TNF receptor-associated factor 4

Overview
NameTNF receptor-associated factor 4
Smed IDSMED30009756
Length (bp)1816
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of TNF receptor-associated factor 4 (SMED30009756) t-SNE clustered cells

Violin plots show distribution of expression levels for TNF receptor-associated factor 4 (SMED30009756) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of TNF receptor-associated factor 4 (SMED30009756) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for TNF receptor-associated factor 4 (SMED30009756) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of TNF receptor-associated factor 4 vs. Ensembl Human
Match: TRAF4 (TNF receptor associated factor 4 [Source:HGNC Symbol;Acc:HGNC:12034])

HSP 1 Score: 226.483 bits (576), Expect = 1.020e-66
Identity = 136/479 (28.39%), Postives = 214/479 (44.68%), Query Frame = 1
Query:  502 DVIFIDPLEKKYACVVCDQVLRYPVQFDECGHHCCSSCLPELMRVAP-RCPIDQCHIERDKVYVDKEFQKEIDNLGVRCSFYQKGCIWTGVLK---------------------------ELSNHLES---------------------------CLHRMITCPNNCNVEFEIRFLEKHKQDDCPKRIIQCQFCEASLIAEVEANHLKVCNKFPIPCPNGCKKKEILRENLAEHLESKCVKQEQDCPFSEYGCDFKGKKKRVREHLNDDFVSHLTLMCEAIKENTRIVEEQSKIITQYQTEVGTFEKRIESLEKLYGPQLIWKIDNYQEKFNEAKTGKKTTIFSAPFMTSRFGYKMALSVCLYGDGKARGKHFSLFICICKGDYDSLLLWPFSHRITFTLIDQCQDPEARK--NVVYTVKPNTCKEN--APFLGRPTTDRNA-SFGAQKFVELDVLNTLDYIRDDAIFIKAQVDCDEMI 1758
            D  F++  +++  C +C + +R PVQ   CGH  C +CL E +     +CP DQ  ++  K+Y D E + ++  L +RC   ++GC W+G L+                           +L  HL+                            C    + C N C      R L +H   +CPKR   C +C    + +   +H   C + P+ CPN C    + RE+L  HL+  C      CPF + GC  +  K  +  H+ +    HL +MC               ++++ + E+    + +E L       LIWKI +Y  +  EAK       FS  F T ++GYK+ +S  L G+G   G H SL+I +  G +D+LL WPF+ R+TF+L+DQ  DP   K  +V  T  P+   +N   P   R + D ++  FG  KF+    +   +Y+RDDA+FI+A V+    I
Sbjct:    5 DYKFLEKPKRRLLCPLCGKPMREPVQVSTCGHRFCDTCLQEFLSEGVFKCPEDQLPLDYAKIYPDPELEVQVLGLPIRCIHSEEGCRWSGPLRHLQGHLNTCSFNVIPCPNRCPMKLSRRDLPAHLQHDCPKRRLKCEFCGCDFSGEAYESHEGMCPQESVYCENKCGARMMRRLLAQHATSECPKRTQPCTYCTKEFVFDTIQSHQYQCPRLPVACPNQCGVGTVAREDLPGHLKDSCNTALVLCPFKDSGCKHRCPKLAMARHVEESVKPHLAMMC--------------ALVSRQRQELQELRRELEELSVGSDGVLIWKIGSYGRRLQEAKAKPNLECFSPAFYTHKYGYKLQVSAFLNGNGSGEGTHLSLYIRVLPGAFDNLLEWPFARRVTFSLLDQ-SDPGLAKPQHVTETFHPDPNWKNFQKPGTWRGSLDESSLGFGYPKFISHQDIRKRNYVRDDAVFIRAAVELPRKI 468          
BLAST of TNF receptor-associated factor 4 vs. Ensembl Human
Match: TRAF2 (TNF receptor associated factor 2 [Source:HGNC Symbol;Acc:HGNC:12032])

HSP 1 Score: 201.83 bits (512), Expect = 3.521e-57
Identity = 153/484 (31.61%), Postives = 221/484 (45.66%), Query Frame = 1
Query:  523 LEKKYACVVCDQVLRYPVQFDECGHHCCSSCLPELMRVAPRCPIDQCH----------IERDKVYVDKEFQKEIDNLGVRCSFYQKGCIWTGVLKEL-SNHLESCLHRMITCPNNCNVEFEIRFLEKHKQDDCPKRIIQCQFCEASLI-AEVEANHLKVCNKFPIPCPNGCKKKEILRENLAEHLESKCVKQEQDCPFSEYGC--DFKGKKKR------VREHL----------------NDDFVSHLTLMCEAIKENTRIVE--------------------------EQSKI------ITQYQTEVGTFEKRIESLEK--------LYGPQLIWKIDNYQEKFNEAKTGKKTTIFSAPFMTSRFGYKMALSVCLYGDGKARGKHFSLFICICKGDYDSLLLWPFSHRITFTLIDQCQDPEARKNVVYTVKPNTCKENAPFLGRPTTDRNASFGAQKFVELDVLNTLD-YIRDDAIFIKAQVD 1743
            LE KY C  C  VLR P Q  +CGH  CS CL  ++   P+      H          +E    + D   ++E+++L   C     GC W G LKE  S H   C   +  CP  C     +   E+H + +CP+R + C+ C A    A+V+A+H +VC KFP+ C +GC KK+I RE   +H+++ C K    C F   GC    +G+K++      +REHL                     S L   CE++++ T   E                          +Q KI      + Q +  +G  +  +  LE+         Y    IWKI ++  K  EA  G+   IFS  F TSR+GYKM L + L GDG  RG H SLF  + KG  D+LL WPF+ ++T  L+DQ      R++V+   +P+    +     RP  D N + G   F  +  +   + Y+RDDAIFIKA VD
Sbjct:   28 LEAKYLCSACRNVLRRPFQ-AQCGHRYCSFCLASILSSGPQNCAACVHEGIYEEGISILESSSAFPDNAARREVESLPAVCP--SDGCTWKGTLKEYESCHEGRCPLMLTECPA-CKGLVRLGEKERHLEHECPERSLSCRHCRAPCCGADVKAHH-EVCPKFPLTC-DGCGKKKIPREKFQDHVKT-CGKCRVPCRFHAIGCLETVEGEKQQEHEVQWLREHLAMLLSSVLEAKPLLGDQSHAGSELLQRCESLEKKTATFENIVCVLNREVERVAMTAEACSRQHRLDQDKIEALSSKVQQLERSIGLKDLAMADLEQKVLEMEASTYDGVFIWKISDFARKRQEAVAGRIPAIFSPAFYTSRYGYKMCLRIYLNGDGTGRGTHLSLFFVVMKGPNDALLRWPFNQKVTLMLLDQ----NNREHVIDAFRPDVTSSS---FQRPVNDMNIASGCPLFCPVSKMEAKNSYVRDDAIFIKAIVD 497          
BLAST of TNF receptor-associated factor 4 vs. Ensembl Human
Match: TRAF4 (TNF receptor associated factor 4 [Source:HGNC Symbol;Acc:HGNC:12034])

HSP 1 Score: 189.504 bits (480), Expect = 3.086e-53
Identity = 111/419 (26.49%), Postives = 176/419 (42.00%), Query Frame = 1
Query:  502 DVIFIDPLEKKYACVVCDQVLRYPVQFDECGHHCCSSCLPELMRVAP-RCPIDQCHIERDKVYVDKEFQKEIDNLGVRCSFYQKGCIWTGVLK---------------------------ELSNHLES---------------------------CLHRMITCPNNCNVEFEIRFLEKHKQDDCPKRIIQCQFCEASLIAEVEANHLKVCNKFPIPCPNGCKKKEILRENLAEHLESKCVKQEQDCPFSEYGCDFKGKKKRVREHLNDDFVSHLTLMCEAIKENTRIVEEQSKIITQYQTEVGTFEKRIESLEKLYGPQLIWKIDNYQEKFNEAKTGKKTTIFSAPFMTSRFGYKMALSVCLYGDGKARGKHFSLFICICKGDYDSLLLWPFSHRITFTLIDQCQDPEARKNVVYTVKP 1593
            D  F++  +++  C +C + +R PVQ   CGH  C +CL E +     +CP DQ  ++  K+Y D E + ++  L +RC   ++GC W+G L+                           +L  HL+                            C    + C N C      R L +H   +CPKR   C +C    + +   +H   C + P+ CPN C    + RE+L  HL+  C      CPF + GC  +  K  +  H+ +    HL +MC               ++++ + E+    + +E L       LIWKI +Y  +  EAK       FS  F T ++GYK+ +S  L G+G   G H SL+I +  G +D+LL WPF+ R     + +   P  R +   T  P
Sbjct:    5 DYKFLEKPKRRLLCPLCGKPMREPVQVSTCGHRFCDTCLQEFLSEGVFKCPEDQLPLDYAKIYPDPELEVQVLGLPIRCIHSEEGCRWSGPLRHLQGHLNTCSFNVIPCPNRCPMKLSRRDLPAHLQHDCPKRRLKCEFCGCDFSGEAYESHEGMCPQESVYCENKCGARMMRRLLAQHATSECPKRTQPCTYCTKEFVFDTIQSHQYQCPRLPVACPNQCGVGTVAREDLPGHLKDSCNTALVLCPFKDSGCKHRCPKLAMARHVEESVKPHLAMMC--------------ALVSRQRQELQELRRELEELSVGSDGVLIWKIGSYGRRLQEAKAKPNLECFSPAFYTHKYGYKLQVSAFLNGNGSGEGTHLSLYIRVLPGAFDNLLEWPFARRGLSPFLGRADMPWCRSHSTRTEVP 409          
BLAST of TNF receptor-associated factor 4 vs. Ensembl Human
Match: TRAF3 (TNF receptor associated factor 3 [Source:HGNC Symbol;Acc:HGNC:12033])

