNMNTXXXXXXXXXXXXXXXXXXXXXXXXXLPGDMGEIGPNGPIGYADNGFLYATHSQSKDFPPCHGGGSPLYNGYSLLAIHGDIDSVTMDLGTPGSCLKNFSTIPFVNCFLERNTFYGGRCHVNMRNSRSYWLSTLQSYMSSPQPPSKMDDYISRCSVCQTKTTVMAFHSQKSDWQMTKCPYGWQKLWAGFSFPMAVQASRSGSNQPFSSPGSCLKHFRSLPFIECNNHNSNCNHWRDGVSYYMTAVDSENQFVKAQGKVLKSQTDIMNSISKCVVCQRDMNI 5354
            +G KG+SG PG  G +G          +G  G +G+ G+   G     PG+ G  G  G+PG KG  G  G  G  G S     G  GP GP+G KG DG +G  G+ G+PG KGD+G T   C FC  G KG +G                           D G  GL G +G +G  G  G +G+ GD                       +PG KGE        GP G  G+ GE G  G +G  GL G  G++G                 G     G  G  GL G  G+ G    G+PG  G+KGD G  G+ G  G++      P+     +         G PG  G  G+ G KGE G+PG  G+ G  G+PG        G+KG+ G PG  G +GL G+ GE G+ G  G+ G+ G KG  G PG  G  + G KG+                 KG  G+PG  G  G +G+ G  G+PG KGE GL G +G  G  G  GE G+ G                           +   PG  G+ G+ GL G PG           G KGQ G   V G +G  G  GL G  G KGEQG  G+ G  G     GI G  G+ G  GLPG +G                    GF G  GEKG  G     G+ G+PG  G PG+                                +G  G   PG  G KG  G  G PG  G PGP+G  G  G  G+ GE GL G  G  G  G  G+PG  G  GF G  G VG                      G++G KG  G+ G  GE GLDG  G KG+ G     G  GP G  GS G  G  G++G+ G+ G +GQ G  G  G  G+ G  GR G  GL G+ G+ G  G+  QP                                   G+SI G +G  G  GL G  G+PG  G KG PG  G  G  G+KG+ G  G  G  G+ G SGI G +G+ G+ G     G  G  GM G+SGL G +G  G+ G  G +G PG  G PG+ GE G  G  GI    G+KG  GY  A                                   +G  G +GEKGLPG                      PG+PG  G++G  G  G   +            SG                            Y D GFL   HSQ+ + P C  G   L++GYSLL I G+  S   DLG  GSCL  FST+PF+ C +         C+   RN +SYWLST       P     ++ YISRC+VC+    V+A HSQ    Q+  CP GW  LW G+SF M   A   G  Q  SSPGSCL+ FR+ PFIECN     C+++ +  S+++T ++ + QF   + + LK+ + +   +S+C VC R  ++
Sbjct:  420 KGEKGDSGIPGAPGVQGPPGLAGPPGAKGEPGPRGVDGQSIPGL----PGKDGRPGLDGLPGRKGEMGLPGVRGPPGDSLNGLPGPPGPRGPQGPKGYDGRDGAPGLPGIPGPKGDRGGT---CAFCAHGAKGEKG---------------------------DAGYAGLPGPQGERGLPGIPGATGAPGDDGLPGAPGRPGPPGPPGQDGLPGLPGQKGEPTQLTLRPGPPGYPGQKGETGFPGPRGQEGLPGKPGIVGAPGLPGPPGPKGEPGLTGLPEKPGKDGIPGLPGLKGEPGYGQPGMPGLPGMKGDAGLPGLPGLPGAVGPMGP-PVPESQLR--------PGPPGKDGLPGLPGPKGEAGFPGAPGLQGPAGLPGL------PGMKGNPGLPGAPGLAGLPGIPGEKGIAGKPGLPGLTGAKGEAGYPGQPG--LPGPKGEPGPSTTGPPGPPGFPGLKGKDGIPGAPGLPGLEGQRGLPGVPGQKGEIGLPGLAGAPGFPGAKGEPGLPGLPGKEGPQGPPGQPGAPGFPGQKGDEGLPGLPGVSGMKGDTGLPGVPGLAGPPGQPGFPGQKGQPGFPGVAGAKGEAGLPGLPGAPGQKGEQGLAGLPGIPGMKGAPGIPGAPGQDGLPGLPGVKGDR------------------GFNGLPGEKGEPGPAARDGEKGEPGLPGQPGLRGPQGPPGLPGLPGLKG--------------DEGQPGYGAPGLMGEKGLPGLPGKPGRPGAPGPKGLDGAPGFPGLKGEAGLPGAPGLPGQDGLPGLPGQKGESGFPGQPGLVG-----------PPGLPGKMGAPGIRGEKGDAGLPGLPGERGLDGLPGQKGEAGFPGAPGLPGPVGPKGSAGAPGFPGLKGEPGLPGLEGQPGPRGMKGEAGLPGAPGRDGLPGLPGMKGEAGLPGLPGQP-----------------------------------GKSITGPKGNAGLPGLPGKDGLPGLPGLKGEPGKPGYAGAAGIKGEPGLPGIPGAKGEPGLSGIPGKRGNDGIPGKPGPAGLPGLPGMKGESGLPGPQGPAGLPGLPGLKGEPGLPGFPGQKGETGFPGQPGIPGLPGMKGDSGYPGAPGRDGAPGKQGEPGPMGPPGAQPIVQRGEKGEMGPMGAPGIRGEKGLPGLDGLPGPSGPPGFAGAKGRDGFPGQPGMPGEKGAPGLPGFPGIEGIPGPPGLPGPSGPPGPPGPS--------------------YKD-GFLLVKHSQTSEVPQCPPGMVKLWDGYSLLYIEGNEKSHNQDLGHAGSCLSRFSTMPFLFCDVNN------VCNYASRNDKSYWLSTTAPIPMMPVSEGGIEPYISRCAVCEAPANVIAVHSQT--IQIPNCPNGWNSLWIGYSFAMHTGAGAEGGGQSLSSPGSCLEDFRATPFIECNGARGTCHYFANKFSFWLTTIEDDQQFRIPESETLKAGS-LRTRVSRCQVCIRSPDV 1758          

HSP 2 Score: 256.144 bits (653), Expect = 4.049e-67
Identity = 368/1079 (34.11%), Postives = 465/1079 (43.10%), Query Frame = 3
Query:  201 GNKGRQGFPGPRG---------YQGVSGDKGDVGQFGMPGPKGYKGFTGAIGPQGRKGERGI----------------------------------PGSPGYPGKMGEMGFPGIRGDIGEKGLTGCDGQQGDFGNPGMNGLVGRTGQPGERGDDGDRGLSIIPKYGLKGNKGSRGLLGRYGRKGEKGFKGIKGYSGIFGIKGNKGYVGPMG--------RRGPKG-DSL-GTVIIQSEKGSKGDKGLKGQSGIPCKGFQIEGRMYGRVGSDGPIGDKGIKGEKGLMGEIGQSGIDGARGLNGEKGLPGEAGPRGE-----------------RGDRGNPGFPGDPGASGADGTRGRQGERGPKGVHGISGADGPRGSRGDKGPSGSLLSCPGR------------------KGEKGFFGIPGIKGDIGNKGYQGHDG------DIGEIGFKGEKGYEGPLGPSCSEVEQGFRGTKGESGFPGLRGAKGQRGYSGNKGIKGKPNFGTGINNPGETGSYGNLGVPGEKGNKGFIGDTGEKGFSGTGKQGPEGPRGDKGDDGVNGQVGMIGMPGIKGDKGSTYPICPFCEKGYKGIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEGRMGLLGSKGRQGYKGGKGFSGSMGDAGEIGYVTISGTT-IPGVKGEKGNQGPKGNKGEFGEAGSRGRKGYSGLKGFKGLIGERGTSFSSGDPGDKGLRGENGKDGVSFAGIPGEKGLKGDKGNRGILGDVGSLSNCATRPITSKGFKGPQGAKGTSGSPGSAGKTGIVGNKGENGYPGKRGIDGDNGIPGSKGEEGETGI---KGHAGRPGNLGKSG--LQGLRGEYGVKGDLGIQGIPGRKGVMGDPGPNGYAMIGSKGDKGIKGLPGIYGAKGDKG---------------RPGYIGIPGF------------KGETGLIGRSGLKGDQGEIGEKGIKGFTFISNNPGDRGLLGNKGLKGFPG-----------------------------ELGNKGQVGVCTVRGDQGL------------------RGYSGLIGDMGMKGEQGSKGIVG 2915
            G  G  G PGP+G           G  G+KGD G  G+PGP+G +G  G  G  G  G+ G+                                  PG PGYPG+ GE GFPG RG  G  G  G  G  G  G PG  G  G TG P + G DG  GL      GLKG  G       YG+ G  G  G+KG +G+ G+ G  G VGPMG        R GP G D L G    + E G  G  GL+G +G+P  G        G  G+ G  G  GI GEKG+ G+ G  G+ GA+G  G  G PG  GP+GE                 +G  G PG PG PG  G  G  G  G++G  G+ G++GA G  G++G+ G    L   PG+                  KG++G  G+PG+ G  G+ G  G  G        G  G KG+ G+ G              G KGE+G PGL GA GQ+G  G  G+ G P        PG  G  G  G+PG KG++GF G  GEKG  G   +           DG  G+ G+ G PG++G +G          KG                                 DEG+ G  G+ G  G KG  G  G  G  G  G   + G    PG+KGE G  G  G  G+ G  G  G+KG SG  G  GL+G  G     G PG   +RGE G  G+   G+PGE+GL G  G +G  G  G+            G  GP G KG++G+PG  G  G  G  G  G PG RG+ G+ G+PG+ G +G  G+   KG AG PG  G+ G  + G +G  G+ G  G  G+PG  G+ G+PG  GYA  G+ G KG  GLPGI GAKG+ G               +PG  G+PG             +G  GL G  GLKG+ G  G  G KG T     PG  GL G KG  G+PG                             E G  G +G   +RG++GL                  +G  G  G  GM GE+G+ G+ G
Sbjct:  518 GAPGLPGIPGPKGDRGGTCAFCAHGAKGEKGDAGYAGLPGPQGERGLPGIPGATGAPGDDGLPGAPGRPGPPGPPGQDGLPGLPGQKGEPTQLTLRPGPPGYPGQKGETGFPGPRGQEGLPGKPGIVGAPGLPGPPGPKGEPGLTGLPEKPGKDGIPGLP-----GLKGEPG-------YGQPGMPGLPGMKGDAGLPGLPGLPGAVGPMGPPVPESQLRPGPPGKDGLPGLPGPKGEAGFPGAPGLQGPAGLP--GLPGMKGNPGLPGAPGLAGLPGIPGEKGIAGKPGLPGLTGAKGEAGYPGQPGLPGPKGEPGPSTTGPPGPPGFPGLKGKDGIPGAPGLPGLEGQRGLPGVPGQKGEIGLPGLAGAPGFPGAKGEPG----LPGLPGKEGPQGPPGQPGAPGFPGQKGDEGLPGLPGVSGMKGDTGLPGVPGLAGPPGQPGFPGQKGQPGFPG------------VAGAKGEAGLPGLPGAPGQKGEQGLAGLPGIPGMKGAPGIPGAPGQDGLPGLPGVKGDRGFNGLPGEKGEPGPAAR-----------DGEKGEPGLPGQPGLRGPQGPPGLPGLPGLKG---------------------------------DEGQPGY-GAPGLMGEKGLPGLPGKPGRPGAPGPKGLDGAPGFPGLKGEAGLPGAPGLPGQDGLPGLPGQKGESGFPGQPGLVGPPGLPGKMGAPG---IRGEKGDAGLP--GLPGERGLDGLPGQKGEAGFPGA-----------PGLPGPVGPKGSAGAPGFPGLKGEPGLPGLEGQPGPRGMKGEAGLPGAPGRDGLPGLPGMKGEAGLPGLPGQPGKSITGPKGNAGLPGLPGKDGLPGLPGLKGEPGKPGYA--GAAGIKGEPGLPGIPGAKGEPGLSGIPGKRGNDGIPGKPGPAGLPGLPGMKGESGLPGPQGPAGLPGLPGLKGEPGLPGFPGQKGETGFPGQPGIPGLPGMKGDSGYPGAPGRDGAPGKQGEPGPMGPPGAQPIVQRGEKGEMGPMGAPGIRGEKGLPGLDGLPGPSGPPGFAGAKGRDGFPGQPGMPGEKGAPGLPG 1503          

HSP 3 Score: 240.35 bits (612), Expect = 3.066e-62
Identity = 415/1160 (35.78%), Postives = 502/1160 (43.28%), Query Frame = 3
Query:  201 GNKGRQGFPGPRGYQGVSGDKGDVGQFGMPGPKGYKGFTGAIGPQGRKGERGIPGSPGYPGKMGEMGFPGIRGDIGEK--GLTGCDGQQGDFGNPGMNGLVGRTGQPGERGDDGDRG-LSIIPKYGLKGNKGSRGLLGRYGRKGEKGFKGIKGYSGIFG------------------------IKGNKGYVGPMG-RRGPKGDSLGTVIIQSEKGSKGDKGLKGQSGIPCKGFQIEGR----------------MYGRVGSDGPIGDKGIKGEKGLMGEIGQSGIDGARGLNGEKGLPGEAGPRGERGDRGNPGF-----PGDPGASGADGTRGRQGERGPKGVHGISGADGPRGSRGDKGPSGSLLSCPGRKGEKGFFGIPGIKGDIGNKGYQGHDGDIGEIGFKGEKGYEGPLG--------PSCSEVEQGFRGTKGESGFPGLRGAKGQRGYSGNKGIKGKPNFGTGINNPGETGSYGNLGVPGEKGNKGFIGDTGEKGFSGTGKQ-GPEGPRGDKGDDGVNGQVGMIGMPGIKGDKGSTYPICPFCEKGYKGIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEGRMGLLGSKGRQGYKGGKGFSGSMGDAGEIGYVTISGTT-------IPGVKGEKGNQGPKGNKGEFGEAGSRGRKGYSGLKGFKGLIGERGTSFSSGDPGDKGLRGENGKDGVSFAGIPGEKGLKGDKGNRGILGDVGS--LSNCATRPITSKGFKGPQGAKGTSGSPGSAGKTGIVGNKGENGYPGKRGIDGDNGIPGSKGEEGETGIKGHAGRPGNLGKSGLQGLRGEYGVKGDLGIQGIPGRKGVMGDPGPNGYAMIGSKGDKGIKGLPGIYGAKGDKGRPGYIGIPGFKGETGLIGRSGLKGDQGEIGEKGIKG--FTFISNNPGDRGLLGNKGLKGFPG---ELGNKGQVGVCTVRGDQGLRGYSGLIGDMGMKGEQGSKGIVGDYGAASRSGIMGRTGKIGNQGLPGDQXXXXXXXXXXXXXXXXYIGIPGFEGDRGEKGNKGFPGFPGDIGQPGRLGNPGI------STEGVXXXXXXXXXXXXXXXXXXXXXXXXXXKQGDSGISIP-GRQGIKGEDGTIGLPGEMGEPGPRGDFGQKGNIGITGEFGLQGNRGDDGLKGDDGI 3443
            G KG  G PG  G QG  G  G  G  G PGP+G  G +      G  G+ G PG  G PG+ GEMG PG+RG  G+   GL G  G +G  G  G +G  G  G PG  G  GDRG       +G KG KG  G  G  G +GE+G  GI G +G  G                        + G KG    +  R GP G          +KG  G  G +GQ G+P K   +                   +  + G DG  G  G+KGE G     GQ G+ G  G+ G+ GLPG  G  G  G  G P       PG PG  G  G  G +GE G  G  G+ G  G  G  G KG  G     PG  G  G  GIPG KG  G  G  G  G  GE G+ G+ G  GP G        P       G +G  G  G PGL G +GQRG  G  G KG+         PG  G+ G  G+PG  G +G  G  G+ G  G   Q G EG  G  G  G+ G  G+ G+PG+ G  G         + G+ G+ G                            +G  GL G  G  G KG +G +G  G  G  G   I G         +PGVKG++G  G  G KGE G A   G KG  GL G  GL   RG     G PG  GL+G+ G+ G    G+ GEKGL G  G  G  G  G   L      P    G KG  G  G  G PG  G  G+ G KGE+G+PG+ G+ G  G+PG  G  G  G KG AG PG  G+ GL GL G+ G  G  G  G+PG  G  G  G  G+      G KG  GLPG+ G  G +G  G  G+PG  G  GL G  G+KG+ G  G  G  G   T    N G  GL G  GL G PG   E G  G  G   ++G+ GL G  G  G+ G+ G  G +G  G  G    +G+ G  G  G  GLPG QG                 G+PG  G +GE G  GFPG  G+ G PG+ G PG+      S          A        P  P       ++G+ G   P G  GI+GE G  GL G  G  GP G  G KG  G  G+ G+ G +G  GL G  GI
Sbjct:  421 GEKGDSGIPGAPGVQGPPGLAGPPGAKGEPGPRGVDGQSIP----GLPGKDGRPGLDGLPGRKGEMGLPGVRGPPGDSLNGLPGPPGPRGPQGPKGYDGRDGAPGLPGIPGPKGDRGGTCAFCAHGAKGEKGDAGYAGLPGPQGERGLPGIPGATGAPGDDGLPGAPGRPGPPGPPGQDGLPGLPGQKGEPTQLTLRPGPPG-------YPGQKGETGFPGPRGQEGLPGKPGIVGAPGLPGPPGPKGEPGLTGLPEKPGKDGIPGLPGLKGEPG----YGQPGMPGLPGMKGDAGLPGLPGLPGAVGPMGPPVPESQLRPGPPGKDGLPGLPGPKGEAGFPGAPGLQGPAGLPGLPGMKGNPG----LPGAPGLAGLPGIPGEKGIAGKPGLPGLTGAKGEAGYPGQPGLPGPKGEPGPSTTGPPGPPGFPGLKGKDGIPGAPGLPGLEGQRGLPGVPGQKGEIGLPGLAGAPGFPGAKGEPGLPGLPGKEGPQGPPGQPGAPGFPGQKGDEGLPGLPGVSGMKGDTGLPGVPGLAGPPGQPGFPGQKGQPGFPGVAGA---------------------------KGEAGLPGLPGAPGQKGEQGLAGLPGIPGMKGAPGIPGAPGQDGLPGLPGVKGDRGFNGLPGEKGEPGPAARDGEKGEPGLPGQPGL---RGPQGPPGLPGLPGLKGDEGQPGYGAPGLMGEKGLPGLPGKPGRPGAPGPKGLDGAPGFP----GLKGEAGLPGAPGLPGQDGLPGLPGQKGESGFPGQPGLVGPPGLPGKMGAPGIRGEKGDAGLPGLPGERGLDGLPGQKGEAGFPGAPGLPGPVGPKGSAGAPGFP-----GLKGEPGLPGLEGQPGPRGMKGEAGLPGAPGRDGLPGLPGMKGEAGLPGLPGQPGKSITGPKGNAGLPGLPGKDGLPGLPGLKGEPGKPGYAGAAGIKGEPGLPGIPGAKGEPGLSGIPGKRGNDGIPGKPGPAGLPGLPGMKGESGLPGPQGP---------------AGLPGLPGLKGEPGLPGFPGQKGETGFPGQPGIPGLPGMKGDSGYPGAPGRDGAPGKQGEPGPMGPPGAQPIVQRGEKGEMGPMGAPGIRGEKGLPGLDGLPGPSGPPGFAGAKGRDGFPGQPGMPGEKGAPGLPGFPGI 1507          

HSP 4 Score: 236.498 bits (602), Expect = 4.106e-61
Identity = 423/1199 (35.28%), Postives = 519/1199 (43.29%), Query Frame = 3
Query:  453 GQQGDFGNPGMNGL---------VGRTGQPGERGDDGDRGLSIIPKYGLKGNKGSRGLLGRYGRKGEKGFKGIKGYSG-----------------IFGIKGNKGYVGPMGRRGPKGDSLGTVIIQSEKGSKGDKGLKGQSGIPCKGFQIEGRMYGRVGSDGPIGDKGIKGEKGLMGEIGQSGIDGARGLNGEKGLPGEAGPRGERGDRGNPGFPGDPGASGADGTRGRQGERGPKGVHGISGADGPRGSRGDKGPSGSLLSCPGRKGEKGFFGIPGIKGDIG-----NKGYQGHDGDIGEIGFKGEKGYEGPLGPSCSEVE-----------QGFRGTKGESGFPGLRGAKGQRGYSGNKGIKGKPNFGTGINNPGETGSYGNLGVPGEKG---NKGFIGDTGEKGFSG-TGKQGPEGPRGD-----------------KGDDGVNGQVGMIGM------PGIKGDKGSTYPICPFCEKGYKGIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEGRMGLLGSKGRQGYKGGKGFSGSMGDAGEIGYVTISGTT----IPGVKGEKGNQGPKGNKGEFGEAGSRGRKGYSGLKGFKGLIGERGTSFSSGDPGDKGLRGENGKDGVSFAGIPGEKGLKGDKGNRGILGDVGSLSNCATRPITSKGF-------KGPQGAKGTSGSPGSAGKTGIVGNKGENGYPGKRGIDGDNGIPGSKGEEGETGIKGHAGRPGNLGKSGLQGLRGEYGVKGDLGIQGIPGRKGVMGDPGPNGYAMIGSKGDKGIKGLPGIYGAKGDKGRPGYIGIPGFKGETGLIGRSGLKGDQGEIGEKGIKGFTFISNNPGDRGLLGNKGLKGFPGELGNKGQVGVCTVRGDQGLRGYSGLIGDMGMKGEQGSKG--IVGDYGAASRSGIMGRTGKIGNQGLPGDQXXXXXXXXXXXXXXXXYIGIPGFEGDRGEKGNKGFPGFPGDIGQPGRLGNPGISTEGVXXXXXXXXXXXXXXXXXXXXXXXXXXKQGDSGISIPGRQGIKGEDGTIGLPGEMGEPGPRGDFGQKGNIGITGEFGLQG---NRGDDGLKGDDGIPGLNGPRGFIGDIGFVGFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXELGLDGSMGGKGDNGPRGFNGPTGIPGSKGFEGDKG---IRGDIGVKGFQGQHGEIGFPGLK 3785
            G++GD G PG  G+          G  G+PG RG DG      IP  GL G  G  GL G  GRKGE G  G++G  G                   G  G  G  G  G  GPKGD  GT    +  G+KG+KG  G +G+P  G Q E  + G  G+ G  GD G+ G  G  G  G  G DG  GL G+KG P +   R      G PG+PG  G +G  G RG++G  G  G+ G  G                L   P + G+ G  G+PG+KG+ G       G  G  GD G  G  G  G  GP+GP   E +            G  G KGE+GFPG  G +G  G  G  G+KG P        PG  G  G  G+PGEKG     G  G TG KG +G  G+ G  GP+G+                 KG DG+ G  G+ G+      PG+ G KG           G+ G +GE G  G  G  G  G  G  G  G PG +G  GL G  G  G KG  G  G  G AG  G     G       PGV G KG  G  G  G  G+ G +G  G  G+ G KG  G  G     G PG  G++G+ G     F G+PGEKG  G     G  G+ G       R              KG +G  G  G+PG  G+ G+ G  G+ G PG  G  G +G PG  G +GE G+ G  G PG  G  GL G +GE G  G  G+ G PG  G MG PG     + G KGD G+ GLPG  G  G         +PG KGE G  G  GL G  G  G  G  GF      PG +G  G  GL+G PG  G KG+ G+    G  GL G  G+ G+ G+ G  G  G  I G  G A   G+ G+ G  G  GL G+                   G PG+ G  G KG  G PG PG  G+PG  G PG                                K+G+ GI  PG+ G  G  G  G+ GE G PGP+G  G  G  G+ GE GL G    +G+ G  G  GIPGL G     GD G+ G        GR G  G++G                G KGE+G  G+ G +G+ G  G +G  G  G  GF G KG     G  G+ G +G  G  GFPG++
Sbjct:  421 GEKGDSGIPGAPGVQGPPGLAGPPGAKGEPGPRGVDGQS----IP--GLPGKDGRPGLDGLPGRKGEMGLPGVRGPPGDSLNGLPGPPGPRGPQGPKGYDGRDGAPGLPGIPGPKGDRGGTCAFCAH-GAKGEKGDAGYAGLP--GPQGERGLPGIPGATGAPGDDGLPGAPGRPGPPGPPGQDGLPGLPGQKGEPTQLTLR-----PGPPGYPGQKGETGFPGPRGQEGLPGKPGIVGAPGLP----GPPGPKGEPGLTGLPEKPGKDGIPGLPGLKGEPGYGQPGMPGLPGMKGDAGLPGLPGLPGAVGPMGPPVPESQLRPGPPGKDGLPGLPGPKGEAGFPGAPGLQGPAGLPGLPGMKGNPGL------PGAPGLAGLPGIPGEKGIAGKPGLPGLTGAKGEAGYPGQPGLPGPKGEPGPSTTGPPGPPGFPGLKGKDGIPGAPGLPGLEGQRGLPGVPGQKGEIGLPGLAGAPGFPGAKGEPGLPGLPGKEGPQGPPGQPGAPGFPGQKGDEGLPGLPGVSGMKGDTGLPGVPGLAGPPGQPGFPGQKGQPGFPGVAGAKGEAGLPGLPGAPGQKGEQGLAGLPGIPGMKGAPGIPGAPGQDGLPGLPGVKGDRG-----FNGLPGEKGEPGPAARDGEKGEPGLPGQPGLRGPQGPPGLPGLPGLKGDEGQPGY-GAPGLMGEKGLPGLPGKPGRPGAPGPKGLDGAPGFPGLKGEAGLPGAPGLPGQDGLPGLPGQKGESGFPGQPGLVGPPGLPGKMGAPG-----IRGEKGDAGLPGLPGERGLDG---------LPGQKGEAGFPGAPGLPGPVGPKGSAGAPGF------PGLKGEPGLPGLEGQPGPRGMKGEAGLPGAPGRDGLPGLPGMKGEAGLPGLPGQPGKSITGPKGNAGLPGLPGKDGLPGLPGLKGEP------------------GKPGYAGAAGIKGEPGLPGIPGAKGEPGLSGIPG--------------------------------KRGNDGI--PGKPGPAGLPGLPGMKGESGLPGPQGPAGLPGLPGLKGEPGLPGFPGQKGETGFPGQPGIPGLPG---MKGDSGYPG------APGRDGAPGKQGEPGPMGPPGAQPIVQRGEKGEMGPMGAPGIRGEKGLPGLDGLPGPSGPPGFAGAKGRDGFPGQPGMPGEKGAPGLPGFPGIE 1508          

HSP 5 Score: 125.176 bits (313), Expect = 3.797e-27
Identity = 157/396 (39.65%), Postives = 181/396 (45.71%), Query Frame = 3
Query:  201 GNKGRQGFPGPRGYQGVSGDKGDVGQFGMPGPKGYKGFTGAIGPQGRKGERGIPGSPGYPGKMGEMGFPGIRGDIGEKGLTGCDGQQGDFGNPGMNGLVGRTGQPGERGDDGDRGLSIIPKYGLKGNKGSRGLLGRYGRKGEKGFK---GIKGYSGIFGIKGNKGYVGPMGRRGPKGDSLGTVIIQSEKGSKGDKGLKGQSGIPCKGFQIEGRMYGRVGSDGPIGDKGIKGEKGLMGEIGQSGIDGARGLNGEKGLPGEAGPRGERGDRGNPGFPGDPGASGADGTRGRQGERGPKGVHGISGADGPRGSRGDKGPSGSLLSCPGRKGEKGFFGIPGIKGDIGNKGYQGHDGDIGEIGFKGEKGYEGPLGPSCSEVEQGFRGTKGESGFPGLRGAK 1379
            G+ G  G PG RG  G+ G KG+ G  G PG        G +GP+G  G  G PG  G PG  G  G PG RG  GE GL G  G+ G  G PGM G  G  G PG+ G       SI    G KGN G  GL G+ G  G  G K   G  GY+G  GIKG  G  G  G +G             E G  G  G +G  GIP           G+ G  G  G  G+KGE GL G  G +G+ G  GL GE GLPG  G +GE G  G PG PG PG  G  G  G  G  G  G  G  G  GP G++         +   G KGE G  G PGI+G+ G  G  G  G  G  GF G KG +G  G      + G  G KG  G PG  G +
Sbjct: 1166 GDAGLPGLPGERGLDGLPGQKGEAGFPGAPG------LPGPVGPKGSAGAPGFPGLKGEPGLPGLEGQPGPRGMKGEAGLPGAPGRDGLPGLPGMKGEAGLPGLPGQPGK------SIT---GPKGNAGLPGLPGKDGLPGLPGLKGEPGKPGYAGAAGIKGEPGLPGIPGAKG-------------EPGLSGIPGKRGNDGIP-----------GKPGPAGLPGLPGMKGESGLPGPQGPAGLPGLPGLKGEPGLPGFPGQKGETGFPGQPGIPGLPGMKGDSGYPGAPGRDGAPGKQGEPGPMGPPGAQ--------PIVQRGEKGEMGPMGAPGIRGEKGLPGLDGLPGPSGPPGFAGAKGRDGFPG------QPGMPGEKGAPGLPGFPGIE 1508          

HSP 6 Score: 79.7221 bits (195), Expect = 3.137e-13
Identity = 36/121 (29.75%), Postives = 62/121 (51.24%), Query Frame = 3
Query: 4998 VMAFHSQKSDWQMTKCPYGWQKLWAGFSFPMAVQASRSGSNQPFSSPGSCLKHFRSLPFIECNNHNSNCNHW-RDGVSYYMTAVDSENQFVKAQGKVLKSQTDIMNSISKCVVCQRDMNIV 5357
            ++  HSQ S  ++ +CP G  KLW G+S  + ++ +    NQ     GSCL  F ++PF+ C+ +N  CN+  R+  SY+++          ++G        I   IS+C VC+   N++
Sbjct: 1535 LLVKHSQTS--EVPQCPPGMVKLWDGYSL-LYIEGNEKSHNQDLGHAGSCLSRFSTMPFLFCDVNNV-CNYASRNDKSYWLSTTAPIPMMPVSEG-------GIEPYISRCAVCEAPANVI 1644          
BLAST of Collagen IV NC1 domain-containing protein vs. UniProt/SwissProt
Match: sp|P17140|CO4A2_CAEEL (Collagen alpha-2(IV) chain OS=Caenorhabditis elegans OX=6239 GN=let-2 PE=1 SV=2)

HSP 1 Score: 405.601 bits (1041), Expect = 3.007e-114
Identity = 510/1519 (33.57%), Postives = 666/1519 (43.84%), Query Frame = 3
Query: 1116 GSRGDKGPSGSLLSCPGRKGEKGFFGIPG--IKGDIGNKGYQGHDGDIGEIGFKGEKGYEGPLGPSCSEVEQGFRGTKGESGFPGLRGAKGQRGYSGNKGIKGKPNFGTGINNPGETGSYGNLGVPGEKGNKGFIGDTGEKGFSGT-GKQGPEGPRGDKGDDGVNGQVGMIG---------MPGIKGDKGSTYPIC----PFCEKGYKGIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEGRMGLLGSKGRQGYKGGKGFSGSMGDAG--EIGYVTISGTT----------IPGVKGEKGNQGPKGNKGEFGEAGSRGRKGYSGLKGFKGLIGERGTSFSSGDPGDKGLRGENGKDGVS-------------FAGIPGEKGLKGDKGNRGILGDVGSLSNCATRPITSKGFKGPQGAKGTSGSPGSAGKTGIVGNKGENGYPGKRGIDGDNGIPGSKGEEGETGIKGHAGRPGNLGKSGLQGLRGEYGVKGDLGIQGIPGRKGVMGDPGPNGYAMI-GSKGDKGIKGLPGIYGAKGDKGRPGYIGIPGFKGETGLIGRSGLKGDQGEIGEKGIKGFTFISNNPGDRGLLGNKGLKGFPGELGNKGQVGVCTVRGDQGLRGYSGLIGDMGMKGEQGSKGIVGDYGAASRSGIMGRTGKIGNQGLPGDQXXXXXXXXXXXXXXXXYIGIPGFEGDRG--------EKGNKGFPGFPGDIGQPGRLGNPGISTEGVXXXXXXXXXXXXXXXXXXXXXXXXXXKQGDSGISIPGRQGIKGEDGTIGLPGEMGEPGPRGDFGQKGNIGITGEFGLQGNRGDDGLKGDDG---IPGLNGPRGFIGDIGFVGFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXELGLDGSMGGKGDNGPRGFNGPTGIPGSKGFEGDKGIRGDIGVKGFQGQHGEIGFPGLK---GVSGENGRQXXXXXXXXXXXXXXXXVCMQPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEVGESIRGLQGRKGSTGLRGNIGIPGERGDKGIPGLQGKVGNKGVKGDIGDKGFSGNIGDKGYSGISGDKGSFGVKGDKGFQGDVGMLGKSG------LQGDRGQKGIIGFRGTRGIPGSMGLPGEIGEKGDVGPSG---------------------------IGVKGLKGYQNAVGIKGRKGEKGLP------------------GFPGRPGKVGDQGDKGPKGMKNMNTXXXXXXXXXXXXXXXXXXXXXXXXXLPGDMGEIGPNGPIGYADNGFLYATHSQSKDFPPCHGGGSPLYNGYSLLAIHGDIDSVTMDLGTPGSCLKNFSTIPFVNCFLERNTFYGGRCHVNMRNSRSYWLSTLQSYMSSPQPPSKMDDYISRCSVCQTKTTVMAFHSQKSDWQMTKCPYGWQKLWAGFSFPMAVQASRSGSNQPFSSPGSCLKHFRSLPFIECNNHNSNCNHWRDGVSYYMTAVDSENQFVKAQGKVLKSQTDIMNSISKCVVCQRDMN 5351
            G+ G  GPSG +   PG KGE G+ G PG  I G  G  G  G DG  G  G  G  G  GP G S +          G  G PG RGA G  GY G  G+ G P         G+ G   +   PG KG KG  G +G+ G  G  G  G  GP GD GDDG+ G  G  G          PG+ G KG    +     P    G KG  G  G+ G +G  G +G  G  G  G PG++G  GL G  G+ G  G  G  G+ G+AG  + G     G             PG++G  G   P+ N+      G  G  G  G KG  G  G  G     G PG  G++G++G  G               F G+PG  G+ G KG+                 + + G  G  G KG  G        G+ G  G  G+PG +G  G  G+PG+ G EG+ G  G  G  G  G  GL G  G  G KGD G+ G+PGR+G  G PG +G   + G KG+ G+ GLPG+ G KGD G PG  G PG  G  G     G+KG+ G  G  G KG   +   PG  G  G  G+ G PG  G KG  G+  + G  GL G  G+ GD G  G  G KG   + G A+R G  G  G  G  GL G QG  G              G+PGF+G+ G        + G KG PG PG  G+ G  G+PG   +G+ G PG                      +G+SG   PG+ G+ G DG  G+PG+      +GD GQ G  G++G  GL G  G  G++GD G   +PG+ G RG                                                  +DG  G KG+NG  G  G  G+ G KGF G  G  G  G  G+ GQ G  G PGLK   G  G+ G++G  GL G  G  G  G+  QP     G  G  G  G +G                  +   GL G+KG +GL G  G PG +G+ G+PG        G KGD+G  G  G  G+ G  G+ G  G  G+ G KG  G  G+ G+ G      L+G+ G  G  G +G  G PG+ G+PG  GEKGD G  G                            G KGL G   A G++G KG  GL                   G+PG PG  G++G  G  G   ++    G       G                            Y D GF+   HSQ+ + P C  G + L++GYSLL I G+  S   DLG  GSCL+ FST+PF+ C           C+   RN +SYWLST ++    P    +++ YISRC+VC+     +A HSQ    Q+  CP GW  LW G+SF M   A   G  Q  SSPGSCL+ FR+ PFIECN    +C+++ +  S+++T +D++++F   + + LKS  ++   +S+C VC +  +
Sbjct:  428 GAPGVSGPSG-IPGLPGPKGEPGYRGTPGQSIPGLPGKDGKPGLDGAPGRKGENGLPGVRGPPGDSLN----------GLPGAPGQRGAPGPNGYDGRDGVNGLPGA---PGTKGDRGGTCSACAPGTKGEKGLPGYSGQPGPQGDRGLPGMPGPVGDAGDDGLPGPAGRPGSPGPPGQDGFPGLPGQKGEPTQLTLRPGPPGYPGLKGENGFPGQPGVDGLPGPSGPVGPPGAPGYPGEKGDAGLPGLSGKPGQDGLPGLPGNKGEAGYGQPGQPGFPGAKGDGGLPGLPGTPGLQGMPGEPAPE-NQVNPAPPGQPGLPGLPGTKGEGGYPGRPGEVGQPGFPGLPGMKGDSGLPGPPGLPGHPGVPGDKGFGGVPGLPGIPGPKGD-----------------VGNPGLPGLNGQKGEPG-------VGVPGQPGSPGFPGLKGDAGLPGLPGTPGLEGQRGFPGAPGLKGGDGLPGLSGQPGYPGEKGDAGLPGVPGREGSPGFPGQDGLPGVPGMKGEDGLPGLPGVTGLKGDLGAPGQSGAPGLPGAPGY---PGMKGNAGIPGVPGFKGDGGLPGLPGLNGPKGEPGVPGMPGTPGMKGNGGLPGLPGRDGLSGVPGMKGDRGFNGLPGEKG---EAGPAARDGQKGDAGLPGQPGLRGPQGPSG------------LPGVPGFKGETGLPGYGQPGQPGEKGLPGIPGKAGRQGAPGSPG--QDGLPGFPG---------------------MKGESGY--PGQDGLPGRDGLPGVPGQ------KGDLGQSGQPGLSGAPGLDGQPGVPGIRGDKGQGGLPGIPGDRG--------------------------------------------------MDGYPGQKGENGYPGQPGLPGLGGEKGFAGTPGFPGLKGSPGYPGQDGLPGIPGLKGDSGFPGQPGQEGLPGLSGEKGMGGLPGMPGQPGQSIAGPVGPPGAPGLQGK-----------------DGFPGLPGQKGESGLSGLPGAPGLKGESGMPGF------PGAKGDLGANGIPGKRGEDGLPGVPGRDGQPGIPGLKGEVGGAGLPGQPGFPGIPGLKGEGGLPGFPGAKGEAGFPGTPGVPGYAGEKGDGGLPGLPGRDGLPGADGPVGPPGPSGPQNLVEPGEKGLPGLPGAPGLRGEKGMPGLDGPPGNDGPPGLPGQRGNDGYPGAPGLSGEKGMGGLPGFPGLDGQPGGPGAPGLPGAPGAAGPA--------------------YRD-GFVLVKHSQTTEVPRCPEGQTKLWDGYSLLYIEGNEKSHNQDLGHAGSCLQRFSTMPFLFCDFNN------VCNYASRNEKSYWLSTSEAIPMMPVNEREIEPYISRCAVCEAPANTIAVHSQT--IQIPNCPAGWSSLWIGYSFAMHTGAGAEGGGQSPSSPGSCLEDFRATPFIECNGARGSCHYFANKFSFWLTTIDNDSEFKVPESQTLKS-GNLRTRVSRCQVCVKSTD 1755          

HSP 2 Score: 251.521 bits (641), Expect = 1.063e-65
Identity = 413/1184 (34.88%), Postives = 513/1184 (43.33%), Query Frame = 3
Query:  246 GVSGDKGDVGQFGMPGPKGYKGFTGAIGPQ--GRKGERGIPGSPGYPGKMGEMGFPGIRGDIGEKGLTGCDGQQGDFGNPGMNGLVGR---TGQPGERGDDGDRGLSIIPKYGLKGNKGSRGLLGRYGRKGEKGFKGIKGYSGIFGIKGNKGYVGPM---------------GRRGPKGDSLGTVIIQSEKGSKGDKGLKGQSGIP-------------------------CKGFQIEGRMYGRVGSDGPIGDKGIKGEKGLMGEIGQSGIDGARG---------LNGEKGLPGEAGPRGE--RGDRGNPGFPGDPGASGADGTRGRQGERGPKGVHGISGA--DGPRGSRGDKGPSGSLLSCPGRKGEKGFFGIPGIKGDIGNKGYQGHDGDIGE--IGFKGEKGYEGPLGPSCSEVEQGFRGTKGESGFPGLRGA---KGQRGYSGNKGIKG---KPNFGTGINNPGETGSYGNLGVPGEKGNKGFIGDTGEKGFSGT----GKQGPEGPRGDKGDDGVNGQVGMIGMPGIKGDKGSTYPICPFCEKGYKGIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEGRMGLLGSKGRQGYKGGKGFSGSMGDAGEIGYVTISGTTIPGVKGEKGNQGPKGNKGEFGEAGSRGRKGYSGLKGFKGLIGERGTSFSSGDPGDKGLRGENGKDGVSFAGIPGEKGLKGDKGNRGILGDVGSLSNCATRPITSKGFKGPQGAKGTSGSPGSAGKTGIVGNKGENGYPGKRGI---DGDNGIPGSKGEEGETGIKGHAGRPGNLGKSGLQGLRGEYGVKGDLGIQGIPGRKGVMGDPG---PNGYAMIG-------SKGDKGIKGLPGIYGAKGDKGRPGYIGIPGFKGETGLIGRSGLKGDQGEIGEKGIKGFTFISNNPGDR--------GLLGNKGLKGFPGELGNKGQVGVCTVRGDQGLRGYSGLIGDMGMKGEQGSKGIVGDYGAASRSGIMGRTGKIGNQGLPGDQXXXXXXXXXXXXXXXXYIGIPGFEGDRGEKGNKGFPGFPGDIGQPGRLGNPGIS---------TEGVXXXXXXXXXXXXXXXXXXXXXXXXXXKQGDSGIS-IPGRQGIKGEDGTI------------GLPGEMGEPGPRGDFGQKGNIGITGEFGLQGNRGDDGLKGDDGIPGLNG 3458
            G  G  G  G  G+PGPKG  G+ G  G    G  G+ G PG  G PG+ GE G PG+RG  G+  L G  G  G  G PG NG  GR    G PG  G  GDRG +        G KG +GL G  G+ G +G +G+ G  G  G  G+ G  GP                G  G KG+     +     G  G  GLKG++G P                          KG      + G+ G DG  G  G KGE G  G+ GQ G  GA+G           G +G+PGE  P  +      G PG PG PG  G  G  GR GE G  G  G+ G   D              +    G  G  G  GIPG KGD+GN G  G +G  GE  +G  G+ G              GF G KG++G PGL G    +GQRG+ G  G+KG    P        PGE G  G  GVPG +G+ GF G  G  G  G     G  G  G  G KGD G  GQ G  G+PG  G               Y G++G  G  G  G  G  GL G  G  G  G+ G  G+ G+ G +G  G  G  G  G +G           +PG+KG++G  G  G KGE G A   G+KG +GL G  GL   RG    SG PG  G +GE G  G    G PGEKGL G  G                            G +G  GSPG  G  G  G KGE+GYPG+ G+   DG  G+PG KG+ G++G  G +G PG  G+ G+ G+RG+   KG  G+ GIPG +G+ G PG    NGY            KG  G  G PG+ G+ G  G+ G  GIPG KG++G  G+ G +G  G  GEKG+ G   +   PG          G  G +G  GFPG  G KG+ G+  + G  GL+G SG+ G  G KG+ G+ GI G  G     G+ GR G+ G  GL G+             G  G  G PGF G  G KG  G PGFPG  G+ G  G PG+              +              P  P       + G+ G+  +PG  G++GE G                          G  GQ+GN G  G  GL G +G  GL    G PGL+G
Sbjct:  428 GAPGVSGPSGIPGLPGPKGEPGYRGTPGQSIPGLPGKDGKPGLDGAPGRKGENGLPGVRGPPGDS-LNGLPGAPGQRGAPGPNGYDGRDGVNGLPGAPGTKGDRGGTC--SACAPGTKGEKGLPGYSGQPGPQGDRGLPGMPGPVGDAGDDGLPGPAGRPGSPGPPGQDGFPGLPGQKGEPTQLTL---RPGPPGYPGLKGENGFPGQPGVDGLPGPSGPVGPPGAPGYPGEKGDAGLPGLSGKPGQDGLPGLPGNKGEAG-YGQPGQPGFPGAKGDGGLPGLPGTPGLQGMPGEPAPENQVNPAPPGQPGLPGLPGTKGEGGYPGRPGEVGQPGFPGLPGMKGDSGLPGPPGLPGHPGVPGDKGFGGVPGLPGIPGPKGDVGNPGLPGLNGQKGEPGVGVPGQPG------------SPGFPGLKGDAGLPGLPGTPGLEGQRGFPGAPGLKGGDGLPGLSGQPGYPGEKGDAGLPGVPGREGSPGFPGQDGLPGVPGMKGEDGLPGLPGVTGLKGDLGAPGQSGAPGLPGAPG---------------YPGMKGNAGIPGVPGFKGDGGLPGLPGLNGPKGEPGVPGMPGTPGMKGNGGLPGLPGRDGLSG-----------VPGMKGDRGFNGLPGEKGEAGPAARDGQKGDAGLPGQPGL---RGPQGPSGLPGVPGFKGETGLPGYGQPGQPGEKGLPGIPGK--------------------------AGRQGAPGSPGQDGLPGFPGMKGESGYPGQDGLPGRDGLPGVPGQKGDLGQSGQPGLSGAPGLDGQPGVPGIRGD---KGQGGLPGIPGDRGMDGYPGQKGENGYPGQPGLPGLGGEKGFAGTPGFPGLKGSPGYPGQDGLPGIPGLKGDSGFPGQPGQEGLPGLSGEKGMGGLPGMPGQPGQSIAGPVGPPGAPGLQGKDGFPGLPGQKGESGLSGLPGAPGLKGESGMPGFPGAKGDLGANGIPGKRGEDGLPGVPGRDGQPGIPGLKGE------------VGGAGLPGQPGFPGIPGLKGEGGLPGFPGAKGEAGFPGTPGVPGYAGEKGDGGLPGLPGRDGLPGADGPVGPPGPSGPQNLVEPGEKGLPGLPGAPGLRGEKGMPGLDGPPGNDGPP------------GLPGQRGNDGYPGAPGLSGEKGMGGLP---GFPGLDG 1507          

HSP 3 Score: 216.468 bits (550), Expect = 6.302e-55
Identity = 384/1106 (34.72%), Postives = 466/1106 (42.13%), Query Frame = 3
Query:  471 GNPGMNGLVGRTGQPGERGDDGDRGLSIIPKYGLKGNKGSRGLLGRYGRKGEKGFKGIKGYSGIFGIKGNKGYVGPMGRRGPKGDSLGTVIIQSEKGSKGDKGLKGQSGIPCKGFQIEGRMYGRVGSDGPIGDKGIKGEKGLMGEIGQSGIDGARGLNGEKGLPGEAGPRGERGDRGNPGFPGDPGASGADGTRGRQGERGPKGVHGISGADGPRGSRGDK-------GPSGSLLSCPGRKGEKGFFGIPGI---------------------KGDIGNKGYQGHDGDIGEIGFKGEKGYEGPLGPSCSEVEQGFRGTKGESGFPGLRGAKGQRGYSGNKGIKGKPNFGTGIN--NPGETGSYGNLGVPGEKGNKGFIGDTGEKGFSGTGKQGPEGPRGDKG---------------DDGVNGQVGMIGMPGIKGDKGSTYPICPFC--EKGYKGIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEGRMGLLGSKGRQGYKGGKGFSGSMGDAGEIGYVTISGTTIPGVKGEKGNQGPKGNKGEFGEAGSRGRKGYSGLKGFKGLIGERGTSFSSGDPGDKGLRGENGKDGVSFA-GIPGEKGLKGDKGNRGILGDVG----SLSNCATRPITSKGFKGPQGAKGTSGSPGSAGKTGIVGNKGENGYPGKRGIDGDNGIPGSKGEEGETGIKGHAGRPGNLGKSGLQGLRGEYGVKGDLGIQGIPGRKGVMGDPGPNGYAMIGSKGDKGIKGLPGIYGAKGDKGRPGYIGIPGF---KGETGLIGRSGLKGDQGEIGEKGIKGFTFISNNPGDRGLLGNKGLKGFPGELGNKGQVGVCTVRGDQGLRGYSG---------------------LIGDMGMKGEQGSKGIVGDYGAASRSGIMGRTG---KIGNQGLPG-----------------DQXXXXXXXXXXXXXXXXYIGIPGFEGDRGEKGNKGFPGFPGDIGQPGRLGNPGISTEGVXXXXXXXXXXXXXXXXXXXXXXXXXXKQGDSGIS-IPGRQGIKGEDGTIGLPGEMGEPGPRGDFGQKGNIGITGEFGLQGNRGDDGLKGDDGIPGLNGPRGFIGDIGFVGF 3497
            G PG++G  G  G PG +G+ G RG       GL G  G  GL G  GRKGE G  G+                     RGP GDSL            G  G  GQ G P           G  G DG  G  G+ G  G  G+ G +    A G  GEKGLPG +G  G +GDRG PG PG  G +G DG  G  G  G  G  G  G  G  G +G+        GP G     PG KGE GF G PG+                     KGD G  G  G  G  G  G  G KG            E G+ G  G+ GFPG +G  G  G  G  G++G P      N  NP   G  G  G+PG KG  G+ G  GE G  G    G  G +GD G               D G  G  G+ G+PG KGD G+  P  P    +KG  G+                G+ G  G+ G PG +G  GL G  G  G +G +GF G+ G  G        G  +PG+ G+ G  G KG+ G  G  G  G  G+ G  G  G+ G +G     G PG  GL+G+ G  G S A G+PG  G  G KGN GI G  G                KG  G  G  GT G  G+ G  G+ G  G +G PG +G  G NG+PG KGE G       A R G  G +GL G  G  G +G  G+ G+PG KG  G PG   Y   G  G+KG+ G+PG  G +G  G PG  G+PGF   KGE+G  G+ GL G  G  G  G KG    S  PG  G  G  G  G PG  G+KGQ G+  + GD+G+ GY G                       G  G  G +GS G  G  G     G+ G +G   + G +GLPG                  Q   G  G  G  G +G  G PG  G +GE G  G PG PG  G+ G  G PG                                 +GD G + IPG+   +GEDG  G+PG  G+PG  G  G+ G  G+ G+ G  G  G  G  G  G PG  G  GF G  G  G+
Sbjct:  428 GAPGVSGPSGIPGLPGPKGEPGYRGTPGQSIPGLPGKDGKPGLDGAPGRKGENGLPGV---------------------RGPPGDSL-----------NGLPGAPGQRGAP-----------GPNGYDGRDGVNGLPGAPGTKGDRGGTCSACAPGTKGEKGLPGYSGQPGPQGDRGLPGMPGPVGDAGDDGLPGPAGRPGSPGPPGQDGFPGLPGQKGEPTQLTLRPGPPGY----PGLKGENGFPGQPGVDGLPGPSGPVGPPGAPGYPGEKGDAGLPGLSGKPGQDGLPGLPGNKG------------EAGY-GQPGQPGFPGAKGDGGLPGLPGTPGLQGMPGEPAPENQVNPAPPGQPGLPGLPGTKGEGGYPGRPGEVGQPGF--PGLPGMKGDSGLPGPPGLPGHPGVPGDKGFGGVPGLPGIPGPKGDVGN--PGLPGLNGQKGEPGV----------------GVPGQPGSPGFPGLKGDAGLPGLPGTPGLEGQRGFPGAPGLKG--------GDGLPGLSGQPGYPGEKGDAGLPGVPGREGSPGFPGQDGLPGVPGMKGEDGLPGLPGVTGLKGDLGAPGQSGAPGLPGAPGYPGMKGNAGIPGVPGFKGDGGLPGLPGLNGPKGEPGVPGMPGTPGMKGNGGLPGLPGRDGLSGVPGMKGDRGFNGLPGEKGEAGP------AARDGQKGDAGLPGQPGLRGPQGPSGLPGVPGFKGETGLPG---YGQPGQPGEKGLPGIPGKAGRQGAPGSPGQDGLPGFPGMKGESGYPGQDGLPGRDGLPGVPGQKGDLGQSGQPGLSGAPGLDGQPGVPGIRGDKGQGGLPGIPGDRGMDGYPGQKGENGYPGQPGLPGLGGEKGFAGTPGFPGLKGSPGYPGQDGLPGIPGLKGDSGFPGQPGQEGLPGLSGEKGMGGLPGMPGQPGQSIAGPVGPPGAPGLQGKDGFPGLPGQKGESGLSGLPGAPGLKGESGMPGFPGA--------------------------------KGDLGANGIPGK---RGEDGLPGVPGRDGQPGIPGLKGEVGGAGLPGQPGFPGIPGLKGEGGLPGFPGAKGEAGFPGTPGVPGY 1401          

HSP 4 Score: 211.46 bits (537), Expect = 1.959e-53
Identity = 386/1120 (34.46%), Postives = 471/1120 (42.05%), Query Frame = 3
Query:  201 GNKGRQGFPGPRGYQGVSGDKGDVGQFGMPGPKGYKGFTGAIGPQGRKGERGIPGSPGYPGKMGEMGFPGIRGDIGEKG---------------------LTGCDGQQGDF----------GNPGMNGLVGRTGQPG---------------------ERGDDGDRGLSIIP----KYGLKGNKGSRGLLGRYGRKGEKGFKGIKGYSGIFGIKGNKGYVGPMGRRGPKGDSLGTVIIQSEKGSKGDKGLKGQSGIPCKGFQIEGRMYGRVGSDGPIGDKGIKGE------------------KGLMGEIGQSGIDGARGLNGEKGLPGEAGPRGERG-----DRGNPGFPG---DPGASGADGTRGRQGERGPKGVHGISGADGPRGSRGDKGPSGSLLSCPGRKGEKGFFGIPGIKGDIGNKGYQGHDGDIGEIGFKGEKGYEGPLGPSCSEVEQGFRGTKGESGFPGLRGAKGQRGYSGNKGIKGKPNF------------GTGINNPGETGSYGNLG------------------VPGEKGNKGFIGDTGEKGFSGTGKQGPEGPRGDKGDDGVNGQVGM------IGMPGIKGDKGST------YPICPFCEKGYKGIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEGRMGLLGSKGRQGYKGGKGFSGSMGDAGEIGYVTISGTTIPGVKGEKGNQGPKGNKGEFGEAGSRGRKGYSGLKGFKGLIGERGTSFSSGDPGDKGLRGENGKDGVS----------FAGIPGEKGLKGDKGNRGILGDVGSLSNCATRPITSKGFKGPQGAKGTSGSPGSAGKTGIVGNKGENG---------YPGKR-----------GIDGDNGIPGSKGEEGETGIKGHAGRPGNLGKSGLQGLRGEYGVKGDLGIQGIPGRKGVMGDPGPNGYAMIGSKGDKGIKGLPGIYGAKGDKGRPGYIGIPGFKGETGLIGRSGLKGDQGEIGEKGIKGFTFISNNPGDRGLLGNKGLKGFPGELGNKGQVGVCTVRGDQGLRGYSGLIGDMGMKGEQGSKGIVGDYGAASRSGIMGRTGKIGNQGLPGDQXXXXXXXXXXXXXXXXYIGIPGFEGDRGEKGNKGF 3098
            G  G++G PGP GY G  G  G     G PG KG +G T +    G KGE+G+PG  G PG  G+ G PG+ G +G+ G                       G  GQ+G+           G PG+ G  G  GQPG                     E+GD G  GLS  P      GL GNKG  G    YG+ G+ GF G KG  G+ G+ G  G  G  G   P+           + G  G  G KG+ G P +         G VG  G  G  G+KG+                  KG  G  G  GI G +G  G  GLPG  G +GE G       G+PGFPG   D G  G  GT G +G+RG  G  G+ G DG  G  G           PG  GEKG  G+PG+ G  G+ G+ G DG  G  G KGE G  G   P  + + +G  G  G+SG PGL GA G  G  GN GI G P F                  PG  G  G  G                  VPG KG++GF G  GEKG     + GP    G KGD G+ GQ G+       G+PG+ G KG T       P  P  EKG  GI G                             GR G  GS G+ G  G  G  G  G  G+ G     G  +PGV G+KG+ G  G  G  G  G  G+ G  G++G KG  G  G     G  G  G +GENG  G            FAG PG  GLKG  G  G                   G  G  G KG SG PG  G+ G+ G  GE G          PG+            G+ G +G PG  G++GE+G+ G  G PG  G+SG+ G  G    KGDLG  GIPG++G  G PG     + G  G  GI GL G  G  G  G+PG+ GIPG KGE GL G  G KG+ G  G  G+ G+     + G  GL G  GL G  G +G  G  G   +  + G +G  GL G  G++GE+G  G+ G  G     G+ G+ G  G  G PG           G KG  G  G PG +G  G  G  G 
Sbjct:  498 GAPGQRGAPGPNGYDGRDGVNG---LPGAPGTKGDRGGTCSACAPGTKGEKGLPGYSGQPGPQGDRGLPGMPGPVGDAGDDGLPGPAGRPGSPGPPGQDGFPGLPGQKGEPTQLTLRPGPPGYPGLKGENGFPGQPGVDGLPGPSGPVGPPGAPGYPGEKGDAGLPGLSGKPGQDGLPGLPGNKGEAG----YGQPGQPGFPGAKGDGGLPGLPGTPGLQGMPGEPAPENQV--NPAPPGQPGLPGLPGTKGEGGYPGR--------PGEVGQPGFPGLPGMKGDSGLPGPPGLPGHPGVPGDKGFGGVPGLPGIPGPKGDVGNPGLPGLNGQKGEPGVGVPGQPGSPGFPGLKGDAGLPGLPGTPGLEGQRGFPGAPGLKGGDGLPGLSGQ----------PGYPGEKGDAGLPGVPGREGSPGFPGQDGLPGVPGMKGEDGLPG--LPGVTGL-KGDLGAPGQSGAPGLPGAPGYPGMKGNAGIPGVPGFKGDGGLPGLPGLNGPKGEPGVPGMPGTPGMKGNGGLPGLPGRDGLSGVPGMKGDRGFNGLPGEKG-----EAGPAARDGQKGDAGLPGQPGLRGPQGPSGLPGVPGFKGETGLPGYGQPGQP-GEKGLPGIPG---------------------------KAGRQGAPGSPGQDGLPGFPGMKGESGYPGQDGLPGRDG--LPGVPGQKGDLGQSGQPGLSGAPGLDGQPGVPGIRGDKGQGGLPGIPGDRGMDGYPGQKGENGYPGQPGLPGLGGEKGFAGTPGFPGLKGSPGYPG-----------------QDGLPGIPGLKGDSGFPGQPGQEGLPGLSGEKGMGGLPGMPGQPGQSIAGPVGPPGAPGLQGKDGFPGLPGQKGESGLSGLPGAPGLKGESGMPGFPG---AKGDLGANGIPGKRGEDGLPG-----VPGRDGQPGIPGLKGEVGGAGLPGQPGFPGIPGLKGEGGLPGFPGAKGEAGFPGTPGVPGYAGEKGDGGLPGLPGRDGLPGADGPVGPPGPSGPQNLV-EPGEKGLPGLPGAPGLRGEKGMPGLDGPPGNDGPPGLPGQRGNDGYPGAPG---------LSGEKGMGGLPGFPGLDGQPGGPGAPGL 1517          

HSP 5 Score: 119.013 bits (297), Expect = 2.827e-25
Identity = 200/597 (33.50%), Postives = 254/597 (42.55%), Query Frame = 3
Query: 2253 TSGSPGSAGKTGIVGNKGENGYPGKRGIDGDNGIPGSKGEEGETGIKGHAGRPGNLGKSGLQGLRGEYGVKGDLGIQGIPGRKGVMGDPGPNGYAMIGSKGDKGIKGLPGIYGAKGDKGRPGYIGIPGFKGETGLIGRSGLKGDQGEIGEKGIKGF-------------------------------------TFISNNPGDRGLLGNKGLKGFPGELG------------NKGQVGVCTVRGDQGLRGYSGLIGDMGMKGEQGSKGIVGDYGAASRSGIMGRTG---------KIGNQGLPGDQXXXXXXXXXXXXXXXXYIGIPGFEGDRGEKGNKGFPGFPGDIGQPGRLGNPGIS-------------------TEGVXXXXXXXXXXXXXXXXXXXXXXXXXXKQGDSGISIPGRQGIKGEDGTIGLPGEMGEPGPRGDFGQKGNIGITGEFGLQGNRGDDGLKGDDGIPGLNGPRGFIGDIGFVGFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXELGLDGSMGGKGDNGPRGFNGPTGIPGSKGFEGDKGIRGDIGVKGFQGQHGEIGFPGLKGVSGENGRQ 3812
              G+PG +G +GI G  G  G PG RG  G + IPG  G++G+ G+ G  GR    G++GL G+RG  G      + G+PG  G  G PGPNGY      G  G+ GLPG  G KGD+G       PG KGE GL G SG  G QG+ G  G+ G                                      T ++  PG  G  G KG  GFPG+ G              G  G    +GD GL G SG  G  G+ G  G+KG  G YG   + G  G  G           G QG+PG+                   G PG  G  G KG  G+PG PG++GQPG  G PG+                     +G  G PGL G+PGP G+ G PGL G  G++G+ G+ +PG+            PG  G PG +GD G  G  G  G  G +G  G  GLKG DG+PGL+G  G+ G+ G                                         + GL G  G +G  G  G +G  G+PG KG +G  G+ G  G+KG  G  G+ G PGL G  G  G +
Sbjct:  426 IPGAPGVSGPSGIPGLPGPKGEPGYRGTPGQS-IPGLPGKDGKPGLDGAPGR---KGENGLPGVRGPPGDS----LNGLPGAPGQRGAPGPNGY-----DGRDGVNGLPGAPGTKGDRGGTCSACAPGTKGEKGLPGYSGQPGPQGDRGLPGMPGPVGDAGDDGLPGPAGRPGSPGPPGQDGFPGLPGQKGEPTQLTLRPGPPGYPGLKGENGFPGQPGVDGLPGPSGPVGPPGAPGYPGEKGDAGLPGLSGKPGQDGLPGLPGNKGEAG-YGQPGQPGFPGAKGDGGLPGLPGTPGLQGMPGEPAPENQVNPAPP-------GQPGLPGLPGTKGEGGYPGRPGEVGQPGFPGLPGMKGDSGLPGPPGLPGHPGVPGDKGFGGVPGLPGIPGPKGDVGNPGLPGLNGQKGEPGVGVPGQ------------PGSPGFPGLKGDAGLPGLPGTPGLEGQRGFPGAPGLKGGDGLPGLSGQPGYPGEKG-----------------------------------------DAGLPGVPGREGSPGFPGQDGLPGVPGMKGEDGLPGLPGVTGLKGDLGAPGQSGAPGLPGAPGYPGMK 948          
BLAST of Collagen IV NC1 domain-containing protein vs. UniProt/SwissProt
Match: sp|Q5UQ13|COLL2_MIMIV (Collagen-like protein 2 OS=Acanthamoeba polyphaga mimivirus OX=212035 GN=MIMI_R196 PE=4 SV=1)

HSP 1 Score: 367.851 bits (943), Expect = 1.997e-102
Identity = 458/1197 (38.26%), Postives = 610/1197 (50.96%), Query Frame = 3
Query:   96 LLLLIMVSQSYYAQDSDPDPFKCLRICTPDKCQC--FGNKGRQGFPGPRGYQGVSGDKGDVGQ---FGMPGPKGYKGFTGAI---------------------------GPQGRKGERGIPGSPGYPGKMGEMGFPGIRGDIGEKGLTGCDGQQGDFGNPGMNGLVGRTGQPGERGDDGDRGLSIIPKYGLKGNKGSRGLLGRYGRKGEKGFKGIKGYSGIFGIKGNKGYVGPMGRRGPKGDSLGTVIIQSEKGSKGDKGLKGQSG----IPCKGFQIEGRMYGRVGSDGPIGDKGIKGEKGLMGEIGQSGIDGARGLNGEKGLPGEAGPRGERGDRGNPGFPGDPGASGADGTRGRQGERGPKGVHGISGADGPRGSRGDKGPSGSLLSCPGRKGEKGFFGIPGIKGDIGNKGYQGHDG---DIGEIGFKGEKGYEGPLGPSCSEVEQGFRGTKGESGFPGLRGAKGQRGYSGNKGIKGKPNFGTGINNPGETGSYGNLGVPGEKGNKGFIGDTGEKGFSGTGKQG-PEGPRGDKGDDGVNGQVGMI------------GMPGIKGDKGSTYPIC------------PFCEKGYKGIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEGRMGLLGSKGRQGYKGGKGFSGSMGDAGEIGYVTI---SGTTI----PGVKGEKGNQGPKGNKGEFGEAGSRGRKGYSGLKGFKGLIGERGTSFSSGDPGDKGLRGE----------NGKDGVSFAGIPGEKGLKGDKGNRGILGDVGSLSNCATRPITSKGFKGPQGAKGTSGSPGSAGKTGIVGNKGENGYPGKRGIDGDNGIPGSKGEEGETGIKGHAGRPGNLGKSGLQGLRGEYGVKGDLGIQGIPGRKGVMGDPGPNGYAMIGSKGDKGIKGLPGIYGAKGDKGRPGYIGIPGFKGETGLIGRSGLKGDQGEIGEKGIKGFTFISNNPGDRGLLGNKGLKGFPGELGNKGQVGVCTVRGDQGLRGYSGLIGDMGMKGEQGSKGIVGDYGA---ASRSGIMGRTGKIGNQGLPGDQXXXXXXXXXXXXXXXXYIGIPGFEGDRGEKGNKGFPGFPGDIGQPGRLGNPGISTEGVXXXXXXXXXXXXXXXXXXXXXXXXXXKQGDSGISIPGRQGIKGEDGTIGLPGEMGEPGPRGDFGQKGNIGITGEFGLQGNRGDDGLKGD 3434
            L + ++    Y+  DS       LR    +K Q    G KG +G  G +G +G+ G  G  G    FG   P+ Y+G  G +                           G QG KG++G  G  G  G+ G  GF G +GD+G+KG TG  G +GD G  G  G  G  G  G++G+ GD+        G+KG+KGS G+ G  G KG+ G KG  G  G  G KG+KG +G  G +G KGD +G   I+ +KG+KGD G KG  G    I  KG + +    G +G  G IGDKG+KG+KG +G+         +G+ G+    G+ G  G +GD+G+ G  GD G +G  G  G  G +G KG +GI G  G +G++GDKG  G+     G KG KG  GI G KGDIG+KG +G  G   D G+ G KG+KG +G  G   S+ ++G+ G  G+ G  G +G  G++G +G KG KG+        + GE G  G  G  GEKGNKG  GD GE G S    QG P    G+ GD  ++   G++             + G KGDKG +                    KG KG +G++G++G  G+ G  G+KGNKG+KG  GD+G  G  G KG +G KG KG  G  GD G+IG   I   SG+ +     G KG+KGN+G KGNKG+ G  G +G KG  G KG KG  G++G     GD GDKG +G                    G  G KG KGDKG++G                 SKG+KG +G KG  G+ GS G  G  G+KGE G  G +G  G+ G  G KG +GE G KG+ G  G+ G  G  G++G  GVKGD G  GI G  G+ GD            GDKGIKG  G  G KGDKG  G  G  G +G+ G+ G  G KG +G  G+KGIKG +      G +G  G KG KG+ G+ G+KG +G+   +GD+G++G  G  GD G KG +G+KG  GD G        GI G  G  GN+GL GD+G  G KG KG KG KG  G  G +G  G+KG+K      GD G  G  G  G+S +G                          G +G+ G+SI G +G+KG+    G  G+ G+ G +GD   KG+ GI G+ G++GN+GD G KG+
Sbjct:   74 LYINLLTDDLYFKNDSFWSLVGNLRGEKGEKGQLGIMGYKGEKGEIGSQGIKGMKGSDGLNGSTILFGQGLPRPYEGENGDVYIDKNTGIMYKKINGIWIPQVGLKGSQGDQGYKGDQGSKGDKGQKGEFGSAGFKGDKGDMGQKGETGAKGDKGDKG-EGSKGSKGDVGNKGDKGNKGDK--------GIKGDKGSEGIKGDNGIKGDNGTKGDNGTKGDNGTKGDKGDIGDNGIKGDKGD-IGDNGIKGDKGNKGDNGDKGNKGDKGDIGDKGMKGD---KGDIGDKGDIGDKGMKGDKGDIGD---------KGMKGDNSTKGDKGDNGTKGDKGDNGIKGDKGDNGTKGDNGDNGTKGDKGDNGIKGDKGDKGTKGDKGDKGT-KGDNGDKGTKGDNGIKGYKGDIGDKGIKGESGANADKGDKGIKGDKGDKGIKGDDGSKGDKGYNGEIGQKGDNGEKGDNGEKGDNGEKGDKGEK------GDIGEKGDNGEKGDIGEKGNKGSKGDKGEIGSSILFGQGIPSPDLGNDGDIYIDDNTGILYKKLNGIWVPQTDIKGEKGDKGESGQSANKGDKGDKGNGGEIGNKGDKGSKGDIGDKGNKGDKGDGGIKGNKGDKGSKGDKGSKGDKGDKGDEGIKGDKGNKGDKGDKGDIGSQGIKGESGSAVFKGDKGTKGDKGNKGDKGNKGDKGTNGDKGNKGDKGSKGDKGTKGDKGI---KGDKGDKGSKGNKGSKGDKGDKGDSGDKGDKGDKGSKGYKGDKGDKG-----------------SKGYKGDKGDKGIKGNTGSKGDKGSKGDKGEKGSKGNKGEKGEKGFKGEKGSKGEKGSKGNKGDKGDKGFKGDNGIKGNIGVKGDKGDSGIKGENGLKGDV-----------GDKGIKGDKGNEGDKGDKGNKGEKGNRGDEGDKGIKGNKGDKGIKGSEGDKGIKGES------GSKGDKGEKGNKGYKGDKGDKGNLGIKGDKGDKGIKGVKGTKGDKGTKGVKGTKGDKGDKGTNGDKGDKGIKGTNGDKGNKGLEGDKGNIGGKGDKGDKGDKGDKGDKGDKGVNGDKGSK------GDKGDQGTKGETGLSIKG------------------------DKGDKGEFGLSIKGDKGVKGD---QGYKGDKGDKGIKGD---KGDKGIKGDQGIKGNKGDKGDKGN 1168          

HSP 2 Score: 328.176 bits (840), Expect = 9.189e-90
Identity = 405/1040 (38.94%), Postives = 526/1040 (50.58%), Query Frame = 3
Query:  156 FKCLRICTPDKCQC--FGNKGRQGFPGPRGYQGVSGDKGDVGQFGMPGPKGYKGFTGAIGPQGRKGERGIPGSPGYPGKMGEMGFP---GIRGDIGEKGLTGCDGQQGDFGNPGMNGLVGRTGQPGERGDDGDRGLSIIPKYGLKGNKGSRGLLGRYGRKGEKGFKGIKGYSGIFGIKGNKGYVGPMGRRGPKGDSLGTVIIQSEKGSKGDKGLKGQSGIP-CKGFQIEGRMYGRVGSDGPIGDK---GIKGEKGLMGEIGQSGIDGARGLNGEKGLPGEAGPRGERGDRGNPGFPGDPGASGADGTRGRQGERGPKGVHGISGADGPRGSRGDKGPSGS--LLSCPGRKGEKGFFGIPGIKGDIGNKGYQGHDGDIGEIGFKGEKGYEGPLGPSCSEVEQG---------------------FRGTKG----ESGFPGLRGAKGQRGYSGNKGIKGKPNFGTGINNPGETGSYGNL------------GVPGEKGNKGFIGDTGEKGFSGTGKQGPEGPRGDKGDDGVNGQVGMIGMPGIKGDKGSTYPICPFCEKGYKGIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEGRMGLLGSKGRQGYKGGKG---------------------------FSGSMGDAGEIGYVTISGTT-IPGVKGEKGNQGPKGNKGEFGEAGSRGRKGYSGLKGFKGLIGERGTSFSSGDPGDKGLRGENGKDGVSFAGIPGEKGLKGDKGNRGILGDVGSLSNCATRPITSKGFKGPQGAKGTSGSPGSAGKTGIVGNKGENGYPGKRGIDGDNGIPGSKGEEGETGIKGHAGRPGNLGKSGLQGLRGEYGVKGDLGIQGIPGRKGVMGDPGPNGYAMIGSKGDKGIKGLPGIYGAKGDKGRPGYIGIPGFKGETGLIGRSGLKGDQGEI------------------------GEKGIKGFTFISNNPGDRGLLGNKGLKGFPGELGNKGQVGVCTVRGDQGLR---GYSGLIGDMGMKGEQGSKGIVGDYGAASRSGIMGRTGKI 2966
            +K  +    DK Q   FG+ G +G  G  G +G +G KGD G  G  G KG KG  G  G +G KG++GI G  G  G  G+ G     G +GD G KG  G  G +GD G+ G+ G  G  G  G +GD G++G +     G KGNKG +G +G  G KG+KG  G KG  G  G+KG+KG +G  G +G            S KG KGD G KG  G    KG + +    G  G +G  GDK   GIKG+KG  G  G  G  G +G NG+KG  G+ G +G +GD G+ G  G+ GA+   G +G +G++G KG+ G  G+ G +G  G+ G  G        G KG+ G  G  G KGDIG KG  G  GDIGE G KG KG +G +G S     QG                     ++   G    ++   G +G KG+ G S NKG KG    G  I N G+ GS G++            G+ G KG+KG  GD G KG  G   +G EG +GDKG+ G  G  G IG  GIKG+ GS        +KG KG +G  G++G  G+ G NG KGNKG+KG  GD+G  G  G KG +G KG KG                           + G  GD G  GY    G   I G  G KG++G KG+KGE G  G++G KG  G KG KG  GE+G+  + GD GDKG +G+N        GI G  G+KGDKG+ GI G+ G            KG  G +G KG  G+ G  G  G  G KG  G  G +GI G+ G  G KG EG+ GIKG +G  G+ G+ G +G +G+ G KG+LGI+G  G KG+ G        + G+KGDKG KG+ G  G KGDKG  G  G  G KG  G  G  GL+GD+G I                        G+KG KG      + GD+G  G  GL    G+ G+KG+ G+ +++GD+G++   GY G  GD G+KG++G KGI GD G     G  G  G +
Sbjct:  187 YKGDQGSKGDKGQKGEFGSAGFKGDKGDMGQKGETGAKGDKGDKG-EGSKGSKGDVGNKGDKGNKGDKGIKGDKGSEGIKGDNGIKGDNGTKGDNGTKGDNGTKGDKGDIGDNGIKGDKGDIGDNGIKGDKGNKGDN-----GDKGNKGDKGDIGDKGMKGDKGDIGDKGDIGDKGMKGDKGDIGDKGMKGD----------NSTKGDKGDNGTKGDKGDNGIKGDKGDNGTKGDNGDNGTKGDKGDNGIKGDKGDKGTKGDKGDKGTKGDNGDKGTKGDNGIKGYKGDIGDKGIKGESGANADKGDKGIKGDKGDKGIKGDDGSKGDKGYNGEIGQKGDNGEKGDNGEKGDNGEKGDKGEKGDIGEKGDNGEKGDIGEKGNKGSKGDKGEIGSSIL-FGQGIPSPDLGNDGDIYIDDNTGILYKKLNGIWVPQTDIKGEKGDKGESGQSANKGDKGDKGNGGEIGNKGDKGSKGDIGDKGNKGDKGDGGIKGNKGDKGSKGDKGSKGDKGD--KGDEGIKGDKGNKGDKGDKGDIGSQGIKGESGSA---VFKGDKGTKGDKGNKGDKGNKGDKGTNGDKGNKGDKGSKGDKGTKGDKGIKGDKGDKGSKGNKGSKGDKGDKGDSGDKGDKGDKGSKGYKGDKGDKGSKGYKGDKGDKGIKGNTGSKGDKGSKGDKGEKGSKGNKGEKGEKGFKGEKGSKGEKGSKGNKGDKGDKGFKGDN--------GIKGNIGVKGDKGDSGIKGENG-----------LKGDVGDKGIKGDKGNEGDKGDKGNKGEKGNRGDEGDKGIKGNKGDKGIKGSEGDKGIKGESGSKGDKGEKGNKGYKGDKGDKGNLGIKGDKGDKGIKG--------VKGTKGDKGTKGVKGTKGDKGDKGTNGDKGDKGIKGTNGDKGNKGLEGDKGNIGGKGDKGDKGDKGDKGDKGDKGVNGDKGSKG------DKGDQGTKGETGLS-IKGDKGDKGEFGL-SIKGDKGVKGDQGYKGDKGDKGIKGDKGDKGIKGDQGIKGNKGDKGDKGNL 1169          

HSP 3 Score: 311.227 bits (796), Expect = 2.466e-84
Identity = 419/1255 (33.39%), Postives = 572/1255 (45.58%), Query Frame = 3
Query:  357 IPGSPGYPGKMGEMGFPGIRGDIGEKGLTGCDGQQGDFGNPGMNGLVGRTGQ------PGERGD---DGDRGLSI-------IPKYGLKGNKGSRGLLGRYGRKGEKGFKGIKGYSGIFGIKGNKGYVGPMGRRGPKGD-------SLGTVIIQSEKGSKGDKGLKGQSGIPCKGFQIEGRMYGRVGSDGPIGDKGIKGEKGLMGEIGQSGIDGARGLNGEKGLPGEAGPRGERGDRGNPGFPGDPGASGADGTRGRQGERGPKGVHGISGADGPRGSRGDKGPSGSLLSCPGRKGEKGFFGIPGIKGDIGNKGYQGHDGDIGEIGFKGEKGYEGPLGPSCSEVEQGFRGTKGESGFPGLRGAKGQRGYSGNKGIKGKPNFGTGINNPGETGSYGNLGVPGEKGNKGFIGDTGEKGFSGTGKQGPEGPRGDKGDDGVNGQVGMIGMPGIKGDKGSTYPICPFCEKGYKGIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEGRMGLLGSKGRQGYKGGKGFSGS------------MGDAGEIG--------YVTISGTTIP--GVKGEKGNQGPKGNKG------------EFGEAGSRGRKG---------------YSGLKGFKGLIGERGTSFSSGDPGDKGLRGENGKDGVSFAGIPGEKGLKGDKGNRGILGDVGSLSNCATRPITSKGFKGPQGAKGTSGSPGSAGKTGIVGNKGENGYPGKRGIDGDNGIPGSKGEEGETG------------------------IKGHAGRPGNLGKSGLQGLRGEYGVKGDLGIQGIPGRKGVMGDPGPNGYAMIGSKGDKGIKGLPGIYGAKGDKGRPGYIGIPGFKGETGLIGRSGLKGDQGEIGEKGIKGFTFISNNPGDRGLLGNKGLKGFPGELGNKGQVGVCTVRGDQGLRGYSGLIGDMGMKGEQGSKGIVGDYGAASRSGIMGRTGKIGNQGLPGDQXXXXXXXXXXXXXXXXYIGIPGFEGDRGEKGNKGFPGFPGDIGQPGRLGNPGISTEGVXXXXXXXXXXXXXXXXXXXXXXXXXXKQGDSGISIPGRQGIKGEDGTIGLPGEMGEPGPRGDFGQKGNIG---------------------ITGEFGLQGNRGDDGLKGDDGIPGLNGPRGFIGDIGFVGFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXELGLDGSMGGKGDNGPRGFNGPTGIPGSKGFEGDKGIRGDIGVKGFQGQHGEIG 3770
            + G  G  G++G MG+ G +G+IG +G+ G        G+ G+NG     GQ       GE GD   D + G+         IP+ GLKG++G +G  G  G KG+KG KG  G +G  G KG+ G  G  G +G KGD       S G V  + +KG+KGDKG+KG  G   +G + +  + G  G+ G  G KG  G KG  G+IG +GI G +G  G+ G+ G+ G +G+ GD+GN G  GD G  G  G +G  G++G  G  G+ G  G  G +G KG + S     G  G KG  G  GIKGD G+ G +G +GD G  G KG+ G +G  G   ++ ++G +GTKG++G  G +G  G +GY G+                G+ G  G  G   +KG+KG  GD G+KG         +G  G KGD G NG++G  G  G KGD G         +KG KG                        + G  GD G  G +G KG +G KG KG  GS            +G+ G+I         Y  ++G  +P   +KGEKG++G  G               E G  G +G KG                 G KG KG  G++G+    GD GD+G++G+ G          G+KG KGD G++GI G+ GS           KG KG +G KG  G+ G  G  G  GNKG+ G  G +G  GD GI G KG++G  G                         KG+ G  G+ G  G +G +G+ G+KG+ G +G  G KG  G+ G  G    G KG+KG KG  G  G KG KG  G  G  GFKG+ G+ G  G+KGD+G+    GIKG   +  + GD+G+ G+KG +G  G+ GNKG+ G    RGD+G +G  G  GD G+KG +G KGI G       SG  G  G+ GN+G  GD+G                 G  G +GD+G+KG KG  G  GD G  G  G  G                                          G +G  G+ G  G+ G  G+ G +G  G KGNIG                     + G+ G +G++GD G KG+ G+  + G +G  G+ G                                       KG+ G+ G  G KGD G +G          KG +GDKGI+GD G+KG +G  G+ G
Sbjct:   97 LRGEKGEKGQLGIMGYKGEKGEIGSQGIKGM------KGSDGLNGSTILFGQGLPRPYEGENGDVYIDKNTGIMYKKINGIWIPQVGLKGSQGDQGYKGDQGSKGDKGQKGEFGSAGFKGDKGDMGQKGETGAKGDKGDKGEGSKGSKGDVGNKGDKGNKGDKGIKGDKG--SEGIKGDNGIKGDNGTKGDNGTKGDNGTKGDKGDIGDNGIKGDKGDIGDNGIKGDKGNKGDNGDKGNKGDKGDIGDKGMKGDKGDIGDKGDIGDKGMKGDKGDIGDKGMKGDN-STKGDKGDNGTKGDKGDNGIKGDKGDNGTKGDNGDNGTKGDKGDNGIKGDKGDKGTKGDKGDKGTKGDNGDKGTKGDNGIKGYKGD---------------IGDKGIKGESGANADKGDKGIKGDKGDKGI--------KGDDGSKGDKGYNGEIGQKGDNGEKGDNGEKGDNGEKGDKGEKG------------------------DIGEKGDNGEKGDIGEKGNKGSKGDKGEIGSSILFGQGIPSPDLGNDGDIYIDDNTGILYKKLNGIWVPQTDIKGEKGDKGESGQSANKGDKGDKGNGGEIGNKGDKGSKGDIGDKGNKGDKGDGGIKGNKGDKGSKGDKGSKGDKGDKGDEGIKGDKGN--------KGDKGDKGDIGSQGIKGESGSAVFKG-----DKGTKGDKGNKGDKGNKGDKGTNGDKGNKGDKGSKGDKGTKGDKGIKGDKGDKGSKGNKGSKGDKGDKGDSGDKGDKGDKGSKGYKGDKGDKGSKGYKGDKGDKGIKGNTGSKGDKGSKGDKGEKGSKGNK--GEKGEKGFKGEKGSKGEKGSKGNKGDKGDKGFKGDNGIKGNIGVKGDKGD---SGIKGENGLKGDVGDKGIKGDKGNEGDKGDKGNKGEKGN---RGDEGDKGIKGNKGDKGIKGSEGDKGIKG------ESGSKGDKGEKGNKGYKGDKGDK---------------GNLGIKGDKGDKGIKGVKGTKGDKGTKGVKGTKGD----------------------------------------KGDKGTNGDKGDKGIKGTNGDKGNKGLEGDKGNIGGKGDKGDKGDKGDKGDKGDKGVNGDKGSKGDKGDQGTKGETGLS-IKGDKGDKGEFGLS------------------------------------IKGDKGVKGDQGYKGDKGDKGI---------KGDKGDKGIKGDQGIKGNKGDKGDKG 1167          

HSP 4 Score: 279.641 bits (714), Expect = 1.539e-74
Identity = 437/1226 (35.64%), Postives = 566/1226 (46.17%), Query Frame = 3
Query: 1146 SLL-SCPGRKGEKGFFGIPGIKGDIGNKGYQGHDGDIGEIGFKGEKGYEGPLGPSCSEVEQGF-RGTKGESG-------------------FP--GLRGAKGQRGYSGNKGIKGKPNFGTGINNPGETGSYGNLGVPGEKGNKGFIGDTGEKGFSGTGKQGPEGPRGDKGDDGVNGQVGMIGMPGIKGDKGSTYPICPFCEKGYKGIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEGRMGLLGSKGRQGYKGGKGFSGSMGDAGEIGYVTISGTTIPGVKGEKGNQGPKGNKGEFGEAGSRGRKGYSGLKGFKGLIGERGTSFSSGDPGDKGLRGENGKDGVSFAGIPGEKGLKGDKGNRGILGDVGSLSNCATRPITSKGFKGPQGAKGTSGSPGSAGKTGIVGNKGENGYPGKRGIDGDNGIPGSKGEEGETGIKGHAGRPGNLGKSGLQGLRGEYGVKGDLGIQGIPGRKGVMGDPGPNGYA-------MIGSKGDKGIKGLPGIYGAKGDKGRPGYIGIPGFKGETGLIGRS---------------------------------------GLKGDQGEIGEKGIKGFTFISNNPGDRGLLGNKGLKGFPGELG---------------NKGQVGVCTVRGDQGLRGYSGLIGDMGMKGEQGSKGIVGDYGAASRSGIMGRTGKI---GNQGLPGDQXXXXXXXXXXXXXXXXYIGIPGFEGDRGEKGNKGFPGFPGDIGQPGRLGNPGISTEGVXXXXXXXXXXXXXXXXXXXXXXXXXXKQGDSGIS-IPGRQGIKGEDGTIGLPGEMGEPGPRGDFGQKGNIGITGEFGLQGNRGDDGLKGDDGIPGLNGPRGFIGDIGFVGFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXELGLDGSMGGKGDNGPRGFNGPTGIPGSKGFEGDKGIRGDIGVKGFQGQHGEIGFPGLKGVSGENGRQXXXXXXXXXXXXXXXXVCMQPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEVGESIRGLQGRKGSTGLRGNIGIPGERGDKGIPGLQGKVGN------KGVKGDIGDKGFSGNIGDKGYSGISGDKGSFGVKGDKG------------FQGDVGMLGKSGLQGDRGQKGIIGFRGTRGIPGSMGLPGEIGEKGDVGPSGIGVKGLKGYQNAVGIKGRKGEKGLPGFPGRPGKVGDQGDKGPKGMK 4505
            SL+ +  G KGEKG  GI G         Y+G  G+IG  G KG KG +G L  S     QG  R  +GE+G                    P  GL+G++G +GY G++G KG         + G+ G +G+ G  G+KG+ G  G+TG KG  G      EG +G KGD G  G  G  G  GIKGDKGS         KG  GI+G                           D G  G  G+KG  G KG KG  G  G  G+ G +  +G  I G KG KG+ G KGNKG+ G+ G +G KG  G  G KG IG++G     GD GDKG++G+N     S  G  G+ G KGDKG+ GI GD G   N         G KG +G  G  G  G  G  G  G+KG  G  G +G  GDNGI G KG+ G+ GIKG +G   + G  G++G +G+ G+KGD G +G  G  G +G  G NG           G KGDKG KG  G  G  G+KG  G  G  G KG+ G IG S                                        +KG++G+ GE G         + G+ G +GNKG KG  G++G               NKG  G    +GD+G +G  G  GD G+KG++G+KG  GD G     GI G +G     G++G  GD+G  G KG KG KG+ G  G  G +G +G+KG KG  G  GD G  G  GN G   +                             +GD G     G +G KG  G  G  G+ G  G +G+ G KGN G  GE G +G +G  G KG  G  G  G +GF GD                                             G+ G++G KGD G  G  G  G+   KG  GDKGI+GD G +G +G  G  G  G +G  G+ G +G+ G KG+ G  GDKG+  +                                  + GE  +G +G KG  G +GN+GI G++GDKGI G++G  G+      KG KGD GDKG +G+ GDKG  G +GDKG+ G++GDKG             +GD G  G  G+ GD+G KG  G +GT+G  G + + G+ G+KG+ G S  G KG+KG Q   G KG KG+KG+ G  G  G  GDQG KG KG K
Sbjct:   92 SLVGNLRGEKGEKGQLGIMG---------YKGEKGEIGSQGIKGMKGSDG-LNGSTILFGQGLPRPYEGENGDVYIDKNTGIMYKKINGIWIPQVGLKGSQGDQGYKGDQGSKG---------DKGQKGEFGSAGFKGDKGDMGQKGETGAKGDKG---DKGEGSKGSKGDVGNKGDKGNKGDKGIKGDKGSE------GIKGDNGIKG---------------------------DNGTKGDNGTKGDNGTKGDKGDIGDNGIKGDKGDIGDNG--IKGDKGNKGDNGDKGNKGDKGDIGDKGMKGDKGDIGDKGDIGDKGMKGDKGDIGDKGMKGDN-----STKGDKGDNGTKGDKGDNGIKGDKGD--NGTKGDNGDNGTKGDKGDNGIKGDKGDKGTKGDKGDKGTKGDNGDKGTKGDNGIKGYKGDIGDKGIKGESGANADKGDKGIKGDKGDKGIKGDDGSKGDKGYNGEIGQKGDNGEKGDNGEKGDNGEKGDKGEKGDIGEKGDNGEKGDIGEKGNKGSKGDKGEIGSSILFGQGIPSPDLGNDGDIYIDDNTGILYKKLNGIWVPQTDIKGEKGDKGESGQSANKGDKGDKGNGGEIGNKGDKGSKGDIGDKGNKGDKGDGGIKGNKGDKGS---KGDKGSKGDKGDKGDEGIKGDKGNKGDKGDKGDIGSQGIKGESGSAVFKGDKGTKGDKGNKGDKGNKGDKGTNGDKGNKGDKGSKGDKGTKGDKGIKGDKGDKGSKGNKGSKGDKGDKGDSGDKGDKGDKGSKGYKGD-----KGDKGSKGYKGDKGDKGIKGNTGSKGDKGSKGDKGEKGSKGNKGEKGEKGFKGEKGSKGEKGSKGNKGDKGDKGFKGD--------------------------------------------NGIKGNIGVKGDKGDSGIKGENGL---KGDVGDKGIKGDKGNEGDKGDKGNKGEKGNRGDEGDKGIKGNKGDKGIKGSEGDKGIKGESGSKG-----------------------------DKGE--KGNKGYKGDKGDKGNLGIKGDKGDKGIKGVKGTKGDKGTKGVKGTKGDKGDKGTNGDKGDKGIKGTNGDKGNKGLEGDKGNIGGKGDKGDKGDKGDKGDKGDKGVNGDKGSKGDKGDQGTKGETG-LSIKGDKGDKGEFGLSIKGDKGVKGDQ---GYKGDKGDKGIKGDKGDKGIKGDQGIKGNKGDK 1163          