HSP 1 Score: 176.792 bits (447), Expect = 3.395e-48
Identity = 150/495 (30.30%), Postives = 229/495 (46.26%), Query Frame = 1
Query:  412 SSVSIDSVGIFHNQIKNPPIITNSNNQNDVDVI----------FIDPLEKKYACVVCDQVLRYPVQFDECGHHCCSSCLPELMRVA-PRCPIDQCHIERDKVYVDKEFQKEIDNLGVRCSFYQKGCIWTGVLKELSNHLES-CLHRMITCPN-NCNVEFEIRFLEKHKQDDCPKRIIQCQFCEAS--LIA---------EVEAN------HLKVCNKFPIPCPNGCKKKEILRENLAE--HLESKCVKQEQDC--------PFSEYGCDFKGKKKRVREHLNDDFVSHLTLMCEA--IKENTRIVEEQ----SKIITQYQTEVGTFEKRIESLEKL-YGPQLIWKIDNYQEKFNEAKTGKKTTIFSAPFMTSRFGYKMALSVCLYGDGKARGKHFSLFICICKGDYDSLLLWPFSHRITFTLIDQCQDPEARKNVVYTVKPNTCKENAPFLGRPTTDRNASFGAQKFVELDVLNTLDYIRDDAIFIKAQVDCDEM 1755
            SS  +DS G       NPP+  +++      V           F+  +E KY C  C  VL  P Q  ECGH  C SC+  L+  + P+C   Q  I +DKV+ D   ++EI  L + C    +GC    +L  L  HL++ C    + C   +C  +   + L  H +  C  R   C  C++   +IA          VE N      H ++C+ F I      ++KE+LR N ++  HL+     Q +          PF +   +    K  V E L +      ++   A  +  NT ++E Q     ++++ +   +   + R + LE   Y   LIWKI +Y+ +  EA  GK  +++S PF T  FGYKM   V L GDG  +G H SLF  I +G+YD+LL WPF  ++T  L+DQ     +R+++    KP+    N+    +PT + N + G   FV   VL    YI+DD IFIK  VD  ++
Sbjct:    3 SSKKMDSPGALQT---NPPLKLHTDRSAGTPVFVPEQGGYKEKFVKTVEDKYKCEKCHLVLCSPKQ-TECGHRFCESCMAALLSSSSPKCTACQESIVKDKVFKDNCCKREILALQIYCRNESRGCAEQLMLGHLLVHLKNDCHFEELPCVRPDCKEKVLRKDLRDHVEKACKYREATCSHCKSQVPMIALQVSLLQNESVEKNKSIQSLHNQICS-FEIEIE---RQKEMLRNNESKILHLQRVIDSQAEKLKELDKEIRPFRQNWEEADSMKSSV-ESLQNRVTELESVDKSAGQVARNTGLLESQLSRHDQMLSVHDIRLADMDLRFQVLETASYNGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQ---GSSRRHLGDAFKPDP---NSSSFKKPTGEMNIASGCPVFVAQTVLENGTYIKDDTIFIKVIVDTSDL 482          
BLAST of TNF receptor-associated factor 4 vs. Ensembl Human
Match: TRAF6 (TNF receptor associated factor 6 [Source:HGNC Symbol;Acc:HGNC:12036])

HSP 1 Score: 167.933 bits (424), Expect = 1.208e-44
Identity = 127/455 (27.91%), Postives = 205/455 (45.05%), Query Frame = 1
Query:  502 DVIFIDPLEKKYACVVCDQVLRYPVQFDECGHHCCSSCLPELMRVAP-RCPIDQCHIERDKVYVDKEFQKEIDNLGVRCSFYQKGCIWTGVLKELSNHLESCLHRMITCPNNCNVEFEIRFLEKHKQDDCPKRIIQCQFCEASLIAEVEANHLKVCNKFPIPCPNGCKKKEILRENLAEHLESKCVKQEQDCPFSEYGCDFKGKKKRVREHLNDDFVSHLTLMCEA------------------------------------IKENTRIVEEQSKIITQYQTEVGTFEKRIESLEKLYGPQL-IWKIDNYQEKFNEAKTGKKTTIFSAPFMTSRFGYKMALSVCLYGDGKAR-GKHFSLFICICKGDYDSLLLWPFSHRITFTLIDQCQDPEARKN--VVYTVKPNTCKENAPFLGRPTTDRNA-SFGAQKFVELDVLNTLDYIRDDAIFIKAQV 1740
            DV F  PLE KY C +C   LR  VQ   CGH  C +C+ + +R A  +CP+D   +  ++++ D   ++EI +L V+C    +GC+    L+ L +H   C   ++ CP  C   F+   +  H   DCP+R + C  C AS+  E +  H + C    + C   C    ++RE +  H +  C      C FS +GC  K ++  +  HL ++  SH+ ++ +A                                    I+E T  +E QS  +++ +  + T E ++  +E      + IWKI N+       +  K   I S  F T + GYK+ + + L      R   + SLF+   +G+YDS L WPF   I  T++DQ + P  R+N   +   KP           RPT  RN   FG   F+ L+ L    +I+DD + ++ +V
Sbjct:   57 DVEFDPPLESKYECPICLMALREAVQ-TPCGHRFCKACIIKSIRDAGHKCPVDNEILLENQLFPDNFAKREILSLMVKCP--NEGCLHKMELRHLEDHQAHCEFALMDCPQ-CQRPFQKFHINIHILKDCPRRQVSCDNCAASMAFEDKEIHDQNCPLANVIC-EYCNTI-LIREQMPNHYDLDCPTAPIPCTFSTFGCHEKMQRNHLARHLQENTQSHMRMLAQAVHSLSVIPDSGYISEVRNFQETIHQLEGRLVRQDHQIRELTAKMETQSMYVSELKRTIRTLEDKVAEIEAQQCNGIYIWKIGNFGMHLKCQEEEKPVVIHSPGFYTGKPGYKLCMRLHLQLPTAQRCANYISLFVHTMQGEYDSHLPWPFQGTIRLTILDQSEAP-VRQNHEEIMDAKPELLA-----FQRPTIPRNPKGFGYVTFMHLEALRQRTFIKDDTLLVRCEV 499          
BLAST of TNF receptor-associated factor 4 vs. Ensembl Celegans
Match: trf-1 (TNF Receptor Associated Factor (TRAF) homolog; TRF-1 [Source:UniProtKB/TrEMBL;Acc:G5EG80])

HSP 1 Score: 278.485 bits (711), Expect = 5.925e-87
Identity = 152/413 (36.80%), Postives = 214/413 (51.82%), Query Frame = 1
Query:  505 VIFIDPLEKKYACVVCDQVLRYPVQFDECGHHCCSSCLPELMRVAPRCPIDQCHIERDKVYVDKEFQKEIDNLGVRCSFYQKGCIWTGVLKELSNHLESCLHRMITCPNNCNVEFEIRFLEKHKQDDCPKRIIQCQFCEASLIAEVEANHLKVCNKFPIPCPNGCKKKEILRENLAEHLESKCVKQEQDCPFSEYGCDFKGKKKRVREHLNDDFVSHLTLMCEAIKENTRIVEEQSKIITQYQTEVGTFEKRIESLEKLYGPQLIWKIDNYQEKFNEAKTGKKTTIFSAPFMTSRFGYKMALSVCLYGDGKARGKHFSLFICICKGDYDSLLLWPFSHRITFTLIDQCQDPEARKNVVYTVKPNTCKENAPFLGRPTTDRNASFGAQKFVELDVLNTLDYIRDDAIFIKAQVD 1743
            V+F   L     C +C+Q LR P++ + C HH C  C     R  P C   Q  I+ +    D+  QK+I  L V C+F   GC W G L  L +HL  C  +       C  +F    LEKH+   C      C FC  ++       H K C +  I CP  C   +  R  +  H  S C   +  CPF  YGC F G K+ +++HL+D+ V HL  +C+ I +     E   + +  +           E+  +++GPQLIWKID  Q++ NEAK+G  TTIFS PFM+ RFGYKM    CL+GDG + GK  SL++ + KG++D  L WPF   I  +L+DQ   PE R N+ Y + P   K N  FL RP  +RNA+FG+Q F  L +L   +Y++DD I+++  VD
Sbjct:    6 VMFKGGLPADCTCPICEQALRDPIKLN-CDHHYCRQCFENENRT-PGCAACQTIIQPELCQHDRAKQKQILALPVVCTFESSGCPWDGQLGTLHDHLSECTFKSSLKCEKCGRQFAKNDLEKHRAK-CELNRAVCSFCNKTIRDSDRERHPKTCPQVIISCPFQCGLTDRPRLEIEAHCPS-CPNVDNVCPFVPYGCTFAGGKESIQQHLSDEPVRHLMYLCDEITDLKGTYELMERDMGSFNDRQTRILSAAETCTEMFGPQLIWKIDKLQQRTNEAKSGADTTIFSVPFMSHRFGYKMMACACLFGDGSSAGKSISLYVLLLKGEFDPTLEWPFHRAIKISLLDQNPRPEDRVNITYVIDPRKLKANEKFLARPRGERNAAFGSQSFCSLAILQ--NYVKDDKIYVQIDVD 412          
BLAST of TNF receptor-associated factor 4 vs. Ensembl Celegans
Match: trf-2 (TNF Receptor Associated Factor (TRAF) homolog [Source:UniProtKB/TrEMBL;Acc:Q9N586])