HSP 5 Score: 277.33 bits (708), Expect = 8.463e-74
Identity = 431/1220 (35.33%), Postives = 556/1220 (45.57%), Query Frame = 3
Query:  813 FQIEGRMYGRVGSDGPIGDKGIKGEKGLMGEIGQSGIDGARGLNGEKGLPGEAGPRGERGDRGNPGFPGDPGASGADGTRGRQGERGPKGVHGI----SGADGPRGSRGDKGPSGSLLSCPGRKGEKGFFGIPGIKGDIGNKGYQGHDGDIGEIGFKGEKGYEGPLGPSCSEVEQGFRGTKGESGFPGLRGAKGQRGYSGNKGIKGKPNFGTGINNPGETGSYGNLGVPGEKGNKGFIGDTGEKGFSG----TGKQGPEGPRGDKGDDGVNGQVGMIGMPGIKGDKGSTYPICPFCEKGYKGIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEGRMGLLGSKGRQGYKGGKGFSGSMGDAGEIGYVTISGTTIPGVKGEKGNQGPKGNKGEFGEAGSRGRKGYSGLKGFKGLIGERGTSFSSGDPGDKGLRGENGKDGVSFAGIPGEKGLKGDKGNRGILGDVGSLSNCATRPITSKGFKGPQGAKGTSGSPGSAGKTGIVGNKGENGYPGKRGIDGDNGIPGSKGEEGETGIKGHAGRPGNLGKS---GLQGLRGE---------------YGVKGDLGIQGIPGR---------------KGVMGDPGPNGYAM-------------IGSKGDKGIKG------------------LPGIYGAKGDKGRPGYIGIPGFKGETGLIGRSGLKGDQGEIGEKGIKGFTFISNNPGDRGLLGNKGLKGFPGELGNKGQVGVCTVRGDQGLRGYSGLIGDMGMKGEQGSKGIVG---------------------------------DYGAASRSGIMGRTGKIGNQGLPGDQXXXXXXXXXXXXXXXXYIGIPGFEGDRGEKGNKGFPGFPGDIGQPGRLGNPGISTE-GVXXXXXXXXXXXXXXXXXXXXXXXXXXKQGDSGISIPGRQGIKGEDGTIGLPGEMGEPGPRGDFG---QKGNIGITGEFGLQGNRGDDGLKGDDGIPGLNGPRGFIGDIGFVGFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXELGLDGSMGGKGDNGPRGFNGPTGIPGSKGFEGDKGIRGDIGVKGFQGQHGEIGFPGL------KGVSGENGRQXXXXXXXXXXXXXXXXVCMQPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEVGESIRGLQGRKGSTGLRGNIG---IPGERGDKGIPGLQGKVGNKGVKGD 4118
            + + G + G  G  G +G  G KGEKG +G  G  G+ G+ GLNG   L G+  PR   G+ G+     + G                K ++GI     G  G +G +G KG  GS     G KG+KG FG  G KGD G+ G +G      E G KG+KG +G  G   S+ + G +G KG  G  G++G KG  G  G+ GIKG         + G  G  G  G  G KG+KG IGD G KG  G     G +G +G +GD GD G  G  G IG  G+KGDKG         +KG KG                              D+G +G  G KG    KG KG +G+ GD G+            G+KG+KG+ G KG+ G+ G  G +G  G  G KG KG  G++G   + GD GDKG +G+NG            KG KGD G++GI G+ G+ ++   + I  KG KG +G KG  GS G  G  G +G KG+NG  G  G  GDNG  G KGE+G+ G KG  G  G++G+    G +G +GE                G  GD+ I    G                KG  GD G +G +              IG+KGDKG KG                    G  G+KGDKG  G  G  G +G  G  G  G KGD+G+IG +GIKG +  +   GD+G  G+KG KG  G  G+KG  G    +GD+G +G  G  GD G+KG++G KG  G                                 D G+    G  G  G  GN G  GD+G  G KG KG KG+KG  G  GF+G++G KG KG  G  GD G  G  G+ GI    GV GD                        +GDSGI   G  G+KG+ G  G+ G+ G  G +GD G   +KGN G  G+ G++GN+GD G+KG +G  G+ G  G  GD G  G                                  G+KG+ G  G++G KGD G +G  G  G  G KG +G KG +GD G KG  G  G+ G  G       KG+ G+ G  G  G KG  GD GDKG      V                 +    + G KG KGE G SI+G +G KG  G +G+ G   I G++GDKGI G QG  GNKG KGD
Sbjct:   91 WSLVGNLRGEKGEKGQLGIMGYKGEKGEIGSQGIKGMKGSDGLNGSTILFGQGLPRPYEGENGDVYIDKNTGIM-------------YKKINGIWIPQVGLKGSQGDQGYKGDQGS----KGDKGQKGEFGSAGFKGDKGDMGQKG------ETGAKGDKGDKGE-GSKGSKGDVGNKGDKGNKGDKGIKGDKGSEGIKGDNGIKG---------DNGTKGDNGTKGDNGTKGDKGDIGDNGIKGDKGDIGDNGIKGDKGNKGDNGDKGNKGDKGDIGDKGMKGDKGDIGDKGDIGDKGMKG------------------------------DKGDIGDKGMKGDNSTKGDKGDNGTKGDKGD-----------NGIKGDKGDNGTKGDNGDNGTKGDKGDNGIKGDKGDKGTKGDKGDKGTKGDNGDKGTKGDNG-----------IKGYKGDIGDKGIKGESGANADKGDKGI--KGDKGDKGIKGDDGSKGDKGYNGEIGQKGDNGEKGDNGEKGDNGEKGDKGEKGDIGEKGDNGEKGDIGEKGNKGSKGDKGEIGSSILFGQGIPSPDLGNDGDIYIDDNTGILYKKLNGIWVPQTDIKGEKGDKGESGQSANKGDKGDKGNGGEIGNKGDKGSKGDIGDKGNKGDKGDGGIKGNKGDKGSKGDKGSKGDKGDKGDEGIKGDKGNKGDKGDKGDIGSQGIKGESGSAVFKGDKGTKGDKGNKGDKGNKGDKGTNGDKGNKGDKGSKGDKGTKGDKGIKGDKGDKGSKGNKGSKGDKGDKGDSGDKGDKGDKGSKGYKGDKGDKGSKGYKGDKGDKGIKGNTGSKGDKGSKGDKGEKGSKGNKGEKGEKGFKGEKGSKGEKGSKGNKGDKGDKGFKGDNGIKGNIGVKGD------------------------KGDSGI--KGENGLKGDVGDKGIKGDKGNEGDKGDKGNKGEKGNRGDEGDKGIKGNKGDKGIKGSEGDKGIKGESGSKGDKGEKG--------------------------------NKGYKGDKGDKGNLGIKGDKGDKGIKGVKGTKGDKGTKGVKGTKGDKGDKGTNGDKGDKGIKGTNGDKGNKGLEGDKGNIGGKGDKGDKGDKGDKGDKGDKGVNGDKGSKGDKGDQGTKGETGLSIKGDKGDKGEFGLSIKGDKGVKGDQGYKGDKGDKGIKGDKGDKGIKGDQGIKGNKGDKGD 1165          

HSP 6 Score: 220.32 bits (560), Expect = 3.136e-56
Identity = 356/1036 (34.36%), Postives = 455/1036 (43.92%), Query Frame = 3
Query: 1188 FGIPGIKGDIGNKGYQGH---------------DGDI------GEIGFK------------GEKGYEGPLGPSCSEVEQGFRGTKGESGFPGLRGAKGQRGYSG------------------------NKGIKGKPNFGTGINNPGETGSYGNLGVPGEKGNKGFIGDTGEKGFSG-------TGKQGPEGPRGDKGDDGVNGQVGMIGMPGIKGDKGSTYPICPFCEKGYKGIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEGRMGLLGSKGRQGYKGGKGFSGSMGDAGEIGYVTISGTT-------IPGVKGEKGNQGPKGNKGEFGEAGSRGRKGYSGLKGFKGLIGERGTSFSSGDPGDKGLRGENGKDGVSFAGIPGEKGLKGDKGNRGILGDVGSLSNCATRPITSKGFKGPQGAKGTSGSPGSAGKTGIVGNKGENGYPGKRGIDGDNGIPGSKGEEGETGIKGHAGRPGNLGKSGLQGLRGEYGVKGDLGIQGIPGRKGVMGDPGPNGYAMIGSKGDKGIKGLPGIYGAKGDKGRPGYIGIPGFKGETGLIGRSGLKGDQGEIGEK------------GIKGFTFISNNP---------------------GDRG------------------LLGNKGLKGFPGEL---------------GNKGQVGVCTVRGDQGLRGYSGLIGDMGMKGEQGSKGIVGDYGAASRSGIMGRTGKI---GNQGLPGDQXXXXXXXXXXXXXXXXYIGIPGFEGDRGEKGNKGFPGFPGDIGQPGRLGNPGISTEGVXXXXXXXXXXXX-------XXXXXXXXXXXXXXKQGDSGIS-------IPGRQGIKGEDGTIGLPGE------------MGEPGPRGDFGQKGNIGITGEFGLQGNRGDDGLKGDDGIPGLNGPRGFIGDIGFVGFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXELGLDGSMGGKGDNGPRGFNGPTGIPGSKGFEGDKGIRGDIGVKGFQGQHGEIGFPGLKGVSG 3797
            + IPGI G  G+KG  G                +GD+       ++ FK            GEKG +G LG        G++G KGE G  G++G KG  G +G                        N GI  K   G  I   G  GS G+ G  G++G+KG  G  GE G +G        G++G  G +GDKGD G  G  G  G  G KGDKG+        +KG +GI+                              G  G+ G  G +G  G KG +G+ GD G+IG   I G         I G KG KG+ G KGNKG+ G+ G +G KG  G  G KG IG++G     GD GDKG++G+N     S  G  G+ G KGDKG+ GI GD G   N         G KG +G  G  G  G  G  G  G+KG  G  G +G  GDNGI G KG+ G+ GIKG +G   + G  G++G +G+ G+KGD G +G  G  G +G  G N     G KGD G KG  G  G KG+KG  G  G  G KG+ G  G  G KGD+GEIG              G  G  +I +N                      GD+G                   +GNKG KG  G++               GNKG  G    +GD+G +G  G  GD G+KG++G+KG  GD G     GI G +G     G++G  GD+G  G KG KG KG+ G  G  G +G +G+KG KG  G  GD G  G  GN G   +                      G+ G  G  G  G +GD GI          G +G KGE G+ G  GE             GE G +G+ G KG+ G  G+ G++GN G  G KGD GI G NG +G +GD G  G                              KG  G KG+ G  G  G +GD G +G  G  G  G KG EGDKGI+G+ G KG +G+ G  G+ G KG  G
Sbjct:   38 YSIPGIPGIKGDKGLTGSRIFLRNGIPQNELGTNGDLYINLLTDDLYFKNDSFWSLVGNLRGEKGEKGQLGI------MGYKGEKGEIGSQGIKGMKGSDGLNGSTILFGQGLPRPYEGENGDVYIDKNTGIMYKKINGIWIPQVGLKGSQGDQGYKGDQGSKGDKGQKGEFGSAGFKGDKGDMGQKGETGAKGDKGDKG-EGSKGSKGDVGNKGDKGNKGDKGIKGDKGSEGIK------------------------------GDNGIKGDNGTKGDNGTKGDNGTKGDKGDIGDNGIKGDKGDIGDNGIKGDKGNKGDNGDKGNKGDKGDIGDKGMKGDKGDIGDKGDIGDKGMKGDKGDIGDKGMKGDN-----STKGDKGDNGTKGDKGDNGIKGDKG--DNGTKGDNGDNGTKGDKGDNGIKGDKGDKGTKGDKGDKGTKGDNGDKGTKGDNGIKGYKGDIGDKGIKGESGANADKGDKGIKGDKGDKGIKGDDGSKGDKGYNGEIGQKGDN-----GEKGDNGEKGDNGEKGDKGEKGDIGEKGDNGEKGDIGEKGNKGSKGDKGEIGSSILFGQGIPSPDLGNDGDIYIDDNTGILYKKLNGIWVPQTDIKGEKGDKGESGQSANKGDKGDKGNGGEIGNKGDKGSKGDIGDKGNKGDKGDGGIKGNKGDKG---SKGDKGSKGDKGDKGDEGIKGDKGNKGDKGDKGDIGSQGIKGESGSAVFKGDKGTKGDKGNKGDKGNKGDKGTNGDKGNKGDKGSKGDKGTKGDKGIKGDKGDKGSKGNKGSKGDKGDKGDSGDKGDKGDKGSKGYKGDKGDKGSKGYKGDKGDKGIKGNTGSKGDKGSKGDKGEKGSKGNKGEKGEKGFKGEKGSKGEKGSKGNKGDKGDKGFKGDNGIKGNIGVKGDKGDSGIKGENGLKGDVGDKGIKG-----------------------------DKGNEGDKGDKGNKGEKGNRGDEGDKGIKGNKGDKGIKGSEGDKGIKGESGSKGDKGEKGNKGYKGDKGDKG 992          

HSP 7 Score: 102.064 bits (253), Expect = 4.189e-20
Identity = 88/190 (46.32%), Postives = 111/190 (58.42%), Query Frame = 3
Query: 3993 RGLQGRKGSTGLRGNIGIPGERGDKGIPGLQGKVGNKGVKGDIGDKGFSGN---IGDKGYSGISGDKGSFGVKGDKGFQGDVGMLGKS---GLQGDRGQKGIIGFRGTRGIPGSMGLPGEIGEKGDVGPSG-------IGVKGLKGYQNAVGIKGRKGEKGLPGFPGRPGKVGDQ---GDKGPKGMKNMN 4514
            +G +G KGS G +G+ G  G++GDKG  G  G  GN GVKGD GD G  G     GD G  GI GDKG+ G KGDKG +G+ G  G     G++G++G KGI G  G +GI G  G  G+ GEKG+ G  G       +G+KG KG +   G+KG KG+KG  G  G  G  GD+   GDKG KG+K  N
Sbjct:  856 KGFKGEKGSKGEKGSKGNKGDKGDKGFKGDNGIKGNIGVKGDKGDSGIKGENGLKGDVGDKGIKGDKGNEGDKGDKGNKGEKGNRGDEGDKGIKGNKGDKGIKGSEGDKGIKGESGSKGDKGEKGNKGYKGDKGDKGNLGIKGDKGDKGIKGVKGTKGDKGTKGVKGTKGDKGDKGTNGDKGDKGIKGTN 1045          

HSP 8 Score: 98.9821 bits (245), Expect = 3.423e-19
Identity = 76/169 (44.97%), Postives = 106/169 (62.72%), Query Frame = 3
Query: 4011 KGSTGLRGNIGIPGERGDKGIPGLQGKVGNKGVKGDIGDKGFSGNIGDKGYSGISGDKGSFGVKGDKGFQGDVGMLGKSGLQGDRGQKGIIGFRGTRGIPGSMGLPGEIGEKGDVGPSG-IGVKGLKGYQNAVGIKGRKGEKGLPGFPGRPGKVGDQGDKGPKGMKNMN 4514
            +GS G +G++G  G++G+KG  G++G  G++G+KGD G KG +G  GD G  G +G KG  G  GD G +GD G +G +G++GD+G KG  G +G +G  G +G  G  G+KGD+G  G IG KG+KG +  +G KG KG+    G  G  G  GD+GD G KG K  N
Sbjct:  232 EGSKGSKGDVGNKGDKGNKGDKGIKGDKGSEGIKGDNGIKGDNGTKGDNGTKGDNGTKGDKGDIGDNGIKGDKGDIGDNGIKGDKGNKGDNGDKGNKGDKGDIGDKGMKGDKGDIGDKGDIGDKGMKGDKGDIGDKGMKGDNSTKGDKGDNGTKGDKGDNGIKGDKGDN 400          

HSP 9 Score: 97.8265 bits (242), Expect = 7.758e-19
Identity = 80/175 (45.71%), Postives = 100/175 (57.14%), Query Frame = 3
Query: 3993 RGLQGRKGSTGLRGNIGIPGERGDKGIPGLQGKVGNKGVKGDIGDKGFSGNIGDKGYSGISGDKGSFGVKGDKGFQGDVGMLGKSGLQGDRGQKGIIGFRGTRGIPGSMGLPGEIGEKGDVGPSGI-GVKGLKGYQNAVGIKGRKGEKGLPGFPGRPGKVGDQGDKGPKGMKNMN 4514
            +G +G KG  G++G+ G  G +GD GI G  G  G+ G KGD G KG  G+IGD G  G  GD G  G+KGDKG +GD G  G  G +GD G KG+ G +G  G  G +G  G  G+KGD+G  G+ G    KG +   G KG KG+ G+ G  G  G  GD GD G KG K  N
Sbjct:  244 KGDKGNKGDKGIKGDKGSEGIKGDNGIKGDNGTKGDNGTKGDNGTKGDKGDIGDNGIKGDKGDIGDNGIKGDKGNKGDNGDKGNKGDKGDIGDKGMKGDKGDIGDKGDIGDKGMKGDKGDIGDKGMKGDNSTKGDKGDNGTKGDKGDNGIKGDKGDNGTKGDNGDNGTKGDKGDN 418          

HSP 10 Score: 88.5817 bits (218), Expect = 5.002e-16
Identity = 90/223 (40.36%), Postives = 111/223 (49.78%), Query Frame = 3
Query: 3984 ESIRGLQGRKGSTGLRGNIG---IPGE------RGDKGIPGLQGKVGNKGVKGDIGDKGFSGNIGDKGYSGISGDKGSFGVKGDKG---------------------------------FQGDVGMLGKSGLQGDRGQKGIIGFRGTRGIPGSMGLPGEIGEKGDVGPSG----IGVKGLKGYQNAVGIKGRKGEKGLPGFPGRPGKVGDQGDKGPKGMKNMN 4514
            E I+G +G KG  G +G+IG   I GE      +GDKG  G +G  G+KG KGD G  G  GN GDKG  G  G KG  G+KGDKG                                 ++GD G  G  G +GD+G KGI G  G++G  GS G  GE G KG+ G  G     G KG KG + + G KG KG+KG  G  G  G +G +GDKG  G+K  N
Sbjct:  685 EGIKGDKGNKGDKGDKGDIGSQGIKGESGSAVFKGDKGTKGDKGNKGDKGNKGDKGTNGDKGNKGDKGSKGDKGTKGDKGIKGDKGDKGSKGNKGSKGDKGDKGDSGDKGDKGDKGSKGYKGDKGDKGSKGYKGDKGDKGIKGNTGSKGDKGSKGDKGEKGSKGNKGEKGEKGFKGEKGSKGEKGSKGNKGDKGDKGFKGDNGIKGNIGVKGDKGDSGIKGEN 907          

HSP 11 Score: 87.8113 bits (216), Expect = 9.025e-16
Identity = 79/177 (44.63%), Postives = 98/177 (55.37%), Query Frame = 3
Query: 3993 RGLQGRKGSTGLRGNIGIPGERGDKGIPGLQGKVGNKGVKGD---IGDKGFSGNIGDKGYSGISGDKGSFGVKGDKGFQGDVGMLGKSGLQGDRGQKGIIGFRGTRGIPGSMGLPGEIGEKGDVGPSGIGVKGLKGYQNAVGIKGRKGEKGLPGFPGRPGKVGDQGDKGPKGMKNMN 4514
            +G++G   + G +G+ G  G++GD GI G +G  G KG  GD    GDKG +G  GDKG  G  GDKG  G KGD G +G  G  G  G +GD G KGI G  G     G  G+ G+ G+KG  G    G KG KGY   +G KG  GEKG  G  G  G+ GD+G+KG  G K  N
Sbjct:  367 KGMKGDNSTKGDKGDNGTKGDKGDNGIKGDKGDNGTKGDNGDNGTKGDKGDNGIKGDKGDKGTKGDKGDKGTKGDNGDKGTKGDNGIKGYKGDIGDKGIKGESGANADKGDKGIKGDKGDKGIKGDD--GSKGDKGYNGEIGQKGDNGEKGDNGEKGDNGEKGDKGEKGDIGEKGDN 541          

HSP 12 Score: 67.0106 bits (162), Expect = 2.009e-9
Identity = 77/188 (40.96%), Postives = 92/188 (48.94%), Query Frame = 3
Query: 3987 SIRGLQGRKGSTGLRGNIGIPGERGDKGIPGLQGKVGNKG------------VKGDIGDKGFSGNIGDKGYSGISGDKGSFGVKGDKGFQGDVGMLGKSGLQGDRGQKGIIGFRGTRGIPGSMGLPGEIGEKGDVGPSGIGVKGLKGYQNAVGIKGRKGEKGLPGFPGRPGKVGDQGDKGPKGMKNMN 4514
            ++RG +G KG  G+ G  G  GE G +GI G++G  G  G             +G+ GD     N G   Y  I+G        G KG QGD G  G  G +GD+GQKG  G  G +G  G MG  GE G KGD G  G G KG KG     G KG KG+KG+ G  G  G  GD G KG  G K  N
Sbjct:   96 NLRGEKGEKGQLGIMGYKGEKGEIGSQGIKGMKGSDGLNGSTILFGQGLPRPYEGENGDVYIDKNTGIM-YKKINGI--WIPQVGLKGSQGDQGYKGDQGSKGDKGQKGEFGSAGFKGDKGDMGQKGETGAKGDKGDKGEGSKGSKGDVGNKGDKGNKGDKGIKGDKGSEGIKGDNGIKGDNGTKGDN 280          
BLAST of Collagen IV NC1 domain-containing protein vs. TrEMBL
Match: A0A0X3NQW5 (Collagen IV NC1 domain-containing protein OS=Schistocephalus solidus OX=70667 GN=TR149272 PE=4 SV=1)

HSP 1 Score: 798.505 bits (2061), Expect = 0.000e+0
Identity = 768/1824 (42.11%), Postives = 962/1824 (52.74%), Query Frame = 3
Query:   75 FKNSYHYL-----LLLIMVSQSYYAQD----SDPDPFKCLRICTPDKCQCFGNKGRQGFPGPRGYQGVSGDKGDVGQFGMPGPKGYKGFTGAIGPQGRKGERGIPGSPGYPGKMGEMGFPGIRGDIGEKGLTGCDGQQGDFGNPGMNGLVGR---TGQPGERGDDGDRGLSIIPKYGLKGNKGSRGLLGRYGRKG---------EKGFKGIKGYSGIFGIKGNKGYVGPMGRRGPKGDSLGTVIIQSEKGSKGDKGLKGQSGIPCKGFQIEGRMYGRVGSDGPIGDKGIKGEKGLMGEIGQSGIDGARGLNGEKGLPGEAGPRGERGDRGNPGFPGDPGASGADGTRGRQGERGPKGVHGISGADGPRGSRGDKGPSGSLLSCPGRKGEKGFFGIPGIKGDIGNKGYQGHDGDIGEIGFKGEKGYEGPLGPS---CSEVEQGFRGTKGESGFPGLRGAKGQRGYSGNKGIKGKPNFGTGINNPGETGSYGNLGVPGEKGNKGFIGDTGEKGFSGTGKQGPEGPRGDKGDDGVNGQVGMIGMPGIKGDKGSTYPICPFCEKGYKGIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEGRMGLLGSKGRQGYKGGKGFSGSMGDAGEIGYVTISGTTIPGVKGEKGNQGPKGNKGEFGEAGSRGRKGYSGLKGFKGLIGERGTSFSSGDPGDKGLRGENGKDGVSFAGIPGEKGLKGDKGNRGILGDVGSLSNCATRPITSKG----FKGPQGAKGTSGSPGSAGKTGIVGNKGENGYPG---KRGIDGDNGIPGSKGEEGETGIKGHAGRPGNLGKSGLQGLRGEYGVKGDLGIQGIPGRKGVMGDPGPNGYAMIGSKGDKGIKGLPGIYGAKGDKGRPGYIGIPGFKGETGLIGRSGLKGDQGEIGEKGIKGFTFISNNPGDRGLLGNKGLKGFPGELGNKGQVGVCTVRGDQGLRGY---------------SGLIGDMGMKGEQGSKGIVGDYGAASRSGIMGRTGKIGNQGLPGDQXXXXXXXXXXXXXXXXYIGIPGFEGDRGEKGNKGFPG--FPGDIGQPGRLGNPGISTEGVXXXXXXXXXXXXXXXXXXXXXXXXXXKQGDSGISIPGRQGIKGEDGTIGLPGEMGEPGPRGDFGQKGNIGITGEFGLQGNRGDDGLKGDDGIPGLNGPRGFIGDIGFVGFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXELGLDGSMGGKGDNGPRGFNGPTGIPGSKGFEGDKGIRGDIGVKGFQGQHGEIGF---------PGLKGVSGENGRQXXXXXXXXXXXXXXXXVCMQPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEVGES---IRGLQGRKGSTGLRGNIGIPGERGDKGIP---GLQGKVGNKGVKGDIGDKGFSGNIGDKGYSGISGDKGSFGVKGDKGFQGDVGMLGKSGLQGDRGQKGIIGFRGTRGIPGSMGLPGEIGEKGDVGPSGIGVKGLKGYQNAVGIKGRKGEKGLPGFPGRPGKVGDQGDKGPKGMKNMNTXXXXXXXXXXXXXXXXXXXXXXXXXLPGDMGEIGPNGPIGYADNGFLYATHSQSKDFPPCHGGGSPLYNGYSLLAIHGDIDSVTMDLGTPGSCLKNFSTIPFVNCFLERNTFYGGRCHVNMRNSRSYWLSTLQSYMSSPQPPSKMDDYISRCSVCQTKTTVMAFHSQKSDWQMTKCPYGWQKLWAGFSFPMAVQASRSGSNQPFSSPGSCLKHFRSLPFIECNNHNSNCNHWRDGVSYYMTAVDSENQFVKAQGKVLKSQTDIMNSISKCVVCQRDMNIV 5357
            F+ +  YL     + ++++S S   QD    +  DPF+C RICTPD+CQC G KG QG PG  G  G+ G  G+ G FG  G  G +GF+G  G QGRKGE GI GSPGYPG  G MG PG+RG  GEKG TGC GQ+G  G PG NGL GR    G+PG RG  G  G +     G  G++G  G  G YG KG         E+G +G +GY G+ G+ G  G  GP             + I+ +KG KG KG++G  G PC   ++     GR G DGPIG KG KGE+GL GE   +G+DG  G  GEKGLPG  G RGE GD G+PG  G+PG  G DG  GR G  G  G  G  G DG  G  G KG  GS   C G KG KG  G PG+KG    +GYQG +G  G  G KG++G  G  GP    C   + G RG KG +G  G RG  G  G  G KG +G           G  G  G  G  G KG+ G  GD G+KG+ GTG  G  G RG  G+ G  G  G  G  G  GDKG   P+CP C  G  G++G+ G+ GE G  GI G++G  G++G PG  G  GL+G  G QG  G  G  G  GD G+ GYVTI    +  ++G++G  G  G  G  G+ G  G +G  G  GF G  GE+G +   G  GD G RGE G+ G+   GI GE G  GD G  G++G  G      T P    G     KGP+G +G  G PG AG+ G  G  GE G PG    RG  GD G  G  G+ G+ G+ G  G  G  G+SG  G +G  G  G+ G  GI G+KG  GD G  G   +   G KG +G PG+ G  G  G PG  G  G  G  GL G  G+KG  G  G+KG +G   +   PG  G  G  GL+G  G+ G  G+VG C  RG +G  G+                G+ GD+G  G  G  GI G+ G     G+ GR G+ G  G PG  G  G  G  G +G  G+ G  G  G +GEKG +GFPG    G  G+PG  G  G   E                  GLPGL GK GK G+ G    G  GI+G  G  G PGE G  G  G FGQ+G+ G  G  G +G RG  G  G  G+PG +GP+G  G+ G +G           G  G+ G   +        KG  G+ G  GL G  G  G  G +G  GP G+PG  G +G  GI GD G  G  G  G+ GF         PG  G+ G +GR+G  G +G+ G  G   +C     G +G +G  G  G +G KG  G  G  G KG  G S    +GL+G +G  G+ G  G+PG+ G KG P   GL+G  G+ G +G  GD G  G  G  G+ G  G KG  G +G  G  G+ G  G  GL+GD G+ G  GF G  G     GL G  G KG  G S  G  GLKG   + G  G +GE G PGF G PG  G  GDKG KG + +  G RG  G++G  GA G  G  GE G  G  G  G NG  GYAD GFL+A HSQ    P C      +Y GYSL+ + G+ +S+TMDLG+ GSC++ FS +PF +CF +  +   G C  NMRN RSYWLSTL+ YM+ P P  ++  YISRC VC+++T ++AFHSQ++D     CP GW+  W GFS PM V AS SG  QP  SPGSCL +FR+LPFIECNN+ + C HW+DG SY++ A+ S++QF K  G   KS  D++  +S+C VC+R M ++
Sbjct:   17 FRQARFYLGGPVWICILLISTSLITQDVSAQNAADPFRCQRICTPDQCQCVGIKGYQGVPGGIGPSGLMGPPGESGPFGGVGDPGDRGFSGNQGLQGRKGEPGIQGSPGYPGVHGFMGHPGLRGPKGEKGTTGCPGQRGLDGLPGANGLPGRDGLKGEPGSRGPKGAPGFADAGPRGPDGDRGDTGYSGPYGTKGDPGPAGPPGERGLRGPEGYKGLQGLSGPPGIDGP------------EITIEGQKGDKGWKGVRGPDGTPCSIQELTSGPRGRSGYDGPIGPKGDKGEQGLAGE---AGLDGPTGYPGEKGLPGREGDRGEPGDLGDPGRVGEPGDRGFDGDTGRPGPAGMPGEMGRPGVDGLAGYPGPKGRPGSSRDCTGPKGIKGETGFPGLKG---QRGYQGREGQPGLPGSKGDRGPAGRPGPPGRRCELGDMGMRGEKGNTGLAGRRGPPGAPGMPGKKGSRGSDGLPPLYAPAGLPGLPGPSGAMGPKGDPGPRGDPGDKGYRGTGDVGMPGDRGIPGEKGAPGHTGEEGRMGPMGDKGLPAPVCPACSNGEPGLRGDSGDNGEEGLAGIPGIRGPDGDQGRPGMPGPPGLMGLPGFQGPDGLPGIRGEKGDVGDTGYVTIRNRDV--IRGDRGEPGLSGLMGPPGDRGVMGAQGEMGEPGFPGRKGEQGLNGVMGSTGDFGDRGEPGEPGLDRDGIKGEAGDYGDDGYPGLIGPKGEKGE--TLPCEPPGEDLTLKGPKGFQGFKGEPGPAGEDGPRGPPGEKGIPGLGGVRGNVGDRGPDGPPGDMGDPGLPGLPGLDGVPGRSGDPGSQGPDGWPGEAGYPGIMGQKGERGDMGEPGALAVRISGIKGPRGFPGLKGEMGFFGLPGPKGDRGLSGYMGLEGYKGVKGLPGFKGDKGPRGIPGVIGPPGAFGPRGPTGLQGLAGQKGEMGEVGRCYGRGGKGEMGFMGEKGYKGIPGFFGAQGMDGDVGFPGLDGLPGIKGNRGEPGDFGLPGRMGQRGPSGWPGLSGLKGLPGPPGPRGESGFEGPVGEMGFQGEKGQRGFPGRSISGMKGEPGPSGLMGPVGE-----------------KGLPGLDGKVGKMGEPGRPGVGLVGIQGPQGFPGEPGEKGRRGMDGFFGQRGDDGPRGRPGDKGFRGRSGDLGPSGLPGPSGPKGRAGEEGNMG---------SPGLPGDIGEPGEPGVPTVLVKGEKGYPGRPGLKGYPGSFGLFGEKGSQGPIGLPGIDGLQGLWGIDGDPGFPGIDGPPGKPGFSGLPGVMGEPGQPGLPGYSGRRGPKGFQGVKGRKGLSPICPSATKGIKGDQGPSGLPGLEGIKGERGFDGRPGPKGFPGPSQPGPKGLKGERGPDGIPGRTGMPGQMGWKGEPGRLGLEGLDGDMGPEGPPGDDGAWGAPGRPGFFGRPGIKGRVGDRGPSGPIGEPGYPGLDGLRGDVGEPGRRGFDGQEGY---QGLEGPKGPKGRKGSSSFGYFGLKG---SPGDAGHRGEPGYPGFEGLPGFEGPPGDKGVKGYRGIRVGSRGPPGEAGPMGAPGDVGPKGEAGPRGFRGPDGLNGSTGYADGGFLFAVHSQRDSPPTCPEFTYEVYTGYSLVTLQGNENSMTMDLGSSGSCMRTFSLMPFASCFSQTPS---GACQTNMRNGRSYWLSTLEHYMTEPLPVDRIQRYISRCVVCESRTNLIAFHSQQAD-SAGGCPQGWEHAWNGFSMPMVVSASISGGVQPLESPGSCLMNFRALPFIECNNNEARCFHWQDGRSYWLKALSSDDQFAKPVGSTYKS--DLLRHVSRCTVCRRAMEVL 1780          
BLAST of Collagen IV NC1 domain-containing protein vs. TrEMBL
Match: A0A068XXM4 (Collagen alpha 1IV chain OS=Echinococcus multilocularis OX=6211 GN=EmuJ_000417600 PE=4 SV=1)

HSP 1 Score: 769.615 bits (1986), Expect = 0.000e+0
Identity = 744/1845 (40.33%), Postives = 935/1845 (50.68%), Query Frame = 3
Query:   72 KFKNSYHYL------LLLIMVSQSYYAQDSDPDPFKCLRICTPDKCQCFGNKGRQGFPGPRGYQGVSGDKGDVGQFGMPGPKGYKGFTGAIGPQGRKGERGIPGSPGYPGKMGEMGFPGIRGDIGEKGLTGCDGQQGDFGNPGMNGLVGRTGQPGERGDDGDRGLSIIPKYGLKGNKGSRGLLGRYGRKGEKGFKGIKGYSGIFGIKGN---KGYVGPMGRRGPKGDSLGTVIIQSEKGSKGDKGLKGQSGIPCKGFQIEGRMYGRVGSDGPIGDKGIKGEKGLMGEIGQSGIDGARGLNGEKGLPGEAGPRGERGDRGNPGFPGDPGASGADGTRGRQGERGPKGVHGISGADGPRGSRGDKGPSGSLLSCPGRKGEKGFFGIPGIKGDIGNKGYQGHDGDIGEIGFKGEKGYEGPLGPSCSEVEQGFRGTKGESGFPGLRGAKGQRGYSGNKGIKGKPNFGTGINNPGETGSYGNLGVPGEKGNKGFIGDTGEKGFSGTGKQGPEGPRGDKGDDGVNGQVGMIGMPGIKGDKGSTYPICPFCEKGYKGIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEGRMGLLGSKGRQGYKGGKGFSGSMGDAGEIGYVT-ISGTTIPGVKGEKGNQGPKGNKGEFGEAGSRG------------RKGYSGLKGFKGLIGERGTSFSSGDPGDKGLRGENGKDGVSFAGIPGEKGLKGDKGNRGILGDVGSLSNCA-TRPITSKGFKGPQGAKGTSGSPGSAGKTGIVGNKGENGYPGKRGIDGDNGIPGSKGEEGETGIKGHAGRPGNLGKSGLQGLRGEYGVKGDLGIQGIPGRKGVMGDPGPNGYAMIGSKGDKGIKGLPGIYGAKGDKGRPGYIGIPGFKGETGLIGRSGLKGDQGEIGEKGIKGFTFISNNP---------GDRGLLGNKGLKG---------------FPGELGNKGQVGVCTVRGDQGLRGYSGLIGDMGMKGEQGSKGIVGDYGAASRSGIMGRTGKIGNQGLPGDQXXXXXXXXXXXXXXXXYIGIPGFEGDRGEKGNKGFPGFPGDIGQPGRLGNPGISTEG---VXXXXXXXXXXXXXXXXXXXXXXXXXXKQGDSGISIPGRQGIKGE---------------DGTIGLPGEMGEPGPRGDFGQKGNIGITGEFGLQGNRGDDGLKGDDGIPGLNGPRGFIGDIGFVGFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXELGLDGSMGGKGDNGPRGFN------------GPTGIPGSKGFEGDKGIRGDIGVKGF---QGQHGEIGFPGLKGVSGENGRQXXXXXXXXXXXXXXXXVCMQPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEVGESIRGLQGRKGSTGL---RGNIGIPGERGDKGIPGLQGKVGNKGVKGDIGDKGFSGNIGDKGYSGISGDKGSFGVKGDKGFQGDVGMLGKSGLQGDRGQKGIIGFRGTRGIPGSMGLPGEIGEKGDVGPSGIGVKGLKGYQNAVGIKGRKGEKGLPGFPGRPGKVGDQGDKGPKGMKNMNTXXXXXXXXXXXXXXXXXXXXXXXXXLPGDMGEIGPNGPIGYADNGFLYATHSQSKDFPPCHGGGSPLYNGYSLLAIHGDIDSVTMDLGTPGSCLKNFSTIPFVNCFLERNTFYGGRCHVNMRNSRSYWLSTLQSYMSSPQPPSKMDDYISRCSVCQTKTTVMAFHSQKSDWQMTKCPYGWQKLWAGFSFPMAVQASRSGSNQPFSSPGSCLKHFRSLPFIECNNHNSNCNHWRDGVSYYMTAVDSENQFVKAQGKVLKSQTDIMNSISKCVVCQRDMNIV 5357
            +F+    YL      LL  +V+          DP +C  +CTPD+CQC G +G +G PG  G  G  G  GDVG  G+PG +G +G+ GA G QGRKGE G+ G PGY G  G  G PG RG  G +G TGC+G +G  G+PG+ G  G  G PGERG  G +G    P Y   G  G  G     G  G  GF+G  GY G  G +G    KGY G +G RGP G    T+ I+ +KG +G +G+ G+ G PC+  ++     GR G  GP G KG +GE+G  G     G DG  GL GEKGLPG  G RG+ GD G+PG  G+PG  G DG  GR G  G  G  G  G DG  G RG KG  GSL  C G +G KG  G PG KG +G +G QG  G  G  G  G +G  GP G  C   E G  G KGE+G PG RG  G  GY G +G++G           GE G  G+ G  G KG+ G  GD G+KG+ GT   G  GPRG  GD G  G+ G  G+ G  G+KG   P C  C  G  G +GE GE GE G  G  G +G  G++G+PG  G  GL G  G +G +G  G  G  G+ GE G+VT ++   IPG +G+ G  G  G  G+ G  G  G            R G  G+ G+ GL            PGDKG  GE G+DG    G  GE G  G  G  G  G  G + +C    P+  KG  G +G KG +GS G  G+TG  G KG  G  G+RG  GD G  G  G  G+ G+ G  G+ G  G  G  G+ G+ G+ GD G  G+ G KG  G+PG  G  + GS G+KG  GLPG  G +G  GR G +G+ G  G  G+ G  G  G  G  GEKG +G       P         G RG +G+KG +G                PG+ G  G  G+    G  GL G+ GL G  G KGE+G++G  G+ G    +G  GR G  G  G  G+                  IG+PGF       G KG+ G PG  G  GR G PGIS +G   V G PGL G  G  G  G+ G  GKPG+ G  G+  PG  G KG                 G +G  G MG  GP+G  G  G +G TG  GL G +GD G  GDDG+PG+ G RG   D G+ G                                    KG  G  G  G KG  GP G +            GPTG PG +G +G  G+ GD G  G+   QG +G +G PG  G  G  G  G  G  GL G  G  G C  P  G +G  G  G+ G  G +G  G+ G  GLKG  G+   G +GRKG  G     GN G+PG++GD+GIPG +    N+G  GD+G  G  G  G  G  G +G  G  G  G  G +G  G+ G SG  G  G  G  G  G RG  GS G  G  G  G  GP G    G  G     G  G +GE+G  GF G  G+ G  G+KG KG      G RG  G+ G  G +G +G  G++G  G  G  GPNG +G  D G+L+A HSQ    P C      LY GYSL+ + GD DS++MDLG+P SC + FS +PF +CF   ++   G CH NMRN RS+WLSTL+ YM+ P P  ++  YISRC VC+++T ++AFHSQ+  +    CP GW+  W GFS PM V A+ SG  QP  SPGSCL +FR+LPFIECNNH+ NC HW+DG SY++ A+    QF K  G   K  TD++  +S+C VC++ M ++
Sbjct:   22 QFRLHSSYLATVAIALLFSLVASVSAQIPWQIDPSRCQLLCTPDQCQCVGIRGPRGPPGEIGPVGAWGPPGDVGMPGVPGERGDRGYPGAPGLQGRKGEPGVQGPPGYAGIHGLQGHPGRRGIKGARGATGCEGPRGPDGSPGIAGPSGIQGPPGERGPRGPKG---NPGYMNAGPPGPPGQSSDVGYMGPLGFRGPPGYDGPIGERGPMGPKGYKGAVGPRGPPGRDAPTITIEGQKGDQGFRGVPGRDGRPCEVLELLSGPRGRSGYPGPRGPKGDRGERGTEGF---QGPDGYPGLPGEKGLPGREGDRGQVGDIGDPGRVGEPGDRGFDGDMGRMGLAGAPGERGPPGVDGLPGFRGPKGRPGSLRDCVGPRGRKGERGPPGAKGFLGYRGRQGPTGYKGPKGDPGPRGRPGPPGRMCETGEMGLVGEKGETGLPGRRGEDGDPGYMGPQGLRGPDGLTPMYGPVGEPGIPGSPGRVGPKGDPGLPGDRGDKGYRGTPTVGLPGPRGPSGDMGEPGRTGAPGLMGPAGEKGPRAPPCDACPSGEPGGRGETGEDGEPGQPGQPGQRGQDGDRGIPGARGLPGLPGLDGFRGPQGVAGIPGLKGEPGETGFVTLVNRQVIPGDQGDPGRDGLPGAMGDRGAMGPPGLPGFPGPRGPKGRPGIDGMVGYPGL------------PGDKGEPGEPGEDGYGVKGGQGEPGDMGITGPPGRKGSRGGVFDCPFVGPVYKKGEPGHRGPKGDTGSAGPHGQTGPQGTKGIQGLAGQRGSRGDRGPRGPSGLPGDMGMPGSRGQDGREGPPGPMGVPGQPGIAGDPGYPGLVGEKGERGEPGDPGSRVGGSPGEKGRPGLPGFPGDRGPPGRAGPMGVRGRPGPPGVSGIPGAPGRMGPPGEKGPQGLPSTRLPPGLPGLPGVQGPRGPVGSKGQRGPFGRCFGRGPTGDMGSPGDRGYSGMQGLRGPEGPVGLPGFQGLSGRPGEKGERGARGPTGEPGRPGPTGPAGRRGYAGRTGRSGE------------------IGLPGF------YGQKGYMGLPGMSGPKGRRGRPGISRDGRPGVTGRPGLEGPKGEKGIRGVDGKDGKPGEPGRPGVGSPGLPGAKGYRGPVGDPGPPGMDPIPGPVGDVGFMGRMGPKGPRGLPGPVGFTGREGLPGKKGDRGEPGDDGLPGIAGDRG---DEGYPG------------------------------PPPSFMKGRKGYGGRPGPKGFTGPTGLHGGIGPRGRPGIAGPTGRPGLRGLDGYPGLPGDTGTPGYPGRQGMNGSMGQPGDVGPPGFRGLIGHQGPPGLKGAKGRPGFCPIPPPGPKGEPGPPGRIGPDGPQGDKGIEGLPGLKGTPGQPRMGPEGRKGERGFDGQPGNAGLPGDQGDRGIPGYR---ANRGEPGDVGPPGLPGERGPIGLPGKNGPPGYRGAPGKDGVKGKPGLPGISGRPGPDGPFGDPGEPGPRGFEGSRGPVGRPGYPGPKGPKGKSGYGFVGRSGDFGEPGPQGERGYSGFQGTLGRTGLPGEKGYKGSAGYIPGPRGPTGERGPPGDMGYQGIKGQRGPQGYRGPDGPNGTLGLGDGGYLFAVHSQKDTPPSCPEFTHELYTGYSLVTLQGDDDSISMDLGSPSSCTRVFSIMPFASCF---SSPPSGACHFNMRNGRSFWLSTLEHYMTEPLPVERIQRYISRCVVCESRTNLVAFHSQRP-YLEESCPPGWEHAWNGFSMPMVVSAAVSGGVQPLHSPGSCLMNFRALPFIECNNHHGNCFHWQDGRSYWLRAMTFNEQFTKPAGATYK--TDLLRQVSRCSVCRKSMEML 1782          
BLAST of Collagen IV NC1 domain-containing protein vs. TrEMBL
Match: A0A4Z2DGT3 (Collagen alpha-1(IV) chain isoform 1 OS=Schistosoma japonicum OX=6182 GN=EWB00_001102 PE=4 SV=1)

HSP 1 Score: 768.459 bits (1983), Expect = 0.000e+0
Identity = 766/1870 (40.96%), Postives = 958/1870 (51.23%), Query Frame = 3
Query:   87 YHYLLLLIMVSQSYYAQDSDPDPFKCLRICTPDKCQCFGNKGRQGFPGPRGYQGVSGDKGDVGQFGMPGPKGYKGFTGAIGPQGRKGER------------GIPGSPGYPGKMGEMGFPGIRGDIGEKGLTGCDGQQGDFGNPGMNGLVGRTGQPGERGDDGDRGLSIIPKYGLKGNKGSRGLLGRYGRKGEKGFKGIKGYSGIFGIKGNKGYVGPMGRRGPKGDSLGTVIIQSEKGSKGDKGLKGQSGIPCKGFQIEGRMYGRVGSDGPIGDKGIKGEKGLMGEIGQSGIDGARGLNGEKGLPGEAGPRGERGDRGNPGFPGDPGASGADGTRGRQGERGPKGVHGISGADGPRGSRGDKGPSGSLLSCPGRKGEKGFFGIPGIKG---DIGNKGYQGHDGDIGEIGFKGEKGYEGPLGPSCSEVEQGFRGTKGESGFPGLRGAKGQRGYSGNKGIKGKP------NFGTGINNPGETGSYGNLGVPGEKGNKGFIGDTGEKGFSGTGKQGPEGPRGDKGDDGVNGQVGMIGMPGIKGDKGSTYPICPFCEKGYKGIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEGRMGLLGSKGRQGYKGGKGFSGSMGDAGEIGYVTISGT-TIPGVKGEKGNQGPKGNKGEFGEAGSRGRKGYSGLKGFKGLIGERGTSFSSGDPGDKGLRGENGKDGVSFAGI---PGEKGLKGDKGNRGILGDVGSLSNCATRPITSKGFKGPQGAKGTSGSPGSAGKTGIVGNKGENGYPGKRGIDGDNGIPGSKGEEGETGIKGHAGRPGNLGKSGL------------------QGLRGEYGVKGDLG--------IQGIPGRKGVMGDPG------------------------PNGYAMIGSKGDKGIKGLPGI---YGAKGDKGRPGYIGIPGFKGETGLIGRSGLKG------DQGEIGEKGIKGFTFISNNPGDRGLLGNKGLKGFPGELGNKGQVGVCTVRGDQGLRGYSGLIGDMGMKGEQGSKGIVGDYGAASRSGIMGR--------------TGKIGNQGLPGDQXXXXXXXXXXXXXXXXYIGIPGFEGDRGEKGNKGFPG---FPGDIGQPGRLGNPGISTE-GVXXXXXXXXXXXXXXXXXXXXXXXXXXKQGDSGISIPGRQGIKGEDGTIGLPGEMGEPGPRGDF-----GQKGNIGITGEFGLQGNRGDDGLKGDDGIPGLNGPRGFIGDIGFVGFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXELGLDGSMGGKGDNGPRGFNGPTGIPGSKGFEGDKGIRGDIGVKGF--QGQHGEIGFPGLKGVSGENGRQXXXXXXXXXXXXXXXXVCMQPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEVGESIRGLQGRKGSTGLRGNIGIPGERGDKGIPGLQGKVGNKGVKGDIGDKGFSGNIGDKGYSGISGDKGSFGVKGDKGFQGDVGMLGKSGLQGDRGQKGIIGFRGTRGIPGSMG---LPGEIGEKGDVGPSGIGVKGLKGYQNAVGIKGRKGEKGLPGFPGRPGKVGDQGDKGPKGMKNMNTXXXXXXXXXXXXXXXXXXXXXXXXXLPGDMGEIGPNGPIGYADNGFLYATHSQSKDFPPCHGGGSPLYNGYSLLAIHGDIDSVTMDLGTPGSCLKNFSTIPFVNCFLERNTFYGGRCHVNMRNSRSYWLSTLQSYMSSPQPPSKMDDYISRCSVCQTKTTVMAFHSQKSDW-QMTKCPYGWQKLWAGFSFPMAVQASRSGSNQPFSSPGSCLKHFRSLPFIECNNHNSNCNHWRDGVSYYMTAVDSENQFVKAQGKVLKSQTDIMNSISKCVVCQRDMNIV 5357
            Y + L+ + V+Q         DP++C R+CTP+KCQC G KG +G  GP G  G  G  G  G  G PG KG KG TG +G QG KGER            G  G PG+ G  G+ G PG  GD GE G  G      D G PG+ GL G  G  G +G  G  G  +I   GL G +G  G +G YG  G+ G  G  G  G  G+KG KG  GP G    KG     + I+ +KG KG +G +G  G PC    I  ++ G  G  GP+G KG KG++G +G+ G++G DG  G+ GEKGLPG  G RG  GD G PG  G+PG  G DG  GR G+ GPKG  G SG DG RG RG KG  G  + C G KG KG  G PG+KG   +IG +G  G DGD G+ G KGE+G  G     C++ + G  G KG  G PG+RG  G  G  G+ G++G+P              PG  GS+G  G+PG+ G      D GEKGF GTG+QGP GPRG  GD G+ G+ G  G PGI+G KG +   C FCE G  G  G+ GE GE+G  G  G  G  G  G  GD GR G+ G  GR+G  G  G  G  GD GE G + I+    +PG  G  G  G KG  G+ G  GS G +G  G KG  GL G  G     GDPGD+G+ G+ G DG +F G    PGE G  G  G++GI G  G        P  +KG  G +G  G  G PG  G  G  G KG  G PG RGI GD G  G  G +G+ G+ G  GRPG  G  GL                  +GL+G  G +GD G        I+G+PG  G +G PG                        P GY   G KG KG+KGLP +    GA G KG+PG  G  G KG  G+ G   ++G        G +G +G  G   +S  PGD   +G  GL+G PG+ G +G  G+    G +G +G SG    +G KG  G  G  G+ G   R G +GR              TG  G+QG  G QG  G KG  G  G  G  GIPG +  +G  G +G PG    PGD G+PG  G PG   E G  G  G  G  GP G PG+ G+ G PG +G SG+     QG +G++G+ G  G +G+PGP         G+KG  G+ G FGL G  GD G  G  G+PG +G  G  G  G  GF+G  G+ G                               G  G +G +G++G  GF GP G+   KG+ GDKG   D GV  F   GQ G  G PG  G+ G +G +G+ G  G  G  G +GV  +P                                         + G KG  G  G  G+ G  GD G PG  G  G  G  GD G +G  G+ GD+G+ G  G  G+ G  G +G  G  G  G  GL G RG  G  GF GT+G  GS G    PG+IG KG  G S    KG++G   + G+ G   E G+PG PG+ GK GD G+KG KG+ N   G+RG  G  G  G  G +G  G  G  G  G  G NG IG  D+GFL+  HSQ    P C    +P+Y GYSL+ + GD DS TMDLGTPGSCL+ FS +PF NCF + N    G C +NMRN RSYWLSTL+ YM SP     +  YISRC VCQ++T ++AFHSQ+ D  QM  CP GW+  W GFSFPMA+ +S +G  QP  SPGSCL+HFR+LPFIECNNH+ NC HW+DG SY+M ++    QF+K  G   K++T I+  +S+C VC+R M  +
Sbjct:   15 YSFALVQLGVTQQID------DPYRCQRVCTPEKCQCIGRKGIEGPFGPVGPPGEIGLFGGRGPPGNPGTKGEKGDTGQLGRQGFKGERGPQGPPGYPGQHGFDGYPGFMGAKGDKGDPGCFGDPGENGFPG------DSGRPGIKGLPGFPGNKGTKGTPGWAGRGLI---GLPGGRGDSGPMGEYGLPGQPGPMGDAGNRGPIGMKGFKGIRGPSGI---KGRPAEPITIEGQKGDKGQRGSRGSDGYPCT-LDIHAQI-GPQGPQGPVGFKGDKGDRGSIGDFGEAGFDGPPGIPGEKGLPGRHGDRGPPGDTGYPGSQGEPGKRGLDGEPGRIGDLGPKGDTGPSGIDGERGPRGQKGKPGGYVHCAGPKGIKGLPGFPGLKGFSGEIGREGPIGADGDKGDTGIKGERGVSGR---GCTDGQPGLPGPKGNMGSPGIRGPPGTSGLPGSIGLRGQPGDVADGALPGPTGTPGTPGSFGMKGLPGDSG------DPGEKGFPGTGEQGPAGPRGPPGDPGLVGRPGREGRPGIRGPKGVSIAACLFCEDGGIGRPGDTGEIGESGLPGRPGANGPDGELGDIGDPGRPGVPGPPGRKGMSGFPGPVGFKGDQGEPGILRITNQQVVPGEPGNSGYPGAKGEPGDLGGPGSFGARGEFGSKGRMGLPGISGVPGPEGDPGDRGVPGDPGLDGRAFVGETGDPGEFGFPGLPGSKGIPGLKGYCERL--HPQLTKGVSGDRGFPGDPGLPGEQGSQGRSGMKGITGLPGARGIPGDEGRLGVFGFKGDRGLPGLPGRPGFPGSVGLPGNNVSRGDPGFQGPPGSKGLKGMIGERGDFGRTSYASKGIKGLPGIPGSIGLPGNDGVPGLKGFPGRPGGRGVDGSFGPKGYP--GQKGYKGVKGLPSVSRELGAIGIKGKPGIPGSFGQKGARGIPGVCDIRGILGNPGSMGPVGRRGQPGNPGVSGEPGD---IGYDGLQGRPGQKGERGLSGLPGRIGLRGPKGRSGWAASVGPKGNLGRPGQPGNPGQQGRPGFVGRQGFKGEPGVSARMVTGATGDQGPMGIQGIRGEKGLHGLHGKTGKPGIPGIQ-LKGLPGRRGLPGSFGAPGDAGRPGFAGIPGAKGESGFPGRMGSKGEVGPPGFPGIDGIPGGPGNKGRSGL-----QGFRGDEGSKGDRGLIGDPGPAAPLLDGRQGRKGLAGVPGSFGLPGLTGDKGFSGAPGLPGDDGLPGQWGIPGSPGFKGQAGDPGLPS--------------------------RFGKPGDVGDRGESGRPGFQGPVGL---KGYLGDKG---DRGVTPFCPVGQPGRQGRPGDVGLPGLDGEKGNQGFSGPPGPKGQRGVTPEP-----------------------------------------IPGYKGDIGPVGPDGLQGAFGDPGFPGPTGVKGQPGPTGDPGFRGIQGDPGDRGFPGTPGQDGAPGRDGFRGNPGRPGNDGPPGLNGVRGLPGNPGFPGTKGSIGSQGPPGSPGQIGAKGFPGRSDYAQKGVRGDPGSPGVMG---EPGIPGLPGQRGKTGDPGEKGIKGLPNPFPGERGPTGDRGPRGDPGYRGMKGFIGEKGLRGPPGRNGTIGLDDSGFLFTVHSQDSQPPSCPIYTTPVYTGYSLVTLQGDDDSTTMDLGTPGSCLRKFSIMPFANCFAKVN----GNCQINMRNGRSYWLSTLEQYMLSPARVENIKPYISRCIVCQSRTWLVAFHSQRDDIGQM--CPPGWENAWNGFSFPMAIGSSSNGGVQPLESPGSCLQHFRALPFIECNNHDGNCFHWQDGRSYWMASIRQNEQFIKPVGTTYKTETGILQHVSRCSVCRRAMESL 1760          
BLAST of Collagen IV NC1 domain-containing protein vs. TrEMBL
Match: A0A068WVM5 (Collagen alpha 1IV chain OS=Echinococcus granulosus OX=6210 GN=EgrG_000417600 PE=4 SV=1)

HSP 1 Score: 762.296 bits (1967), Expect = 0.000e+0
Identity = 741/1839 (40.29%), Postives = 931/1839 (50.63%), Query Frame = 3
Query:   63 LLPKFKNSYHYLLLLIMVSQSYYAQDSDPDPFKCLRICTPDKCQCFGNKGRQGFPGPRGYQGVSGDKGDVGQFGMPGPKGYKGFTGAIGPQGRKGERGIPGSPGYPGKMGEMGFPGIRGDIGEKGLTGCDGQQGDFGNPGMNGLVGRTGQPGERGDDGDRGLSIIPKYGLKGNKGSRGLLGRYGRKGEKGFKGIKGYSGIFGIKGNKGYVGPMGRRGPKGDSLGTVIIQSEKGSKGDKGLKGQSGIPCKGFQIEGRMYGRVGSDGPIGDKGIKGEKGLMGEIGQSGIDGARGLNGEKGLPGEAGPRGERGDRGNPGFPGDPGASGADGTRGRQGERGPKGVHGISGADGPRGSRGDKGPSGSLLSCPGRKGEKGFFGIPGIKGDIGNKGYQGHDGDIGEIGFKGEKGYEGPLGPSCSEVEQGFRGTKGESGFPGLRGAKGQRGYSGNKGIKGKPNFGTGINNPGETGSYGNLGVPGEKGNKGFIGDTGEKGFSGTGKQGPEGPRGDKGDDGVNGQVGMIGMPGIKGDKGSTYPICPFCEKGYKGIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEGRMGLLGSKGRQGYKGGKGFSGSMGDAGEIGYVT-ISGTTIPGVKGEKGNQGPKGNKGEFGEAGSRG------------RKGYSGLKGFKGLIGERGTSFSSGDPGDKGLRGENGKDGVSFAGIPGEKGLKGDKGNRGILGDVGSLSNCA-TRPITSKGFKGPQGAKGTSGSPGSAGKTGIVGNKGENGYPGKRGIDGDNGIPGSKGEEGETGIKGHAGRPGNLGKSGLQGLRGEYGVKGDLGIQGIPGRKGVMGDPGPNGYAMIGSKGDKGIKGLPGIYGAKGDKGRPGYIGIPGFKGETGLIGRSGLKGDQGEIGEKGIKGFTFISNNP---------GDRGLLGNKGLKG---------------FPGELGNKGQVGVCTVRGDQGLRGYSGLIGDMGMKGEQGSKGIVGDYGAASRSGIMGRTGKIGNQGLPGDQXXXXXXXXXXXXXXXXYIGIPGFEGDRGEKGNKGFPGFPGDIGQPGRLGNPGISTEG---VXXXXXXXXXXXXXXXXXXXXXXXXXXKQGDSGISIPGRQGIKGE---------------DGTIGLPGEMGEPGPRGDFGQKGNIGITGEFGLQGNRGDDGLKGDDGIPGLNGPRGFIGDIGFVGFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXELGLDGSMGGKGDNGPRGFN------------GPTGIPGSKGFEGDKGIRGDIGVKGF---QGQHGEIGFPGLKGVSGENGRQXXXXXXXXXXXXXXXXVCMQPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEVGESIRGLQGRKGSTGL---RGNIGIPGERGDKGIPGLQGKVGNKGVKGDIGDKGFSGNIGDKGYSGISGDKGSFGVKGDKGFQGDVGMLGKSGLQGDRGQKGIIGFRGTRGIPGSMGLPGEIGEKGDVGPSGIGVKGLKGYQNAVGIKGRKGEKGLPGFPGRPGKVGDQGDKGPKGMKNMNTXXXXXXXXXXXXXXXXXXXXXXXXXLPGDMGEIGPNGPIGYADNGFLYATHSQSKDFPPCHGGGSPLYNGYSLLAIHGDIDSVTMDLGTPGSCLKNFSTIPFVNCFLERNTFYGGRCHVNMRNSRSYWLSTLQSYMSSPQPPSKMDDYISRCSVCQTKTTVMAFHSQKSDWQMTKCPYGWQKLWAGFSFPMAVQASRSGSNQPFSSPGSCLKHFRSLPFIECNNHNSNCNHWRDGVSYYMTAVDSENQFVKAQGKVLKSQTDIMNSISKCVVCQRDMNIV 5357
            L   +  +    LL  +V+ +        DP +C  +CTPD+CQC G +G +G PG  G  G  G  GDVG  G+PG +G +G+ GA G QGRKGE G+ G PGY G  G  G PG RG  G +G TGC+G +G  G+PG+ G  G  G PGERG  G +G       G  G  G  G +G  G  G +G  G  G  G  G  G KGY G +G RGP G    T+ I+ +KG +G +G+ G+ G PC+  ++     GR G  GP G KG +GE+G  G     G DG  GL GEKGLPG  G RG+ GD G+PG  G+PG  G DG  GR G  G  G  G  G DG  G RG KG  GSL  C G +G KG  G PG KG +G +G QG  G  G  G  G +G  GP G  C   E G  G KGE+G PG RG  G  GY G +G +G           GE G  G+ G  G KG+ G  GD G+KG+ GT   G  GPRG  GD G  G+ G  G+ G  G+KG   P C  C  G  G +GE GE GE G  G  G +G  G++G+PG  G  GL G  G +G +G  G  G  G+ GE G+VT ++   IPG +G+ G  G  G  G+ G  G  G            R G  G+ G+ GL            PGDKG  GE G+DG    G  GE G  G  G  G  G  G + +C    P+  KG  G +G KG +GS G  G+TG  G KG  G  G+RG  GD G  G  G  G+ G+ G  G+ G  G  G  G+ G+ G+ GD G  GI G KG  G+PG  G  + GS G+KG  GLPG  G +G  GR G +G+ G  G  G+ G  G  G  G  GEKG +G       P         G RG +G+KG +G                PG+ G  G  G+    G  GL G+ GL G  G KGE+G++G  G+ G    +G  GR G  G  G  G+                  IG+PGF       G KG+ G PG  G  GR G PGIS +G   V G PGL G  G  G  G+ G  GKPG+ G  G+  PG  G KG                 G +G  G MG  GP+G  G  G +G TG  GL G +GD G  GDDG+PG+ G RG   D G+ G                                    KG  G  G  G KG  GP G +            GP+G PG +G EG  G+ GD G  G+   QG +G +G PG  G  G  G  G  G  GL G  G  G C  P  G +G  G  G+ G  G +G  G+ G  GLKG  G+   G +GRKG  G     GN G+PG++GD+G PG +    N+G  GD+G  G  G  G  G  G +G  G  G  G  G +G  G+ G SG  G  G  G  G  G RG  GS G  G  G  G  GP G    G  G     G  G +GE+G  GF G PG+ G  G+KG KG      G RG  G+ G  G +G +G  G++G  G  G  GPNG +G  D G+L+A HSQ    P C      LY GYSL+ + GD DS++MDLG+P SC + FS +PF +CF   ++   G CH NMRN RS+WLSTL+ YM+ P P  ++  YISRC VC+++T ++AFHSQ+  +    CP GW+  W GFS PM V A+ SG  QP  SPGSCL +FR+LPFIECNNH+ NC HW+DG SY++ A+    QF K  G   K  TD++  +S+C VC++ M ++
Sbjct:   25 LHSSYLATVAIALLFSLVASASAQIPWQIDPARCQLLCTPDQCQCVGIRGPRGPPGEVGPVGAWGPPGDVGMPGVPGERGDRGYPGAPGLQGRKGEPGVQGPPGYAGIHGLQGHPGRRGIKGARGATGCEGPRGPDGSPGIAGPSGIQGPPGERGPRGPKGNPGYMNAGPPGPPGQSGDVGYMGPPGFRGPPGYDGPIGERGPMGPKGYKGAIGPRGPPGRDAPTITIEGQKGDQGFRGVPGRDGRPCEVLELLSGPRGRSGYPGPRGPKGDRGERGTEGF---QGPDGYPGLLGEKGLPGREGDRGQVGDIGDPGRVGEPGDRGFDGDMGRMGPAGAPGERGPPGVDGLPGFRGPKGRPGSLRDCVGPRGRKGERGPPGAKGFLGYRGRQGPTGYKGPKGDPGPRGRPGPPGRMCETGEMGLVGEKGETGLPGRRGEDGDPGYMGPQGPRGPDGLTPMYGPVGEPGIPGSPGRVGPKGDPGLPGDRGDKGYRGTPTVGLPGPRGPSGDMGEPGRTGAPGLMGPAGEKGPRAPPCDACPSGEPGGRGETGEDGEPGQPGQPGQRGQDGDRGIPGARGLPGLPGLDGFRGPQGVAGIPGLKGEPGETGFVTLVNRQVIPGDQGDPGRDGLPGAMGDRGAMGPPGLPGFPGPRGPKGRPGIDGMVGYPGL------------PGDKGEPGEPGEDGYGVKGAQGEPGDMGITGPPGRKGSRGGVFDCPFVGPVYKKGEPGYRGPKGDTGSAGPHGQTGPQGTKGIQGLAGQRGSRGDRGPRGPSGLPGDMGMPGSRGQDGREGPPGPMGVPGQPGIAGDPGYPGIVGEKGERGEPGDPGSRVGGSPGEKGRPGLPGFPGDRGPPGRAGPMGVRGRPGPPGVSGIPGAPGRMGPPGEKGPQGLPSTRLPPGLPGLPGVQGPRGSVGSKGQRGPFGRCYGRGPTGDMGSPGDRGYSGMQGLRGPEGPVGLSGFQGLSGRPGEKGERGARGPTGEPGRPGPTGPAGRRGYAGRSGRSGE------------------IGLPGF------YGQKGYMGLPGMSGPKGRRGRPGISRDGRPGVTGRPGLEGPKGEKGIRGVDGKDGKPGEPGRPGVGSPGLPGAKGYRGPVGDPGPPGMDPIPGPVGDVGFMGRMGPKGPRGLPGPVGFTGREGLPGKKGDRGEPGDDGLPGIAGDRG---DEGYPG------------------------------PPPSFMKGRKGYGGRPGPKGFTGPAGLHGGIGPRGRPGIAGPSGRPGLRGLEGYPGLPGDTGTPGYPGRQGMNGSMGQPGDVGPPGFQGLVGHQGPPGLKGAKGRPGFCPIPPPGPKGEPGPPGRIGPDGPQGDKGIAGLPGLKGTPGQPRMGPEGRKGERGFDGQPGNAGLPGDQGDRGTPGYR---ANRGEPGDMGPPGLPGERGPIGLPGKNGPPGYRGAPGKDGVKGKPGLPGISGRPGPDGPVGDPGEPGPRGFEGSRGPIGRPGYPGPKGPKGKSGYGFVGRSGDFGEPGPQGERGYSGFQGTPGRTGPPGEKGYKGSAGYIPGPRGPTGERGPPGDMGYQGIKGQRGPQGYRGPDGPNGTLGLGDGGYLFAVHSQKDTPPSCPEFTHELYTGYSLVTLQGDDDSISMDLGSPSSCTRVFSIMPFASCF---SSPPSGACHFNMRNGRSFWLSTLEHYMTEPLPVERIQRYISRCVVCESRTNLVAFHSQRP-YLEESCPPGWEHAWNGFSMPMVVSAAVSGGVQPLHSPGSCLMNFRALPFIECNNHHGNCFHWQDGRSYWLRAMTFNEQFTKPAGATYK--TDLLRQVSRCSVCRKSMEML 1782          
BLAST of Collagen IV NC1 domain-containing protein vs. TrEMBL
Match: W6U827 (Collagen alpha-1(IV) chain OS=Echinococcus granulosus OX=6210 GN=EGR_08623 PE=4 SV=1)

HSP 1 Score: 759.985 bits (1961), Expect = 0.000e+0
Identity = 744/1842 (40.39%), Postives = 936/1842 (50.81%), Query Frame = 3
Query:   63 LLPKFKNSYHYLLLLIMVSQSYYAQDSDPDPFKCLRICTPDKCQCFGNKGRQGFPGPRGYQGVSGDKGDVGQFGMPGPKGYKGFTGAIGPQGRKGERGIPGSPGYPGKMGEMGFPGIRGDIGEKGLTGCDGQQGDFGNPGMNGLVGRTGQPGERGDDGDRGLSIIPKYGLKGNKGSRGLLGRYGRKGEKGFKGIKGYSGIFGIKGNKGYVGPMGRRGPKGDSLGTVIIQSEKGSKGDKGLKGQSGIPCKGFQIEGRMYGRVGSDGPIGDKGIKGEKGLMGEIGQSGIDGARGLNGEKGLPGEAGPRGERGDRGNPGFPGDPGASGADGTRGRQGERGPKGVHGISGADGPRGSRGDKGPSGSLLSCPGRKGEKGFFGIPGIKGDIGNKGYQGHDGDIGEIGFKGEKGYEGPLGPSCSEVEQGFRGTKGESGFPGLRGAKGQRGYSGNKGIKGKPNFGTGINNPGETGSYGNLGVPGEKGNKGFIGDTGEKGFSGTGKQGPEGPRGDKGDDGVNGQVGMIGMPGIKGDKGSTYPICPFCEKGYKGIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEGRMGLLGSKGRQGYKGGKGFSGSMGDAGEIGYVT-ISGTTIPGVKGEKGNQGPKGNKGEFGEAGSRG------------RKGYSGLKGFKGLIGERGTSFSSGDPGDKGLRGENGKDGVSFAGIPGEKGLKGDKGNRGILGDVGSLSNCA-TRPITSKGFKGPQGAKGTSGSPGSAGKTGIVGNKGENGYPGKRGIDGDNGIPGSKGEEGETGIKGHAGRPGNLGKSGLQGLRGEYGVKGDLGIQGIPGRKGVMGDPGPNGYAMIGSKGDKGIKGLPGIYGAKGDKGRPGYIGIPGFKGETGLIGRSGLKGDQGEIGEKGIKGFTFISNNP---------GDRGLLGNKGLKG---------------FPGELGNKGQVGVCTVRGDQGLRGYSGLIGDMGMKGEQGSKGIVGDYGAASRSGIMGRTGKIGNQGLPGDQXXXXXXXXXXXXXXXXYIGIPGFEGDRGEKGNKGFPGFPGDIGQPGRLGNPGISTEG---VXXXXXXXXXXXXXXXXXXXXXXXXXXKQGDSGISIPGRQGIKGE---------------DGTIGLPGEMGEPGPRGDFGQKGNIGITGEFGLQGNRGDDGLKGDDGIPGLNGPRGFIGDIGFVGFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXELGLDGSMGGKGDNGPRGFN------------GPTGIPGSKGFEGDKGIRGDIGVKGF---QGQHGEIGFPGLKGVSGENGRQXXXXXXXXXXXXXXXXVCMQPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEVGESIRGLQGRKGSTGL---RGNIGIPGERGDKGIPGL---QGKVGNKGVKGDIGDKGFSGNIGDKGYSGISGDKGSFGVKGDKGFQGDVGMLGKSGLQGDRGQKGIIGFRGTRGIPGSMGLPGEIGEKGDVGPSGIGVKGLKGYQNAVGIKGRKGEKGLPGFPGRPGKVGDQGDKGPKGMKNMNTXXXXXXXXXXXXXXXXXXXXXXXXXLPGDMGEIGPNGPIGYADNGFLYATHSQSKDFPPCHGGGSPLYNGYSLLAIHGDIDSVTMDLGTPGSCLKNFSTIPFVNCFLERNTFYGGRCHVNMRNSRSYWLSTLQSYMSSPQPPSKMDDYISRCSVCQTKTTVMAFHSQKSDWQMTKCPYGWQKLWAGFSFPMAVQASRSGSNQPFSSPGSCLKHFRSLPFIECNNHNSNCNHWRDGVSYYMTAVDSENQFVKAQGKVLKSQTDIMNSISKCVVCQRDMNIV 5357
            L   +  +    LL  +V+ +        DP +C  +CTPD+CQC G +G +G PG  G  G  G  GDVG  G+PG +G +G+ GA G QGRKGE G+ G PGY G  G  G PG RG  G +G TGC+G +G  G+PG+ G  G  G PGERG  G +G       G  G  G  G +G  G  G +G  G  G  G  G  G KGY G +G RGP G    T+ I+ +KG +G +G+ G+ G PC+  ++     GR G  GP G KG +GE+G  G     G DG  GL GEKGLPG  G RG+ GD G+PG  G+PG  G DG  GR G  G  G  G  G DG  G RG KG  GSL  C G +G KG  G PG KG +G +G QG  G  G  G  G +G  GP G  C   E G  G KGE+G PG RG  G  GY G +G +G           GE G  G+ G  G KG+ G  GD G+KG+ GT   G  GPRG  GD G  G+ G  G+ G  G+KG   P C  C  G  G +GE GE GE G  G  G +G  G++G+PG  G  GL G  G +G +G  G  G  G+ GE G+VT ++   IPG +G+ G  G  G  G+ G  G  G            R G  G+ G+ GL            PGDKG  GE G+DG    G  GE G  G  G  G  G  G + +C    P+  KG  G +G KG +GS G  G+TG  G KG  G  G+RG  GD G  G  G  G+ G+ G  G+ G  G  G  G+ G+ G+ GD G  GI G KG  G+PG  G  + GS G+KG  GLPG  G +G  GR G +G+ G  G  G+ G  G  G  G  GEKG +G       P         G RG +G+KG +G                PG+ G  G  G+    G  G  G+ GL G  G KGE+G++G  G+ G    +G  GR G  G  G  G+                  IG+PGF       G KG+ G PG  G  GR G PGIS +G   V G PGL G  G  G  G+ G  GKPG+ G  G+  PG  G KG                 G +G  G MG  GP+G  G  G +G TG  GL G +GD G  GDDG+PG+ G RG   D G+ G                                    KG  G  G  G KG  GP G +            GP+G PG +G EG  G+ GD G  G+   QG +G +G PG  G  G  G  G  G  GL G  G  G C  P  G +G  G  G+ G  G +G  G+ G  GLKG  G+   G +GRKG  G     GN G+PG++GD+G PG    +G+ G+ G  G  G++G  G  G  G  G  G  G  GVKG  G  G  G  G  G  GD G+ G  GF G+R   G +G PG  G KG  G SG G  G  G     G  G +GE+G  GF G PG+ G  G+KG KG      G RG  G+ G  G +G +G  G++G  G  G  GPNG +G  D G+L+A HSQ    P C      LY GYSL+ + GD DS++MDLG+P SC + FS +PF +CF   ++   G CH NMRN RS+WLSTL+ YM+ P P  ++  YISRC VC+++T ++AFHSQ+  +    CP GW+  W GFS PM V A+ SG  QP  SPGSCL +FR+LPFIECNNH+ NC HW+DG SY++ A+    QF K  G   K  TD++  +S+C VC++ M ++
Sbjct:   13 LHSSYLATVAIALLFSLVASASAQIPWQIDPARCQLLCTPDQCQCVGIRGPRGPPGEVGPVGAWGPPGDVGMPGVPGERGDRGYPGAPGLQGRKGEPGVQGPPGYAGIHGLQGHPGRRGIKGARGATGCEGPRGPDGSPGIAGPSGIQGPPGERGPRGPKGNPGYMNAGPPGPPGQSGDVGYMGPPGFRGPPGYDGPIGERGPMGPKGYKGAIGPRGPPGRDAPTITIEGQKGDQGFRGVPGRDGRPCEVLELLSGPRGRSGYPGPRGPKGDRGERGTEGF---QGPDGYPGLLGEKGLPGREGDRGQVGDIGDPGRVGEPGDRGFDGDMGRMGPAGAPGERGPPGVDGLPGFRGPKGRPGSLRDCVGPRGRKGERGPPGAKGFLGYRGRQGPTGYKGPKGDPGPRGRPGPPGRMCETGEMGLVGEKGETGLPGRRGEDGDPGYMGPQGPRGPDGLTPMYGPVGEPGIPGSPGRVGPKGDPGLPGDRGDKGYRGTPTVGLPGPRGPSGDMGEPGRTGAPGLMGPAGEKGPRAPPCDACPSGEPGGRGETGEDGEPGQPGQPGQRGQDGDRGIPGARGLPGLPGLDGFRGPQGVAGIPGLKGEPGETGFVTLVNRQVIPGDQGDPGRDGLPGAMGDRGAMGPPGLPGFPGPRGPKGRPGIDGMVGYPGL------------PGDKGEPGEPGEDGYGVKGAQGEPGDMGITGPPGRKGSRGGVFDCPFVGPVYKKGEPGYRGPKGDTGSAGPHGQTGPQGTKGIQGLAGQRGSRGDRGPRGPSGLPGDMGMPGSRGQDGREGPPGPMGVPGQPGIAGDPGYPGIVGEKGERGEPGDPGSRVGGSPGEKGRPGLPGFPGDRGPPGRAGPMGVRGRPGPPGVSGIPGAPGRMGPPGEKGPQGLPSTRLPPGLPGLPGVQGPRGSVGSKGQRGPFGRCYGRGPTGDMGSPGDRGYSGMQGLRGPEGPVGFSGFQGLSGRPGEKGERGARGPTGEPGRPGPTGPAGRRGYAGRSGRSGE------------------IGLPGF------YGQKGYMGLPGMSGPKGRRGRPGISRDGRPGVTGRPGLEGPKGEKGIRGVDGKDGKPGEPGRPGVGSPGLPGAKGYRGPVGDPGPPGMDPIPGPVGDVGFMGRMGPKGPRGLPGPVGFTGREGLPGKKGDRGEPGDDGLPGIAGDRG---DEGYPG------------------------------PPPSFMKGRKGYGGRPGPKGFTGPAGLHGGIGPRGRPGIAGPSGRPGLRGLEGYPGLPGDTGTPGYPGRQGMNGSMGQPGDVGPPGFQGLVGHQGPPGLKGAKGRPGFCPIPPPGPKGEPGPPGRIGPDGPQGDKGIAGLPGLKGTPGQPRMGPEGRKGERGFDGQPGNAGLPGDQGDRGTPGYRANRGEPGDMGPPGLPGERGPIGLPGKNGPPGYRGAPGKDGVKGKPGLPGISGRPGPDGPVGDPGEPGPRGFEGSR---GPIGRPGYPGPKGPKGKSGYGFVGRSG---DFGEPGPQGERGYSGFQGTPGRTGPPGEKGYKGSAGYIPGPRGPTGERGPPGDMGYQGIKGQRGPQGYRGPDGPNGTLGLGDGGYLFAVHSQKDTPPSCPEFTHELYTGYSLVTLQGDDDSISMDLGSPSSCTRVFSIMPFASCF---SSPPSGACHFNMRNGRSFWLSTLEHYMTEPLPVERIQRYISRCVVCESRTNLVAFHSQRP-YLEESCPPGWEHAWNGFSMPMVVSAAVSGGVQPLHSPGSCLMNFRALPFIECNNHHGNCFHWQDGRSYWLRAMTFNEQFTKPAGATYK--TDLLRQVSRCSVCRKSMEML 1770          
BLAST of Collagen IV NC1 domain-containing protein vs. Ensembl Cavefish
Match: col4a2 (collagen, type IV, alpha 2 [Source:ZFIN;Acc:ZDB-GENE-070725-3])

HSP 1 Score: 410.994 bits (1055), Expect = 1.475e-118
Identity = 430/1256 (34.24%), Postives = 566/1256 (45.06%), Query Frame = 3
Query: 1785 DEGRMGLLGSKGRQGYKGGKGFSG----SMGDAGEIGYVTISGTTIPGVKGEKGNQGPKGNKGEFGEAGSRGRKGYSGLKGF--KGLIGERGTSFSSGDPGDKGLRGENGKDGVSFA------GIPGEKGLKGDKGNRGILGDVGSLSNCATRPITSKGFKGPQGAKGTSGSPGSAGKTG------------IVGNKGENGYPGKRGIDGDNGIPGSKGEEGETGIKGHAGR-----PGNLGKSGLQGLRGEYGVKGDLGIQGIPGRKGVMGDPGPNGYAMIGSKGDKGIKGL------PGIYGAKGDKGRPGYIGIPGFKGETGLIGRSGLKGDQGEIGEKGIKGFTFISNNPGDRGLLGNKGLKGFPGELGNKGQVGVCT---VRGDQGLRGYSGLIGDMGMKGEQGSKGIVGDYGAASRSGIMGRTGKIGNQGLPGDQXXXXXXXXXXXXXXXXYI----GIPGFEGDRGEKGNKGFPGFPGDIGQPGRLGNPGISTEGVXXXXXXXXXXXXXXXXXXXXXXXXXXKQGDSGIS-IPGRQGIKGEDGTIGLPGEMGEPGPRGDFGQKGNIGITGEFGLQGNRGDDGLKGDDGIPGLNGPRGFIGDIGFVGFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXELGLDGSMGGKGDNGPRGFNGPTGIPGSKGFEGDKGIRGDIGVKGFQGQHGEIGFPGLKGVSGENGRQXXXXXXXXXXXXXXXXVCMQPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEVGESIRGLQGRKGSTGLRGNIGIPGERGDKGIPGLQGKVGNKGVKGDIGDKGFSGN---IGDKGYSGISGDKGSFGVKGDKGFQGDVGMLGKSGLQGDRGQKGI----------------------IGFRGTRGIPGSMGLPGEIGEKGDVGPSGIGVKGLKGYQNAVGIKGRKGEKGLPGFPGRPGKVGDQGDKGPKGMKNMNTXXXXXXXXXXXXXXXXXXXXXXXXXLPGDMGEIGPNGPIGYADNGFLYATHSQSKDFPPCHGGGSPLYNGYSLLAIHGDIDSVTMDLGTPGSCLKNFSTIPFVNCFLERNTFYGGRCHVNMRNSRSYWLSTLQSYMSSPQPPSKMDDYISRCSVCQTKTTVMAFHSQKSDWQMTKCPYGWQKLWAGFSFPMAVQASRSGSNQPFSSPGSCLKHFRSLPFIECNNHNSNCNHWRDGVSYYMTAVDSENQFVKAQGKVLKSQTDIMNSISKCVVCQRDM 5348
            D G  G  G +G QG  G +G SG    ++     I ++    T   G  G++G+ G  G  GE G  G  G  G  GL G   +G +GE G     G PG  GL G +G  G  F       G PG+ G  G  GN+G+ G  G+ S    R   S G  GP+G  G +G  G+ G+ G              G +GE G PG +G  G  G+ G  G+ G+ G+KG  G      PG LG +GL G +G+ G  GD G  G PG +G+ G        MIG+KG+ G  GL      PG  G  G  G PG  G PG  G TG  G  G  GDQG  G  G  G   ++  PG    LG  G +G PG  G  G++G+     VRG QG+ G+ G+ G++G +G  G KG +G  G     GI GR G+ G+ GL G  G P        K +   I    G PG  G  G +G KG+PG PG  G  G  G P  ST+                           G +G +G   +PG++G+ G  G+ G+PG  G  GPRG+ G  G  G +G FG +G +GD G   D  +PG  GPRG  GD G  G +G  G  G +G  G  G E                  + GL G  G +G  G +G  G  GIPG+ G  G  G  G  G  G +G  G  G  G KG+ G  G              G   + + P            K                         I G QG  G  G RG  G+ G  G  G+PG     G+KG +G  G+ GF+G     GD G  G+ G  G  G KG KG QG +G+ GK G QGDRG  G                       +   G RG+PG  G+ G  G +G+ GP  IG  G +G+   +G +G+KG  GLPG PG PG  GD G  G  G+  +                       G  G PG  G   P  P      G+L   HSQS   P C  G S L++GYSLL   G   +   DLG  GSCL  F+T+PF+ C        G  C+   RN +SYWLST       P    ++  YISRCSVC+  +  +A HSQ  D  + +CP GW+ LW G+SF M   A   G  Q   SPGSCL+ FR+ PFIECN     C+++ +  S+++T+++   Q    + + LK+   +++ IS+C VC +++
Sbjct:  231 DPGMAGEWGQQGDQGDPGPRGESGLPVMTINQKNHIQHILTVYTHTAGPPGDQGDSGRPGEPGETGRTGPSGTDGAPGLHGPPGEGPVGEPGEKGYPGRPGLPGLAGPSGVTGQVFGAPKGIRGFPGDPGPSGYDGNQGLPGIPGNSS--WYRYHFSLGVPGPKGYAGLTGQQGAKGEQGDQGRGGQPGPRGFTGPRGEFGNPGLKGGRGVPGLFGKHGQHGDPGLKGADGEALGASPGPLGDAGLPGQQGDPGPAGDRGKSGYPGMEGMPG--------MIGTKGEAGPSGLQGELGKPGPAGIFGYPGLPGQSGNPGPPGHTGEEGPRGESGDQGNTGSPGPMGVKGVTGEPGSDAGLGQTGPRGDPGHPGFTGRIGLPGLKGVRGSQGMTGFQGMPGNLGPEGFSGEKGEIGFSGVRGEKGIKGRQGEKGDSGLIGPPGEPPVIKMDHMKKTMKGIKGDHGNPGDPGFTGPRGTKGYPGVPGQEGHHGLPGEP--STD--------------------------KGLEGSAGAEGLPGQKGMPGATGSQGIPGFPGMDGPRGEKGSPGAYGPSGGFGSKGVKGDKGDVID--LPGPTGPRGESGDSGPSGHKGFTGEPGDRGGSGFDGIEGMKGYPGDPG--------QQGLPGGEGLQGFPGNQGTKGWAGIPGTPGTPGRPGHTGQRGFPGLKGIFGLDGLKGQKGLQGLPGPDVWGTPGDPGVKGGKGEIGV-PSTEVGVPGSDGLKGSTGDAGDQGSPGQPGVPGPPGAHGIPGRQGFSGDPGPRGQKGLTGFPGPTGLPGFPSPFGSKGEQGVHGETGFTGPKGFPGDIGEKGLPGQPGISGRKGSKGDQGMMGLPGKPGFQGDRGPTGPKGDSGPPGLPGAPGAQGKLPVPVKVPGERGLPGPYGIRGPEGVRGESGP--IGPPGNQGF---LGPEGQKGMPGLPGIPGNPGFRGDVGTVGHPGLLGLE----------------------GPAGRPGTSGR--PGMPGRSVSVGYLLVKHSQSDQTPMCPVGMSKLWDGYSLLYFEGQEKAHNQDLGLAGSCLPRFNTMPFLYCNP------GDLCYYASRNDKSYWLSTTAPIPMMPVEEEEIKPYISRCSVCEAPSVAIAVHSQ--DITIPQCPLGWRSLWIGYSFLMHTAAGDEGGGQSLVSPGSCLEDFRTTPFIECNGAKGTCHYFANKNSFWLTSINQPFQ-TTPESETLKA-GQLLSRISRCQVCMKNL 1398          