HSP 1 Score: 125.176 bits (313), Expect = 2.182e-31
Identity = 77/228 (33.77%), Postives = 121/228 (53.07%), Query Frame = 1
Query: 1069 DCPFSEYGCDFKGKKKRVREHLNDDFVSHLTLMCEAIKE-NTRIVEEQSKIITQYQTEVGTFEKR--IESLEKLYGPQLIWKIDNYQEKFNEAKTGKK-TTIFSAPFMTSRFGYKMALSVCLYGDGKARGKHFSLFICICKGDYDSLLLWPFSHRITFTLIDQCQDPEARKNVVYTVKPNTCKENAPFLGRPTTDRNASFGAQKFVELDVLNTLDYIRDDAIFIKAQV 1740
            DCPF E+GC  KG+   V+ H+ DD   HL L+C+++    T+I  +QS  + +Y   VG  +     ES  + YG Q  ++I        +A   K   +I+S PF +  +GYKM      YGDG A  ++FS+F+C+ KG++D +L WPF   +TF+++      + ++ +  T+  N   E   FL RP   RN +FG Q F  L +    ++  D  IFI+ +V
Sbjct:   85 DCPFKEHGCHKKGENSEVKRHVRDDRNLHLVLLCQSLNPIRTKINIQQSAYVDKY---VGMLQYMSIAESAFEKYGSQHTFRIPKIGLTVVKATKNKSHRSIYSQPFYSHGYGYKMMAVAAPYGDGLAFREYFSVFVCLMKGEWDDILEWPFRCDVTFSILSD----DKKELLTKTIYVNEMPEIQEFLERPEGLRNGTFGFQNF--LPLAKVTEFAADGDIFIQIKV 303          
BLAST of TNF receptor-associated factor 4 vs. Ensembl Fly
Match: Traf4 (gene:FBgn0026319 transcript:FBtr0334401)

HSP 1 Score: 185.267 bits (469), Expect = 1.543e-51
Identity = 111/408 (27.21%), Postives = 177/408 (43.38%), Query Frame = 1
Query:  706 KEIDNLGVRCSFYQKGCIWTGVLKELSNHLESCLHRMITCPNNCNV---------------------------EFEIRFLEKH---------------------------KQDDCPKRIIQCQFCEASLIAEVEANHLKVCNKFPIPCPNGCKKKEILRENLAEHLESKCVKQEQDCPFSEYGCDFKGKKKRVREHLNDDFVSHLTLMCEAIKENTRIVEEQSKIITQYQTEVGTFEKRIESLEKLYGPQLIWKIDNYQEKFNEAKTGKKTTIFSAPFMTSRFGYKMALSVCLYGDGKARGKHFSLFICICKGDYDSLLLWPFSHRITFTLIDQCQDPEARKNVVYTVKPNTCKENAPFLGRPTTDRNA-SFGAQKFVELDVLNTLDYIRDDAIFIKAQVDCDEMINI 1764
            K I    V C  +++GC W+  L++L  HL +C H    CPN C                             EF    LE+H                           K  DC KR+ +C  C+    A+    H   C + P+ CP  C    I R  L  HL  +C      C F E GC FKG ++ +  HL  +  +HL+LM                + ++   ++   +  +  L   Y   L+WKI ++  K  EA+      + S PF TS++GYK+  S+ L G+G     H S++I +  G+YD+LL WPFSH ITFTL +Q      +  V  +  P+   EN     RP+ + +   FG  +F+  ++L++  +I+ D +F++ +VD  +++ +
Sbjct:   88 KHIMGSLVFCIHHKQGCKWSDELRKLKGHLNACKHDATQCPNKCGAQIPRIMMTDHLQYTCTMRRTRCEFCQSEFSGAGLEEHNGSCGQEPVYCEAKCGQRILRGRMTLHKSKDCAKRLRRCAHCQREFSADTLPLHAAQCPRAPLACPQRCDAGPIPRGELEAHLRDECQSLAVSCSFKEAGCRFKGPRQMLEAHLESNAAAHLSLMV--------------ALSSRQGQQIQMLKSAVSKLSINYTGTLLWKITDWSAKMAEARGKDGLELVSPPFYTSQYGYKLQASMFLNGNGPGENTHVSVYIKVLPGEYDALLKWPFSHSITFTLFEQGAQ-SGQGGVAESFVPDPTWEN---FQRPSNEPDQLGFGFPRFISHELLHSRPFIKGDTVFLRVKVDPSKIVAV 477          
BLAST of TNF receptor-associated factor 4 vs. Ensembl Fly
Match: Traf4 (gene:FBgn0026319 transcript:FBtr0077429)

HSP 1 Score: 185.267 bits (469), Expect = 1.691e-51
Identity = 111/408 (27.21%), Postives = 177/408 (43.38%), Query Frame = 1
Query:  706 KEIDNLGVRCSFYQKGCIWTGVLKELSNHLESCLHRMITCPNNCNV---------------------------EFEIRFLEKH---------------------------KQDDCPKRIIQCQFCEASLIAEVEANHLKVCNKFPIPCPNGCKKKEILRENLAEHLESKCVKQEQDCPFSEYGCDFKGKKKRVREHLNDDFVSHLTLMCEAIKENTRIVEEQSKIITQYQTEVGTFEKRIESLEKLYGPQLIWKIDNYQEKFNEAKTGKKTTIFSAPFMTSRFGYKMALSVCLYGDGKARGKHFSLFICICKGDYDSLLLWPFSHRITFTLIDQCQDPEARKNVVYTVKPNTCKENAPFLGRPTTDRNA-SFGAQKFVELDVLNTLDYIRDDAIFIKAQVDCDEMINI 1764
            K I    V C  +++GC W+  L++L  HL +C H    CPN C                             EF    LE+H                           K  DC KR+ +C  C+    A+    H   C + P+ CP  C    I R  L  HL  +C      C F E GC FKG ++ +  HL  +  +HL+LM                + ++   ++   +  +  L   Y   L+WKI ++  K  EA+      + S PF TS++GYK+  S+ L G+G     H S++I +  G+YD+LL WPFSH ITFTL +Q      +  V  +  P+   EN     RP+ + +   FG  +F+  ++L++  +I+ D +F++ +VD  +++ +
Sbjct:   97 KHIMGSLVFCIHHKQGCKWSDELRKLKGHLNACKHDATQCPNKCGAQIPRIMMTDHLQYTCTMRRTRCEFCQSEFSGAGLEEHNGSCGQEPVYCEAKCGQRILRGRMTLHKSKDCAKRLRRCAHCQREFSADTLPLHAAQCPRAPLACPQRCDAGPIPRGELEAHLRDECQSLAVSCSFKEAGCRFKGPRQMLEAHLESNAAAHLSLMV--------------ALSSRQGQQIQMLKSAVSKLSINYTGTLLWKITDWSAKMAEARGKDGLELVSPPFYTSQYGYKLQASMFLNGNGPGENTHVSVYIKVLPGEYDALLKWPFSHSITFTLFEQGAQ-SGQGGVAESFVPDPTWEN---FQRPSNEPDQLGFGFPRFISHELLHSRPFIKGDTVFLRVKVDPSKIVAV 486          
BLAST of TNF receptor-associated factor 4 vs. Ensembl Fly
Match: Traf-like (gene:FBgn0030748 transcript:FBtr0074273)

HSP 1 Score: 75.8702 bits (185), Expect = 3.113e-14
Identity = 51/184 (27.72%), Postives = 95/184 (51.63%), Query Frame = 1
Query: 1192 RIVEEQSKIITQYQTEVGTFEKRIESLEKLYGPQLIWKIDNYQEKFNEAKTGKKTTIFSAPFMTSRFGYKMALSVCLYGDGKARGKHFSLFICICKGDYDSLLLWPFSHRITFTLIDQCQDPEARKNVVYTVKPNTCKENAPFLGRPTTDRNASFGAQKF-VELDVLNTLDYIRDDAIFIKAQV 1740
            R + +  + I+  +T++   ++RI S++ + G  LIW+I +Y +K  E+K    T + SA F    FGY + L + L G G  +G++    + +  G+YD LL WP   +    + DQC +    ++ V T+          F+ + + D   S   Q F +   V+ + +Y+R+D++FI+ +V
Sbjct:  282 RALHQTMQNISDLETQMA-MQQRIASVQNIRG-HLIWRIKDYSKKLEESKQ-YDTILHSAMFSNKAFGYALRLDIYLNGKGTWKGRNMIACLNVLSGEYDPLLAWPCRLQAEIIIRDQCTNVADAEDYVKTI----------FVRKKSDDFIQS--NQYFHIPHKVITSRNYLRNDSMFIEVRV 450          
BLAST of TNF receptor-associated factor 4 vs. Ensembl Fly
Match: Traf-like (gene:FBgn0030748 transcript:FBtr0074275)