HSP 2 Score: 277.33 bits (708), Expect = 5.490e-75
Identity = 367/1061 (34.59%), Postives = 478/1061 (45.05%), Query Frame = 3
Query:   96 LLLLIMVSQSYYAQDSDPDPFKCLRICTPDKCQCFGN--KGRQGFPGPRGYQGVSGDKGDVGQFGMPGPKGYKG------------------FTGAIGPQGRKGERGIPGSPGYPGKMGEMGF---PGIRGDIGEKGLTGCDGQQGDFGNPGMNGLVGRT-----------------GQPGERGDDGDRGLSIIP----------KYGLKGNKGSRGLLGRYGRKGEKG------------FKGIKGYSGIFGIKGNKGYVGPMGRRGPKGDS----LGTVIIQSEKGSKGDKGLKGQSGIPCKGFQIEGRMYGRVGSDGPIGDK---GIKGEKGLMGEIGQSGIDGARGLNGEKGLPGEAGPRGERGDRGNPGFPGDPGASGADGTRGRQGER------GPKGVHGISGA---------DGPRGSRGDKGPSGSLLSCPGRKGEKGFFGIPGIKGDIGNKGYQGHDGDIGEIGF------------KGEKGYEGPLGP----------SCSEVEQGFRGTKGESGFPGLRGAKGQRGY------SGNKGIKGKPNFGTGINNPGETGSYGNLGVPGEKGNKGFIGDTGEKGFSGTGKQGPEGPRGDKGDDGVNGQVGMIGMPGIKGDKGSTYPICPFCEKGYKGIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEGRMGLLGSKGRQGYKGGKGFSGSMGDAGEIGYVTISGTT-IPGVKGEKGNQGPKGNKGEFGEAGSRGRKGYSGLKGFKGLIGERGTSFSSGDPGDKGLRGENGKDGV--SFAGIPGEKGLKGDKGNRGILGDVGSLSNCATRPITSKGFKGPQGAKGTSGSPGSAGKTGIVGNKGENGYPGKRGIDGDNGIPGSKGEEGETGIKGHAGRPGNLGKSGL---QGLRGEYGVKGDLGIQGIPGRKGVMGDPGPNGYAMIGSKGDKGIKG----------LPGIYGAKGDKGRPGYIGIPGFKGETGLIGRSGLKGDQGEIGEKGIKGFTFISNNPGDRGLLGNKGLKGFPGELGNKGQVGVCTVRGDQGLRGYSGLIGDMGMKGEQ 2894
            +  +  +  SY+AQ +       L +    +C C  +   G+ G PGP G  G++G+ G  G  G PGP+G  G                  +T   GP G +G+ G PG PG  G+ G  G    PG+ G  GE G  G  G++G  G PG+ GL G +                 G PG  G DG++GL  IP            G+ G KG  GL G+ G KGE+G            F G +G  G  G+KG +G  G  G+ G  GD          + +  G  GD GL GQ G P                 GP GD+   G  G +G+ G IG  G  G  GL GE G PG AG  G  G  G  G PG PG +G +G RG  G++      GP GV G++G           GPRG  G  G +G  +  PG KG +G  G+ G +G  GN G +G  G+ GEIGF            +GEKG  G +GP             +  +G +G  G  G PG  G +G +GY       G+ G+ G+P+   G+      GS G  G+PG+KG  G  G  G  GF G      +GPRG+KG  G  G  G  G  G+KGDKG    +      G  G +GE G+ G +G+ G  G  G++G  G  G EG  G  G  G+QG  GG+G  G  G+ G  G+  I GT   PG  G  G +G  G KG FG  G +G+KG  GL G              G PGD G++G  G+ GV  +  G+PG  GLKG  G+ G  G  G           + G  G QG  G  G  G  G TG  G  G  G+P   G  G+ G+       GETG  G  G PG++G+ GL    G+ G  G KGD G+ G+PG+ G  GD GP      G KGD G  G          LP      G++G PG  GI G +G  G  G  G  G+QG +G +G KG   +   PG+ G  G+ G  G PG LG +G  G     G  G+ G S  +G + +K  Q
Sbjct:  181 ISFVCFLYLSYFAQLAFDICVCVLSLGDHGQCDCISSSPHGQPGLPGPSGDPGMAGEWGQQGDQGDPGPRGESGLPVMTINQKNHIQHILTVYTHTAGPPGDQGDSGRPGEPGETGRTGPSGTDGAPGLHGPPGE-GPVGEPGEKGYPGRPGLPGLAGPSGVTGQVFGAPKGIRGFPGDPGPSGYDGNQGLPGIPGNSSWYRYHFSLGVPGPKGYAGLTGQQGAKGEQGDQGRGGQPGPRGFTGPRGEFGNPGLKGGRGVPGLFGKHGQHGDPGLKGADGEALGASPGPLGDAGLPGQQGDP-----------------GPAGDRGKSGYPGMEGMPGMIGTKGEAGPSGLQGELGKPGPAGIFGYPGLPGQSGNPGPPGHTGEEGPRGESGDQGNTGSPGPMGVKGVTGEPGSDAGLGQTGPRGDPGHPGFTGR-IGLPGLKGVRGSQGMTGFQGMPGNLGPEGFSGEKGEIGFSGVRGEKGIKGRQGEKGDSGLIGPPGEPPVIKMDHMKKTMKGIKGDHGNPGDPGFTGPRGTKGYPGVPGQEGHHGLPGEPSTDKGLE-----GSAGAEGLPGQKGMPGATGSQGIPGFPGM-----DGPRGEKGSPGAYGPSGGFGSKGVKGDKGDVIDL-----PGPTGPRGESGDSGPSGHKGFTGEPGDRGGSGFDGIEGMKGYPGDPGQQGLPGGEGLQGFPGNQGTKGWAGIPGTPGTPGRPGHTGQRGFPGLKGIFGLDGLKGQKGLQGLPGPD----------VWGTPGDPGVKGGKGEIGVPSTEVGVPGSDGLKGSTGDAGDQGSPGQPGVPGPP--GAHGIPGRQGFSGDPGPRGQKGLTGFPGPTGLPGFPSPFGSKGEQGV------HGETGFTGPKGFPGDIGEKGLPGQPGISGRKGSKGDQGMMGLPGKPGFQGDRGPT-----GPKGDSGPPGLPGAPGAQGKLPVPVKVPGERGLPGPYGIRGPEGVRGESGPIGPPGNQGFLGPEGQKGMPGLPGIPGNPGFRGDVGTVGHPGLLGLEGPAGRPGTSGRPGMPGRSVSVGYLLVKHSQ 1184          

HSP 3 Score: 268.855 bits (686), Expect = 1.936e-72
Identity = 405/1198 (33.81%), Postives = 512/1198 (42.74%), Query Frame = 3
Query:  399 GFPGIRGDIGEKGLTGCDGQQGDFGNPGMNGLVGRTGQPGERGDDGDRGLSIIPKYGLKGNKGSRGLLGRY-------------GRKGEKGFKGIKGYSGIF------------------GIKGNKGYV-----GPMGRRGPKGDSLGTVIIQSEKGSKGDKGLKGQSGIPCKGF----QIEGRMYGRVGSDGPIGDKGIKGEKGLMGEIGQSGIDGARGLNGEKGLPGEAGPRGERGDRGNPGFPGDPGASGADGTRGRQGERGPKGVHGISGADGPRGSRGDKGPSGSLLSCPGRKGEKGFFGIPGIKGDIGNKGYQGHDGDIGEIGFKGEKGYEGPLGPSCSEVEQGFRGTKGESGFPGLRGAKGQRGYSGNKGIKGKPNF--GTGINNPGETGSYGNLGVPGEKGNKGFIGDTGEKGFSGT-------GKQGPEGPRGDKGDDGVNGQVGMIGMPGIKGDKGSTYPICPFCEKGYKGIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEGRMGLLGSKGRQGYKGGKGFSGSMGDAGEIGYVTISGTTIPGVKGEKGNQGPKGNKGEFGEAGSRGRKGYSGLKGFKGLIGERGTSFSSGDPGDKGLRGENGKDGVSFAGIPGEKGLKGDKGNRGILGDVGSLSNCATRPITSKGFKGPQGAKGTSGSPGSAGKTGIVGNKGENGYPGKRGIDGDNGIPGSKGEEGETGIKGHAGRPGNLGKSGLQGLRGEYGVKGDLGIQGIPGRKG-VMGDPGPNGYAMIGSKGDKGIKGLPGIYGAKGDKGRPGYIGIPGFKGETGLIGRSGL---KGDQGEIGEKGIKGFTFISNNPGDRGLLGNKGLKGFPGELGNKGQVGVCTVRGDQGLRG--YSGLIGDMGMKGEQGSKGIVGDYGAASRSGIMGRTGKIGNQGLPGDQXXXXXXXXXXXXXXXXYIGIPGFEGDRGEKGNKGFPGFPGDIGQPGRLGNPGISTEGVXXXXXXXXXXXXXXXXXXXXXXXXXXKQGDSGISIPGRQGIKGEDGTIGLPGEMGEPGPRGDFGQKGNIGITGEFGLQGNRGDDGLKGDDGIPGLNGPRGFIGDIGFVGFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXELGLDGSMGGKGDNGPRGFNGPTGIPGSKGF---EGDKGIRGDIGV---KGFQGQHGEIGFPGLKGVSGENGR 3809
            G PG  G  G+ G  GC+G  GD G PG  G  G  G P     DG +G       G KG +G  G                  G  GEKG   I     ++                  G  G    +     G  G  GP GD  G      ++G +GD G +G+SG+P         I+  +     + GP GD+G  G  G  GE G++G  G  G  G  G PGE GP GE G++G PG PG PG +G  G  G Q    PKG+ G  G  GP G  G++G        PG  G   ++      G  G KGY G  G       +G KG +G  G       +GF G +GE G PGL+G +G  G  G  G  G P      G       G  G+ G+PG++G+ G  GD G+ G+ G        G +G  GP G +G+ G  G  G+ G PG+ G  G+  P     E+G +G                       G++G  G  G MG+ G  G  G   G G +G  GD G  G+    G  +PG+KG +G+QG  G +G  G  G  G  G  G  GF G+ GE+G     G+ GD GL G  G+  V       +K +KG KG+ G  GD               GF GP+G KG  G PG  G  G+ G    +   G  G  G  G+PG KG  G TG +G  G PG  G  G +G  G YG  G  G +G+ G KG V+  PGP G    G  GD G  G  G  G  GD+G  G+ GI G KG  G  G+ GL   +G QG  G +G KG+  I   PG  G  G+ G +GFPG  G  G  G+   +G QGL G    G  GD G+KG +G  G+      ++  G+ G  G  G+ G  GDQG PG  G  G  G+ G  G  GF GD G +G KG  GFPG  G PG                                               P   G KGE G  G  G  G  G  GD G+KG  G  G  G +G++GD G+ G  G PG  G RG  G  G                                    V   GE GL G  G +G  G RG +GP G PG++GF   EG KG+ G  G+    GF+G  G +G PGL G+ G  GR
Sbjct:   92 GHPGQAGPRGKPGADGCNGTHGDAGTPGQRGYDGPRGNPVSEAQDGPKGFK-----GSKGERGGPGAPATSPGPPGFDGYPGAPGPPGEKGSCDISFVCFLYLSYFAQLAFDICVCVLSLGDHGQCDCISSSPHGQPGLPGPSGDP-GMAGEWGQQGDQGDPGPRGESGLPVMTINQKNHIQHILTVYTHTAGPPGDQGDSGRPGEPGETGRTGPSGTDGAPGLHGPPGE-GPVGEPGEKGYPGRPGLPGLAGPSGVTG-QVFGAPKGIRGFPGDPGPSGYDGNQG-------LPGIPGNSSWYRYHFSLGVPGPKGYAGLTGQ------QGAKGEQGDQGRGGQPGPRGFTGPRGEFGNPGLKGGRGVPGLFGKHGQHGDPGLKGADGEALGASPGPLGDAGLPGQQGDPGPAGDRGKSGYPGMEGMPGMIGTKGEAGPSGLQGELGKPGPAGIFGYPGLPGQSGNPGPPGHTGEEGPRG---------------------ESGDQGNTGSPGPMGVKGVTGEPGSDAGLGQTGPRGDPGHPGFTGRIG--LPGLKGVRGSQGMTGFQGMPGNLGPEGFSGEKGEIGFSGVRGEKGIKGRQGEKGDSGLIGPPGEPPVIKMDH-MKKTMKGIKGDHGNPGD--------------PGFTGPRGTKGYPGVPGQEGHHGLPGEPSTDK--GLEGSAGAEGLPGQKGMPGATGSQGIPGFPGMDGPRGEKGSPGAYGPSGGFGSKGVKGDKGDVIDLPGPTGPR--GESGDSGPSGHKGFTGEPGDRGGSGFDGIEGMKGYPGDPGQQGLPGGEGLQGFPGNQGTKGWAGIPGTPGTPGRPGHTGQRGFPGLKGIFGLDGLKGQKGLQGLPGPDVWGTPGDPGVKGGKGEIGV-----PSTEVGVPGSDGLKGSTGDAGDQGSPGQPGVPGPPGAHGIPGRQGFSGDPGPRGQKGLTGFPGPTGLPG----------------------------------------------FPSPFGSKGEQGVHGETGFTGPKGFPGDIGEKGLPGQPGISGRKGSKGDQGMMGLPGKPGFQGDRGPTGPKG----------------DSGPPGLPGAPGAQGKLPVPVKVPGERGLPGPYGIRGPEGVRGESGPIGPPGNQGFLGPEGQKGMPGLPGIPGNPGFRGDVGTVGHPGLLGLEGPAGR 1159          

HSP 4 Score: 262.307 bits (669), Expect = 2.771e-70
Identity = 403/1213 (33.22%), Postives = 536/1213 (44.19%), Query Frame = 3
Query:  201 GNKGRQGFPGPRGYQGVSGDKGDVGQFGMPGPKGYKGFTGAIGPQG---RKGERGIPGSPGY-PGKMGEMGFPGIRGDIGEKGLTG----CDGQQGDFGNPGMNGLVGRTGQPGERGDDGDRGLSIIPKYGLKGNKGSRGLLGRYGRKGEKGFKGIKGYSGIFGIKGN-KGYVGPMGRRGPKGDSLGTVIIQSEKGSKGDKGLKGQSGIPCKGFQIEGRMYGRVGSDGPIGDKGIKGEKGLMGEIGQSGIDGARGLNGEKGLPGEAGPRGERGD-----RGNPGFPGDPGASGADGTRG---------------RQGERGPKGVHGISGADGPRGSRGD------------KGPSGSLLSCPGRKGEKGFFGIPGIKGDIGNKGYQGHDGD--------IGEIGFKGEKGYEGPLGPSCSEVEQGFRGTKGESGFPGLRGAKGQRGYSGNKGIKGKPNFGTGINNPGETGSYGNLGVPGEKGNKGFIGDTGEKGFSG----------TGKQGPE------GPRGDKGDDGVNGQVGMIGMPGIKGDKGSTYPICPFCEKGYKGIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEGRMGLLGSKGRQGYKGGKGFSGSMGDAGEIGYVTISGT--TIPGVKGEKGNQGPKGNKGEFGEAGSRGRKGYSGLKGFKGLIGE-------RGTSFSSGDPGDKGLRGENGKDGVS-FAGIPGEKGLKGDKG---------NRGILGDVGSLSNCA--TRPITSKGFKGPQGAKGTSGSPGSAGKTGIVGNKGENGYPG---KRGIDGDNGIPGSKGEEGETGIKGHAGRPGNLGKSGLQGLRGEYGVKGDLGIQGIPGRKGVMGDPGPNGYAMIGSKGDKGIKGLPGIYGAKGDKGRPGYIGIPGFKGETGLIGRSGLKGDQGEIGEK---------------GIKGFTFISNNPGDRGLLGNKGLKGFPGELGNKGQVGVCTVRGDQGLRGYSGLIGDMGMKGEQGSKGIVGDYGAASRSGIMGRTGKIGNQGLPGDQXXXXXXXXXXXXXXXXYIGIPGFEGDRGEKGNKGFPG-------------FPGDIGQPGRLGNPGIS----TEGVXXXXXXXXXXXXXXXXXXXXXXXXXXKQGDSG-ISIPGRQGIKGEDGTIGLPGEMGEPGPRGDFGQKGNIGITGEFGLQGNRGDDGLKGDDGIPGLNGPRGFI 3473
            G  G +G PG  G  G  GD G  GQ G  GP+G        GP+G    KGERG PG+P   PG  G  G+PG  G  GEKG       C      F     +  V      G+ G       S   + GL G  G  G+ G +G++G++G  G +G SG+  +  N K ++            + TV   +  G  GD+G  G+ G P           G  G  GP G  G  G  G  GE G  G  G +G  G  GLPG AGP G  G      +G  GFPGDPG SG DG +G                 G  GPKG  G++G  G +G +GD             GP G   + PG KG +G  G+ G  G  G+ G +G DG+        +G+ G  G++G  GP G      ++G  G  G  G PG+ G KG+ G SG +G  GKP        PG  G  GN G PG  G +G  G++G++G +G          TG+ G +      GPRGD G  G  G++G+ G+ G++G +G T         G++G+ G LG  G +G  G               + G  G+ G KG +G +G KG SG +G  GE   + +     T+ G+KG+ GN    G+ G  G  G++G  G  G +G  GL GE        G++ + G PG KG+ G  G  G+  F G+ G +G KG  G         ++G+ GD G + +    T P    G  GP G KG +G PG  G +G  G +G  GYPG   ++G+ G  G+ G  G +G  G  G  G PG  G+ G  G RG  G+KG  G+ G+ G+KG+ G PGP+            + G PG  G KG KG    IG+P    E G+ G  GLKG  G+ G++               GI G    S +PG RG    KGL GFPG  G  G       +G+QG+ G +G  G  G  G+ G KG+ G      + GI GR G  G+QG+ G                    G PGF+GDRG  G KG  G              P  +  PG  G PG       EGV                           +G+SG I  PG QG  G +G  G+PG  G PG  G  G  G +G  G  GL+G  G  G  G  G+PG +   G++
Sbjct:   95 GQAGPRGKPGADGCNGTHGDAGTPGQRGYDGPRGNPVSEAQDGPKGFKGSKGERGGPGAPATSPGPPGFDGYPGAPGPPGEKGSCDISFVCFLYLSYFAQLAFDICVCVLSL-GDHGQCDCISSSPHGQPGLPGPSGDPGMAGEWGQQGDQGDPGPRGESGLPVMTINQKNHI----------QHILTVYTHT-AGPPGDQGDSGRPGEP-----------GETGRTGPSGTDGAPGLHGPPGE-GPVGEPGEKGYPGRPGLPGLAGPSGVTGQVFGAPKGIRGFPGDPGPSGYDGNQGLPGIPGNSSWYRYHFSLGVPGPKGYAGLTGQQGAKGEQGDQGRGGQPGPRGFTGPRGEFGN-PGLKGGRGVPGLFGKHGQHGDPGLKGADGEALGASPGPLGDAGLPGQQGDPGPAG------DRGKSGYPGMEGMPGMIGTKGEAGPSGLQGELGKPGPAGIFGYPGLPGQSGNPGPPGHTGEEGPRGESGDQGNTGSPGPMGVKGVTGEPGSDAGLGQTGPRGDPGHPGFTGRIGLPGLKGVRGSQGMT---------GFQGMPGNLGPEGFSGEKG---------------EIGFSGVRGEKGIKGRQGEKGDSGLIGPPGEPPVIKMDHMKKTMKGIKGDHGN---PGDPGFTGPRGTKGYPGVPGQEGHHGLPGEPSTDKGLEGSAGAEGLPGQKGMPGATGSQGIPGFPGMDGPRGEKGSPGAYGPSGGFGSKGVKGDKGDVIDLPGPTGPRGESGDSGPSGHKGFTGEPGDRGGSGFDGIEGMKGYPGDPGQQGLPGGEGLQGFPGNQGTKGWAGIPGTPGTPGRPGHTGQRGFPGLKGIFGLDGLKGQKGLQGLPGPD------------VWGTPGDPGVKGGKGE---IGVP--STEVGVPGSDGLKGSTGDAGDQGSPGQPGVPGPPGAHGIPGRQGFSGDPGPRG---QKGLTGFPGPTGLPGFPSPFGSKGEQGVHGETGFTGPKGFPGDIGEKGLPG------QPGISGRKGSKGDQGMMG------------------LPGKPGFQGDRGPTGPKGDSGPPGLPGAPGAQGKLPVPVKVPGERGLPGPYGIRGPEGV---------------------------RGESGPIGPPGNQGFLGPEGQKGMPGLPGIPGNPGFRGDVGTVGHPGLLGLEGPAGRPGTSGRPGMPGRSVSVGYL 1178          

HSP 5 Score: 194.897 bits (494), Expect = 2.036e-49
Identity = 396/1182 (33.50%), Postives = 496/1182 (41.96%), Query Frame = 3
Query:  660 IFGIKGNKGY--VGPMGRRGPKGDSLGTVIIQSEKGSKGDKGLKGQSGIPCKGFQIEGRMYGRVGSDGPIGDKGIKGEKGLMGEIGQSGIDGARGLNGEKGLPGEAGPRGERGDRGNPGFPG-DPGASGADGTRGRQGERGPKGVHGISGADGPRGSR---------------GDKGPSGSLLSCPGRKGEKGFFGIPGIKGDIGNKGYQGHDGDIGEIGFKGEKGYEGPLGPSCSEVEQ---------GFRGTKGESGFPGLRGAKGQRGYSGNKGIKGKPNFGTGINNPGETGSYGNLGVPGEKGNKGFIGDTGEKGFSGTGKQ---GPEGPRGDKGDDGVNGQVGMIGMPGIKGDKGSTYPICPFC-----EKGYKGIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEGRMGLLGSKGRQGYKGGKGFSGSMGDAGEIGYVTISGTTIPGVKGEKGNQGPKGNKGEFGEAGSRGRKGYSGLKGFKGLIGERGTSFSSGDPGDKGLRGENGKDGVS----FAGIPGEKGLKGDKGNRGILGDVGSLSNCATRPITSKGFKGPQGAKGTSGSPGSAGKTGIVGNKGENGYPGKRGIDGDNGIPGSKGEEGETGIKGHAGRPGNLGKSGLQGLRGEYGVKGDLGIQGIPGRKGVMGDP---GPNGY-----------AMIGSKGDKGIKGLPGIYGAKGDKGRPGYIGIPGFKGETGLIGR-------SGLKGDQGEIGEKGIKGFTFISNNPGDRGLLGNKGLKGFPGELGNKGQVGVCTVRGDQG----LRGYSGLIGDMGMKGEQGSKGIVGDYGAASRS------GIMGRTGKIGNQGLPGDQXXXXXXXXXXXXXXXXYIGIPGFEGDRGEKGNKGFPGFPGDIGQPGRLGN---PGIS-TEGVXXXXXXXXXXXXXXXXXXXXXXXXXXKQG-------DSGISIPGRQGIKGEDGTI------------------GLPGEM---GEPGPRGDFGQKGNIGITGEFGLQGNRGDDGLKGDDGIPGLNGPRGFIGDIGFVGFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXELGLDGSMGGKGDNGPRGFNG-------------------PTGIPGSKGFEGDKGIRGDIGVK------------GFQGQHGEIGFPGLKGVSGENG 3806
             F  KG +G                 G   +Q   G KGD+G  G +G    G        G+ G  G  G  G  G  G  G  GQ G DG RG    +   G  G +G +G+RG PG P   PG  G DG  G  G  G KG   IS       S                GD G    + S P      G  G+PG  GD G  G  G  GD G+ G +GE G         + ++          G  G +G+SG PG  G  G+ G SG  G  G          PGE    G +G PGEKG  G  G  G  G SG   Q    P+G RG  GD G +G  G  G+PGI G+  S++    F       KGY G+ G+ G +GE G+ G  G  G +G        G  G  G+ G +G +G  G  G  G  G+ G     G  +    G  G+ G  G +G+ G AG RG+ GY G++G  G+IG +G +      G  GL+GE GK G +    + G+PG+ G  G  G+ G  G  G   +       + G  GP G KG +G PGS    G  G +G+ G+P   G  G  G+PG KG  G  G+ G  G PGNLG  G  G +GE G  G  G +GI GR+G  GD    GP G             M G KGD G  G PG  G +G K   GY G+PG +G  GL G         G  G +G  G+KG+ G T     PG  G+ G +G KG PG  G  G  G   V+GD+G    L G +G  G+ G  G  G KG  G+ G    S      G+ G  G  G QGLPG +                  G+ GF G++G KG  G PG PG  G+PG  G    PG+    G+ G  G  GL G  G            K G        + + +PG  G+KG  G                    G+PG     G+PGPRG  G  G  G TG  G     G  G +G  G  G  GP+GF GDIG  G  G  G  GRKG KG++G                     +GL G  G +GD GP G  G                   P  +PG +G  G  GIRG  GV+            GF G  G+ G PGL G+ G  G
Sbjct:   40 CFPEKGGRGQPGPLGPQGPTGPPGRPGEPGLQGAAGEKGDRGRGGTTGPKGSGHP------GQAGPRGKPGADGCNGTHGDAGTPGQRGYDGPRGNPVSEAQDGPKGFKGSKGERGGPGAPATSPGPPGFDGYPGAPGPPGEKGSCDISFVCFLYLSYFAQLAFDICVCVLSLGDHGQCDCISSSP-----HGQPGLPGPSGDPGMAGEWGQQGDQGDPGPRGESGLPVMTINQKNHIQHILTVYTHTAGPPGDQGDSGRPGEPGETGRTGPSGTDGAPGL------HGPPGE----GPVGEPGEKGYPGRPGLPGLAGPSGVTGQVFGAPKGIRGFPGDPGPSGYDGNQGLPGIPGN--SSWYRYHFSLGVPGPKGYAGLTGQQGAKGEQGDQGRGGQPGPRGF------TGPRGEFGNPGLKGGRGVPGLFGKHGQHGDPGLKGADGEALGASPGPLGDAGLPGQQGDPGPAGDRGKSGYPGMEGMPGMIGTKGEA------GPSGLQGELGKPGPAGIFGYPGLPGQSGNPGPPGHTGEEGPRGESGDQG-----NTGSPGPMGVKGVTGEPGSDAGLGQTGPRGDPGHP---GFTGRIGLPGLKGVRGSQGMTGFQGMPGNLGPEGFSGEKGEIGFSGVRGEKGIKGRQGEKGDSGLIGPPGEPPVIKMDHMKKTMKGIKGDHGNPGDPGFTGPRGTK---GYPGVPGQEGHHGLPGEPSTDKGLEGSAGAEGLPGQKGMPGATGSQGIPGFPGMDGPRGEKGSPGAYGPSGGFGSKGVKGDKGDVIDLPGPTGPRGESGDSGPSGHKGFTGEPGDRGGSGFDGIEGMKGYPGDPGQQGLPGGE------------------GLQGFPGNQGTKGWAGIPGTPGTPGRPGHTGQRGFPGLKGIFGLDGLKGQKGLQGLPGPDVWGTPGDPGVKGGKGEIGVPSTEVGVPGSDGLKGSTGDAGDQGSPGQPGVPGPPGAHGIPGRQGFSGDPGPRGQKGLTGFPGPTGLPGFPSPFGSKGEQGVHGETGFTGPKGFPGDIGEKGLPGQPGISGRKGSKGDQGM--------------------MGLPGKPGFQGDRGPTGPKGDSGPPGLPGAPGAQGKLPVPVKVPGERGLPGPYGIRGPEGVRGESGPIGPPGNQGFLGPEGQKGMPGLPGIPGNPG 1137          

HSP 6 Score: 160.614 bits (405), Expect = 6.681e-39
Identity = 194/510 (38.04%), Postives = 239/510 (46.86%), Query Frame = 3
Query:  201 GNKGRQGFPGPRGYQGVSGDKGDVGQFGMPGPKGYKGFTGAIGPQGRKGERGIPGSPG----YPGKMGEMGFPGIRGDIGEKGLTGCDGQQGDFGNPGMNGLVGRTGQPGERGDDGDRGLSIIP-KYGLKGNKGSRGLLGRYGRKGEKGFKGIKGYSGIFGIKGNKGYVGPMGRRGPKGDSLGTVIIQSEKGSKGDKGLKGQSGIPCKGFQIEGRMYGRVGSDGPIGDKGIKGEKGLMGEIGQSGIDGARGLNGEKGLPGEAGPRGERGDRGNPGFPGDPGASGADGTRGRQGERGPKGVHGISGADGPRGSRGDKGPSGSLLSCPGRKGEKGFFGIPGIKGDIGNKGYQGHDGDIGEIGFKGEKGYEGPLGPSCS-------------EVEQGFRGTKGESGFPGLRGAKGQRGYSGNKGIKGKPNFGTGINNPGETGSYGNLGVPGEKGNKGFIGDTGEKGFSGT-GKQGPEGPRGDKGDDGVNGQVGMIGMPGIKGDKGSTYPICPF 1673
            G+ G +G PG +G  G +G +G  G  GM GP+G KG  GA GP G  G +G+ G  G     PG  G  G  G  G  G KG TG  G +G  G  G+ G+ G  G PG++G  G  GL   P   G KG  G  G  G  GR G  G +G  G  GIFG+ G KG  G  G  GP  D  GT       G  G KG KG+ G+P           G  GSDG  G  G  G++G  G+ G  G  GA G+ G +G  G+ GPRG++G  G PG  G PG     G++G QG      VHG +G  GP+G              PG  GEKG  G PGI G  G+KG QG  G  G+ GF+G++G  GP G S                V     G +G  G  G+RG +G RG SG  G  G   F       G  G  G  G+PG  GN GF GD G  G  G  G +GP G  G  G  G+ G+   +G   +K  +    P+CP 
Sbjct:  724 GSAGAEGLPGQKGMPGATGSQGIPGFPGMDGPRGEKGSPGAYGPSGGFGSKGVKGDKGDVIDLPGPTGPRGESGDSGPSGHKGFTGEPGDRGGSGFDGIEGMKGYPGDPGQQGLPGGEGLQGFPGNQGTKGWAGIPGTPGTPGRPGHTGQRGFPGLKGIFGLDGLKGQKGLQGLPGP--DVWGT------PGDPGVKGGKGEIGVPST-------EVGVPGSDGLKGSTGDAGDQGSPGQPGVPGPPGAHGIPGRQGFSGDPGPRGQKGLTGFPGPTGLPGFPSPFGSKGEQG------VHGETGFTGPKG-------------FPGDIGEKGLPGQPGISGRKGSKGDQGMMGLPGKPGFQGDRGPTGPKGDSGPPGLPGAPGAQGKLPVPVKVPGERGLPGPYGIRGPEGVRGESGPIGPPGNQGFL------GPEGQKGMPGLPGIPGNPGFRGDVGTVGHPGLLGLEGPAGRPGTSGRPGMPGRSVSVGYLLVKHSQSDQTPMCPV 1193          

HSP 7 Score: 56.225 bits (134), Expect = 3.653e-7
Identity = 59/164 (35.98%), Postives = 75/164 (45.73%), Query Frame = 3
Query: 4017 STGLRGNIGIPGERGDKGIPGLQGKVGNKGVKGDIGDKGFSG----NIGDKGY--------------SGISGDKGSFGVKGDKGFQGDVGMLGKSGLQGDRGQKGIIGFRGTRGIPGSMGLPGEIGEKGDVGPSGIGVKGLKGYQNAVGIKGRKGEKGLPGFPG 4454
            S+   G  G+PG  GD   PG+ G+ G +G +GD G +G SG     I  K +               G  GD G  G  G+ G  G  G  G  GL G  G+ G +G  G +G PG  GLPG  G  G  G      KG++G+    G  G  G +GLPG PG
Sbjct:  216 SSSPHGQPGLPGPSGD---PGMAGEWGQQGDQGDPGPRGESGLPVMTINQKNHIQHILTVYTHTAGPPGDQGDSGRPGEPGETGRTGPSGTDGAPGLHGPPGE-GPVGEPGEKGYPGRPGLPGLAGPSGVTGQVFGAPKGIRGFPGDPGPSGYDGNQGLPGIPG 375          
BLAST of Collagen IV NC1 domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000006888.2 (pep primary_assembly:Astyanax_mexicanus-2.0:1:4978899:5038801:-1 gene:ENSAMXG00000006614.2 transcript:ENSAMXT00000006888.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 360.147 bits (923), Expect = 1.045e-101
Identity = 528/1585 (33.31%), Postives = 684/1585 (43.15%), Query Frame = 3
Query:  735 TVIIQSEKGSKGDKGL---KGQSGIP-CKGFQIEGRMY-----GRVGSDGPIGDKGIKGEKGLMGEIGQSG-----IDGARGLNGEKGLPGEAGPRGERGDRGNPGFP-GDPGASGADGTRGRQGERGPKGVHGISGADGPRGSRGDKGPSGSLLSCPGRKGEKGFFGI---PGIKGDIGNKGYQGHDGDIGEIGFKGEKGYEGPLGPSCSEVEQGFRGTKGESGFPGLRGAKGQRGYSGNKGIKGKPNFGTGINNPGETGSYGNLGVPGEKGNKGFIGDTGEKGFSGTGKQGPEGPRGDKGDDGVNGQVGMIGMPGIKGDKGSTYPICPFCEKGYKGIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEGRMGLLGSKGRQGYKGGKGFSGSMGDAGEIGYVTISGTTIPGVKGEKGNQGPKGNKGEFGEAGSRGRKGYSGLKGFKGLIGERGTSFSSGDPGDKGLRGENGK---------DGVSFAGIPGEKGLKGDKGNRGILGDVGSLSNCATRPITSKGFKGPQGAKGTSGSPGSAGKTGIVGNKGENGYPGKRGIDGDNGIPGSKGEEGETGIKGHAGRPGNLGKSGLQGLRGEYGVKGDLGIQGIPGRKGVMGDPGPNGYAMIGSKGDKGIKGLPGIYGA-KGDKGRPGYIGIPGFKGETGLIGRSGLKGDQGEIGEKGIKGFTFISNNPGDRGLLGNKGLKGFPGELGNKGQVGVCTVRGDQGLRGYSGLIGDMGMKGEQGSKGIVGDYGAASRSGIMGRTGKIGNQGLPGDQXXXXXXXXXXXXXXXXYIGIPGFEGDRGEKGNKGFPGFPGDIGQPGRLGNPGISTEGVXXXXXXXXXXXXXXXXXXXXXXXXXXKQGDSGISIPGRQGIKGEDGTIGLPGEMGEPGPRGDFGQKGNIGITGEFGLQGNRGDDGLKGDDGIPGLNGPRGFIGDIGFVGFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXELGLDGSMGG---KGDNGPRGFNGPTGIPGSKGFEGDKGI-----RGDIGVKGFQGQHGEIGF-----PGLKGVSGENGRQXXXXXXXXXXXXXXXXVCMQPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEVGES-IRGLQGRKGSTGLRGNIGIP-------GERGDKGIPGLQGKVGNKGVKGDIGDKGFSGNIGDKGYSGISGDKGSFGVKGDKGFQGDVGMLGKSGLQGDRGQKGIIGFRGTRGIPGSMGLPGEIGEKGDVGPSGIGVKGLKGYQNAVGIKGRKGEKGLPGFPGRPGKVGDQGDKGPKGMKNMNTXXXXXXXXXXXXXXXXXXXXXXXXXLPGDMGEIGPNGPIGYADNGFLYATHSQSKDFPPCHGGGSPLYNGYSLLAIHGDIDSVTMDLGTPGSCLKNFSTIPFVNCFLERNTFYGGRCHVNMRNSRSYWLSTLQSYMSSPQPPSKMDDYISRCSVCQTKTTVMAFHSQKSDWQMTKCPYGWQKLWAGFSFPMAVQASRSGSNQPFSSPGSCLKHFRSLPFIECNNHNSNCNHWRDGVSYYMTAVDSENQFVKAQGKVLKSQTDIMNSISKCVVCQR 5342
             + +Q  +GS G  GL   KGQ G P   G Q E   +     G VG  GP G  G KG+ G+MG  G  G     I G  G     G+PGE G +GE G R N     G+PG  G  G +G  G  G  G   I G  G  G +G++GP G +    G KG KGF GI   P      G KG+ G  G+ G+ G  G  G +G  GP+            G+ G PG  G KG RG  G KG KG       +++ G  G  G  GVPG+ G +G +GD        TGK G  G  G +GD        + G PG +GD G+     P C KG KG  G  G                          G  G  G  GR+G  G KG  G M                P    + G+ GPKG   E G+ G  G KG SGL GF+G  G +G + + GD G  G RG  G          DG+S+ G PG  GL G  G +G  G+    +     PI   G  GP+G  G SGSPGS G  G  G KG  G PG  G  G  G  G   ++ + G  G  G  G  G +G  G RGE GV G  G+ G  G KG+ G+ GP G                    A  G KG PG  G  G  GE G  G  G  G  GE G  G  GF      PG++G+ G KG+ GFPG    +GQ  V  ++G+ G  G  G+ G  G +GE+G +G++G  G     G  G       QGLPG  G  G  G +G KG  G +G PG  G  G++G+KG PG PG  G+ G  G+ G                                    S +SIPG  G+KG  G IGL   +G+   RG+ GQ         +G  G  G  G  G DG  G  GP+G IG  G                            G  G +G  G  G LGL G+ G    +G  GP G NG  G+ G KG  G +G+     RG  G+ G QG  G+ G      PG KG  G  G +G  G  G  G  G+   C  PK+G                              ++GES   GL G +G+ G  G  G+P       GE G KG PG +G+ G  G+ G  G +G++GN G+KG  G+ G+ G  G+ G     G  G+ GK G  G  G+ GI+ +   +  P    L               G  G  G +   G+KG  GEKGL G  G  G  G  GD+G KG +           +   G +                            ++GFL A HSQS+  P C    + ++ GYSLL + G   + T DLG  GSC++ FST+PF            G C+   RN +SYWLST  +    P     +  YISRC VC+T +   A HSQ    ++ +CP  W+ LW G+SF M   +   G  Q  +SPGSCL +FR+ PF+EC   +  CN +    SY++T V+ +      +  VLK + +  ++ S+C+VC R
Sbjct:   27 CLFLQGGRGSDGLPGLIGNKGQKGFPGDAGPQGETTFHYLNITGSVGDPGPPGFFGDKGDMGMMGLPGPKGFPGLSIKGDMGFAESIGIPGEKGIKGEPGRRANSILTYGEPGKMGPPGQKGSPGPAGIPGSKCIPGPLGEFGEKGERGPPGEI----GNKGPKGFDGICECPPPPDMPGPKGFAGDPGNPGDPGRPGRPGLQGDFGPT------------GDKGLPGQYGDKGFRGLKGRKGDKGDLYI---MSDKGVRGDPGANGVPGDPGFEGRVGD--------TGKPGAPGDTGPQGDS-------LSGCPGDRGDPGN-----PGC-KGQKGAPGPPGPGVPGSIG----------------QRGLNGDPGPPGRRGIDGPKGVKGDM---------------RPCSPTKPGDPGPKG---EMGDQGLPGEKGLSGLPGFRGPPGLKGPAGTKGDSGSCGYRGPTGNVGDPGDPGPDGLSYGGQPGIPGLDGPLGLKGSPGNSFPGAPGPMGPIGFNGLSGPKGVPGPSGSPGSEGPPGEPGAKGRKGEPGPIGQLGGPGCTGPNPKQCDRGPDGPVGDRGPPGFTGTPGYRGEKGVMGQPGLPGA-GPKGMAGNAGPPGLQGCTGLQGPPGPPGESGIPAGSGRKGLPGLDGKDGQPGEPGQNGSPGSPGSSGEKGPDGRPGF------PGEQGIRGQKGMDGFPGP---RGQTEVIQIKGNPGPPGPPGMNGFTGPRGEKGERGLLGLNGNQGGPGPPGYERG--PQGLPGAPGIRGESGLRGSKGPLGIMGFPGISGFPGDRGSKGSPGAPGLNGREGLKGDKG------------------------------------SSVSIPGLPGVKGPKGDIGLQAFVGD---RGEVGQ---------YGPPGTCGKPGAVGPDGPRGYPGPQGVIGPPGPC--------------------------GNYGPEGPPGPPGRLGLKGNPGRSGLRGPPGPLGLNGLDGLRGLKGATGPQGMVTSGDRGPQGLSGDQGCTGDTGPSGLSQPGNKGAKGMPGNRGDPGPSGPPGFAGED--CRDPKLG------------------------------QMGESGYAGLDGPQGAPGPVGAPGLPIPISGDPGEPGAKGFPGFRGQKGTPGLPGLPGIQGYNGNKGEKGDMGVLGEPGPPGLPGSCCHSGPNGLKGKQGDPGPPGEPGIVIYE--KAAPSRGPLGPPGTCGPPGPQGPAGTDGRTGPK---GLKGEPGEKGLSGLMGSEGSQGYPGDEGLKGERGPPGQAGPPGPQGDPGPSQS-------------------------CNSGFLVAFHSQSQVVPSCPLNMTEVWQGYSLLYLEGQEKAHTQDLGQAGSCMRIFSTMPFAYSNP-------GICNYASRNDKSYWLSTSVALPMMPVSGLSIQPYISRCVVCETPSPAFAIHSQSK--ELPRCPLSWKPLWIGYSFLMHTGSGDEGGGQSLTSPGSCLPNFRTHPFVECQGEHGTCNFFPSIYSYWLTNVEQQAIKPVPEKTVLKEELEQRDNTSRCIVCMR 1380          

HSP 2 Score: 223.402 bits (568), Expect = 3.306e-58
Identity = 378/1103 (34.27%), Postives = 465/1103 (42.16%), Query Frame = 3
Query:  198 FGNKGRQGFPGPRGYQGVS--------------------GDKGDVGQFGMPGPKGYKGFTGAIGPQGRKGERGIPGSPGYPGKMGEMGFPGIRGDIGEKGLTGCDGQQGDFGNPGMNGLVGRTGQPGERGDDGDRGLSIIP-KYGLKGNKGSRGLLGRYGRKGEKGFKGIKGYSGIFGIKGNKGYVGPMGRRGPKGDSLGTVIIQSEKGSKGDKGLKGQSGIPCKGFQIEGRMYGRVGSDGPI---GDKGIKGEKGLMGEIGQSGIDGARGLNGEKGLPGEAGPRGER-----GDRGNPGFPGDPG-----------ASGADGTRGRQGERGPKGVHGISGADGPRGSRGDKGP-SGSLLSCPGRKGEKGFFGIPGIKGDIGNKGYQGHDGDIGEIGFKGEK---GYEGPLGPSCSEVEQGFRGTK--GESGFPGLRGAKGQRGYSGNKGIKGKPNFGTGINNPGETGSYGNLGVPGEKGNKGFIGDTGEKGFSGTGKQGPEGPRGDKGDDGVNGQVGMIGMPGIKGDKGSTYPICPFCEKGYKGIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEGRMGLLGSKGRQGYKGGKGFSGSMGDAGEIGYVTISGTTIPGVKGEKGNQGPKGNKG-------------EFGEAGSRGRKGYSGLKGFKGLIG---------------ERGTSFSSGDPGDKGLRGENGKDGVSFAGIPGE---------------------KGLKGDKGNRGILG--DVGSLSNCATRPITSKGFKGPQGAKGTSGSPGSAGKTGIVGNKGENGYPGKRGIDGDNGIPGSKGEEGETGIKGHAGRPGNLGKSGLQGLRGEYGVKGDLGIQGIPGRKGVMGDPGPNGYAMIGSKGDKGIKGLPGIYGAKGDKGRPGYIGIPGFKGETGLIGRSGLKGDQGEIGEKGIKGFTFISNNPGDRGLLGNKGLKGFPGELGNKGQVGVCTVRGDQGLRGYSGLIGDMG-----MKGEQGSKGIVGD------------YGAASRSGIMGRTGKIGNQGLPGDQXXXXXXXXXXXXXXXXYIGIPGF----EGDRGEKGNKGFPGFPGDIGQPGRLGNPGI 3152
             GNKG++GFPG  G QG +                    GDKGD+G  G+PGPKG+ G +        KG+ G   S G PG+ G  G PG R +     LT        +G PG  G  G+ G PG  G  G +    IP   G  G KG RG  G  G KG KGF GI        + G KG+ G  G  G  G   G   +Q + G  GDKGL GQ G   KGF+    + GR G  G +    DKG++G+ G  G  G  G +G  G  G+ G PG+ GP+G+      GDRG+PG PG  G             G+ G RG  G+ GP G  GI   DGP+G +GD  P S +    PG KGE G  G+PG KG  G  G++G  G  G  G KG+    GY GP G      + G  G    G+ G PGL G  G +G  GN             + PG  G  G +G  G  G KG  G +G       G +GP G  G KG  G  G +G +G PG  G           C++G  G                             GD G  G  G+    GY+G KG  G  G  G             G KG  GN GP G +G                 AGS GRKG  GL G  G  G               E+G     G PG++G+RG+ G DG  F G  G+                      G +G+KG RG+LG                 +G  G  G +G SG  GS G  GI+G  G +G+PG RG  G  G PG  G EG  G KG +          + GL G  G KGD+G+Q   G +G +G  GP G             G PG  G  G +G PG  G+ G  G  G  G  G  G  G +G KG  G + +   PG  GL G  GL+G  G  G +G V     RG QGL G  G  GD G       G +G+KG+ G+             G   R   +G+ G+ G  GL G QG PG             +G PG      GD GE G KGFPGF G  G PG  G PGI
Sbjct:   43 IGNKGQKGFPGDAGPQGETTFHYLNITGSVGDPGPPGFFGDKGDMGMMGLPGPKGFPGLS-------IKGDMGFAESIGIPGEKGIKGEPGRRAN---SILT--------YGEPGKMGPPGQKGSPGPAGIPGSK---CIPGPLGEFGEKGERGPPGEIGNKGPKGFDGICECPPPPDMPGPKGFAGDPGNPGDPGRP-GRPGLQGDFGPTGDKGLPGQYGD--KGFR---GLKGRKGDKGDLYIMSDKGVRGDPGANGVPGDPGFEGRVGDTGKPGAPGDTGPQGDSLSGCPGDRGDPGNPGCKGQKGAPGPPGPGVPGSIGQRGLNGDPGPPGRRGI---DGPKGVKGDMRPCSPTKPGDPGPKGEMGDQGLPGEKGLSGLPGFRGPPGLKGPAGTKGDSGSCGYRGPTGNVGDPGDPGPDGLSYGGQPGIPGLDGPLGLKGSPGN-------------SFPGAPGPMGPIGFNGLSGPKGVPGPSGS-----PGSEGPPGEPGAKGRKGEPGPIGQLGGPGCTGPNPKQ------CDRGPDG---------------------------PVGDRGPPGFTGTP---GYRGEKGVMGQPGLPGA------------GPKGMAGNAGPPGLQGCTGLQGPPGPPGESGIPAGS-GRKGLPGLDGKDGQPGEPGQNGSPGSPGSSGEKGPDGRPGFPGEQGIRGQKGMDG--FPGPRGQTEVIQIKGNPGPPGPPGMNGFTGPRGEKGERGLLGLNGNQGGPGPPGYERGPQGLPGAPGIRGESGLRGSKGPLGIMGFPGISGFPGDRGSKGSPGAPGLNGREGLKGDKGSS--------VSIPGLPGVKGPKGDIGLQAFVGDRGEVGQYGPPGTC-----------GKPGAVGPDGPRGYPGPQGVIGPPGPCGNYGPEGPPGPPGRLGLKGNPGRSGLRGPPGPLGLNGLDGLRGLKGATGPQGMV-TSGDRGPQGLSGDQGCTGDTGPSGLSQPGNKGAKGMPGNRGDPGPSGPPGFAGEDCRDPKLGQMGESGYAGLDGPQGAPGP------------VGAPGLPIPISGDPGEPGAKGFPGFRGQKGTPGLPGLPGI 1014          

HSP 3 Score: 210.305 bits (534), Expect = 3.415e-54
Identity = 399/1151 (34.67%), Postives = 499/1151 (43.35%), Query Frame = 3
Query:  201 GNKGRQGFPGPRGYQGVS--GDKGDVGQFGMPGPKGYKGFTG-------------AIGPQGRKGE---RGIPGSPGYPGKMGEMGFPGIRG---DIGEKGLTGCDGQ---------------QGDFGNPGMNGLVGRTGQPGERGDDGDRGLSIIPKYGLKGNKGSRGLLGRYGRKGE------KGFKGIKGYSGIFGIKGNKGYVGPMGR------RGPKGDSLGTVIIQSEKGSKGDKGLKGQSGIPCKGFQIEGRMYGRVGSDGPIGDKGIKGEKGLMGEIGQSGIDGARGLNGE-----KGLPGEAGPRGERGDRGNPGFPGDPGASGADGTRGRQGERGPKGVHGISGADGPRGSRGD----KGPSGSLLSCPGRKGEKGFFGIPGIKGDIGNKGYQGHDGDIGEIGFKGEKGYEGPLGPSCSEVEQGFRGTKGESGFPGLRGAKGQRGYSGNKGIKGKPNFGTGIN----NPGETGSYGNLGVPGEKGNKGFIGDTGEKGFSGTGKQGPEGPRGDKGDDGVNGQVGMIGMPGIKGDKGSTYPICPFCEKGYKGIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEGRMGLLGSKGRQGYKGGKGFSGSMGDAGEI-------GYVTISGTTIPGVKGEKGN----------------------QGPKGNKGEFGEAGSRGRKGYSGLKGFKGLIGERGTSFSSGDPGDKGLRGENGKDG-----VSFAGIPGEKGLKGDKGNRGILGDVGSLSNCATRPITSKGFKGPQGAKGTSGSPGSAGKTGIVGNKGENGYPGKRGIDGDNGIP---------------GSKGEEGETGIKGHAGRPGNLGKSGLQGLRGEYG--------VKGDLGIQGIPGRKGVMGDPGPNGYAMIGSKGDKGIKGLPGIYGAK------------------GDKGRPGYIGIPGFKGETGLIGRSGL----KGDQGEIGEKGIKGFTFISNNPGDRGLLGNKGLKGFPGELGNKGQVGVCTVRGDQGLRGYSGLIGDMGMKGEQGSKG-------IVGDYGAASRSG-----------------IMGRTGKIGNQGLPGDQXXXXXXXXXXXXXXXXYIGIPGFEGDRGEKGNKGFPGFPGDIGQ---------PGR 3134
            G+ G  G PGP+G+ G+S  GD G     G+PG KG KG  G              +GP G+KG     GIPGS   PG +GE G  G RG   +IG KG  G DG                 GD GNPG  G  GR G  G+ G  GD+GL      G  G+KG RGL GR G KG+      KG +G  G +G+ G  G +G VG  G+       GP+GDSL         G  GD+G  G  G  CKG Q         G  G IG +G+ G+ G     G+ GIDG +G+ G+        PG+ GP+GE GD+G    PG+ G SG  G RG  G +GP G  G SG+ G RG  G+      P    LS  G+ G  G  G  G+KG  GN  + G  G +G IGF G  G +G  GPS         G+ G  G PG  GAKG++G  G  G  G P   TG N    + G  G  G+ G PG  G  G+ G+ G  G  G    GP+G  G+ G  G+ G  G+ G PG  G+ G           G KG+ G  G+ G+ G  G NG  G+ G+ G  G +GR G  G +G +G KG  GF G  G    I                  G +GEKG                       QG  G  G  GE+G RG KG  G+ GF G+ G  G   S G PG  GL G  G  G     VS  G+PG KG KGD G +  +GD G +                    G  G PG+ GK G VG  G  GYPG +G+ G  G                 G KG  G +G++G    PG LG +GL GLRG  G          GD G QG+ G +G  GD GP+G +     G+KG KG+PG  G                    G  G  GY G+ G +G  G +G  GL     GD GE G KG  GF      PG  GL    G++G+ G  G KG +GV    G  GL G     G  G+KG+QG  G       ++ +  A SR                     GRTG  G +G PG++                     G  G  G +G++G+PG  G  G+         PG 
Sbjct:   85 GDMGMMGLPGPKGFPGLSIKGDMGFAESIGIPGEKGIKGEPGRRANSILTYGEPGKMGPPGQKGSPGPAGIPGSKCIPGPLGEFGEKGERGPPGEIGNKGPKGFDGICECPPPPDMPGPKGFAGDPGNPGDPGRPGRPGLQGDFGPTGDKGLP-----GQYGDKGFRGLKGRKGDKGDLYIMSDKGVRGDPGANGVPGDPGFEGRVGDTGKPGAPGDTGPQGDSL--------SGCPGDRGDPGNPG--CKG-QKGAPGPPGPGVPGSIGQRGLNGDPG---PPGRRGIDGPKGVKGDMRPCSPTKPGDPGPKGEMGDQG---LPGEKGLSGLPGFRGPPGLKGPAGTKGDSGSCGYRGPTGNVGDPGDPGPDGLSYGGQPGIPGLDGPLGLKGSPGNS-FPGAPGPMGPIGFNGLSGPKGVPGPS---------GSPGSEGPPGEPGAKGRKGEPGPIGQLGGPGC-TGPNPKQCDRGPDGPVGDRGPPGFTGTPGYRGEKGVMGQPGLPGAGPKGMAGNAGPPGLQGCTGLQGPPGPPGESGIP------AGSGRKGLPGLDGKDGQPGEPGQNGSPGSPGSSGEKGPDGRPGFPGEQGIRGQKGMDGFPGPRGQTEVIQIKGNPGPPGPPGMNGFTGPRGEKGERGLLGLNGNQGGPGPPGYERGPQGLPGAPGIRGESGLRGSKGPLGIMGFPGISGFPGDRGSKGSPGAPGLNGREGLKGDKGSSVSIPGLPGVKGPKGDIGLQAFVGDRGEV--------------------GQYGPPGTCGKPGAVGPDGPRGYPGPQGVIGPPGPCGNYGPEGPPGPPGRLGLKGNPGRSGLRGP---PGPLGLNGLDGLRGLKGATGPQGMVTSGDRGPQGLSGDQGCTGDTGPSGLSQ---PGNKGAKGMPGNRGDPGPSGPPGFAGEDCRDPKLGQMGESGYAGLDGPQGAPGPVGAPGLPIPISGDPGEPGAKGFPGFRGQKGTPGLPGL---PGIQGYNGNKGEKGDMGVLGEPGPPGLPGSCCHSGPNGLKGKQGDPGPPGEPGIVIYEKAAPSRGPLGPPGTCGPPGPQGPAGTDGRTGPKGLKGEPGEK---------------------GLSGLMGSEGSQGYPGDEGLKGERGPPGQAGPPGP 1146          

HSP 4 Score: 198.364 bits (503), Expect = 1.598e-50
Identity = 366/1122 (32.62%), Postives = 483/1122 (43.05%), Query Frame = 3
Query:  390 GEMGFPGIRGDIGEKGLTGCDGQQGD--FGNPGMNGLVGRTGQPGERGDDGDRGLSIIPKYGLKGNKGSRGLLGRYGRKGEKGFKGIKGYSGIFGIKGNKGYVGPMGRRGPKGDSLGTVIIQSEKGSKGDKGLKGQSGIPCKGFQIEGRMYGRVGSDGPIGDKGIKGEKGLMGEIGQSGIDGARGLNGEKGLPGEAGPRGERGDRGNPGFPGDPGASGADGTRGRQGERGPKGVHGISGADGPRGSRGDKGPSGSLLSCPGRKGEKGFFGIPGIKGDIGNKGYQGHDGDIGEIGFKGEKGYEGPLGPSCSEVEQGFRGTKGESGFPGLRGAKGQRGYSGNKGIKGKPNFGTGINNPGETGSYGNLGVPGEKGNKGFIGDTGEKGFSGTGKQGPEGPRGDKGDDGVNGQVGMIGMPGIKGDKGSTYPICPFCEKGYKGIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEGRMGLLGSKGRQGYKG--GKGFSGSMGDAGEIGYVTISGTT-IPGVKGEKGNQGP------KGNKGEFGEAGSRGRKGYSGL------KGFKGLIGERGTSFSSGDPGDKGLRGENGKDGVSFAGIPGEKGLKGDKGNRGILGDVGSLSNCATRPITS-------KGFKGPQG---------------------AKGTSGSPGSAGKTGIVGNKGENGYPGKRGID---------------GDNGIPGSKGEEGETGI-------------------KGHAGRPGNLGKSGLQGLRGEYGVKGDLGIQGIPGRKGVMGDPGPNGY-AMIGSKGDKG----IKGLPGIYGAKGDKGRPGYIGIPGFKGETGLIGRSGLKGDQGEIGEKGIKGFTFISNNPGDRGLLGNKG------------------LKGFPGELGNKGQVGVCTVRGDQGLRGYSGLIGDMGM--KGEQGSKGIVGDYGAASRSGIMG--RTGKIGNQGLPGDQXXXXXXXXXXXXXXXXYIGIPGFEGDRGEKGNKGFPGFPGDIGQPGRLGNPGISTEGVXXXXXXXXXXXXXXXXXXXXXXXXXXKQGDSGISIPGRQGIKGEDGTIGLPGEMGEPGPRGDFGQKGNIGITGEFGLQGNRGDDGLKGDD 3437
            G  G PG+ G+ G+KG  G  G QG+  F    + G VG  G PG  GD GD G+      GL G KG  GL            KG  G++   GI G KG  G  GRR    +S+ T     + G  G KG  G +GIP           G     GP+G+ G KGE+G  GEIG  G  G  G+      P   GP+G  GD GNPG PG PG  G  G  G  G++G  G +G  G  G +G +GDKG    ++S      +KG  G PG  G  G+ G++G  GD G+ G  G+ G +G              G  G+ G PG  G KGQ+G  G  G     + G       + G  G+ G PG +G  G  G  G+       K G  GP+G+ GD G+ G+ G+ G+PG +G  G   P     + G  G +G  G  G+ G+ G +GL             G+ G+ G  G  G KG  G  F G+ G  G IG+  +SG   +PG  G  G++GP      KG KGE G  G  G  G +G       +G  G +G+RG    +G PG +G +G  G+ G+  AG    KG+ G+ G  G+ G  G          +        KG  G  G                      KG  G PG  G+ GI G KG +G+PG RG                 G NG  G +GE+GE G+                   +G  G PG  G+SGL+G +G  G+ G  GI G PG +G  G PG  G     G KGDKG    I GLPG+ G KGD G   ++G    +GE G  G  G  G  G +G  G +G+      PG +G++G  G                  LKG PG  G +G  G   + G  GLRG  G  G  GM   G++G +G+ GD G    +G  G  + G  G +G+PG++G PG  G  G      + G    +   G+ G  G+ G  G  G PG +G PG                                      + IP   G  GE G  G PG  G+   +G  G  G  GI G  G +G +GD G+ G+ 
Sbjct:   35 GSDGLPGLIGNKGQKGFPGDAGPQGETTFHYLNITGSVGDPGPPGFFGDKGDMGM-----MGLPGPKGFPGL----------SIKGDMGFAESIGIPGEKGIKGEPGRRA---NSILTYGEPGKMGPPGQKGSPGPAGIP-----------GSKCIPGPLGEFGEKGERGPPGEIGNKGPKGFDGICECPPPPDMPGPKGFAGDPGNPGDPGRPGRPGLQGDFGPTGDKGLPGQYGDKGFRGLKGRKGDKG-DLYIMS------DKGVRGDPGANGVPGDPGFEGRVGDTGKPGAPGDTGPQG----------DSLSGCPGDRGDPGNPGCKGQKGAPGPPGPGVPGSIG-------QRGLNGDPGPPGRRGIDGPKGVKGDMRPCSPTKPGDPGPKGEMGDQGLPGEKGLSGLPGFRGPPGLKGPAGTKGDSGSCGYRGPTGNVGDPGDPGPDGLSYG----------GQPGIPGLDGPLGLKGSPGNSFPGAPGPMGPIGFNGLSGPKGVPGPSGSPGSEGPPGEPGAKGRKGEPGPIGQLGGPGCTGPNPKQCDRGPDGPVGDRGPPGFTGTPGYRGEKGVMGQPGLPGAG---PKGMAGNAGPPGLQGCTGLQGPPGPPGESGIPAGSGRKGLPGLDGKDGQPGEPGQNGSPGSPGSSGEKGPDGRPGFPGEQGIRGQKGMDGFPGPRGQTEVIQIKGNPGPPGPPGMNGFTGPRGEKGERGLLGLNGNQGGPGPPGYERGPQGLPGAPGIRGESGLRGSKGPLGIMGFPGISGFPGDRGSKGSPGAPGLNGREGLKGDKGSSVSIPGLPGVKGPKGDIGLQAFVGD---RGEVGQYGPPGTCGKPGAVGPDGPRGY------PGPQGVIGPPGPCGNYGPEGPPGPPGRLGLKGNPGRSGLRGPPGPLGLNGLDGLRGLKGATGPQGMVTSGDRGPQGLSGDQGCTGDTGPSGLSQPGNKGAKGMPGNRGDPGPSGPPG------FAGEDCRDPKLGQMGESGYAGLDGPQGAPGPVGAPG--------------------------------------LPIP-ISGDPGEPGAKGFPGFRGQ---KGTPGLPGLPGIQGYNGNKGEKGDMGVLGEP 1033          

HSP 5 Score: 162.155 bits (409), Expect = 1.800e-39
Identity = 299/950 (31.47%), Postives = 377/950 (39.68%), Query Frame = 3
Query:  174 CTPDKCQCFGNKGRQGFP------GPRGYQGVS---------------------------------GDKGDVGQFGMPGPKGYKGFTGAIGPQGRKGE---------------RGIPGSPGYPGKMGEMGFPGIRGDIGEKG--LTGCDGQQGDFGNP--------------------GMNGLVGRTGQPGERGDDGDRGL--SIIPKYGLK-GNKGSRGLLGRYGRKGEKGFKGIKGYSGIFGIK---GNKGYVGPMGRRGPKGDSLGTVIIQSEKGSKGDKGLKGQSGIPCKGFQIEGRMYGRVGSDGPIGDKG-----IKGEKGLMGEIGQSGIDGARGLNGEKGLPGEAGPRGERGDRGNPGFPGD------PGASGADGTRGRQGERGPKGVHGISGADGPRGSRGDKGPSGSL-LSCPGRKGEKGFFGIPGIKGDI------------------GNKGYQGHDGDIGEIGFKGEK---------GYEGPLGPSCSEVEQGFRGTKGESGFPGLRGAK---------------GQRGYSGNKGIKGKPNFGTGINN-----------------PGETGSYGNLGVPGEKGNKGFIGDTGEKGFSGTGKQGPEGPRGDKGDDGVNGQVGMIGMPGIKGDKGSTYPICPFCEKGYKGIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEGRMGLLGSKGRQGYKGGKGFSGSMGDAGEIGYVTISGTTIPGVKGEKGNQGP---------------KGNKGEFGEAGSRGRKGYSGLKGFKGLIGERGTS-----FSSGDPGDKGLRGE---NGKDGVSFAGIPGEKGLKGDKGNRGILGDVGSL----SNCATRPITSKGFKGPQGAKGTSGSPGSAGKTGI-VGNKGENGYPGKRGIDGDNGIPGSKGEEGETGIKGHAGRPGNLGKSGLQGLRGEYGVKGDLGI 2480
            C P     FG KG +G P      GP+G+ G+                                  GD G  G  G+PG  G KGF G  G +G KG+                G+PG PG+ G++G+ G PG  GD G +G  L+GC G +GD GNP                    G  GL G  G PG RG DG +G+   + P    K G+ G +G +G  G  GEKG  G+ G+ G  G+K   G KG  G  G RGP G+         +  S G     GQ GIP              G DGP+G KG       G  G MG IG +G+ G +G+ G  G PG  GP GE G +G  G PG       PG +G +  +  +G  GP G  G  G  G  G RG+KG  G   L   G KG  G  G PG++G                    G KG  G DG  G+ G  G+          G +GP G      EQG RG KG  GFPG RG                 G  G++G +G KG+     G+N                  PG  G  G  G+ G KG  G +G  G  GF            GD+G  G  G  G+ G  G+KGDKGS+  I      G  G++                           G +G +GL    G +G  G  G  G+ G  G +G     G   PG +G  G  GP                G KG  G +G RG  G  GL G  GL G +G +      +SGD G +GL G+    G  G S    PG KG KG  GNRG  G  G       +C    +   G  G  G  G  G+PG  G  G+ +   G+ G PG +G                 G +G  G PG  G  G+QG  G  G KGD+G+
Sbjct:  160 CIPGPLGEFGEKGERGPPGEIGNKGPKGFDGICECPPPPDMPGPKGFAGDPGNPGDPGRPGRPGLQGDFGPTGDKGLPGQYGDKGFRGLKGRKGDKGDLYIMSDKGVRGDPGANGVPGDPGFEGRVGDTGKPGAPGDTGPQGDSLSGCPGDRGDPGNPGCKGQKGAPGPPGPGVPGSIGQRGLNGDPGPPGRRGIDGPKGVKGDMRPCSPTKPGDPGPKGEMGDQGLPGEKGLSGLPGFRGPPGLKGPAGTKGDSGSCGYRGPTGNVGDPGDPGPDGLSYG-----GQPGIP--------------GLDGPLGLKGSPGNSFPGAPGPMGPIGFNGLSGPKGVPGPSGSPGSEGPPGEPGAKGRKGEPGPIGQLGGPGCTGPNPKQCDRGPDGPVGDRGPPGFTGTPGYRGEKGVMGQPGLPGAGPKGMAGNAGPPGLQGCTGLQGPPGPPGESGIPAGSGRKGLPGLDGKDGQPGEPGQNGSPGSPGSSGEKGPDGRPGFPGEQGIRGQKGMDGFPGPRGQTEVIQIKGNPGPPGPPGMNGFTGPRGEKGERGL-LGLNGNQGGPGPPGYERGPQGLPGAPGIRGESGLRGSKGPLGIMGFPGISGFP-----------GDRGSKGSPGAPGLNGREGLKGDKGSSVSI-----PGLPGVK---------------------------GPKGDIGLQAFVGDRGEVGQYGPPGTCGKPGAVGPDGPRG--YPGPQGVIGPPGPCGNYGPEGPPGPPGRLGLKGNPGRSGLRGPPGPLGLNGLDGLRGLKGATGPQGMVTSGDRGPQGLSGDQGCTGDTGPSGLSQPGNKGAKGMPGNRGDPGPSGPPGFAGEDCRDPKLGQMGESGYAGLDGPQGAPGPVGAPGLPIPISGDPGEPGAKGF---------------PGFRGQKGTPGLPGLPGIQGYNGNKGEKGDMGV 1029          

HSP 6 Score: 125.946 bits (315), Expect = 2.518e-28
Identity = 271/824 (32.89%), Postives = 334/824 (40.53%), Query Frame = 3
Query:  165 LRICTPDKCQCFGNKGRQGFPGPRGYQGVSGDKGDVGQFGMPGPKGYKGFTGAIGPQGRK-----------------GERGIP---------GSPG--YPGKMGEMGFPGIRGDIGEKGLTGCDGQQGDFGNPGMNGLVGRTGQPGERGDDGDRGLS-IIPKY------GLKGNKGSRGLLGRYGRKGEKGFKGIKGYSGIFGIKGNKGYVGPMGRRG-----PKGDSLGTVIIQSEKGSKGDKGLKGQSGIPCK-GFQIEGRMYGRVGSDGPIGDKGIKGEKGLMGEIGQSGIDGARGLNGEKGLPGE------------AGPRGERGDRG-------------------NPGFPGDPGASGADGTRGRQGERGPKGVHGISGADGPRGSRGDKGPSGSLLSCPGRKGEKG----FFGIPGIKGDIGNKGYQGHDGDIGEIGFKGEKGYEGPLGPSCSEVEQGFRGTKGESGFPGLRGAKGQRGYSGNKGIKGKPNFGTGIN---------------NPGET---GSYGNLGVPGEKGNKGFIGDTGEKGFSGTGKQGPEGPRGDKGDDGVNGQVGMIGMPGIKGDKGSTYPICPFCEKGYKGIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEGRMGLLGSKGRQGYKGGKGFSGSMGDAGEIGY-VTISGTTIPGVKGEKGNQGPKGNKGEFGEAGSRGRKGYSGLKGFKGLIGERGTSFSSGDPGDKGLRGENGKDGVSFAGIPGEKG--LKGDKGNRGILGDVGSLSNCATRPITSKGFKGPQGAKGTSGSPGSAGKTGIVGNKGENGYPGKRGIDGD 2345
            +R C+P K    G KG  G  G  G +G+SG  G  G  G+ GP G KG +G+ G +G                   G+ GIP         GSPG  +PG  G MG  G  G  G KG+ G  G  G  G PG  G  GR G+PG  G  G  G +   PK       G  G++G  G  G  G +GEKG  G  G  G  G KG  G  GP G +G           G   I +  G KG  GL G+ G P + G        G  G  GP G  G  GE+G+ G+ G  G  G RG      + G              GPRGE+G+RG                     G PG PG  G  G RG +G  G  G  GISG  G RGS+G  G  G L    G KG+KG      G+PG+KG  G+ G Q   GD GE+                     G  G  G  G PG  G  G RGY G +G+ G P                      NPG +   G  G LG+ G  G +G  G TG +G   +G +GP+G  GD+G  G  G  G+   PG KG KG                             G  G  G  G  G  G++ R   LG  G  GY G  G  G+ G  G  G  + ISG   PG  G KG  G +G KG  G  G  G +GY+G KG KG +G  G     G PG     G NG  G      P  +   +  +K            +     P    G  G  G KG  G PG  G +G++G++G  GYPG  G+ G+
Sbjct:  364 MRPCSPTKPGDPGPKGEMGDQGLPGEKGLSGLPGFRGPPGLKGPAGTKGDSGSCGYRGPTGNVGDPGDPGPDGLSYGGQPGIPGLDGPLGLKGSPGNSFPGAPGPMGPIGFNGLSGPKGVPGPSGSPGSEGPPGEPGAKGRKGEPGPIGQLGGPGCTGPNPKQCDRGPDGPVGDRGPPGFTGTPGYRGEKGVMGQPGLPGA-GPKGMAGNAGPPGLQGCTGLQGPPGPPGESGIPAGSGRKGLPGLDGKDGQPGEPGQNGSPGSPGSSGEKGPDGRPGFPGEQGIRGQKGMDGFPGPRGQTEVIQIKGNPGPPGPPGMNGFTGPRGEKGERGLLGLNGNQGGPGPPGYERGPQGLPGAPGIRGESGLRGSKGPLGIMGFPGISGFPGDRGSKGSPGAPG-LNGREGLKGDKGSSVSIPGLPGVKGPKGDIGLQAFVGDRGEV---------------------GQYGPPGTCGKPGAVGPDGPRGYPGPQGVIGPPGPCGNYGPEGPPGPPGRLGLKGNPGRSGLRGPPGPLGLNGLDGLRGLKGATGPQGMVTSGDRGPQGLSGDQGCTGDTGPSGL-SQPGNKGAKGMP---------------------------GNRGDPGPSGPPGFAGEDCRDPKLGQMGESGYAGLDGPQGAPGPVGAPGLPIPISGD--PGEPGAKGFPGFRGQKGTPGLPGLPGIQGYNGNKGEKGDMGVLGEPGPPGLPGSCCHSGPNGLKGKQGDPGPPGEPGIVIYEKAAPSRGPLGPPGTCGPPGPQGPAGTDGRTGPKGLKGEPGEKGLSGLMGSEGSQGYPGDEGLKGE 1134          
BLAST of Collagen IV NC1 domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000017587.2 (pep primary_assembly:Astyanax_mexicanus-2.0:16:35732567:35767046:-1 gene:ENSAMXG00000015997.2 transcript:ENSAMXT00000017587.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 347.821 bits (891), Expect = 4.357e-99
Identity = 426/1260 (33.81%), Postives = 541/1260 (42.94%), Query Frame = 3
Query: 1932 GNQGPKGNKGEFGEAGSRGRKGYSGL------KGFKGLIGERGTSFSSGDPGDKGLRGENGKDGVSFAGIPGEKGLKGDKGNRGILGDVG-------SLSNCATRPITSKGFKGPQGAKGTSGSPGSAGKTG------------------------IVGNKGENGYPGKRGIDGDNGIPGSKGEEGETGIKGHAGRPGN-LGKS-GLQGLRGEYGVKGDLGIQ---------------GIPGRKGVMGDPGPNGYAMIGSKGDKGIKGLP-----------------GIYGAKGDKGRPGYIGIPGFKGETGLIGRSGLKGDQGEIGEKGIKGFTFISNNPGDRGLLGNKGLKGFPGELGNKGQVGVCTVRGDQGLRGYSGLIGDMGMKGEQGSKGIVGDYGAASRSGI---MGRTGKI--GNQGLPGDQXXXXXXXXXXXXXXXXYIGIPGFEGDRGEKGNKGFPGFPGDIGQPGRLGNPGISTEGVXXXXXXXXXXXXXXXXXXXXXXXXXXKQGDSGISIPGRQGIKGEDGTIGLPGEMGEPGPRGDFGQKGNIGITGEFGLQGNRGDDGLKGD-DGIPGLNGPRGFIGDIGFVGFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXELGLDGSMGGKGDNGPRGFNGPTGIPGS---KGFEGDKGIRGDIGVKGFQGQHGEIGFPG---LKGVSGENGRQXXXXXXXXXXXXXXXXVCMQPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEVGESIRGLQGRKGSTGLRGNIGIPGERGDKGIPGLQGKVGNKGVKGDIGDKGFSGN---------------------IGDKGYSGISGDKGSFGVKGDKGFQGDVGMLGKSG---LQGDRGQKGIIGFRGTRGIPGSMGLPGEIGEKGDVGPSGI--------------GVKGLKGYQNAVGIKGRKGEKGLPGFPGRPGKVGDQGDKGPKGMKNMNTXXXXXXXXXXXXXXXXXXXXXXXXXLPGDMGEIGPNGPIGYADNGFLYATHSQSKDFPPCHGGGSPLYNGYSLLAIHGDIDSVTMDLGTPGSCLKNFSTIPFVNCFLERNTFYGGRCHVNMRNSRSYWLSTLQSYMSSPQPPSKMDDYISRCSVCQTKTTVMAFHSQKSDWQMTKCPYGWQKLWAGFSFPMAVQASRSGSNQPFSSPGSCLKHFRSLPFIECNNHNSNCNHWRDGVSYYMTAVDSENQFVKAQGKVLKSQTDIMNSISKCVVCQRDM 5348
            G  GP+G  GE G+ G  G  G+ G        GF GL G+RG     G  G  GL GE    G+ +AG+PG +GL GD G  GI G  G       +L    T  + S GF G  G  G  G PG +G +G                         +G +G+ G PG        G PG+ G++G  G  G  G PG  LG + G QG  G+ G+ GD G Q               G+PG KG+ GD G  G               P                 G+ G +GD GR          G  G  G  G+ G QGE+G  G  G   +  N G  G  G KG KGFPG LG  G  G     G  G +G  G+ G  G  GE G  G  GD G   R G    +   G +  G +G+PG                    G+PGF G RG   +KGFPG PG  GQPG+ G+P I  +G+                            GD G   PGRQG+ G  G  G  G +G PG  G  G  G  G+ G  G  G  G  G KGD  GIPG  G +G +G+ GF G                         G  G  G  GF G  GL G  G  GD G  GF+G  G+PG+    G+ GDKG  G+ G  GF G+ GE G PG   L G++G  G +G  G+ G+          M                               GLKGE G S+ GL G  G+ G+RG  G+PG+ G +G PG +G   + G+ G +GD G  G                       GD+G +GI G  G+ G +G+ GF G  G+ G  G   ++GD G  GI G +G  G PG  G  G  G +G  G  G+              G  G +G+    G+ G  G+ G PGFPG  GK+G  G  G  G    + G  G  G  G  G  G KG  G++GLPG  G  G +  IGY         HSQS   P C  G + L+ GYSLL + G   +   DLG  GSCL  FSTIPF+ C           C+   RN +SYWLST       P    ++ +YISRCSVC+  +  +A HSQ  D  +  CP GW+ LW G+SF M   A   G  Q   SPGSCL+ FR+ PFIECN     C  + +  S+++T VD + QFV+               IS+C VC + +
Sbjct:    2 GEPGPRGPSGEIGKPGRDGTYGFPGQPGPPGDAGF-GLPGDRGFPGFPGGKGRPGLAGE---PGIGYAGVPGVQGLPGDPGINGIPGQPGLPGARGQTLPCIITGEVGSPGFPGLPGVPGPKGQPGPSGLSGRPGFDGVKGERGSPGIGGQPGPQGFIGQRGDPGLPGLT----SPGTPGAPGKDGRPGFPGRKGEPGEALGTTPGTQGFPGQPGLPGDKGQQGTPGLPGGPGFDGRFGVPGLKGMQGDAGFPGPQGPPGPPGYVPPSDPVRGPPGPPGFPGPRGFPGLKGERGDPGR-------SVSGSKGNSGPRGIPGRQGEVGRTGSPG---LGQN-GIPGRPGTKGQKGFPGLLGFTGLPGRPGDGGLPGGKGLPGIPGREGRPGENGRTGTKGDRGEPGRPGPAPPLFPEGILDKGEKGIPG------------------ITGVPGFPGQRG---DKGFPGSPGRPGQPGQPGDP-IQAKGL---------------------------PGDPGF--PGRQGLAGFSGIKGAAGVLGFPGMPGPKGDNGVPGLPGLPGSPGQPGVKGQKGDATGIPGAPGTKGLVGNAGFPG-----------------------GPGASGEPGAPGFNGISGLPGQKGLLGDPGRPGFSGLPGLPGTMGLPGYPGDKGRSGESGRPGFPGRPGEKGLPGSPGLDGLNGLQGPKGQQGVPGVTEGGRTGAPGMD------------------------------GLKGERGSSLPGLPGFSGAKGVRGQDGLPGQPGFQGPPGPRGLPSSSGIPGPVGDPGLPGLDGGQGFSGPPGPPGPAGPGTIQGDRGDAGIPGFSGTPGKRGEPGFPGRFGLPGNPGFKGMKGDPGNSGIPGPQGPAGDPGQYGYKGPKGSQGKRGSPGLPGIFLPPEDVQIPNGDFGPEGFSGGPGLAGSAGQPGSPGFPGPKGKIGSPGKPGRSGPAG-SPGIVGDPGSPGFQGLTGYKGFPGKQGLPGRPGLPGRSIGIGYT-----LVKHSQSSQVPMCPQGMAKLWEGYSLLYVEGQEKAHNQDLGLAGSCLPRFSTIPFLYCTTTE------LCYYASRNDKSYWLSTTAPIPMMPVAKQQITEYISRCSVCEAPSQAVAVHSQ--DTSIPPCPSGWRSLWIGYSFLMHTAAGAEGGGQSLVSPGSCLEDFRATPFIECNGARGTCFFFNNKHSFWLTTVDRDRQFVQGPESETLKGDQYRTRISRCQVCMKIL 1124          

HSP 2 Score: 186.422 bits (472), Expect = 4.148e-47
Identity = 349/1008 (34.62%), Postives = 425/1008 (42.16%), Query Frame = 3
Query:  435 GLTGCDGQQGDFGNPGMNGLVGRTGQPGERGDDGDRGLSIIPKYGLKGNKGSRGLLGRYGRKGEKGFKGIKGYSGIFGIKGNKGYVGPMGRRGPKGDSLGTVIIQSEKGSKGDKGLKGQSGIPCKGFQIEGRMYGRVGSDGPIGDKGIKGEKGLMGEIGQSGIDGARGLNGEKGLPGEAGPR------GERGDRGNPGF--PGDPGASGADGTRGRQGERGPKG-----VHGISGADGPRGSRGDKGPSGSLLSCPGRKGEKGFFGIPGIKGDIGNK-------------------------------------GYQGHDGDIGEIGFKGEKGYEGPLGPSCSEVEQGFRGTK--GESGFPGLRGAKGQRGYSGNKGIKGKPNFGTGINNPGETGSY---GNLGVPGEKGNKGFIGDTGEKGFSGTGKQGPEGPRG--DKGDDGVNGQVGMIGMPGIKGDKGSTYPICP--FCEKGYKG--IQXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEGRMGLLGSKGRQGYKGGKGFSGSMGDAGEIGYVTISGTTIPGVKGEKGNQGPKGNKGEFGEAGSRGRKGYSGLKGFKGLIGERGTSFSSGDPGDKGLRGENGKDGVS-FAGIPGEKGLKGDKGNRGILGDVGSLSNCATRPITSKGFKGPQGAKGTSGSPGSAGKTGIVGNKGENGYPGKRGIDGDNGIPGSKGEEGETGIK--GHAGRPGNLGKSG-----LQGLRGEYGVKGDLGIQGIPGRKGVMGDPGPNGYA----MIGSKGDKGIKGL------------------PGIYGAKGDKGRPGYIGIPGFKGETGLIGRSGLKGDQGEIGEKGIKGFTFISNNPGDRGLLGNKGLKGFPGELGNKGQVGVCTVRGDQGLRG-------YSGLIGDMGMKGEQGSKGIVGDYGAASRSGIMGRTGKIGNQGLPGDQXXXXXXXXXXXXXXXXYIGIPGFEGDRGE---KGNKGFPGFPGDIGQPGRLGNPGIS 3155
            G  G  G  G+ G PG +G  G  GQPG  GD G         +GL G++G  G  G  GR G  G  GI GY+G+ G++G  G  G                I    G  G  G +GQ+ +PC        + G VGS G  G  G+ G KG  G  G SG  G  G+ GE+G PG  G        G+RGD G PG   PG PGA G DG  G  G +G  G       G  G  G  G  GDKG  G+     G  G  G FG+PG+KG  G+                                      G +G  GD G     G KG  GP G    + E G  G+   G++G PG  G KGQ+G+ G  G  G P        PG  G     G  G PGE G  G  GD GE G  G     P  P G  DKG+ G+ G  G+ G PG +GDKG  +P  P    + G  G  IQ                                 GL G  G  G +G  GFSG  G AG +G+       +PG KG+ G  G  G  G  G+ G +G+KG +   G  G  G +G   ++G PG  G  GE G  G +  +G+PG+KGL GD G  G  G  G             G  G  G  G  G  G +G+ G  G  GE G PG  G+DG NG+ G KG++G  G+   G  G PG  G  G     L GL G  G KG  G  G+PG+ G  G PGP G      + G  GD G+ GL                    I G +GD G PG+ G PG +GE G  GR GL G+ G  G KG         +PG+ G+ G +G  G PG+ G KG  G    RG  GL G            GD G +G  G  G+ G  G     G  G  GKIG+ G PG  G                 G PG  GD G    +G  G+ GFPG  G PGR G PG S
Sbjct:    2 GEPGPRGPSGEIGKPGRDGTYGFPGQPGPPGDAG---------FGLPGDRGFPGFPGGKGRPGLAGEPGI-GYAGVPGVQGLPGDPG----------------INGIPGQPGLPGARGQT-LPCI-------ITGEVGSPGFPGLPGVPGPKGQPGPSGLSGRPGFDGVKGERGSPGIGGQPGPQGFIGQRGDPGLPGLTSPGTPGAPGKDGRPGFPGRKGEPGEALGTTPGTQGFPGQPGLPGDKGQQGTPGLP-GGPGFDGRFGVPGLKGMQGDAGFPGPQGPPGPPGYVPPSDPVRGPPGPPGFPGPRGFPGLKGERGDPGR-SVSGSKGNSGPRGIPGRQGEVGRTGSPGLGQNGIPGRPGTKGQKGFPGLLGFTGLPGRPGDGGLPGGKGLPGIPGREGRPGENGRTGTKGDRGEPGRPGPAP--PLFPEGILDKGEKGIPGITGVPGFPGQRGDKG--FPGSPGRPGQPGQPGDPIQA-------------------------------KGLPGDPGFPGRQGLAGFSGIKGAAGVLGF-----PGMPGPKGDNGVPGLPGLPGSPGQPGVKGQKGDA--TGIPGAPGTKGLVGNAGFPGGPGASGEPGAPGFNGISGLPGQKGLLGDPGRPGFSGLPG-----------LPGTMGLPGYPGDKGRSGESGRPGFPGRPGEKGLPGSPGLDGLNGLQGPKGQQGVPGVTEGGRTGAPGMDGLKGERGSSLPGLPGFSGAKGVRGQDGLPGQPGFQGPPGPRGLPSSSGIPGPVGDPGLPGLDGGQGFSGPPGPPGPAGPGTIQGDRGDAGIPGFSGTPGKRGEPGFPGRFGLPGNPGFKGMKG---------DPGNSGIPGPQGPAGDPGQYGYKGPKGSQGKRGSPGLPGIFLPPEDVQIPNGDFGPEGFSGGPGLAGSAGQPGSPGFPGPKGKIGSPGKPGRSGP---------------AGSPGIVGDPGSPGFQGLTGYKGFPGKQGLPGRPGLPGRS 896          