HSP 1 Score: 75.8702 bits (185), Expect = 3.212e-14
Identity = 51/184 (27.72%), Postives = 95/184 (51.63%), Query Frame = 1
Query: 1192 RIVEEQSKIITQYQTEVGTFEKRIESLEKLYGPQLIWKIDNYQEKFNEAKTGKKTTIFSAPFMTSRFGYKMALSVCLYGDGKARGKHFSLFICICKGDYDSLLLWPFSHRITFTLIDQCQDPEARKNVVYTVKPNTCKENAPFLGRPTTDRNASFGAQKF-VELDVLNTLDYIRDDAIFIKAQV 1740
            R + +  + I+  +T++   ++RI S++ + G  LIW+I +Y +K  E+K    T + SA F    FGY + L + L G G  +G++    + +  G+YD LL WP   +    + DQC +    ++ V T+          F+ + + D   S   Q F +   V+ + +Y+R+D++FI+ +V
Sbjct:  304 RALHQTMQNISDLETQMA-MQQRIASVQNIRG-HLIWRIKDYSKKLEESKQYD-TILHSAMFSNKAFGYALRLDIYLNGKGTWKGRNMIACLNVLSGEYDPLLAWPCRLQAEIIIRDQCTNVADAEDYVKTI----------FVRKKSDDFIQS--NQYFHIPHKVITSRNYLRNDSMFIEVRV 472          
BLAST of TNF receptor-associated factor 4 vs. Ensembl Fly
Match: Traf-like (gene:FBgn0030748 transcript:FBtr0308606)

HSP 1 Score: 75.0998 bits (183), Expect = 3.735e-14
Identity = 50/186 (26.88%), Postives = 94/186 (50.54%), Query Frame = 1
Query: 1192 RIVEEQSKIITQYQTEVGTFEKRIESLEKLYGPQLIWKIDNYQEKFNEAKTGKKTTIFSAPFMTSRFGYKMALSVCLYGDGKARGKHFSLFICICKGDYDSLLLWPFSHRITFTLIDQCQDPEARKNVVYTVKPNTCKENAPFLGRPTTD---RNASFGAQKFVELDVLNTLDYIRDDAIFIKAQV 1740
            R + +  + I+  +T++   ++RI S++ + G  LIW+I +Y +K  E+K    T + SA F    FGY + L + L G G  +G++    + +  G+YD LL WP   +    + DQC +    ++ V T+          F+ + + D    N  F     +   V+ + +Y+R+D++FI+ +V
Sbjct:  225 RALHQTMQNISDLETQMA-MQQRIASVQNIRG-HLIWRIKDYSKKLEESKQYD-TILHSAMFSNKAFGYALRLDIYLNGKGTWKGRNMIACLNVLSGEYDPLLAWPCRLQAEIIIRDQCTNVADAEDYVKTI----------FVRKKSDDFIQSNQYF----HIPHKVITSRNYLRNDSMFIEVRV 393          
BLAST of TNF receptor-associated factor 4 vs. Ensembl Zebrafish
Match: traf4a (tnf receptor-associated factor 4a [Source:ZFIN;Acc:ZDB-GENE-040308-1])

HSP 1 Score: 250.751 bits (639), Expect = 4.133e-76
Identity = 143/482 (29.67%), Postives = 226/482 (46.89%), Query Frame = 1
Query:  502 DVIFIDPLEKKYACVVCDQVLRYPVQFDECGHHCCSSCLPELMRVAP-RCPIDQCHIERDKVYVDKEFQKEIDNLGVRCSFYQKGCIWTGVL---------------------------KELSNHLES---------------------------CLHRMITCPNNCNVEFEIRFLEKHKQDDCPKRIIQCQFCEASLIAEVEANHLKVCNKFPIPCPNGCKKKEILRENLAEHLESKCVKQEQDCPFSEYGCDFKGKKKRVREHLNDDFVSHLTLMCEAIKENTRIVEEQSKIITQYQTEVGTFEKRIESLEKLYGPQLIWKIDNYQEKFNEAKTGKKTTIFSAPFMTSRFGYKMALSVCLYGDGKARGKHFSLFICICKGDYDSLLLWPFSHRITFTLIDQCQDPEARK--NVVYTVKPNTCKENAPFLGRPTTDRNA------SFGAQKFVELDVLNTLDYIRDDAIFIKAQVDCDEMI 1758
            D  F++  ++++ C +C + +R PVQ   CGH  C +CL E +     +CP DQ  ++  K+Y D E +++I  L +RC   ++GC WTG +                           ++L  HL+                            C    + C N C      R L +H   +CPKR   C++C    + +   NH   C +FP+ CPN C    I RE+LA H++  C      CPF E GC  +  K  +  HL +   SHLT+MC               ++ + + E+    + +E L   +   LIWK+ +Y  K  EAK       FS PF T R+GYK+ +S  L G+G   G H S++I +  G+YD+LL WPFS+++TF+++DQ  DP   K  ++  T  P+   +N     +P + RN+       FG  KF+  + +   +YIRD++IF+KA ++  + I
Sbjct:    5 DYKFLEKPKRRFQCPLCSKAMREPVQVSTCGHRFCDTCLQEFLSEGVFKCPEDQLPLDYAKIYPDPELEQQILALPIRCIHSEEGCRWTGQMKQLQSHFSTCAFNVIPCPNRCSVKLTRRDLPEHLQHDCPKRKVKCEFCGSEFTGEAYENHQGICPQESVYCENKCGARMMRRLLSQHTMTECPKRTQPCKYCGKEFVYDTIQNHQYHCPRFPVQCPNQCGTPNIAREDLANHVKESCGSALVLCPFKEAGCKHRCPKMAIGRHLEESTKSHLTMMC--------------SLVGRQRQEILELRREMEELSVSHDGVLIWKLTDYSRKLQEAKLRNNHEFFSPPFYTHRYGYKLQVSAFLNGNGSGEGSHLSIYIRVLPGEYDNLLEWPFSYKVTFSILDQ-SDPSLSKPQHITETFNPDPNWKN---FQKPCSSRNSLDESTLGFGYPKFISHEEIKKRNYIRDNSIFLKASIEIPQKI 468          
BLAST of TNF receptor-associated factor 4 vs. Ensembl Zebrafish
Match: traf4a (tnf receptor-associated factor 4a [Source:ZFIN;Acc:ZDB-GENE-040308-1])

HSP 1 Score: 250.751 bits (639), Expect = 4.133e-76
Identity = 143/482 (29.67%), Postives = 226/482 (46.89%), Query Frame = 1
Query:  502 DVIFIDPLEKKYACVVCDQVLRYPVQFDECGHHCCSSCLPELMRVAP-RCPIDQCHIERDKVYVDKEFQKEIDNLGVRCSFYQKGCIWTGVL---------------------------KELSNHLES---------------------------CLHRMITCPNNCNVEFEIRFLEKHKQDDCPKRIIQCQFCEASLIAEVEANHLKVCNKFPIPCPNGCKKKEILRENLAEHLESKCVKQEQDCPFSEYGCDFKGKKKRVREHLNDDFVSHLTLMCEAIKENTRIVEEQSKIITQYQTEVGTFEKRIESLEKLYGPQLIWKIDNYQEKFNEAKTGKKTTIFSAPFMTSRFGYKMALSVCLYGDGKARGKHFSLFICICKGDYDSLLLWPFSHRITFTLIDQCQDPEARK--NVVYTVKPNTCKENAPFLGRPTTDRNA------SFGAQKFVELDVLNTLDYIRDDAIFIKAQVDCDEMI 1758
            D  F++  ++++ C +C + +R PVQ   CGH  C +CL E +     +CP DQ  ++  K+Y D E +++I  L +RC   ++GC WTG +                           ++L  HL+                            C    + C N C      R L +H   +CPKR   C++C    + +   NH   C +FP+ CPN C    I RE+LA H++  C      CPF E GC  +  K  +  HL +   SHLT+MC               ++ + + E+    + +E L   +   LIWK+ +Y  K  EAK       FS PF T R+GYK+ +S  L G+G   G H S++I +  G+YD+LL WPFS+++TF+++DQ  DP   K  ++  T  P+   +N     +P + RN+       FG  KF+  + +   +YIRD++IF+KA ++  + I
Sbjct:    5 DYKFLEKPKRRFQCPLCSKAMREPVQVSTCGHRFCDTCLQEFLSEGVFKCPEDQLPLDYAKIYPDPELEQQILALPIRCIHSEEGCRWTGQMKQLQSHFSTCAFNVIPCPNRCSVKLTRRDLPEHLQHDCPKRKVKCEFCGSEFTGEAYENHQGICPQESVYCENKCGARMMRRLLSQHTMTECPKRTQPCKYCGKEFVYDTIQNHQYHCPRFPVQCPNQCGTPNIAREDLANHVKESCGSALVLCPFKEAGCKHRCPKMAIGRHLEESTKSHLTMMC--------------SLVGRQRQEILELRREMEELSVSHDGVLIWKLTDYSRKLQEAKLRNNHEFFSPPFYTHRYGYKLQVSAFLNGNGSGEGSHLSIYIRVLPGEYDNLLEWPFSYKVTFSILDQ-SDPSLSKPQHITETFNPDPNWKN---FQKPCSSRNSLDESTLGFGYPKFISHEEIKKRNYIRDNSIFLKASIEIPQKI 468          
BLAST of TNF receptor-associated factor 4 vs. Ensembl Zebrafish
Match: traf4b (tnf receptor-associated factor 4b [Source:ZFIN;Acc:ZDB-GENE-040305-2])

HSP 1 Score: 217.624 bits (553), Expect = 1.771e-63
Identity = 135/488 (27.66%), Postives = 224/488 (45.90%), Query Frame = 1
Query:  499 VDVIFIDPLEKKYACVVCDQVLRYPVQFDECGHHCCSSCLPELMRVAP-RCPIDQCHIERDKVYVDKEFQKEIDNLGVRCSFYQKGCIWTG---------------------------VLKELSNHLES---------------------------CLHRMITCPNNCNVEFEIRFLEKHKQDDCPKRIIQCQFCEASLIAEVEANHLKVCNKFPIPCPNGCKKKEILRENLAEHLESKCVKQEQDCPFSEYGCDFKGKKKRVREHLNDDFVSHLTLMCEAIKENTRIVEEQSKIITQYQTEVGTFEKRIESLEKLYGPQLIWKIDNYQEKFNEAKTGKKT--TIFSAPFMTSRFGYKMALSVCLYGDGKARGKHFSLFICICKGDYDSLLLWPFSHRITFTLIDQCQDPEARK--NVVYTVKPNTCKEN--APFLGRPTTDRNA-------SFGAQKFVELDVLNTLDYIRDDAIFIKAQVDCDEMI 1758
            +D+ F++   +K+ C +C++ +R PVQ   CGH  C +CL E +      CP DQ  ++  K++ D E +++I +L +RC   ++GC WT                            + +EL  HL+                            C    + C N C      R L +H   +C KR + C++C+   + +   NH + C +FP+ CPN C    I R+ L  H++  C      CPF E GC  +  K  V  HL +   +HL+L+C               ++ + + E+    +R+E L       L+WK+ ++ ++  EAKT       +FS  F +  +GY++ +S  L G+G     H S+++ +  G+YD LL WPF +R++F+L+DQC DP   K  ++  T  P+   +N   P  G   + R          FG  KF+  + +   +YIRD+A+FIKA +D  + I
Sbjct:    4 LDLKFLERPRRKFYCPLCEKPMREPVQVSTCGHRFCDTCLQEYLSEGVFTCPEDQLPLDYAKIFPDLELEQQILSLPIRCIHSEEGCRWTAQNKLLQAHLSVCEFNVVSCPNRCSVKLLRRELPEHLQHDCAKRKLHCDHCGEQFTGEAYENHQGVCPEESVYCENKCGARMVRRLLAQHSVSECLKRKLPCRYCKKEFLYDTIQNHQQQCPRFPMQCPNRCGTPGITRDTLMAHVKEGCSTAMVLCPFKEAGCKHRSPKTGVARHLEEAAPTHLSLLC--------------GLVNRQRLELRDLRRRMEELSGSRDGTLLWKLTDFSQRLQEAKTRTSGCLELFSPAFYSHNYGYRLQVSAFLNGNGSGEDTHMSVYLRVLPGEYDGLLEWPFPYRVSFSLLDQC-DPALTKPQHITETFSPDPTWKNFQRPRPGALGSIRGGCLDESMLGFGYPKFISHEEMKKRNYIRDNAVFIKASIDVVQKI 476          
BLAST of TNF receptor-associated factor 4 vs. Ensembl Zebrafish
Match: traf6 (TNF receptor-associated factor 6 [Source:NCBI gene;Acc:554561])

HSP 1 Score: 172.17 bits (435), Expect = 3.612e-46
Identity = 132/501 (26.35%), Postives = 219/501 (43.71%), Query Frame = 1
Query:  442 FHNQIKNPPIITNSN----NQNDVDVIFIDPLEKKYACVVCDQVLRYPVQFDECGHHCCSSCLPELMR-VAPRCPIDQCHIERDKVYVDKEFQKEIDNLGVRCSFYQKGCIWTGVLKELSNHLESCLHRMITCPNNCNVEFEIRFLEKHKQDDCPKRIIQCQFCEASLIAEVEANHLKVCNKFPIPCPNGCKKKEILRENLAEHLESKCVKQEQDCPFSEYGCDFKGKKKRVREHLNDDFVSHLTLMCEAIKENT---------------------------------------RIVEEQSKIITQYQ-------------TEVGTFEKRIESLE--------KLYGPQLIWKIDNYQEKFNEAKTGKKTTIFSAPFMTSRFGYKMALSVCLYGDGKARGKHF-SLFICICKGDYDSLLLWPFSHRITFTLIDQCQDPEARKNV-VYTVKPNTCKENAPFLGRPTTDRNA-SFGAQKFVELDVLNTLDYIRDDAIFIKAQV 1740
            F +  +NP  I+ S+    +Q   DV F  PLE KY C +C   LR  VQ   CGH  C SC+ + +R    +CP+D   +  ++++ D   ++EI +L V+CS +  GC     L++L  HL  C      CP  C     I  L++HK   C +RI+ C  C  S +  V+ NH + C      C   C + E++R+ LA H ++ C+K    C FS +GC  K  +  + +H+ +    H+  M E ++  T                                        ++E + +++ Q Q              +V    +++ SLE        + Y    +W+++N+       + G+   + S PF T R GYK+ L + L      R  +F SLF+   +G++DS L WP    I   ++DQ    E + ++ V   KP+          RPT  RN   FG   F+ L  L    ++++D + ++ +V
Sbjct:   34 FLSPTENPSTISVSSSMPPDQQGYDVEFDPPLESKYECPICLMGLRSAVQ-TPCGHRFCDSCIRKSIRDTGQKCPVDNEVLLEEQLFPDNFAKREILSLTVKCSNF--GCSEKMELRQLEKHLSQCRFATAPCP-QCQESVPISHLDEHKSQHCLQRIMTCPDCAGSFVYAVKQNHEQFCPFANTVC-EYC-EMELIRDQLALHCDTDCLKAPVACTFSTFGCREKMTRNELAQHMQEFTQMHMRYMAEFLRSQTLNNCTMPSAAAHLSSDDRGASARSPDSCQCKQELLNLRETVLELEGRLVRQDQQIRELCIHNDTQKNQVTELRRKLVSLEESTRELEAQQYQGIYVWRVENFSHHLRNQEAGQPIVLHSPPFYTGRPGYKLCLRLHLQTPSAPRCSNFISLFVHTMQGEFDSQLSWPLQGTIRLAVLDQV---EGQHHIEVMETKPDL-----QAFQRPTVMRNPKGFGYVTFLHLQALRQRGFVKEDVLLVRCEV 520          
BLAST of TNF receptor-associated factor 4 vs. Ensembl Zebrafish
Match: traf6 (TNF receptor-associated factor 6 [Source:NCBI gene;Acc:554561])

HSP 1 Score: 172.17 bits (435), Expect = 3.612e-46
Identity = 132/501 (26.35%), Postives = 219/501 (43.71%), Query Frame = 1
Query:  442 FHNQIKNPPIITNSN----NQNDVDVIFIDPLEKKYACVVCDQVLRYPVQFDECGHHCCSSCLPELMR-VAPRCPIDQCHIERDKVYVDKEFQKEIDNLGVRCSFYQKGCIWTGVLKELSNHLESCLHRMITCPNNCNVEFEIRFLEKHKQDDCPKRIIQCQFCEASLIAEVEANHLKVCNKFPIPCPNGCKKKEILRENLAEHLESKCVKQEQDCPFSEYGCDFKGKKKRVREHLNDDFVSHLTLMCEAIKENT---------------------------------------RIVEEQSKIITQYQ-------------TEVGTFEKRIESLE--------KLYGPQLIWKIDNYQEKFNEAKTGKKTTIFSAPFMTSRFGYKMALSVCLYGDGKARGKHF-SLFICICKGDYDSLLLWPFSHRITFTLIDQCQDPEARKNV-VYTVKPNTCKENAPFLGRPTTDRNA-SFGAQKFVELDVLNTLDYIRDDAIFIKAQV 1740
            F +  +NP  I+ S+    +Q   DV F  PLE KY C +C   LR  VQ   CGH  C SC+ + +R    +CP+D   +  ++++ D   ++EI +L V+CS +  GC     L++L  HL  C      CP  C     I  L++HK   C +RI+ C  C  S +  V+ NH + C      C   C + E++R+ LA H ++ C+K    C FS +GC  K  +  + +H+ +    H+  M E ++  T                                        ++E + +++ Q Q              +V    +++ SLE        + Y    +W+++N+       + G+   + S PF T R GYK+ L + L      R  +F SLF+   +G++DS L WP    I   ++DQ    E + ++ V   KP+          RPT  RN   FG   F+ L  L    ++++D + ++ +V
Sbjct:   34 FLSPTENPSTISVSSSMPPDQQGYDVEFDPPLESKYECPICLMGLRSAVQ-TPCGHRFCDSCIRKSIRDTGQKCPVDNEVLLEEQLFPDNFAKREILSLTVKCSNF--GCSEKMELRQLEKHLSQCRFATAPCP-QCQESVPISHLDEHKSQHCLQRIMTCPDCAGSFVYAVKQNHEQFCPFANTVC-EYC-EMELIRDQLALHCDTDCLKAPVACTFSTFGCREKMTRNELAQHMQEFTQMHMRYMAEFLRSQTLNNCTMPSAAAHLSSDDRGASARSPDSCQCKQELLNLRETVLELEGRLVRQDQQIRELCIHNDTQKNQVTELRRKLVSLEESTRELEAQQYQGIYVWRVENFSHHLRNQEAGQPIVLHSPPFYTGRPGYKLCLRLHLQTPSAPRCSNFISLFVHTMQGEFDSQLSWPLQGTIRLAVLDQV---EGQHHIEVMETKPDL-----QAFQRPTVMRNPKGFGYVTFLHLQALRQRGFVKEDVLLVRCEV 520          
BLAST of TNF receptor-associated factor 4 vs. Ensembl Xenopus
Match: sytl2 (synaptotagmin like 2 [Source:Xenbase;Acc:XB-GENE-945155])