HSP 3 Score: 179.489 bits (454), Expect = 6.279e-45
Identity = 344/981 (35.07%), Postives = 430/981 (43.83%), Query Frame = 3
Query:  216 QGFPGPRGYQGVSGDKGDVGQ--------------FGMPGPKGYKGFTGAIGPQGRKGERGIPGSPGYPGKMGEMGFPGIRGDIGEKGLTGCDGQQ------GDFGNPGMNGLVGRTGQPGERGDDGDRGLSIIPKYGLKGNKGSRGLLGR---------YGRKGEKGFKGIKGYSGIFGIKGNKGYVGPMGRRGPKGDSLGTVIIQSEKGSKGDKGLKGQSGIP-CKGFQIEGRMYGRVGSDGPIGDKGIKGEKG----------LMGEIGQSGIDGARGLNGEKGLPGEAGPRGERGDRGNPG--FPGDPGASGADGTRGRQGERGPKGVHGISGADGPRGSRGDKGPSGSLLSCPGRKGEKGFFGIPGIKG------------------DIGNKGYQGHDGDIGEIGFKGEKGYEGPLGPSCSE--VEQGFRGTKGESGFPGLRGAKGQRGYSGNKGIKGKPNFGTGINNPGET----GSYGNLGVPGEKGNKGFIGDTGEKGFSGTGKQGPEGPRGDKGDDGVNGQVGMIGMPGIKGDKGSTYPICPFCEKGYKGIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEGRMGLLGSKGRQGYKGGKGFSGSMGDAGEIGYVTISGTTIPGVKGEKGNQGPKGNKGEFGEAGSRGRKGYSGLKGFKGLIGERGTSF--------SSGDPGDKGLRGENGKDGVSFAGIPGEKGLKGDKGNRGILGDVGSLSNCATRPITSKGFKGPQGAKGTSGSPGSAGKTGIVGNKGENGYPGKRGIDGDNGIPGSKGEEGETGIKGHAGRPGNLGKSG------LQGLRGEYGVKGDLGIQGIPGRKGVMGDPGPNGYA-MIGSKGDKGIKGLPGIY----------------------GAKGDKGRPGYIGIPGFKGETGL---IGRSGLKGDQGEIGEKGIKGFTFISNNPGDRGLLGNKGLKGFPGELGNKGQVGVCTVRGDQ 2840
             G PGPRG  G  G  G  G               FG+PG +G+ GF G  G  G  GE GI G  G PG  G  G PGI G  G+ GL G  GQ       G+ G+PG  GL    G PG +G  G  GLS  P  G  G KG RG  G           G++G+ G  G+    G  G  G  G  G  GR+G  G++LGT        + G +G  GQ G+P  KG Q    + G  G DG  G  G+KG +G                    D  RG  G  G PG  G  G +G+RG+PG    G  G SG  G  GRQGE G  G  G+       G  G  G        PG KG+KGF G+ G  G                    G +G  G +G  G  G +GE G  GP  P   E  +++G +G  G +G PG  G +G +G+ G+ G  G+P        PG+     G  G+ G PG +G  GF G  G  G    G  G  GP+GD G  G+ G  G  G PG+KG KG    I      G  G +G +G  G  G  G +G  G  G  G+ G  G+ GLLG  GR G+ G  G  G+MG              +PG  G+KG  G  G  G  G  G +G  G  GL G  GL G +G            +G PG  GL+GE G    S  G+PG  G KG +G  G+ G  G            +G  GP+G   +SG PG  G  G+ G  G  G+ G  G  G  G    +G+ G+ GI G +G PG  G+ G      L G  G  G+KGD G  GIPG +G  GDPG  GY    GS+G +G  GLPGI+                      G  G  G+PG  G PG KG+ G     GRSG  G  G +G+ G  GF  ++   G +G  G +GL G PG  G    +G   V+  Q
Sbjct:    1 MGEPGPRGPSGEIGKPGRDGTYGFPGQPGPPGDAGFGLPGDRGFPGFPGGKGRPGLAGEPGI-GYAGVPGVQGLPGDPGINGIPGQPGLPGARGQTLPCIITGEVGSPGFPGL---PGVPGPKGQPGPSGLSGRP--GFDGVKGERGSPGIGGQPGPQGFIGQRGDPGLPGLT-SPGTPGAPGKDGRPGFPGRKGEPGEALGT--------TPGTQGFPGQPGLPGDKGQQGTPGLPGGPGFDGRFGVPGLKGMQGDAGFPGPQGPPGPPGYVPPSDPVRGPPGPPGFPGPRGFPGLKGERGDPGRSVSGSKGNSGPRGIPGRQGEVGRTGSPGL-------GQNGIPG-------RPGTKGQKGFPGLLGFTGLPGRPGDGGLPGGKGLPGIPGREGRPGENGRTGTKGDRGEPGRPGPAPPLFPEGILDKGEKGIPGITGVPGFPGQRGDKGFPGSPGRPGQPG------QPGDPIQAKGLPGDPGFPGRQGLAGFSGIKGAAGV--LGFPGMPGPKGDNGVPGLPGLPGSPGQPGVKGQKGDATGI-----PGAPGTKGLVGNAGFPGGPGASGEPGAPGFNGISGLPGQKGLLGDPGRPGFSGLPGLPGTMG--------------LPGYPGDKGRSGESGRPGFPGRPGEKGLPGSPGLDGLNGLQGPKGQQGVPGVTEGGRTGAPGMDGLKGERGS---SLPGLPGFSGAKGVRGQDGLPGQPGF-----------QGPPGPRGLPSSSGIPGPVGDPGLPGLDGGQGFSGPPGPPGPAGPGTIQGDRGDAGIPGFSGTPGKRGEPGFPGRFGLPGNPGFKGMKGDPGNSGIPGPQGPAGDPGQYGYKGPKGSQGKRGSPGLPGIFLPPEDVQIPNGDFGPEGFSGGPGLAGSAGQPGSPGFPGPKGKIGSPGKPGRSGPAGSPGIVGDPGSPGFQGLT---GYKGFPGKQGLPGRPGLPGRSIGIGYTLVKHSQ 908          

HSP 4 Score: 178.718 bits (452), Expect = 1.248e-44
Identity = 298/906 (32.89%), Postives = 363/906 (40.07%), Query Frame = 3
Query:  189 CQCFGNKGRQGFPGPRGYQGVSGDKGDVGQFGMPGPKGYKGFTGA---------------IGPQGRKGERGI--PGSPGYPGKMGEMGFPGIRGDIGEKGLTGCDGQQGDFGNPGMNGLVG---------------RTGQPGERGDDGD-------------------------------------------RGLSIIPKYGLKGNKGSRGLLGRYGRKGEKGFKGI--KGYSGIFGIKGNKGYVGPMGRRGPKGDSLGTVII-----------QSEKGSKGDKGLKGQSGIPCKGFQIEGRMYGRVGSDGPIGDKGI--KGEKGLMGEIGQSGIDGARGLNGEKGLPGEAGPRGERGDRGNP----GFPGDPGASGADGTRGRQGERGPKGVHGISGADGPRGSRGDKGPSGSLLSC--PGRKGEK----GFFGIPGIKGDIGNKGYQGHDGDIGEIGFKGEKGYEGPLGPSCSEVEQGFRGTKGESGFPGLRGAKGQRGYSGNKGIKGKPNFGTGINNPGETGSYGNLGVPGEKGNKGFIGDTGEKGFSGTGKQGPEGPRGDKGDDGVN--GQVGMIGMPGIKGDKGSTYPICPFCEKGYKGIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEGRMGLLGSKGRQGYKGGKGFSGSMGDAGEIGYVTISGT-------------------TIPGVKGEKGNQGPKGNKGEFGEAGSRGRKGYSGLKGFKGLIGERGTSFSSGDPGDKGLRGENGKDGVSFAGIPGEKGLKGDKGNRGILGDVGSLSNCATRPITSKGFKGPQGAKGTSGSPGSAGKTGIVGNKGENGYPGKRGIDGDNGIPGSKGEEGETGIKGHAGRPGNLGKSGLQGLRGEYGVKGDLGIQGIPGRKGVMGDPGPNGYAMI 2543
            C   G  G  GFP   G  GV G KG  G  G+ G  G+ G  G                IG +G  G  G+  PG+PG PGK G  GFPG +G+ GE  L    G QG  G PG+ G  G               R G PG +G  GD                                           RG       G KGN G RG+ GR G  G  G  G+   G  G  G KG KG+ G +G  G  G      +            +   G  G  G KG  G P           GR G   P+  +GI  KGEKG+ G  G  G  G R   G+KG PG  G  G+ G  G+P    G PGDPG  G  G  G  G +G  GV G  G  GP+G  G  G  G   S   PG KG+K    G  G PG KG +GN G+ G  G  GE G  G  G  G  G      ++G  G  G  GF GL G  G  G  G  G KG+            +G  G  G PG  G KG  G  G  G +G      +GP+G +G  GV   G+ G  GM G+KG++GS+ P  P    G KG++                              G+ GL G  G QG  G +G   S G  G +G   + G                    TI G +G+ G  G  G  G+ GE G  GR G  G  GFKG+          GDPG+ G+ G  G      AG PG+ G KG KG++G  G  G L      P   +   G  G +G SG PG AG     G  G  G+PG +G  G  G PG  G  G  GI G  G PG  G +G +G  G+         QG+PGR G+ G     GY ++
Sbjct:   98 CIITGEVGSPGFP---GLPGVPGPKGQPGPSGLSGRPGFDGVKGERGSPGIGGQPGPQGFIGQRGDPGLPGLTSPGTPGAPGKDGRPGFPGRKGEPGEA-LGTTPGTQGFPGQPGLPGDKGQQGTPGLPGGPGFDGRFGVPGLKGMQGDAGFPGPQGPPGPPGYVPPSDPVRGPPGPPGFPGPRGFPGLKGERGDPGRSVSGSKGNSGPRGIPGRQGEVGRTGSPGLGQNGIPGRPGTKGQKGFPGLLGFTGLPGRPGDGGLPGGKGLPGIPGREGRPGENGRTGTKGDRGEP-----------GRPGPAPPLFPEGILDKGEKGIPGITGVPGFPGQR---GDKGFPGSPGRPGQPGQPGDPIQAKGLPGDPGFPGRQGLAGFSGIKGAAGVLGFPGMPGPKGDNGVPGLPGLPGSPGQPGVKGQKGDATGIPGAPGTKGLVGNAGFPGGPGASGEPGAPGFNGISGLPG------QKGLLGDPGRPGFSGLPGLPGTMGLPGYPGDKGR------------SGESGRPGFPGRPGEKGLPGSPGLDGLNGL-----QGPKGQQGVPGVTEGGRTGAPGMDGLKGERGSSLPGLPGFS-GAKGVR------------------------------GQDGLPGQPGFQGPPGPRGLPSSSGIPGPVGDPGLPGLDGGQGFSGPPGPPGPAGPGTIQGDRGDAGIPGFSGTPGKRGEPGFPGRFGLPGNPGFKGM---------KGDPGNSGIPGPQGP-----AGDPGQYGYKGPKGSQGKRGSPG-LPGIFLPPEDVQIPNGDFGPEGFSGGPGLAGS---AGQPGSPGFPGPKGKIGSPGKPGRSGPAGSPGIVGDPGSPGFQGLTGYKGFPGK---------QGLPGRPGLPGRSIGIGYTLV 904          

HSP 5 Score: 176.407 bits (446), Expect = 5.796e-44
Identity = 269/744 (36.16%), Postives = 333/744 (44.76%), Query Frame = 3
Query:  207 KGRQGFPGPRGYQGVSGDKGDVGQFGMPGPKGYKGFTGAIGPQGRKGERGIPGSPGYPGKMGEMGFPGIRGDIGEKGLTGCDGQQGDFGNPGMNGLVGRTGQPGERGDDGDRGLSIIPKYGLKGNKGSRGLLGRYG--RKGEKGFKGIKGYSGIFGIKGNKGYVGPMGRRGPKGDSLGTVIIQSEKGSKGDKGLKGQSGIPCKGFQ-IEGR--MYGRVGSDGPIGDKGIKGEKGLMGEIGQSGIDGARGLNGEKGLPGEAGPRGERGDRGNPGFPGDPGASGADGTRGRQGERGPKGVHGISGADGPRGSRGDKGPSGSLLSCPGRKGEKGFFGIPGIKGDIGNKGYQGHDGDIGEIGFKGEKGYEGPLGPSCSEVEQGFRGTKGESGFPGLRGAKGQRGYSGNKGIKGKPNFGTGINNPGETGSYGNLGVPGEKGNK--GFIGDTGEKGFSG-------TGKQGPEGPRGDKGDDGVNGQVGMIGMPGIKGDKGSTYPICPFCEKGYKGIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEGRMGLLGSKGRQGYKGGKGFSGSMGDAGEIGYVTISGTTIPGVKGEKGNQGPKGNKGEFGEAGSRGRKGYSGLKGFKGL-IGERGTSFSSGDPGDKGLRGENGKDGVSFAGIPGEKGLKGDKGNRGILGDVGSLSNCATRPITSKGFKGPQGAKGTSGSPGSAGKTGIVGNKGENGYPGKRGIDGDNGIPGSKGEEGETGIK 2393
            KG +G PG    + VSG KG+ G  G+PG +G  G TG+ G     G+ GIPG PG     G+ GFPG+   +G  GL G  G  G  G  G+ G+ GR G+PGE G  G +G       G  G  G    L   G   KGEKG  GI G  G  G +G+KG+ G  GR G  G     +     KG  GD G  G+ G+   GF  I+G   + G  G  GP GD G+ G  GL G  GQ G+ G +G     G+PG  G    +G  GN GFPG PGASG         E G  G +GISG  G +G  GD          PGR G   F G+PG+ G +G  GY G  G  GE G                    GF G  GE G PG  G  G  G  G KG +G P    G+   G TG+ G  G+ GE+G+   G  G +G KG  G        G QGP GPRG     G+ G VG  G+PG+ G +G + P  P    G   IQG                           D G  G+ G  G  G +G  GF G  G  G  G+  + G   PG  G  G QGP G+ G++G  G +G +G  G  G  G+ +        +GD G +G  G  G  G   AG PG  G  G KG  G  G  G                GP G+ G  G PGS G  G+ G KG   +PGK+G+ G  G+PG     G T +K
Sbjct:  283 KGERGDPG----RSVSGSKGNSGPRGIPGRQGEVGRTGSPG----LGQNGIPGRPG---TKGQKGFPGL---LGFTGLPGRPGDGGLPGGKGLPGIPGREGRPGENGRTGTKG-----DRGEPGRPGPAPPLFPEGILDKGEKGIPGITGVPGFPGQRGDKGFPGSPGRPGQPGQPGDPI---QAKGLPGDPGFPGRQGL--AGFSGIKGAAGVLGFPGMPGPKGDNGVPGLPGLPGSPGQPGVKGQKG--DATGIPGAPG---TKGLVGNAGFPGGPGASG---------EPGAPGFNGISGLPGQKGLLGD----------PGRPG---FSGLPGLPGTMGLPGYPGDKGRSGESG------------------RPGFPGRPGEKGLPGSPGLDGLNGLQGPKGQQGVP----GVTEGGRTGAPGMDGLKGERGSSLPGLPGFSGAKGVRGQDGLPGQPGFQGPPGPRGLPSSSGIPGPVGDPGLPGLDGGQGFSGPPGPPGPAGPGTIQG---------------------------DRGDAGIPGFSGTPGKRGEPGFPGRFGLPGNPGFKGMKGD--PGNSGIPGPQGPAGDPGQYGYKGPKGSQGKRGSPGLPGIFLPPEDVQIPNGDFGPEGFSGGPGLAGS--AGQPGSPGFPGPKGKIGSPGKPGR--------------SGPAGSPGIVGDPGSPGFQGLTGYKG---FPGKQGLPGRPGLPGRSIGIGYTLVK 905          

HSP 6 Score: 174.096 bits (440), Expect = 2.759e-43
Identity = 312/911 (34.25%), Postives = 391/911 (42.92%), Query Frame = 3
Query: 1359 PGLRGAKGQRGYSGNKGIKGKPNFGTGINNPGETGSYGNLGVPGEKGNKGFIGDTGEKGFSG-TGKQGPEGPRGDKGDDGVNGQVGMIGMPGIKGDKGSTYPICPFCEKGYKGIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEGRMGLL--GSKGRQGYKGGKGFSGSMGDAGEIGYVTISGTTIPGVKGEKGNQGPKGNKGEFGEAGSRGRKGYSGLKGFKG----------------------------------------LIGERG-----------TSFSSGDPGDKGLRGENGKDGVSFAGIPGEKGLKGDKGNRGILGDVGSLSNCATRPITSKGFKGPQGAKGTSGSPGSAGKTGIVGNKGENGYPG--------------KRGIDGDNGIPGSKGEEGETGIKGHAGRPGNLGKSG----LQGLRGEYGVKGDLGI---QGIPGRKGVMGDPGPNGYAMIGSKGDKGIKGLPGIYGAKGDKGRPG----YIGIPGFKGETGLIGRSGLKGDQGEIGEKGIKGFTFISNNPGDRGLLGN------KGLKGFPGELGNKGQVGVCTVRGDQGLRGYSGLIGDMGMKGEQGSKGIVGDYGAASRSGIMG-----RTGKIGNQGLPGDQXXXXXXXXXXXXXXXXYIGIPGFEGDRGEKGNKGFPGFPGDIGQPGRLGNPGISTEGVXXXXXXXXXXXXXXXXXXXXXXXXXXKQGDSGISIPGRQGIKGEDGTIGLPGEMGEPGPRGDFGQKGNIGITGEFGLQGNRGDDGLKGDDGIPGLNGPRGFIGDIGFVGFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXE--LGLDGSMGGKGD---NGPRGFNGPTGIPGSKGFEGDKGIRGDIGVKGFQGQHGEIGFPGLKGVSGENG 3806
            PGL G  G  GY+G  G++G P       +PG  G  G  G+PG +G       TGE G  G  G  G  GP+G  G  G++G+ G  G   +KG++GS         +G+ G +G                           D G  GL   G+ G  G  G  GF G  G+ GE    T      PG  G  G++G +G  G  G  G  GR G  GLKG +G                                        L GERG            S   G PG +G  G  G  G+   GIPG  G KG KG  G+LG  G         +         G  G  G PG  G+TG  G++GE G PG              ++GI G  G+PG  G+ G+ G  G  GRPG  G+ G     +GL G+ G  G  G+    GI G  GV+G PG     M G KGD G+ GLPG+ G+ G  G  G      GIPG  G  GL+G +G  G  G  GE G  GF  IS  PG +GLLG+       GL G PG +G  G  G     G+ G  G+ G  G+ G+ G  G  G+ G  G   + G+ G     RTG  G  GL G++G                 G+PGF G +G +G  G PG PG  G PG  G P  S+ G+ G  G  GLPG  G  G  G  G PG  G   I        +G+ G  G+PG  G PG      ++G  G  G FGL GN G  G+KGD G  G+ GP+G  GD G  G++G KG++G++G  G  G  +                     GL GS G  G     GP+G  G  G PG  G  G  GI GD G  GFQG  G  GFPG +G+ G  G
Sbjct:   54 PGLAGEPG-IGYAGVPGVQGLPG------DPGINGIPGQPGLPGARGQTLPCIITGEVGSPGFPGLPGVPGPKGQPGPSGLSGRPGFDG---VKGERGSPGIGGQPGPQGFIGQRG---------------------------DPGLPGLTSPGTPGAPGKDGRPGFPGRKGEPGEALGTTPGTQGFPGQPGLPGDKGQQGTPGLPGGPGFDGRFGVPGLKGMQGDAGFPGPQGPPGPPGYVPPSDPVRGPPGPPGFPGPRGFPGLKGERGDPGRSVSGSKGNSGPRGIPGRQGEVGRTGSPGLGQNGIPGRPGTKGQKGFPGLLGFTGLPGRPGDGGLPGGKGL--PGIPGREGRPGENGRTGTKGDRGEPGRPGPAPPLFPEGILDKGEKGIPGITGVPGFPGQRGDKGFPGSPGRPGQPGQPGDPIQAKGLPGDPGFPGRQGLAGFSGIKGAAGVLGFPG-----MPGPKGDNGVPGLPGLPGSPGQPGVKGQKGDATGIPGAPGTKGLVGNAGFPGGPGASGEPGAPGFNGISGLPGQKGLLGDPGRPGFSGLPGLPGTMGLPGYPGDKGRSGESGRPGFPGRPGEKGLPGSPGLDGLNGLQGPKGQQGVPGVTEGGRTGAPGMDGLKGERGSS-------------LPGLPGFSGAKGVRGQDGLPGQPGFQGPPGPRGLP--SSSGIPGPVGDPGLPGLDGGQGFSGPPGPPGPAGPGTI--------QGDRGDAGIPGFSGTPG------KRGEPGFPGRFGLPGNPGFKGMKGDPGNSGIPGPQGPAGDPGQYGYKGPKGSQGKRGSPGLPGIFLPPEDVQIPNGDFGPEGFSGGPGLAGSAGQPGSPGFPGPKGKIGSPGKPGRSGPAGSPGIVGDPGSPGFQGLTGYKGFPGKQGLPGRPG 891          

HSP 7 Score: 171.785 bits (434), Expect = 1.741e-42
Identity = 323/963 (33.54%), Postives = 411/963 (42.68%), Query Frame = 3
Query:  873 GIKGEKGLMGEIGQSGIDGARGLNGEK--------GLPGEAGPRGERGDRGNPGFPGDPGASGADGTRGRQGERGPKGVHGISGADGPRGSRGDKGPSGSLLSCPGRKGEKGFFGIPGIKGDIGNKGYQGHDGDIGEIGFKGEKGYEGPLGPSCSEVEQGFRGTKGESGFPGLR-----GAKGQRGYSGNKGIKGKPNFGTGINN-----PGETGSYGN------------------LGVPGEKGNKG----------------------------------------FIGDTGEKGFSGTGKQGPEGPRGDKGDDGVNGQVGMIGM-----PGIKGDKGSTYPICPFCEKGYKGIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEGRMGLLGSKGRQGYKGGKG-----FSGSMGDAGEIGYVTISGTT-IPGVKGEKGNQGPKGNKGEFGEAGSR-------GRKGYSGLKGFKGLIGERGTSFSSGDPGDKGLRGENGKDGVS-FAGIPGEKGLKGDKGN-RGILGDVGSLSNCATRPITSKGFKGPQGAKGTSGSPGSAGKTGIVGNKGENGYPGKRGIDGDNGIPGS---------KGEEGETGIKGHAGRPGNLGKSGLQGLRGEYGVKGDLGIQGIPGRK--GVMGDPGPNGYAMIGSKGDKG--IKGLPGIYGAKGDKGRPGYIGIPGFKGETGLIGRSGLKGDQGEIGEKGIKGFTFISNNP---------------GDRGLLGNKGLKGFPGELGNKGQVGVCTVRGDQGLRGYSGLIGDMGMKGEQGSKGIVGDYGAASRSGIMGRTGKIGNQGLPGD-QXXXXXXXXXXXXXXXXYIGIPGFEGDRGEKGNKGFPGFPGDIGQPGRLGNPGIS-TEGVXXXXXXXXXXXXXXXXXXXXXXXXXXKQGDSGISIPGRQGIKGEDGTIGLPGEMGEPGPRGDFGQKGNIGIT 3383
            G  G +G  GEIG+ G DG  G  G+         GLPG+ G  G  G +G PG  G+PG  G  G  G QG  G  G++GI G  G  G+RG        L C    GE G  G PG+ G  G KG  G  G  G  GF G KG  G  G       QGF G +G+ G PGL      GA G+ G  G  G KG+P    G        PG+ G  G+                   GVPG KG +G                                          G+ G+ G S +G +G  GPRG  G  G  G+ G  G+     PG  G KG         +KG+ G+ G  G  G  G+ G+ G KG  G  G  G  G  G  G+KG +G  G  G     F   + D GE G   I+G    PG +G+KG  G  G  G+ G+ G         G  G+ G +G  G  G +G +   G PG  G +G+NG  G+    G PG+ G+KG KG+  GI G  G+        + + GF G  GA G  G+PG  G +G+ G KG  G PG+ G  G  G+PG+         KG  GE+G  G  GRPG  G  G  GL G  G++G  G QG+PG    G  G PG     M G KG++G  + GLPG  GAKG +G+ G  G PGF+G  G  G     G  G +G+ G+ G                       GDRG  G  G  G PG+ G  G  G   + G+ G +G  G  G+ G+ G QG  G  G YG     G  G  GK G+ GLPG        +   G  G +G+ G PG  G  G+ G+ GFPG  G IG PG+ G  G + + G+                                +  PG  G +G  G  G PG+ G PG  G  G+   IG T
Sbjct:    2 GEPGPRGPSGEIGKPGRDGTYGFPGQPGPPGDAGFGLPGDRGFPGFPGGKGRPGLAGEPGI-GYAGVPGVQGLPGDPGINGIPGQPGLPGARGQT------LPC-IITGEVGSPGFPGLPGVPGPKGQPGPSGLSGRPGFDGVKGERGSPGIGGQPGPQGFIGQRGDPGLPGLTSPGTPGAPGKDGRPGFPGRKGEPGEALGTTPGTQGFPGQPGLPGDKGQQGTPGLPGGPGFDGRFGVPGLKGMQGDAGFPGPQGPPGPPGYVPPSDPVRGPPGPPGFPGPRGFPGLKGERGDPGRSVSGSKGNSGPRGIPGRQGEVGRTGSPGLGQNGIPGRPGTKG---------QKGFPGLLGFTGLPGRPGDGGLPGGKGLPGIPGREGRPGENGRTGTKGDRGEPGRPGPAPPLFPEGILDKGEKGIPGITGVPGFPGQRGDKGFPGSPGRPGQPGQPGDPIQAKGLPGDPGFPGRQGLAGFSGIKGAAGVLGFPGMPGPKGDNGVPGLPGLPGSPGQPGVKGQKGDATGIPGAPGTKGL-----VGNAGFPGGPGASGEPGAPGFNGISGLPGQKGLLGDPGRPGFSGLPGLPGTMGLPGYPGDKGRSGESGRPGFPGRPGEKGLPGSPGLDGLNGLQGPKGQQGVPGVTEGGRTGAPG-----MDGLKGERGSSLPGLPGFSGAKGVRGQDGLPGQPGFQGPPGPRGLPSSSGIPGPVGDPGLPGLDGGQGFSGPPGPPGPAGPGTIQGDRGDAGIPGFSGTPGKRGEPGFPGRFGLPGNPGFKGMKGDPGNSGIPGPQGPAGDPGQYG---YKGPKGSQGKRGSPGLPGIFLPPEDVQIPNGDFGPEGFSGGPGLAGSAGQPGSPGFPGPKGKIGSPGKPGRSGPAGSPGI--------------------------------VGDPGSPGFQGLTGYKGFPGKQGLPGRPGLPGRSIGIGYT 902          

HSP 8 Score: 166.007 bits (419), Expect = 1.006e-40
Identity = 339/976 (34.73%), Postives = 401/976 (41.09%), Query Frame = 3
Query:  396 MGFPGIRGDIGEKGLTGCDGQQGDFGNPGMNGLVGRTGQPGERGDDGDRGLSIIPKYGLKGNKGSRGLLGRYGRKGEKGFKGIKGYSGIFGIKGNKGYVGPMGRRGPKGDSLGTVIIQSEKGSKGDKGLKGQSGIPCKGFQIEGRMYGRVGSDGP------------------IGDKGIKGEKGLM--GEIGQSGIDGARGLNGEKGLPGEA--GPRGERGDRGNPGFPGDPGASGADGTRGRQGERGPKGVHGISGADGP----------------------------------------RGSRGDKGPSGSLLSCPGRKGEKGFFGIPGIKGDIGNKGYQG--HDGDIGEIGFKGEKGYEGPLGPS---CSEVEQGFRGTKGESGFPGLRGAKGQRGYSGNKGIKGKPN--------FGTGINNPGETGSYGNLGVPG---EKGNKGFIGDTGEKGFSGTGKQGPEGPRGDKGDDGVNGQVGMIGMPGIKGDKGST-YPICPFCEKGYKGIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEGRMGLLGSKGRQGYKGGKG-FSGSMGDAGEIGYVTISGTTIPGVKGEKGNQGPKGNKGEFGEAGSRGRKGYSGLKGFKGLIGERGTSFSSGDPGDKGLRGENGKDGVSFAGIPGEKGLKGDKGNRGILGDVGSLSNCATRPITS---------KGFKGPQGAK-----GTSGSPGSAGKTGIVGNKGENGYPGKRGIDGDNGIPGSKGEEGETG---------------------IKGHAGRPGNLGKSGLQGLRGEYGVKGDLGIQGIPGRKGVMGDPGPNGYAMIGSKGDKGIKGLPGIYGAKGDKGRPGYIGIPGFKGETGLIGRSGLKGDQGEIGEKGIKGFTFISNNPGDRGLLGNKGLKGFPGELGNKGQVGVCTVRGDQGLRGYSGLIGDMGMKGEQ---GSKGIVGDYGAASRSGIMGRTGKIG 2969
            MG PG RG  GE G  G DG  G  G PG  G  G  G PG+RG  G  G    P  GL G  G        G  G  G +G+ G  GI GI G  G  G  G+  P        II  E GS G  GL G  G   KG      + GR G DG                   IG +G  G  GL   G  G  G DG  G  G KG PGEA     G +G  G PG PGD G  G  G  G  G  G  GV G+ G  G                                         +G RGD G      S  G KG  G  GIPG +G++G  G  G   +G  G  G KG+KG+ G LG +       + G  G KG  G PG  G  G+ G +G KG +G+P         F  GI + GE G  G  GVPG   ++G+KGF G  G  G  G     P   +G  GD G  G+ G+ G  GIKG  G   +P  P   KG  G+                               G  GL GS G+ G KG KG  +G  G  G  G V  +G   PG  G  G  G  G  G  G  G +G  G  G  GF GL G  GT    G PGDKG  GE+G+ G  F G PGEKGL G  G  G+ G  G         +T           G KG +G+      G SG+ G  G+ G+ G  G  G PG RG+   +GIPG  G+ G  G                     I+G  G  G  G SG  G RGE G  G  G+ G PG KG+ GDPG +G       G +G  G PG YG KG KG  G  G PG  G    +    ++   G+ G +G  G       PG  G  G  G  GFPG    KG++G     G  G  G  G++GD G  G Q   G KG  G  G   R G+ GR+  IG
Sbjct:    1 MGEPGPRGPSGEIGKPGRDGTYGFPGQPGPPGDAG-FGLPGDRGFPGFPGGKGRP--GLAGEPG-------IGYAGVPGVQGLPGDPGINGIPGQPGLPGARGQTLP-------CIITGEVGSPGFPGLPGVPGP--KGQPGPSGLSGRPGFDGVKGERGSPGIGGQPGPQGFIGQRGDPGLPGLTSPGTPGAPGKDGRPGFPGRKGEPGEALGTTPGTQGFPGQPGLPGDKGQQGTPGLPGGPGFDGRFGVPGLKGMQGDAGFPGPQGPPGPPGYVPPSDPVRGPPGPPGFPGPRGFPGLKGERGDPG-----RSVSGSKGNSGPRGIPGRQGEVGRTGSPGLGQNGIPGRPGTKGQKGFPGLLGFTGLPGRPGDGGLPGGKGLPGIPGREGRPGENGRTGTKGDRGEPGRPGPAPPLFPEGILDKGEKGIPGITGVPGFPGQRGDKGFPGSPGRPGQPGQPGD-PIQAKGLPGDPGFPGRQGLAGFSGIKGAAGVLGFPGMP-GPKGDNGV------------------------------PGLPGLPGSPGQPGVKGQKGDATGIPGAPGTKGLVGNAG--FPGGPGASGEPGAPGFNGISGLPGQKGLLGDPGRPGFSGLPGLPGTMGLPGYPGDKGRSGESGRPG--FPGRPGEKGLPGSPGLDGLNGLQGPKGQQGVPGVTEGGRTGAPGMDGLKGERGSSLPGLPGFSGAKGVRGQDGLPGQPGFQGPPGPRGLPSSSGIPGPVGDPGLPGLDGGQGFSGPPGPPGPAGPGTIQGDRGDAGIPGFSGTPGKRGEPGFPGRFGLPGNPGFKGMKGDPGNSGIP-----GPQGPAGDPGQYGYKGPKGSQGKRGSPGLPGI--FLPPEDVQIPNGDFGPEGFSG------GPGLAGSAGQPGSPGFPGP---KGKIGSPGKPGRSGPAGSPGIVGDPGSPGFQGLTGYKGFPGKQGLPGRPGLPGRSIGIG 900          

HSP 9 Score: 159.458 bits (402), Expect = 9.251e-39
Identity = 199/531 (37.48%), Postives = 238/531 (44.82%), Query Frame = 3
Query:  183 DKCQCFGNKGRQGFPGPRGYQGVSGDKGDVGQFGMPGPKGYKGFTGAIGPQGRKGERGIPGSPGYPGKMGEM-------GFPGIRGDIGEKGLTGCDGQQGDFGNPGMNGLVGRTGQPGERGDDGDRGLSIIPKYGLKGNKGSRGLLGRYGRKGEKGFKGIKGYSGIFGIKGNKGYVGPMGRRGPKGDSLGTVIIQSEKGSKGDKGLKGQSGIPCKGFQIEGRMYGRVGSDGPIGDKGIKGEKGLMGEIGQSGIDGARGLNGEKGLPGEAGPRGERGDRGNPGFPGDPGASGADGTRGR---------------QGERGPKGVHGISGADGPRGSRGDKGPSGSLLSCPGRKGEKGFFGIPGIKGDIGNKGY---QGHDGDIGEIGFKGEKGYEGP----------LGPSCSEVEQGFRGTKGESGFPGLRGAKGQRGYSGNKGIKGKPNFGTGINNPGETGSYGNLGVPGEKGNKGFIGDTGEKGFSGTGKQGPEGPRGDKGDDGVNGQVGMIGMPGIKGDKGSTYPICP 1670
            D  Q  G  G  GFPG +G  G SG KG  G  G PG  G KG  G        G  G+PGSPG PG  G+        G PG +G +G  G  G  G  G+ G PG NG+ G  GQ G  GD G  G S +P  GL G  G  G  G  GR GE G  G  G  G  G+ G+ G  G  G +GP                      KGQ G+P      EG   G  G DG  G++G     GL G  G  G+ G  GL G+ G  G  GPRG     G PG  GDPG  G DG +G                QG+RG  G+ G SG  G RG  G           PGR G  G  G  G+KGD GN G    QG  GD G+ G+KG KG +G           L P   ++  G  G +G SG PGL G+ GQ G  G  G KGK   G+    PG +G  G+ G+ G+ G+ GF G TG KGF G         +G  G  G+ G+   IG   +K  + S  P+CP
Sbjct:  441 DPIQAKGLPGDPGFPGRQGLAGFSGIKGAAGVLGFPGMPGPKGDNGV------PGLPGLPGSPGQPGVKGQKGDATGIPGAPGTKGLVGNAGFPGGPGASGEPGAPGFNGISGLPGQKGLLGDPGRPGFSGLP--GLPGTMGLPGYPGDKGRSGESGRPGFPGRPGEKGLPGSPGLDGLNGLQGP----------------------KGQQGVPGV---TEGGRTGAPGMDGLKGERG-SSLPGLPGFSGAKGVRGQDGLPGQPGFQGPPGPRGLPSSSGIPGPVGDPGLPGLDGGQGFSGPPGPPGPAGPGTIQGDRGDAGIPGFSGTPGKRGEPG----------FPGRFGLPGNPGFKGMKGDPGNSGIPGPQGPAGDPGQYGYKGPKGSQGKRGSPGLPGIFLPPEDVQIPNGDFGPEGFSGGPGLAGSAGQPGSPGFPGPKGK--IGS-PGKPGRSGPAGSPGIVGDPGSPGFQGLTGYKGFPGK--------QGLPGRPGLPGRSIGIGYTLVKHSQSSQVPMCP 916          

HSP 10 Score: 137.887 bits (346), Expect = 4.249e-32
Identity = 264/833 (31.69%), Postives = 321/833 (38.54%), Query Frame = 3
Query: 1797 MGLLGSKGRQGYKGGKGFSGSMGDAGEIGYVTISGTTIPGV-KGEKGNQGPKGNKGEFGEAGSRGRKGYSGLKGFKGLIGERGTSFSSGDPGDKGLRGENGKDGVSFAGIPGEKGLKGDKGNRGILGDVGSLSNCATRPITSKGFKGPQGAKGTSGSPGSAGKTGIVGNKGENGYPGKRGIDGD------------------------------------------------NGIPGSKGEEGETGIKGHAGRPGNLGKSGL--------QGLRGEYGVKGDLGIQG------------------IPGR------------KGVMGDPG---------PNGYAMIGSKGDKGIKGLPGIYGAKGDKGRPGYIGIP-------------GFKGETGLIGRSGLKGDQGEIGEKGIKGFTFISNNPGDRGLLGNKGLKGFPGELGNKGQVGVCT----VRGDQGLRGYSGLIGDMGMKGEQGSKGIVGDYGAASRSGIMGRTGKIGNQGLPGDQXXXXXXXXXXXXXXXXYIGIPGFEGDRGEKGNKGFPGFPGDIGQPGRLGNPGISTEGVXXXXXXXXXXXXXXXXXXXXXXXXXXKQGDSGISIP------GRQGIKGEDGTIGLPGEMGEPGPRGDFGQKGNIGITGEFGL------------------------QGNRGDDGLKGDDGIPGLNGPRGFIGDIGFVGFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXELGLDGSMGGKGDNGPRGFNGPTGIPGSKGFEGDKGI----------RGDIGVKGFQ---------GQHGEIGFPGLKGVSGENGR 3809
            +G  G  G QG  G  G +G  G  G  G     G T+P +  GE G+ G  G  G  G  G  G  G SG  GF G+ GERG+    G PG +G  G+ G  G+     PG  G  G  G  G  G  G           ++GF G  G  G  G  G+ G  G  G  G  G PG +G+ GD                                                  + GSKG  G  GI G  G  G  G  GL         G +G+ G  G LG  G                  IPGR            KG  G+PG         P G    G KG  GI G+PG  G +GDKG PG  G P             G  G+ G  GR GL G  G  G  G+ GF  +    GD G+ G  GL G PG+ G KGQ G  T      G +GL G +G  G  G  GE G+ G  G  G   + G++G  G+ G  GLPG                 G +G+PG+ GD+G  G  G PGFPG  G+ G  G+PG+     +  P        + E G  G  G  G +G+ G S+P      G +G++G+DG  G PG  G PGPRG     G  G  G+ GL                        QG+RGD G+ G  G PG  G  GF G  G  G                            GFKGM G  G  G+ G  G  GD G  G+ GP G  G +G  G  GI           GD G +GF          GQ G  GFPG KG  G  G+
Sbjct:   62 IGYAGVPGVQGLPGDPGINGIPGQPGLPG---ARGQTLPCIITGEVGSPGFPGLPGVPGPKGQPGPSGLSGRPGFDGVKGERGSPGIGGQPGPQGFIGQRGDPGLPGLTSPGTPGAPGKDGRPGFPGRKGEPGEALGTTPGTQGFPGQPGLPGDKGQQGTPGLPGGPGFDGRFGVPGLKGMQGDAGFPGPQGPPGPPGYVPPSDPVRGPPGPPGFPGPRGFPGLKGERGDPGRSVSGSKGNSGPRGIPGRQGEVGRTGSPGLGQNGIPGRPGTKGQKGFPGLLGFTGLPGRPGDGGLPGGKGLPGIPGREGRPGENGRTGTKGDRGEPGRPGPAPPLFPEGILDKGEKGIPGITGVPGFPGQRGDKGFPGSPGRPGQPGQPGDPIQAKGLPGDPGFPGRQGLAGFSGIKGAAGVLGFPGMPGPKGDNGVPGLPGLPGSPGQPGVKGQKGDATGIPGAPGTKGLVGNAGFPGGPGASGEPGAPGFNGISGLPGQKGLLGDPGRPGFSGLPG---------------LPGTMGLPGYPGDKGRSGESGRPGFPGRPGEKGLPGSPGLDGLNGLQGPKGQQGVPGVTEGGRTGAPGMDGLKGERGSSLPGLPGFSGAKGVRGQDGLPGQPGFQGPPGPRGLPSSSGIPGPVGDPGLPGLDGGQGFSGPPGPPGPAGPGTIQGDRGDAGIPGFSGTPGKRGEPGFPGRFGLPG--------------------------NPGFKGMKGDPGNSGIPGPQGPAGDPGQYGYKGPKGSQGKRGSPGLPGIFLPPEDVQIPNGDFGPEGFSGGPGLAGSAGQPGSPGFPGPKGKIGSPGK 850          

HSP 11 Score: 61.2326 bits (147), Expect = 1.073e-8
Identity = 66/173 (38.15%), Postives = 83/173 (47.98%), Query Frame = 3
Query:  177 TPDKCQCFGNKGRQGFPGPRGYQGVSGDKGDVGQFGMPGPKGYKGFTGAIGPQGRKGERGIPGSPGYPGKMGEMGFPGIRGDIGEKGLTGCDGQQGDFGNPGMNGLVGRTGQPGERGDDGDRGLSIIPKYGLKGNKGSRGLLGRYGRKGEKGFKGIKGYSGIFGIKGNKGYVG 695
            TP K    G  GR G PG  G++G+ GD G+ G  G  GP G  G  G  GP+G +G+RG PG PG      ++  P   GD G +G +G  G  G  G PG  G       PG +G  G  G     K G  G  GS G++G  G  G +G  G KG+ G  G+ G  G  G
Sbjct:  735 TPGKRGEPGFPGRFGLPGNPGFKGMKGDPGNSGIPGPQGPAGDPGQYGYKGPKGSQGKRGSPGLPGIFLPPEDVQIP--NGDFGPEGFSGGPGLAGSAGQPGSPGF------PGPKGKIGSPG-----KPGRSGPAGSPGIVGDPGSPGFQGLTGYKGFPGKQGLPGRPGLPG 894          
BLAST of Collagen IV NC1 domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000054929.1 (pep primary_assembly:Astyanax_mexicanus-2.0:16:35732567:35767046:-1 gene:ENSAMXG00000015997.2 transcript:ENSAMXT00000054929.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 341.658 bits (875), Expect = 6.428e-97
Identity = 420/1245 (33.73%), Postives = 536/1245 (43.05%), Query Frame = 3
Query: 1965 FGEAGSRGRKGYSGLKGFKGLIGERGTSFSSGDPGDKGLRGENGKDGVSFAGIPGEKGLKGDKG--------NRGILGDVGSLSNCA-TRPITSKGFKGPQGAKGTSGSPGSAGKTG------------------------IVGNKGENGYPGKRGIDGDNGIPGSKGEEGETGIKGHAGRPGN-LGKS-GLQGLRGEYGVKGDLGIQ---------------GIPGRKGVMGDPGPNGYAMIGSKGDKGIKGLP-----------------GIYGAKGDKGRPGYIGIPGFKGETGLIGRSGLKGDQGEIGEKGIKGFTFISNNPGDRGLLGNKGLKGFPGELGNKGQVGVCTVRGDQGLRGYSGLIGDMGMKGEQGSKGIVGDYGAASRSGI---MGRTGKI--GNQGLPGDQXXXXXXXXXXXXXXXXYIGIPGFEGDRGEKGNKGFPGFPGDIGQPGRLGNPGISTEGVXXXXXXXXXXXXXXXXXXXXXXXXXXKQGDSGISIPGRQGIKGEDGTIGLPGEMGEPGPRGDFGQKGNIGITGEFGLQGNRGDDGLKGD-DGIPGLNGPRGFIGDIGFVGFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXELGLDGSMGGKGDNGPRGFNGPTGIPGS---KGFEGDKGIRGDIGVKGFQGQHGEIGFPG---LKGVSGENGRQXXXXXXXXXXXXXXXXVCMQPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEVGESIRGLQGRKGSTGLRGNIGIPGERGDKGIPGLQGKVGNKGVKGDIGDKGFSGN---------------------IGDKGYSGISGDKGSFGVKGDKGFQGDVGMLGKSG---LQGDRGQKGIIGFRGTRGIPGSMGLPGEIGEKGDVGPSGI--------------GVKGLKGYQNAVGIKGRKGEKGLPGFPGRPGKVGDQGDKGPKGMKNMNTXXXXXXXXXXXXXXXXXXXXXXXXXLPGDMGEIGPNGPIGYADNGFLYATHSQSKDFPPCHGGGSPLYNGYSLLAIHGDIDSVTMDLGTPGSCLKNFSTIPFVNCFLERNTFYGGRCHVNMRNSRSYWLSTLQSYMSSPQPPSKMDDYISRCSVCQTKTTVMAFHSQKSDWQMTKCPYGWQKLWAGFSFPMAVQASRSGSNQPFSSPGSCLKHFRSLPFIECNNHNSNCNHWRDGVSYYMTAVDSENQFVKAQGKVLKSQTDIMNSISKCVVCQRDM 5348
            FG  G RG  G+ G KG  GL GE G  ++ G PG +GL G+ G +G     IPG+ GL G +G        N   +G+ G    C  T  + S GF G  G  G  G PG +G +G                         +G +G+ G PG        G PG+ G++G  G  G  G PG  LG + G QG  G+ G+ GD G Q               G+PG KG+ GD G  G               P                 G+ G +GD GR          G  G  G  G+ G QGE+G  G  G   +  N G  G  G KG KGFPG LG  G  G     G  G +G  G+ G  G  GE G  G  GD G   R G    +   G +  G +G+PG                    G+PGF G RG   +KGFPG PG  GQPG+ G+P I  +G+                            GD G   PGRQG+ G  G  G  G +G PG  G  G  G  G+ G  G  G  G  G KGD  GIPG  G +G +G+ GF G                         G  G  G  GF G  GL G  G  GD G  GF+G  G+PG+    G+ GDKG  G+ G  GF G+ GE G PG   L G++G  G +G  G+ G+          M                               GLKGE G S+ GL G  G+ G+RG  G+PG+ G +G PG +G   + G+ G +GD G  G                       GD+G +GI G  G+ G +G+ GF G  G+ G  G   ++GD G  GI G +G  G PG  G  G  G +G  G  G+              G  G +G+    G+ G  G+ G PGFPG  GK+G  G  G  G    + G  G  G  G  G  G KG  G++GLPG  G  G +  IGY         HSQS   P C  G + L+ GYSLL + G   +   DLG  GSCL  FSTIPF+ C           C+   RN +SYWLST       P    ++ +YISRCSVC+  +  +A HSQ  D  +  CP GW+ LW G+SF M   A   G  Q   SPGSCL+ FR+ PFIECN     C  + +  S+++T VD + QFV+               IS+C VC + +
Sbjct:   36 FGLPGDRGFPGFPGGKGRPGLAGEPGIGYA-GVPGVQGLPGDPGING-----IPGQPGLPGARGESCGQAGLNEASIGEGGQTLPCIITGEVGSPGFPGLPGVPGPKGQPGPSGLSGRPGFDGVKGERGSPGIGGQPGPQGFIGQRGDPGLPGLT----SPGTPGAPGKDGRPGFPGRKGEPGEALGTTPGTQGFPGQPGLPGDKGQQGTPGLPGGPGFDGRFGVPGLKGMQGDAGFPGPQGPPGPPGYVPPSDPVRGPPGPPGFPGPRGFPGLKGERGDPGR-------SVSGSKGNSGPRGIPGRQGEVGRTGSPG---LGQN-GIPGRPGTKGQKGFPGLLGFTGLPGRPGDGGLPGGKGLPGIPGREGRPGENGRTGTKGDRGEPGRPGPAPPLFPEGILDKGEKGIPG------------------ITGVPGFPGQRG---DKGFPGSPGRPGQPGQPGDP-IQAKGL---------------------------PGDPGF--PGRQGLAGFSGIKGAAGVLGFPGMPGPKGDNGVPGLPGLPGSPGQPGVKGQKGDATGIPGAPGTKGLVGNAGFPG-----------------------GPGASGEPGAPGFNGISGLPGQKGLLGDPGRPGFSGLPGLPGTMGLPGYPGDKGRSGESGRPGFPGRPGEKGLPGSPGLDGLNGLQGPKGQQGVPGVTEGGRTGAPGMD------------------------------GLKGERGSSLPGLPGFSGAKGVRGQDGLPGQPGFQGPPGPRGLPSSSGIPGPVGDPGLPGLDGGQGFSGPPGPPGPAGPGTIQGDRGDAGIPGFSGTPGKRGEPGFPGRFGLPGNPGFKGMKGDPGNSGIPGPQGPAGDPGQYGYKGPKGSQGKRGSPGLPGIFLPPEDVQIPNGDFGPEGFSGGPGLAGSAGQPGSPGFPGPKGKIGSPGKPGRSGPAG-SPGIVGDPGSPGFQGLTGYKGFPGKQGLPGRPGLPGRSIGIGYT-----LVKHSQSSQVPMCPQGMAKLWEGYSLLYVEGQEKAHNQDLGLAGSCLPRFSTIPFLYCTTTE------LCYYASRNDKSYWLSTTAPIPMMPVAKQQITEYISRCSVCEAPSQAVAVHSQ--DTSIPPCPSGWRSLWIGYSFLMHTAAGAEGGGQSLVSPGSCLEDFRATPFIECNGARGTCFFFNNKHSFWLTTVDRDRQFVQGPESETLKGDQYRTRISRCQVCMKIL 1141          