HSP 1 Score: 269.24 bits (687), Expect = 6.755e-83
Identity = 152/482 (31.54%), Postives = 238/482 (49.38%), Query Frame = 1
Query:  502 DVIFIDPLEKKYACVVCDQVLRYPVQFDECGHHCCSSCLPELMRVAP-RCPIDQCHIERDKVYVDKEFQKEIDNLGVRCSFYQKGCIWTGVLKELSNHLESCLHRMITCPNNCNVEFEIRFLEKHKQDDCPKRIIQCQFCE---------------------------ASLIAEVEANHLKV---------------------------CNKFPIPCPNGCKKKEILRENLAEHLESKCVKQEQDCPFSEYGCDFKGKKKRVREHLNDDFVSHLTLMCEAIKENTRIVEEQSKIITQYQTEVGTFEKRIESLEKLYGPQLIWKIDNYQEKFNEAKTGKKTTIFSAPFMTSRFGYKMALSVCLYGDGKARGKHFSLFICICKGDYDSLLLWPFSHRITFTLIDQCQDPEARK--NVVYTVKPNTCKENAPFLGRPTTDRNA------SFGAQKFVELDVLNTLDYIRDDAIFIKAQVDCDEMI 1758
            D  F++ L +K+ C +C + +R PVQ   CGH  C +CL E +     +CP DQ  ++  K+Y D++ + ++  L +RC   ++GC W+G LK+L  HL  C   +I CPN C+ +   R L +H Q DCPKR ++C+FC                            A ++  V + H  V                           C ++P PCPN C    I RE+L+ HL+  C      CPF + GC  +G K  +  HL ++  +HL++M              S ++++ + E+    K++E L       LIWKI +Y  K  EAK       FS PF T ++GYK+ +S  L G+G   G + S++I +  G+YD+LL WPFS+R+TF+L+DQ  DP   K  ++  T  P+   +N     +PT  RN+       FG  KF+  + +   +Y+RD+AIF++A V+  + I
Sbjct:    5 DYKFLEKLRRKFLCPLCGKAMREPVQVSTCGHRFCDTCLQEFLSEGVFKCPEDQLPLDYAKIYPDRDLETQVMGLSIRCIHSEEGCRWSGQLKQLQPHLNICAFNVIPCPNRCSTKLIRRDLPEHMQHDCPKRKVRCEFCGADFTGEAYEDHQGCCPQESVYCENKCGARMMRRVLSQHSLVECPKRTQPCPYCNKEFVFDTIQSHQYQCPRYPTPCPNQCGIASIAREDLSNHLKDSCSSALVLCPFKDSGCKHRGPKITISRHLEENMRAHLSMM--------------SSLVSRQRQEILELRKQVEELSVSSEGVLIWKISDYSRKVQEAKVRGNFESFSPPFYTHKYGYKLQVSAFLNGNGSGEGSYLSVYIRVLPGEYDNLLEWPFSYRVTFSLLDQ-SDPSLSKPQHITETFNPDPNWKN---FQKPTGSRNSLDESTLGFGYPKFISHEDIRKRNYVRDNAIFLRASVEIPQKI 468          
BLAST of TNF receptor-associated factor 4 vs. Ensembl Xenopus
Match: TRAF2 (TNF receptor associated factor 2 [Source:NCBI gene;Acc:100494415])

HSP 1 Score: 159.458 bits (402), Expect = 3.103e-42
Identity = 124/467 (26.55%), Postives = 198/467 (42.40%), Query Frame = 1
Query:  508 IFIDPLEKKYACVVCDQVLRYPVQFDECGHHCCSSCLPELMRVAPRCPIDQCHIERDKVYVDKEFQKEIDNLG--VRCSFYQKGCIWTGVLKELSNHLESCLHRMITCPNNCNVEFEIRFLEKHKQDDCPKRIIQCQFCEASLIAEVEANHLKVCNKFPIPCPNGCKKKEILRENLAEHLESKCVKQEQDCPFSEYGCDFKGKKKRVREHLNDDFVSHL----------------------------------------TLMCEAIKENTRIVEEQSK-----------IITQYQTEVGTFEKRIESLE-KLYGPQLIWKIDNYQEKFNEAKTGKKTTIFSAPFMTSRFGYKMALSVCLYGDGKARGKHFSLFICICKGDYDSLLLWPFSHRITFTLIDQCQDPEARKNVVYTVKPNTCKENAPFLGRPTTDRNASFGAQKFVELDVLNTLD-YIRDDAIFIKAQVD 1743
            I    LE KY C  C  +LR P+Q  +CGH  CS CL +++R   R                        N G    C    +   WTG L  +  H   C + +  CP  C         + H + +CP+R + C++C+ S        H ++C KFP+ C  GC +K+I RE +   +   C+     C ++  GC    +  +  EH N     HL                                        +++   ++ ++   EE ++            + Q +  V   E R++  E   Y    IWKI  + +K  +A  G+   +FS PF T+++GYKM L + L GDG  R  H SLF  + KG+ D+LL WPF+ ++T  L+DQ      R++V+   +P+    ++    RP ++ N + G   F ++  L   + Y+RDD IF+K  VD
Sbjct:   26 ILGTKLEVKYLCSDCKNLLRRPLQ-AQCGHRYCSHCLNKIIRWVAR------------------------NWGGVPECPAVCERSDWTGALISVG-HEGKCPYLLAPCPA-CKTIIRAANRDLHSERECPERKLNCRYCKLSFYFPDIKAHDEICPKFPMTC-EGCGRKKIPREKVRLFV---CMP----CRYAAVGCTEMVENDKCLEHENKSLAEHLAKGSPAPPANAPPNNSAKVAEMLLKFDTLDKKNTTFENIVSVLNREVERSSHAAEELARQLRAADTRLERTLGQKELIVAELETRMQESELSTYDGVFIWKISEFGKKRQDAINGRCPAMFSPPFYTNKYGYKMCLRIYLNGDGTGRNTHLSLFFVVMKGNNDALLRWPFNQKVTLMLLDQ----NNREHVIDAFRPDV---SSSSFQRPISEMNIASGCPLFCQVSKLEGKNSYVRDDTIFVKVIVD 450          
BLAST of TNF receptor-associated factor 4 vs. Ensembl Xenopus
Match: TRAF2 (TNF receptor associated factor 2 [Source:NCBI gene;Acc:100494415])

HSP 1 Score: 159.458 bits (402), Expect = 5.154e-42
Identity = 123/487 (25.26%), Postives = 199/487 (40.86%), Query Frame = 1
Query:  508 IFIDPLEKKYACVVCDQVLRYPVQFDECGHHCCSSCLPELMRVAPRCPIDQCHIERDKVYVDKEFQKEIDNLG--VRCSFYQKGCIWTGVLKELSNHLESCLHRMITCPNNCNVEFEIRFLEKHKQDDCPKRIIQCQFCEASLIAEVEANHLKVCNKFPIPCPNGCKKKEILRENLAEHL--ESKCVKQEQDCPFSEYGCDFKGKKKRVREHLNDDFVSHL------------------------------------------------TLMCEAIKENTRIVEEQSKIITQYQTEVGTFEKRIESLEKLYGPQ----------------------LIWKIDNYQEKFNEAKTGKKTTIFSAPFMTSRFGYKMALSVCLYGDGKARGKHFSLFICICKGDYDSLLLWPFSHRITFTLIDQCQDPEARKNVVYTVKPNTCKENAPFLGRPTTDRNASFGAQKFVELDVLNTLD-YIRDDAIFIKAQVD 1743
            I    LE KY C  C  +LR P+Q  +CGH  CS CL +++R   R                        N G    C    +   WTG L  +  H   C + +  CP  C         + H + +CP+R + C++C+ S        H ++C KFP+ C  GC +K+I RE +   +   S+ +     C ++  GC    +  +  EH N     HL                                                +++   ++ ++   EE ++ +   Q +V     ++  LE+  G +                       IWKI  + +K  +A  G+   +FS PF T+++GYKM L + L GDG  R  H SLF  + KG+ D+LL WPF+ ++T  L+DQ      R++V+   +P+    +     RP ++ N + G   F ++  L   + Y+RDD IF+K  VD
Sbjct:   26 ILGTKLEVKYLCSDCKNLLRRPLQ-AQCGHRYCSHCLNKIIRWVAR------------------------NWGGVPECPAVCERSDWTGALISVG-HEGKCPYLLAPCP-ACKTIIRAANRDLHSERECPERKLNCRYCKLSFYFPDIKAHDEICPKFPMTC-EGCGRKKIPREKVRLFVCSFSRNITLSLPCRYAAVGCTEMVENDKCLEHENKSLAEHLAKVWDYIQHGRKEQNDLSVRMGSLSVQGSPAPPFDTLDKKNTTFENIVSVLNREVERSSHAAEELARQLRAAQEKVEALTTKVRQLERTLGQKELIVAELETRMQESELSTYDGVFIWKISEFGKKRQDAINGRCPAMFSPPFYTNKYGYKMCLRIYLNGDGTGRNTHLSLFFVVMKGNNDALLRWPFNQKVTLMLLDQ----NNREHVIDAFRPDVSSSS---FQRPISEMNIASGCPLFCQVSKLEGKNSYVRDDTIFVKVIVD 477          
BLAST of TNF receptor-associated factor 4 vs. Ensembl Xenopus
Match: ssh2 (slingshot protein phosphatase 2 [Source:Xenbase;Acc:XB-GENE-993093])

HSP 1 Score: 147.132 bits (370), Expect = 2.532e-37
Identity = 135/507 (26.63%), Postives = 227/507 (44.77%), Query Frame = 1
Query:  511 FIDPLEKKYACVVCDQVLRYPVQFDECGHHCCSSCLPELMR-VAPRCPIDQCHIERDKVYVDKEFQKEIDNLGVRCSFYQKG-----------------------------CIWTGVLKELSNHLE-SCLHR---------------------------MITCPNNCNVEFEIRF------LEKHKQDDCPKRIIQCQFCEASLIAEV--------EAN------HLKVCNKFPIPCPNGCKKKEILRENLAEHLESKCVKQEQDCPFSEYGCDFKGKKKRVREH--LNDDF------VSHLTLMCE-AIKENTRIVEEQ----SKIITQYQTEVGTFEKRIESLEKL-YGPQLIWKIDNYQEKFNEAKTGKKTTIFSAPFMTSRFGYKMALSVCLYGDGKARGKHFSLFICICKGDYDSLLLWPFSHRITFTLIDQCQDPEARKNVVYTVKPNTCKENAPFLGRPTTDRNASFGAQKFVELDVLNTLDYIRDDAIFIKAQVDCDEM 1755
            F+ P+E+KY C  C  VL  P Q  ECGH  C +C+  ++   +P+C   + +I +DKV+ D   ++E+  L + C    +G                             C    + K+LS+H+E +C +R                           +I+CP+ C+V+  +R       ++ H+     + +   +     L A+V        E N      H ++C+ F I      + KE LR N A  ++ + V + Q     +   + +  ++   E   +  ++      +S L +M + A   N  ++E Q     ++++ +   +   + R + LE   Y   LIWKI +Y+ +  EA  GK  +++S PF T  FGYKM   V L GDG  +G H SLF  I +G+YD+LL WPF  +++  L+DQ     +R+++    KP+    N+    +PT + N + G   FV   VL    YI+DD IFIK  VD  ++
Sbjct:   38 FLKPVEEKYKCEKCRLVLCNPRQ-TECGHRFCETCMNAILSSTSPQCMACEDNITKDKVFKDNCCRREVLALQMFCRNETRGCKELITLGNLLIHLKSDCQFEELSCPRADCKEKVIRKDLSDHIEKTCKYRETPCKFCRNQVPLVEMQKHEDVDCPSVVISCPHMCSVKSLLRSEGTNQQIKAHEASSAVQHVNLMKEWSNYLEAKVSMLQNESSEKNKSIQILHNQMCS-FEIEIE---RHKEQLRNNEARIIQLQRVIEGQADKLKDLDKEIRNLRQTGDEADGMKSNYESLQNRLSQLEVMAKNAASWNPGVLETQINRHDQMLSVHDIRLADMDLRFQVLETASYNGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVSLMLMDQ---GPSRRHLGDAFKPDP---NSSSFKKPTGEMNIASGCPVFVAQTVLENGTYIKDDTIFIKVIVDTSDL 533          
BLAST of TNF receptor-associated factor 4 vs. Ensembl Xenopus
Match: slc12a1 (solute carrier family 12 member 1 [Source:Xenbase;Acc:XB-GENE-479925])

HSP 1 Score: 144.821 bits (364), Expect = 1.817e-36
Identity = 136/516 (26.36%), Postives = 219/516 (42.44%), Query Frame = 1
Query:  502 DVIFIDPLEKKYACVVCDQVLRYPVQFDECGHHCCSSCLPELMRVA--PRCPIDQCHIERDKVYVDKEFQKEIDNLGVRC------------SFYQK---------------GCIWTGVLKELSNHLES---------------------CLHRMITCPNNCNVEFEIRFLEKHKQDDCPKRIIQCQFCEAS-----LIAEVEANHLKVCNKFPIPCPNGCKKKEILRENLAEHLESKCVKQEQDC-PFSEY----GCDFKGKKKRV------------------REHLNDDFVSHLTLM---------CEAIKENTRIVEEQSK----IITQYQTEVGTFEKRIESLEKL-YGPQLIWKIDNYQEKFNEAKTGKKTTIFSAPFMTSRFGYKMALSVCLYGDGKARGKHFSLFICICKGDYDSLLLWPFSHRITFTLIDQCQDPEARKNV---VYTVKPNTCKENAPFLGRPTTDRNASFGAQKF---VELDVLNTLDYIRDDAIFIKAQVDCDEM 1755
            + +F++ L+ +Y C  C  VL  P Q   CGH  C  C+  L+ ++  P+CPID  +I+  +++ D   ++E+ NL V C              YQ+               GC    + KEL  HLES                     CL  M +C NN    F    L+KH  + CP+  +QC F         L   +  + L +C    +    G ++   L+E+  + L       E++C  F ++    G      K                     +EH   D    L  +          EA K+    ++ Q K    +++ ++ ++ + E+R   +E   Y  +LIWKI +Y+ K  EA  G+  +IFS  F TS  GY++     L GDG  +G   SL+  + KG++DS+LLWPF  ++T  L+DQ      +KN    V+   PN+         RP ++ N + G  +F    +L+      YI+DD +FIK  VD  ++
Sbjct:   31 EYLFVEQLQDRYKCASCHLVLHNPHQTG-CGHRFCEKCISNLIELSETPQCPIDMENIKSHEIFKDNCCKREVLNLLVYCKNSPACDVKVMLGRYQEHLGQCLYEMTLCSNDGCHDQMIRKELKGHLESECKLRQEACIYCKQTMSLCLACLDYMFSCRNNYKKIFFSFQLDKHLCE-CPEAELQCTFSNYGCNVMVLYHSLSVHFLYLCTFTSVSQVLGLQQNLDLKEHQIQQLSDTVKWCEKECHQFGQFTGSNGNSLSSTKTLASYIDKSMWLEEQVIQLVSKEHSRLDLRPILDTLESTKQRLSTLEAYKDRIDNLDGQFKKHDVLLSNHKMQMTSNEERFRLVEGTSYNGKLIWKITDYERKKREAMEGRAVSIFSQHFYTSWCGYRLCARAYLNGDGSGKGSFLSLYFVVMKGEFDSILLWPFKQKVTLMLLDQ----SGKKNHITDVFRADPNSSS-----FKRPDSEMNIASGCPRFASHAQLENPKNGCYIKDDTLFIKIVVDLTDL 535          
BLAST of TNF receptor-associated factor 4 vs. Ensembl Mouse
Match: Traf4 (TNF receptor associated factor 4 [Source:MGI Symbol;Acc:MGI:1202880])

HSP 1 Score: 245.358 bits (625), Expect = 6.398e-74
Identity = 143/479 (29.85%), Postives = 222/479 (46.35%), Query Frame = 1
Query:  502 DVIFIDPLEKKYACVVCDQVLRYPVQFDECGHHCCSSCLPELMRVAP-RCPIDQCHIERDKVYVDKEFQKEIDNLGVRCSFYQKGCIWTGVLKELSNHLESCLHRMITCPNNCNVEFEIRFLEKHKQDDCPKRIIQCQF---------------------------CEASLIAEVEANHLKV---------------------------CNKFPIPCPNGCKKKEILRENLAEHLESKCVKQEQDCPFSEYGCDFKGKKKRVREHLNDDFVSHLTLMCEAIKENTRIVEEQSKIITQYQTEVGTFEKRIESLEKLYGPQLIWKIDNYQEKFNEAKTGKKTTIFSAPFMTSRFGYKMALSVCLYGDGKARGKHFSLFICICKGDYDSLLLWPFSHRITFTLIDQCQDPEARK--NVVYTVKPNTCKEN--APFLGRPTTDRNA-SFGAQKFVELDVLNTLDYIRDDAIFIKAQVDCDEMI 1758
            D  F++  +++  C +C + +R PVQ   CGH  C +CL E +     +CP DQ  ++  K+Y D E + ++  L +RC   ++GC W+G L+ L  HL +C   ++ CPN C  +   R L  H Q DCPKR ++C+F                           C A ++  + A H                              C + P+PCPN C    + RE+L  HL+  C      CPF E GC  +  K  +  H+ +    HL +MC               ++++ + E+    + +E L       LIWKI +Y  +  EAK       FS  F T ++GYK+ +S  L G+G   G H S++I +  G +D+LL WPF+ R+TF+L+DQ  DP   K  +V  T  P+   +N   P   R + D ++  FG  KF+    +   +Y+RDDA+FI+A V+    I
Sbjct:    5 DYKFLEKPKRRLLCPLCGKPMREPVQVSTCGHRFCDTCLQEFLSEGVFKCPEDQLPLDYAKIYPDPELEVQVLGLAIRCIHSEEGCRWSGPLRHLQGHLNTCSFNVVPCPNRCPAKLSRRDLPAHLQHDCPKRRLKCEFCGCDFSGEAYESHEGVCPQESVYCENKCGARMMRRLLAQHATSECPKRTQPCAYCTKEFVYDTIQSHQYQCPRLPVPCPNQCGVGTVAREDLPTHLKDSCSTAFVLCPFKESGCKHRCPKLAMGRHVEESVKPHLAMMC--------------ALVSRQRQELQELRRELEELSIGSDGVLIWKIGSYGRRLQEAKAKPNLECFSPAFYTHKYGYKLQVSAFLNGNGSGEGTHLSIYIRVLPGAFDNLLEWPFARRVTFSLLDQ-SDPGLAKPQHVTETFHPDPNWKNFQKPGTWRGSLDESSLGFGYPKFISHQDIRKRNYVRDDAVFIRASVELPRKI 468          
BLAST of TNF receptor-associated factor 4 vs. Ensembl Mouse
Match: Traf2 (TNF receptor-associated factor 2 [Source:MGI Symbol;Acc:MGI:101835])