HSP 2 Score: 179.489 bits (454), Expect = 6.092e-45
Identity = 328/935 (35.08%), Postives = 411/935 (43.96%), Query Frame = 3
Query:  300 GYKGFTGAIGPQGRKGERGIPGSPGYPGKMGE-MGFPGI-RGDIGEKGLTGCDGQQGDFGNPGMNGLVGRTGQPGERGDDGDRGLSIIPKYGLKGNKGSRGLLGR---------YGRKGEKGFKGIKGYSGIFGIKGNKGYVGPMGRRGPKGDSLGTVIIQSEKGSKGDKGLKGQSGIP-CKGFQIEGRMYGRVGSDGPIGDKGIKGEKG----------LMGEIGQSGIDGARGLNGEKGLPGEAGPRGERGDRGNPG--FPGDPGASGADGTRGRQGERGPKGVHGISGADGPRGSRGDKGPSGSLLSCPGRKGEKGFFGIPGIKG------------------DIGNKGYQGHDGDIGEIGFKGEKGYEGPLGPSCSE--VEQGFRGTKGESGFPGLRGAKGQRGYSGNKGIKGKPNFGTGINNPGET----GSYGNLGVPGEKGNKGFIGDTGEKGFSGTGKQGPEGPRGDKGDDGVNGQVGMIGMPGIKGDKGSTYPICPFCEKGYKGIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEGRMGLLGSKGRQGYKGGKGFSGSMGDAGEIGYVTISGTTIPGVKGEKGNQGPKGNKGEFGEAGSRGRKGYSGLKGFKGLIGERGTSF--------SSGDPGDKGLRGENGKDGVSFAGIPGEKGLKGDKGNRGILGDVGSLSNCATRPITSKGFKGPQGAKGTSGSPGSAGKTGIVGNKGENGYPGKRGIDGDNGIPGSKGEEGETGIKGHAGRPGNLGKSG------LQGLRGEYGVKGDLGIQGIPGRKGVMGDPGPNGYA-MIGSKGDKGIKGLPGIY----------------------GAKGDKGRPGYIGIPGFKGETGL---IGRSGLKGDQGEIGEKGIKGFTFISNNPGDRGLLGNKGLKGFPGELGNKGQVGVCTVRGDQ 2840
            GY G  G  G  G  G  GIPG PG PG  GE  G  G+    IGE G T      G+ G+PG  GL    G PG +G  G  GLS  P  G  G KG RG  G           G++G+ G  G+    G  G  G  G  G  GR+G  G++LGT        + G +G  GQ G+P  KG Q    + G  G DG  G  G+KG +G                    D  RG  G  G PG  G  G +G+RG+PG    G  G SG  G  GRQGE G  G  G+       G  G  G        PG KG+KGF G+ G  G                    G +G  G +G  G  G +GE G  GP  P   E  +++G +G  G +G PG  G +G +G+ G+ G  G+P        PG+     G  G+ G PG +G  GF G  G  G    G  G  GP+GD G  G+ G  G  G PG+KG KG    I      G  G +G +G  G  G  G +G  G  G  G+ G  G+ GLLG  GR G+ G  G  G+MG              +PG  G+KG  G  G  G  G  G +G  G  GL G  GL G +G            +G PG  GL+GE G    S  G+PG  G KG +G  G+ G  G            +G  GP+G   +SG PG  G  G+ G  G  G+ G  G  G  G    +G+ G+ GI G +G PG  G+ G      L G  G  G+KGD G  GIPG +G  GDPG  GY    GS+G +G  GLPGI+                      G  G  G+PG  G PG KG+ G     GRSG  G  G +G+ G  GF  ++   G +G  G +GL G PG  G    +G   V+  Q
Sbjct:   63 GYAGVPGVQGLPGDPGINGIPGQPGLPGARGESCGQAGLNEASIGEGGQTLPCIITGEVGSPGFPGL---PGVPGPKGQPGPSGLSGRP--GFDGVKGERGSPGIGGQPGPQGFIGQRGDPGLPGLT-SPGTPGAPGKDGRPGFPGRKGEPGEALGT--------TPGTQGFPGQPGLPGDKGQQGTPGLPGGPGFDGRFGVPGLKGMQGDAGFPGPQGPPGPPGYVPPSDPVRGPPGPPGFPGPRGFPGLKGERGDPGRSVSGSKGNSGPRGIPGRQGEVGRTGSPGL-------GQNGIPG-------RPGTKGQKGFPGLLGFTGLPGRPGDGGLPGGKGLPGIPGREGRPGENGRTGTKGDRGEPGRPGPAPPLFPEGILDKGEKGIPGITGVPGFPGQRGDKGFPGSPGRPGQPG------QPGDPIQAKGLPGDPGFPGRQGLAGFSGIKGAAGV--LGFPGMPGPKGDNGVPGLPGLPGSPGQPGVKGQKGDATGI-----PGAPGTKGLVGNAGFPGGPGASGEPGAPGFNGISGLPGQKGLLGDPGRPGFSGLPGLPGTMG--------------LPGYPGDKGRSGESGRPGFPGRPGEKGLPGSPGLDGLNGLQGPKGQQGVPGVTEGGRTGAPGMDGLKGERGS---SLPGLPGFSGAKGVRGQDGLPGQPGF-----------QGPPGPRGLPSSSGIPGPVGDPGLPGLDGGQGFSGPPGPPGPAGPGTIQGDRGDAGIPGFSGTPGKRGEPGFPGRFGLPGNPGFKGMKGDPGNSGIPGPQGPAGDPGQYGYKGPKGSQGKRGSPGLPGIFLPPEDVQIPNGDFGPEGFSGGPGLAGSAGQPGSPGFPGPKGKIGSPGKPGRSGPAGSPGIVGDPGSPGFQGLT---GYKGFPGKQGLPGRPGLPGRSIGIGYTLVKHSQ 925          

HSP 3 Score: 178.333 bits (451), Expect = 1.424e-44
Identity = 298/906 (32.89%), Postives = 363/906 (40.07%), Query Frame = 3
Query:  189 CQCFGNKGRQGFPGPRGYQGVSGDKGDVGQFGMPGPKGYKGFTGA---------------IGPQGRKGERGI--PGSPGYPGKMGEMGFPGIRGDIGEKGLTGCDGQQGDFGNPGMNGLVG---------------RTGQPGERGDDGD-------------------------------------------RGLSIIPKYGLKGNKGSRGLLGRYGRKGEKGFKGI--KGYSGIFGIKGNKGYVGPMGRRGPKGDSLGTVII-----------QSEKGSKGDKGLKGQSGIPCKGFQIEGRMYGRVGSDGPIGDKGI--KGEKGLMGEIGQSGIDGARGLNGEKGLPGEAGPRGERGDRGNP----GFPGDPGASGADGTRGRQGERGPKGVHGISGADGPRGSRGDKGPSGSLLSC--PGRKGEK----GFFGIPGIKGDIGNKGYQGHDGDIGEIGFKGEKGYEGPLGPSCSEVEQGFRGTKGESGFPGLRGAKGQRGYSGNKGIKGKPNFGTGINNPGETGSYGNLGVPGEKGNKGFIGDTGEKGFSGTGKQGPEGPRGDKGDDGVN--GQVGMIGMPGIKGDKGSTYPICPFCEKGYKGIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEGRMGLLGSKGRQGYKGGKGFSGSMGDAGEIGYVTISGT-------------------TIPGVKGEKGNQGPKGNKGEFGEAGSRGRKGYSGLKGFKGLIGERGTSFSSGDPGDKGLRGENGKDGVSFAGIPGEKGLKGDKGNRGILGDVGSLSNCATRPITSKGFKGPQGAKGTSGSPGSAGKTGIVGNKGENGYPGKRGIDGDNGIPGSKGEEGETGIKGHAGRPGNLGKSGLQGLRGEYGVKGDLGIQGIPGRKGVMGDPGPNGYAMI 2543
            C   G  G  GFP   G  GV G KG  G  G+ G  G+ G  G                IG +G  G  G+  PG+PG PGK G  GFPG +G+ GE  L    G QG  G PG+ G  G               R G PG +G  GD                                           RG       G KGN G RG+ GR G  G  G  G+   G  G  G KG KG+ G +G  G  G      +            +   G  G  G KG  G P           GR G   P+  +GI  KGEKG+ G  G  G  G R   G+KG PG  G  G+ G  G+P    G PGDPG  G  G  G  G +G  GV G  G  GP+G  G  G  G   S   PG KG+K    G  G PG KG +GN G+ G  G  GE G  G  G  G  G      ++G  G  G  GF GL G  G  G  G  G KG+            +G  G  G PG  G KG  G  G  G +G      +GP+G +G  GV   G+ G  GM G+KG++GS+ P  P    G KG++                              G+ GL G  G QG  G +G   S G  G +G   + G                    TI G +G+ G  G  G  G+ GE G  GR G  G  GFKG+          GDPG+ G+ G  G      AG PG+ G KG KG++G  G  G L      P   +   G  G +G SG PG AG     G  G  G+PG +G  G  G PG  G  G  GI G  G PG  G +G +G  G+         QG+PGR G+ G     GY ++
Sbjct:  115 CIITGEVGSPGFP---GLPGVPGPKGQPGPSGLSGRPGFDGVKGERGSPGIGGQPGPQGFIGQRGDPGLPGLTSPGTPGAPGKDGRPGFPGRKGEPGEA-LGTTPGTQGFPGQPGLPGDKGQQGTPGLPGGPGFDGRFGVPGLKGMQGDAGFPGPQGPPGPPGYVPPSDPVRGPPGPPGFPGPRGFPGLKGERGDPGRSVSGSKGNSGPRGIPGRQGEVGRTGSPGLGQNGIPGRPGTKGQKGFPGLLGFTGLPGRPGDGGLPGGKGLPGIPGREGRPGENGRTGTKGDRGEP-----------GRPGPAPPLFPEGILDKGEKGIPGITGVPGFPGQR---GDKGFPGSPGRPGQPGQPGDPIQAKGLPGDPGFPGRQGLAGFSGIKGAAGVLGFPGMPGPKGDNGVPGLPGLPGSPGQPGVKGQKGDATGIPGAPGTKGLVGNAGFPGGPGASGEPGAPGFNGISGLPG------QKGLLGDPGRPGFSGLPGLPGTMGLPGYPGDKGR------------SGESGRPGFPGRPGEKGLPGSPGLDGLNGL-----QGPKGQQGVPGVTEGGRTGAPGMDGLKGERGSSLPGLPGFS-GAKGVR------------------------------GQDGLPGQPGFQGPPGPRGLPSSSGIPGPVGDPGLPGLDGGQGFSGPPGPPGPAGPGTIQGDRGDAGIPGFSGTPGKRGEPGFPGRFGLPGNPGFKGM---------KGDPGNSGIPGPQGP-----AGDPGQYGYKGPKGSQGKRGSPG-LPGIFLPPEDVQIPNGDFGPEGFSGGPGLAGS---AGQPGSPGFPGPKGKIGSPGKPGRSGPAGSPGIVGDPGSPGFQGLTGYKGFPGK---------QGLPGRPGLPGRSIGIGYTLV 921          

HSP 4 Score: 178.333 bits (451), Expect = 1.473e-44
Identity = 354/1028 (34.44%), Postives = 433/1028 (42.12%), Query Frame = 3
Query:  396 MGFPGIRGDIGEKGLTGCDGQQGDFGNPGMNGLVGRTGQPGERGDDGDRGLSIIPKYGLKGNKGSRGLLGRYGRKGEKGFKGIKGYSGIFGIKGN------KGYVGPMGRRGPKGDSLGTVIIQSEKGSKGDKGLKGQSGIPCKGFQIEGRMYGRVGSDGPIGDKGIKGEKGLMGEIGQSGIDGARGLNGEKGLPGEAGPR------GERGDRGNPGF--PGDPGASGADGTRGRQGERGPKG-----VHGISGADGPRGSRGDKGPSGSLLSCPGRKGEKGFFGIPGIKGDIGNK-------------------------------------GYQGHDGDIGEIGFKGEKGYEGPLGPSCSEVEQGFRGTK--GESGFPGLRGAKGQRGYSGNKGIKGKPNFGTGINNPGETGSY---GNLGVPGEKGNKGFIGDTGEKGFSGTGKQGPEGPRG--DKGDDGVNGQVGMIGMPGIKGDKGSTYPICP--FCEKGYKG--IQXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEGRMGLLGSKGRQGYKGGKGFSGSMGDAGEIGYVTISGTTIPGVKGEKGNQGPKGNKGEFGEAGSRGRKGYSGLKGFKGLIGERGTSFSSGDPGDKGLRGENGKDGVS-FAGIPGEKGLKGDKGNRGILGDVGSLSNCATRPITSKGFKGPQGAKGTSGSPGSAGKTGIVGNKGENGYPGKRGIDGDNGIPGSKGEEGETGIK--GHAGRPGNLGK-----SGLQGLRGEYGVKGDLGIQGIPGRKGVMGDPGPNGYA----MIGSKGDKGIKGLPG------------------IYGAKGDKGRPGYIGIPGFKGETGLIGRSGLKGDQGEIGEKGIKGFTFISNNPGDRGLLGNKGLKGFPGELGNKGQVGVCTVRGDQGLRG-------YSGLIGDMGMKGEQGSKGIVGDYGAASRSGIMGRTGKIGNQGLPGDQXXXXXXXXXXXXXXXXYIGIPGFEGDRGE---KGNKGFPGFPGDIGQPGRLGNPGIST 3158
            MG PG RG  GE G  G DG  G           G+ G PG+ G            +GL G++G  G  G  GR G  G  GI GY+G+ G++G        G  G  G  G +G+S G   +      +G     GQ+ +PC        + G VGS G  G  G+ G KG  G  G SG  G  G+ GE+G PG  G        G+RGD G PG   PG PGA G DG  G  G +G  G       G  G  G  G  GDKG  G+     G  G  G FG+PG+KG  G+                                      G +G  GD G     G KG  GP G    + E G  G+   G++G PG  G KGQ+G+ G  G  G P        PG  G     G  G PGE G  G  GD GE G  G     P  P G  DKG+ G+ G  G+ G PG +GDKG  +P  P    + G  G  IQ                                 GL G  G  G +G  GFSG  G AG +G+       +PG KG+ G  G  G  G  G+ G +G+KG +   G  G  G +G   ++G PG  G  GE G  G +  +G+PG+KGL GD G  G  G  G             G  G  G  G  G  G +G+ G  G  GE G PG  G+DG NG+ G KG++G  G+   G  G PG  G      S L GL G  G KG  G  G+PG+ G  G PGP G      + G  GD G+ GL G                  I G +GD G PG+ G PG +GE G  GR GL G+ G  G KG         +PG+ G+ G +G  G PG+ G KG  G    RG  GL G            GD G +G  G  G+ G  G     G  G  GKIG+ G PG  G                 G PG  GD G    +G  G+ GFPG  G PGR G PG S 
Sbjct:    1 MGEPGPRGPSGEIGKPGRDGTYGF---------PGQPGPPGDAG------------FGLPGDRGFPGFPGGKGRPGLAGEPGI-GYAGVPGVQGLPGDPGINGIPGQPGLPGARGESCGQAGLNEASIGEG-----GQT-LPCI-------ITGEVGSPGFPGLPGVPGPKGQPGPSGLSGRPGFDGVKGERGSPGIGGQPGPQGFIGQRGDPGLPGLTSPGTPGAPGKDGRPGFPGRKGEPGEALGTTPGTQGFPGQPGLPGDKGQQGTPGLP-GGPGFDGRFGVPGLKGMQGDAGFPGPQGPPGPPGYVPPSDPVRGPPGPPGFPGPRGFPGLKGERGDPGR-SVSGSKGNSGPRGIPGRQGEVGRTGSPGLGQNGIPGRPGTKGQKGFPGLLGFTGLPGRPGDGGLPGGKGLPGIPGREGRPGENGRTGTKGDRGEPGRPGPAP--PLFPEGILDKGEKGIPGITGVPGFPGQRGDKG--FPGSPGRPGQPGQPGDPIQA-------------------------------KGLPGDPGFPGRQGLAGFSGIKGAAGVLGF-----PGMPGPKGDNGVPGLPGLPGSPGQPGVKGQKGDA--TGIPGAPGTKGLVGNAGFPGGPGASGEPGAPGFNGISGLPGQKGLLGDPGRPGFSGLPG-----------LPGTMGLPGYPGDKGRSGESGRPGFPGRPGEKGLPGSPGLDGLNGLQGPKGQQGVPGVTEGGRTGAPGMDGLKGERGSSLPGLPGFSGAKGVRGQDGLPGQPGFQGPPGPRGLPSSSGIPGPVGDPGLPGLDGGQGFSGPPGPPGPAGPGTIQGDRGDAGIPGFSGTPGKRGEPGFPGRFGLPGNPGFKGMKG---------DPGNSGIPGPQGPAGDPGQYGYKGPKGSQGKRGSPGLPGIFLPPEDVQIPNGDFGPEGFSGGPGLAGSAGQPGSPGFPGPKGKIGSPGKPGRSGP---------------AGSPGIVGDPGSPGFQGLTGYKGFPGKQGLPGRPGLPGRSI 914          

HSP 5 Score: 176.407 bits (446), Expect = 6.113e-44
Identity = 269/744 (36.16%), Postives = 333/744 (44.76%), Query Frame = 3
Query:  207 KGRQGFPGPRGYQGVSGDKGDVGQFGMPGPKGYKGFTGAIGPQGRKGERGIPGSPGYPGKMGEMGFPGIRGDIGEKGLTGCDGQQGDFGNPGMNGLVGRTGQPGERGDDGDRGLSIIPKYGLKGNKGSRGLLGRYG--RKGEKGFKGIKGYSGIFGIKGNKGYVGPMGRRGPKGDSLGTVIIQSEKGSKGDKGLKGQSGIPCKGFQ-IEGR--MYGRVGSDGPIGDKGIKGEKGLMGEIGQSGIDGARGLNGEKGLPGEAGPRGERGDRGNPGFPGDPGASGADGTRGRQGERGPKGVHGISGADGPRGSRGDKGPSGSLLSCPGRKGEKGFFGIPGIKGDIGNKGYQGHDGDIGEIGFKGEKGYEGPLGPSCSEVEQGFRGTKGESGFPGLRGAKGQRGYSGNKGIKGKPNFGTGINNPGETGSYGNLGVPGEKGNK--GFIGDTGEKGFSG-------TGKQGPEGPRGDKGDDGVNGQVGMIGMPGIKGDKGSTYPICPFCEKGYKGIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEGRMGLLGSKGRQGYKGGKGFSGSMGDAGEIGYVTISGTTIPGVKGEKGNQGPKGNKGEFGEAGSRGRKGYSGLKGFKGL-IGERGTSFSSGDPGDKGLRGENGKDGVSFAGIPGEKGLKGDKGNRGILGDVGSLSNCATRPITSKGFKGPQGAKGTSGSPGSAGKTGIVGNKGENGYPGKRGIDGDNGIPGSKGEEGETGIK 2393
            KG +G PG    + VSG KG+ G  G+PG +G  G TG+ G     G+ GIPG PG     G+ GFPG+   +G  GL G  G  G  G  G+ G+ GR G+PGE G  G +G       G  G  G    L   G   KGEKG  GI G  G  G +G+KG+ G  GR G  G     +     KG  GD G  G+ G+   GF  I+G   + G  G  GP GD G+ G  GL G  GQ G+ G +G     G+PG  G    +G  GN GFPG PGASG         E G  G +GISG  G +G  GD          PGR G   F G+PG+ G +G  GY G  G  GE G                    GF G  GE G PG  G  G  G  G KG +G P    G+   G TG+ G  G+ GE+G+   G  G +G KG  G        G QGP GPRG     G+ G VG  G+PG+ G +G + P  P    G   IQG                           D G  G+ G  G  G +G  GF G  G  G  G+  + G   PG  G  G QGP G+ G++G  G +G +G  G  G  G+ +        +GD G +G  G  G  G   AG PG  G  G KG  G  G  G                GP G+ G  G PGS G  G+ G KG   +PGK+G+ G  G+PG     G T +K
Sbjct:  300 KGERGDPG----RSVSGSKGNSGPRGIPGRQGEVGRTGSPG----LGQNGIPGRPG---TKGQKGFPGL---LGFTGLPGRPGDGGLPGGKGLPGIPGREGRPGENGRTGTKG-----DRGEPGRPGPAPPLFPEGILDKGEKGIPGITGVPGFPGQRGDKGFPGSPGRPGQPGQPGDPI---QAKGLPGDPGFPGRQGL--AGFSGIKGAAGVLGFPGMPGPKGDNGVPGLPGLPGSPGQPGVKGQKG--DATGIPGAPG---TKGLVGNAGFPGGPGASG---------EPGAPGFNGISGLPGQKGLLGD----------PGRPG---FSGLPGLPGTMGLPGYPGDKGRSGESG------------------RPGFPGRPGEKGLPGSPGLDGLNGLQGPKGQQGVP----GVTEGGRTGAPGMDGLKGERGSSLPGLPGFSGAKGVRGQDGLPGQPGFQGPPGPRGLPSSSGIPGPVGDPGLPGLDGGQGFSGPPGPPGPAGPGTIQG---------------------------DRGDAGIPGFSGTPGKRGEPGFPGRFGLPGNPGFKGMKGD--PGNSGIPGPQGPAGDPGQYGYKGPKGSQGKRGSPGLPGIFLPPEDVQIPNGDFGPEGFSGGPGLAGS--AGQPGSPGFPGPKGKIGSPGKPGR--------------SGPAGSPGIVGDPGSPGFQGLTGYKG---FPGKQGLPGRPGLPGRSIGIGYTLVK 922          

HSP 6 Score: 170.629 bits (431), Expect = 3.478e-42
Identity = 325/974 (33.37%), Postives = 414/974 (42.51%), Query Frame = 3
Query:  873 GIKGEKGLMGEIGQSGIDGARGLNGEK--------GLPGEAGPRGERGDRGNPGFPGDPGASGADGTRGRQGERGPKGVHGISGADGPRGSRGDK-----------GPSGSLLSCPGRKGEKGFFGIPGIKGDIGNKGYQGHDGDIGEIGFKGEKGYEGPLGPSCSEVEQGFRGTKGESGFPGLR-----GAKGQRGYSGNKGIKGKPNFGTGINN-----PGETGSYGN------------------LGVPGEKGNKG----------------------------------------FIGDTGEKGFSGTGKQGPEGPRGDKGDDGVNGQVGMIGM-----PGIKGDKGSTYPICPFCEKGYKGIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEGRMGLLGSKGRQGYKGGKG-----FSGSMGDAGEIGYVTISGTT-IPGVKGEKGNQGPKGNKGEFGEAGSR-------GRKGYSGLKGFKGLIGERGTSFSSGDPGDKGLRGENGKDGVS-FAGIPGEKGLKGDKGN-RGILGDVGSLSNCATRPITSKGFKGPQGAKGTSGSPGSAGKTGIVGNKGENGYPGKRGIDGDNGIPGS---------KGEEGETGIKGHAGRPGNLGKSGLQGLRGEYGVKGDLGIQGIPGRK--GVMGDPGPNGYAMIGSKGDKG--IKGLPGIYGAKGDKGRPGYIGIPGFKGETGLIGRSGLKGDQGEIGEKGIKGFTFISNNP---------------GDRGLLGNKGLKGFPGELGNKGQVGVCTVRGDQGLRGYSGLIGDMGMKGEQGSKGIVGDYGAASRSGIMGRTGKIGNQGLPGD-QXXXXXXXXXXXXXXXXYIGIPGFEGDRGEKGNKGFPGFPGDIGQPGRLGNPGIS-TEGVXXXXXXXXXXXXXXXXXXXXXXXXXXKQGDSGISIPGRQGIKGEDGTIGLPGEMGEPGPRGDFGQKGNIGIT 3383
            G  G +G  GEIG+ G DG  G  G+         GLPG+ G  G  G +G PG  G+PG  G  G  G QG  G  G++GI G  G  G+RG+            G  G  L C    GE G  G PG+ G  G KG  G  G  G  GF G KG  G  G       QGF G +G+ G PGL      GA G+ G  G  G KG+P    G        PG+ G  G+                   GVPG KG +G                                          G+ G+ G S +G +G  GPRG  G  G  G+ G  G+     PG  G KG         +KG+ G+ G  G  G  G+ G+ G KG  G  G  G  G  G  G+KG +G  G  G     F   + D GE G   I+G    PG +G+KG  G  G  G+ G+ G         G  G+ G +G  G  G +G +   G PG  G +G+NG  G+    G PG+ G+KG KG+  GI G  G+        + + GF G  GA G  G+PG  G +G+ G KG  G PG+ G  G  G+PG+         KG  GE+G  G  GRPG  G  G  GL G  G++G  G QG+PG    G  G PG     M G KG++G  + GLPG  GAKG +G+ G  G PGF+G  G  G     G  G +G+ G+ G                       GDRG  G  G  G PG+ G  G  G   + G+ G +G  G  G+ G+ G QG  G  G YG     G  G  GK G+ GLPG        +   G  G +G+ G PG  G  G+ G+ GFPG  G IG PG+ G  G + + G+                                +  PG  G +G  G  G PG+ G PG  G  G+   IG T
Sbjct:    2 GEPGPRGPSGEIGKPGRDGTYGFPGQPGPPGDAGFGLPGDRGFPGFPGGKGRPGLAGEPGI-GYAGVPGVQGLPGDPGINGIPGQPGLPGARGESCGQAGLNEASIGEGGQTLPC-IITGEVGSPGFPGLPGVPGPKGQPGPSGLSGRPGFDGVKGERGSPGIGGQPGPQGFIGQRGDPGLPGLTSPGTPGAPGKDGRPGFPGRKGEPGEALGTTPGTQGFPGQPGLPGDKGQQGTPGLPGGPGFDGRFGVPGLKGMQGDAGFPGPQGPPGPPGYVPPSDPVRGPPGPPGFPGPRGFPGLKGERGDPGRSVSGSKGNSGPRGIPGRQGEVGRTGSPGLGQNGIPGRPGTKG---------QKGFPGLLGFTGLPGRPGDGGLPGGKGLPGIPGREGRPGENGRTGTKGDRGEPGRPGPAPPLFPEGILDKGEKGIPGITGVPGFPGQRGDKGFPGSPGRPGQPGQPGDPIQAKGLPGDPGFPGRQGLAGFSGIKGAAGVLGFPGMPGPKGDNGVPGLPGLPGSPGQPGVKGQKGDATGIPGAPGTKGL-----VGNAGFPGGPGASGEPGAPGFNGISGLPGQKGLLGDPGRPGFSGLPGLPGTMGLPGYPGDKGRSGESGRPGFPGRPGEKGLPGSPGLDGLNGLQGPKGQQGVPGVTEGGRTGAPG-----MDGLKGERGSSLPGLPGFSGAKGVRGQDGLPGQPGFQGPPGPRGLPSSSGIPGPVGDPGLPGLDGGQGFSGPPGPPGPAGPGTIQGDRGDAGIPGFSGTPGKRGEPGFPGRFGLPGNPGFKGMKGDPGNSGIPGPQGPAGDPGQYG---YKGPKGSQGKRGSPGLPGIFLPPEDVQIPNGDFGPEGFSGGPGLAGSAGQPGSPGFPGPKGKIGSPGKPGRSGPAGSPGI--------------------------------VGDPGSPGFQGLTGYKGFPGKQGLPGRPGLPGRSIGIGYT 919          

HSP 7 Score: 168.318 bits (425), Expect = 2.061e-41
Identity = 325/956 (34.00%), Postives = 398/956 (41.63%), Query Frame = 3
Query:  405 PGIRGDIGEKGLTGCDGQQGDFGNPGMNGLVGRTGQPGERGDD-GDRGLSIIPKYGLKGNKGSRGLLGRYGRKGEKGFKGIKGYSGIFGIKGNKGYVGPMGRRGPKGDSLGTVIIQSEKGSKGDKGLKGQSGIPCKGFQIEGRMYGRVGSDGPIGDKGIKGEKGLM--GEIGQSGIDGARGLNGEKGLPGEA--GPRGERGDRGNPGFPGDPGASGADGTRGRQGERGPKGVHGISGADGP----------------------------------------RGSRGDKGPSGSLLSCPGRKGEKGFFGIPGIKGDIGNKGYQG--HDGDIGEIGFKGEKGYEGPLGPS---CSEVEQGFRGTKGESGFPGLRGAKGQRGYSGNKGIKGKPN--------FGTGINNPGETGSYGNLGVPG---EKGNKGFIGDTGEKGFSGTGKQGPEGPRGDKGDDGVNGQVGMIGMPGIKGDKGST-YPICPFCEKGYKGIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEGRMGLLGSKGRQGYKGGKG-FSGSMGDAGEIGYVTISGTTIPGVKGEKGNQGPKGNKGEFGEAGSRGRKGYSGLKGFKGLIGERGTSFSSGDPGDKGLRGENGKDGVSFAGIPGEKGLKGDKGNRGILGDVGSLSNCATRPITS---------KGFKGPQGAK-----GTSGSPGSAGKTGIVGNKGENGYPGKRGIDGDNGIPGSKGEEGETG---------------------IKGHAGRPGNLGKSGLQGLRGEYGVKGDLGIQGIPGRKGVMGDPGPNGYAMIGSKGDKGIKGLPGIYGAKGDKGRPGYIGIPGFKGETGLIGRSGLKGDQGEIGEKGIKGFTFISNNPGDRGLLGNKGLKGFPGELGNKGQVGVCTVRGDQGLRGYSGLIGDMGMKGEQ---GSKGIVGDYGAASRSGIMGRTGKIG 2969
            PG+ G+ G  G  G  G QG  G+PG+NG+ G+ G PG RG+  G  GL          N+ S G  G+       G  G  G+ G+ G+ G KG  GP G                  G  G  G+KG+ G P  G Q   + +        IG +G  G  GL   G  G  G DG  G  G KG PGEA     G +G  G PG PGD G  G  G  G  G  G  GV G+ G  G                                         +G RGD G      S  G KG  G  GIPG +G++G  G  G   +G  G  G KG+KG+ G LG +       + G  G KG  G PG  G  G+ G +G KG +G+P         F  GI + GE G  G  GVPG   ++G+KGF G  G  G  G     P   +G  GD G  G+ G+ G  GIKG  G   +P  P   KG  G+                               G  GL GS G+ G KG KG  +G  G  G  G V  +G   PG  G  G  G  G  G  G  G +G  G  G  GF GL G  GT    G PGDKG  GE+G+ G  F G PGEKGL G  G  G+ G  G         +T           G KG +G+      G SG+ G  G+ G+ G  G  G PG RG+   +GIPG  G+ G  G                     I+G  G  G  G SG  G RGE G  G  G+ G PG KG+ GDPG +G       G +G  G PG YG KG KG  G  G PG  G    +    ++   G+ G +G  G       PG  G  G  G  GFPG    KG++G     G  G  G  G++GD G  G Q   G KG  G  G   R G+ GR+  IG
Sbjct:   54 PGLAGEPG-IGYAGVPGVQGLPGDPGINGIPGQPGLPGARGESCGQAGL----------NEASIGEGGQTLPCIITGEVGSPGFPGLPGVPGPKGQPGPSGL----------------SGRPGFDGVKGERGSPGIGGQPGPQGF--------IGQRGDPGLPGLTSPGTPGAPGKDGRPGFPGRKGEPGEALGTTPGTQGFPGQPGLPGDKGQQGTPGLPGGPGFDGRFGVPGLKGMQGDAGFPGPQGPPGPPGYVPPSDPVRGPPGPPGFPGPRGFPGLKGERGDPG-----RSVSGSKGNSGPRGIPGRQGEVGRTGSPGLGQNGIPGRPGTKGQKGFPGLLGFTGLPGRPGDGGLPGGKGLPGIPGREGRPGENGRTGTKGDRGEPGRPGPAPPLFPEGILDKGEKGIPGITGVPGFPGQRGDKGFPGSPGRPGQPGQPGD-PIQAKGLPGDPGFPGRQGLAGFSGIKGAAGVLGFPGMP-GPKGDNGV------------------------------PGLPGLPGSPGQPGVKGQKGDATGIPGAPGTKGLVGNAG--FPGGPGASGEPGAPGFNGISGLPGQKGLLGDPGRPGFSGLPGLPGTMGLPGYPGDKGRSGESGRPG--FPGRPGEKGLPGSPGLDGLNGLQGPKGQQGVPGVTEGGRTGAPGMDGLKGERGSSLPGLPGFSGAKGVRGQDGLPGQPGFQGPPGPRGLPSSSGIPGPVGDPGLPGLDGGQGFSGPPGPPGPAGPGTIQGDRGDAGIPGFSGTPGKRGEPGFPGRFGLPGNPGFKGMKGDPGNSGIP-----GPQGPAGDPGQYGYKGPKGSQGKRGSPGLPGI--FLPPEDVQIPNGDFGPEGFSG------GPGLAGSAGQPGSPGFPGP---KGKIGSPGKPGRSGPAGSPGIVGDPGSPGFQGLTGYKGFPGKQGLPGRPGLPGRSIGIG 917          

HSP 8 Score: 164.851 bits (416), Expect = 2.143e-40
Identity = 330/1002 (32.93%), Postives = 422/1002 (42.12%), Query Frame = 3
Query:  363 GSPGYPGKMGEMGFP--------------------GIRGD---------------IGEKGL--TGCDGQQGDFGNPGMNGLVGRTGQPGERGD-------------DGDRGLSIIPKYGLKGNKGSRGLLGRYGRKGEKGFKGIKGYSGIFGIKGNK------------GYVGPMGRRG-PKGDSLGTVIIQSEKGSKGDKGLKGQSGIPCKGFQIEGRMYGRVGSDGPIGDKGIKGEKGLMGEIGQSGIDGARGLNGEKGLPGEAGP-------------------------------------RGERGDRGNPGFPGDPGASGADGTRGRQGERGPKGVHGISGADGPRGSRGDKGPSGSLLSCPGRKGEKGFFGIPGIKG------------------DIGNKGYQGHDGDIGEIGFKGEKGYEGPLGPSCSE--VEQGFRGTKGESGFPGLRGAKGQRGYSGNKGIKGKPNFGTGINNPGET----GSYGNLGVPGEKGNKGFIGDTGEKGFSGTGKQGPEGPRGDKGDDGVNGQVGMIGMPGIKGDKGSTYPICPFCEKGYKGIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEGRMGLLGSKGRQGYKGGKGFSGSMGDAGEIGYVTISGTTIPGVKGEKGNQGPKGNKGEFGEAGSRGRKGYSGLKGFKGLIGERGTS--------FSSGDPGDKGLRGENGKDGVSFAGIPGEKGLKGDKGNRGILGDVGSLSNCATRPITSKGFKGPQGAKGTSGSPGSAGKTGIVGNKGENGYPGKRGIDGDNGIPGSKGEEGETGIKGHAGRPGNLGKS------GLQGLRGEYGVKGDLGIQGIPGRKGVMGDPGPNGYA-MIGSKGDKGIKGLPGIYG-------AKGDKGRPGYIGIPGFKGETGLIGRSGLKGDQGEIGEKGIKGFTFISNNPGDRGLLGNKGLKGFPGELGNKGQVGVCTVRGDQGLRGYSGLIGDMGMKGEQGSKGIVGDYGAA 2930
            G PG  G  GE+G P                    G+ GD                GE G+   G  G QG  G+PG+NG+ G+ G PG RG+             +G + L  I   G  G+ G  GL G  G KG+ G  G+ G  G  G+KG +            G++G  G  G P   S GT     + G  G  G KG+ G      +  G   G  G  G  G  G KG++G  G  G  G DG  G+ G KG+ G+AG                                      +GERGD G     G  G SG  G  GRQGE G  G  G+       G  G  G        PG KG+KGF G+ G  G                    G +G  G +G  G  G +GE G  GP  P   E  +++G +G  G +G PG  G +G +G+ G+ G  G+P        PG+     G  G+ G PG +G  GF G  G  G    G  G  GP+GD G  G+ G  G  G PG+KG KG    I      G  G +G +G  G  G  G +G  G  G  G+ G  G+ GLLG  GR G+ G  G  G+MG              +PG  G+KG  G  G  G  G  G +G  G  GL G  GL G +G            +G PG  GL+GE G    S  G+PG  G KG +G  G+ G  G            +G  GP+G   +SG PG  G  G+ G  G  G+ G  G  G  G    +G+ G+ GI G +G PG  G+       GL G  G  G+KGD G  GIPG +G  GDPG  GY    GS+G +G  GLPGI+          GD G  G+ G PG  G  G  G  G  G +G+IG  G  G +  + +P   G++G+ G  GF G  G KG  G   + G  GL G S  IG   +K  Q S+  +   G A
Sbjct:    2 GEPGPRGPSGEIGKPGRDGTYGFPGQPGPPGDAGFGLPGDRGFPGFPGGKGRPGLAGEPGIGYAGVPGVQGLPGDPGINGIPGQPGLPGARGESCGQAGLNEASIGEGGQTLPCI-ITGEVGSPGFPGLPGVPGPKGQPGPSGLSGRPGFDGVKGERGSPGIGGQPGPQGFIGQRGDPGLPGLTSPGTPGAPGKDGRPGFPGRKGEPG------EALGTTPGTQGFPGQPGLPGDKGQQGTPGLPGGPGFDGRFGVPGLKGMQGDAGFPGPQGPPGPPGYVPPSDPVRGPPGPPGFPGPRGFPGLKGERGDPGR-SVSGSKGNSGPRGIPGRQGEVGRTGSPGL-------GQNGIPG-------RPGTKGQKGFPGLLGFTGLPGRPGDGGLPGGKGLPGIPGREGRPGENGRTGTKGDRGEPGRPGPAPPLFPEGILDKGEKGIPGITGVPGFPGQRGDKGFPGSPGRPGQP------GQPGDPIQAKGLPGDPGFPGRQGLAGFSGIKGAAGV--LGFPGMPGPKGDNGVPGLPGLPGSPGQPGVKGQKGDATGI-----PGAPGTKGLVGNAGFPGGPGASGEPGAPGFNGISGLPGQKGLLGDPGRPGFSGLPGLPGTMG--------------LPGYPGDKGRSGESGRPGFPGRPGEKGLPGSPGLDGLNGLQGPKGQQGVPGVTEGGRTGAPGMDGLKGERGS---SLPGLPGFSGAKGVRGQDGLPGQPG-----------FQGPPGPRGLPSSSGIPGPVGDPGLPGLDGGQGFSGPPGPPGPAGPGTIQGDRGDAGIPGFSGTPGKRGEPGFPGRFGLPGNPGFKGMKGDPGNSGIPGPQGPAGDPGQYGYKGPKGSQGKRGSPGLPGIFLPPEDVQIPNGDFGPEGFSGGPGLAGSAGQPGSPGFPGPKGKIGSPGKPGRSGPAGSP---GIVGDPGSPGFQGLTGYKGFPGKQGLPGRPGLPGRSIGIGYTLVKHSQSSQVPMCPQGMA 937          

HSP 9 Score: 159.844 bits (403), Expect = 8.146e-39
Identity = 199/531 (37.48%), Postives = 238/531 (44.82%), Query Frame = 3
Query:  183 DKCQCFGNKGRQGFPGPRGYQGVSGDKGDVGQFGMPGPKGYKGFTGAIGPQGRKGERGIPGSPGYPGKMGEM-------GFPGIRGDIGEKGLTGCDGQQGDFGNPGMNGLVGRTGQPGERGDDGDRGLSIIPKYGLKGNKGSRGLLGRYGRKGEKGFKGIKGYSGIFGIKGNKGYVGPMGRRGPKGDSLGTVIIQSEKGSKGDKGLKGQSGIPCKGFQIEGRMYGRVGSDGPIGDKGIKGEKGLMGEIGQSGIDGARGLNGEKGLPGEAGPRGERGDRGNPGFPGDPGASGADGTRGR---------------QGERGPKGVHGISGADGPRGSRGDKGPSGSLLSCPGRKGEKGFFGIPGIKGDIGNKGY---QGHDGDIGEIGFKGEKGYEGP----------LGPSCSEVEQGFRGTKGESGFPGLRGAKGQRGYSGNKGIKGKPNFGTGINNPGETGSYGNLGVPGEKGNKGFIGDTGEKGFSGTGKQGPEGPRGDKGDDGVNGQVGMIGMPGIKGDKGSTYPICP 1670
            D  Q  G  G  GFPG +G  G SG KG  G  G PG  G KG  G        G  G+PGSPG PG  G+        G PG +G +G  G  G