HSP 1 Score: 198.749 bits (504), Expect = 3.190e-56
Identity = 148/483 (30.64%), Postives = 210/483 (43.48%), Query Frame = 1
Query:  523 LEKKYACVVCDQVLRYPVQFDECGHHCCSSCLPELMRVAPR----CPIDQCH------IERDKVYVDKEFQKEIDNLGVRCSFYQKGCIWTGVLKEL-SNHLESCLHRMITCPNNCNVEFEIRFLEKHKQDDCPKRIIQCQFCEASLIAEVEANHLKVCNKFPIPCPNGCKKKEILRENLAEHLESKCVKQEQDCPFSEYGCDFKGKK--------KRVREHLN--------------------------------------------DDFVSHLTLMCEAIKENTRI----VEEQSKIITQYQTEVGT-------FEKRIESLE-KLYGPQLIWKIDNYQEKFNEAKTGKKTTIFSAPFMTSRFGYKMALSVCLYGDGKARGKHFSLFICICKGDYDSLLLWPFSHRITFTLIDQCQDPEARKNVVYTVKPNTCKENAPFLGRPTTDRNASFGAQKFVELDVLNTLD-YIRDDAIFIKAQVD 1743
            LE KY C  C  +LR P Q  +CGH  CS CL  ++   P+    C  +  +      +E    + D   ++E+++L   C     GC W G LKE  S H   C   +  CP  C     +   E H + +CPKR + CQ C A         H +VC KFP+ C +GC KK+I RE   +H+ + C K    C F   GC    +         +R+REHL                                             +  V  + +  EA     R+    +E  S  + Q +  +G         E+++  LE   Y    IWKI ++  K  EA  G+   IFS  F TSR+GYKM L V L GDG  RG H SLF  + KG  D+LL WPF+ ++T  L+D       R++V+   +P+    +     RP +D N + G   F  +  +   + Y+RDDAIFIKA VD
Sbjct:   28 LEAKYLCSACKNILRRPFQ-AQCGHRYCSFCLTSILSSGPQNCAACVYEGLYEEGISILESSSAFPDNAARREVESLPAVCP--NDGCTWKGTLKEYESCHEGLCPFLLTECPA-CKGLVRLSEKEHHTEQECPKRSLSCQHCRAPCSHVDLEVHYEVCPKFPLTC-DGCGKKKIPRETFQDHVRA-CSKCRVLCRFHTVGCSEMVETENLQDHELQRLREHLALLLSSFLEAQASPGTLNQVGPELLQRCQILEQKIATFENIVCVLNREVERVAVTAEACSRQHRLDQDKIEALSNKVQQLERSIGLKDLAMADLEQKVSELEVSTYDGVFIWKISDFTRKRQEAVAGRTPAIFSPAFYTSRYGYKMCLRVYLNGDGTGRGTHLSLFFVVMKGPNDALLQWPFNQKVTLMLLDH----NNREHVIDAFRPDVTSSS---FQRPVSDMNIASGCPLFCPVSKMEAKNSYVRDDAIFIKAIVD 497          
BLAST of TNF receptor-associated factor 4 vs. Ensembl Mouse
Match: Traf2 (TNF receptor-associated factor 2 [Source:MGI Symbol;Acc:MGI:101835])

HSP 1 Score: 196.438 bits (498), Expect = 2.466e-55
Identity = 149/490 (30.41%), Postives = 210/490 (42.86%), Query Frame = 1
Query:  523 LEKKYACVVCDQVLRYPVQFDECGHHCCSSCLPELMRVA-----------PRCPIDQCH------IERDKVYVDKEFQKEIDNLGVRCSFYQKGCIWTGVLKEL-SNHLESCLHRMITCPNNCNVEFEIRFLEKHKQDDCPKRIIQCQFCEASLIAEVEANHLKVCNKFPIPCPNGCKKKEILRENLAEHLESKCVKQEQDCPFSEYGCDFKGKK--------KRVREHLN--------------------------------------------DDFVSHLTLMCEAIKENTRI----VEEQSKIITQYQTEVGT-------FEKRIESLE-KLYGPQLIWKIDNYQEKFNEAKTGKKTTIFSAPFMTSRFGYKMALSVCLYGDGKARGKHFSLFICICKGDYDSLLLWPFSHRITFTLIDQCQDPEARKNVVYTVKPNTCKENAPFLGRPTTDRNASFGAQKFVELDVLNTLD-YIRDDAIFIKAQVD 1743
            LE KY C  C  +LR P Q  +CGH  CS CL  ++R A             C  +  +      +E    + D   ++E+++L   C     GC W G LKE  S H   C   +  CP  C     +   E H + +CPKR + CQ C A         H +VC KFP+ C +GC KK+I RE   +H+ + C K    C F   GC    +         +R+REHL                                             +  V  + +  EA     R+    +E  S  + Q +  +G         E+++  LE   Y    IWKI ++  K  EA  G+   IFS  F TSR+GYKM L V L GDG  RG H SLF  + KG  D+LL WPF+ ++T  L+D       R++V+   +P+    +     RP +D N + G   F  +  +   + Y+RDDAIFIKA VD
Sbjct:   28 LEAKYLCSACKNILRRPFQ-AQCGHRYCSFCLTSILRCASILSSSGPQNCAACVYEGLYEEGISILESSSAFPDNAARREVESLPAVCP--NDGCTWKGTLKEYESCHEGLCPFLLTECPA-CKGLVRLSEKEHHTEQECPKRSLSCQHCRAPCSHVDLEVHYEVCPKFPLTC-DGCGKKKIPRETFQDHVRA-CSKCRVLCRFHTVGCSEMVETENLQDHELQRLREHLALLLSSFLEAQASPGTLNQVGPELLQRCQILEQKIATFENIVCVLNREVERVAVTAEACSRQHRLDQDKIEALSNKVQQLERSIGLKDLAMADLEQKVSELEVSTYDGVFIWKISDFTRKRQEAVAGRTPAIFSPAFYTSRYGYKMCLRVYLNGDGTGRGTHLSLFFVVMKGPNDALLQWPFNQKVTLMLLDH----NNREHVIDAFRPDVTSSS---FQRPVSDMNIASGCPLFCPVSKMEAKNSYVRDDAIFIKAIVD 504          
BLAST of TNF receptor-associated factor 4 vs. Ensembl Mouse
Match: Traf6 (TNF receptor-associated factor 6 [Source:MGI Symbol;Acc:MGI:108072])

HSP 1 Score: 160.999 bits (406), Expect = 2.373e-42
Identity = 128/463 (27.65%), Postives = 202/463 (43.63%), Query Frame = 1
Query:  502 DVIFIDPLEKKYACVVCDQVLRYPVQFDECGHHCCSSCLPELMRVAP-RCPIDQCHIERDKVYVDKEFQKEIDNLGVRCSFYQKGCIWTGVLKELSNHLESCLHRMITCPNNCNVEFEIRFLEKHKQDDCPKRIIQCQFCEASLIAEVEANHLKVCNKFPIPCPNGCKKKEILRENLAEHLESKCVKQEQDCPFSEYGCDFKGKKKRVREHLNDDFVSHLTLMCEA--------------------------------------------IKENTRIVEEQSKIITQYQTEVGTFEKRIESLEKLYGPQL-IWKIDNYQEKFNEAKTGKKTTIFSAPFMTSRFGYKMALSVCLYGDGKAR-GKHFSLFICICKGDYDSLLLWPFSHRITFTLIDQCQDPEARKN--VVYTVKPNTCKENAPFLGRPTTDRNA-SFGAQKFVELDVLNTLDYIRDDAIFIKAQV 1740
            DV F  PLE KY C +C   LR  VQ   CGH  C +C+ + +R A  +CP+D   +  ++++ D   ++EI +L V+C    KGC+    L+ L +H   C   ++ CP  C   F+   +  H  +DCP+R + C  C  S+  E +  H + C    I C   C    ++RE +  H +  C      C FS +GC  K ++  +  HL ++   H+ L+ +A                                            I+E T  +E QS  + + +  + T E ++  +E      + IWKI N+       +  +   I S  F T R GYK+ + + L      R   + SLF+   +G+YDS L WPF   I  T++DQ  +   R+N   V   KP           RPT  RN   FG   F+ L+ L    +I+DD + ++ +V
Sbjct:   57 DVEFDPPLESKYECPICLMALREAVQ-TPCGHRFCKACIIKSIRDAGHKCPVDNEILLENQLFPDNFAKREILSLTVKCP--NKGCLQKMELRHLEDHQVHCEFALVNCPQ-CQRPFQKCQVNTHIIEDCPRRQVSCVNCAVSMAYEEKEIHDQSCPLANIIC-EYCGTI-LIREQMPNHYDLDCPTAPIPCTFSVFGCHEKMQRNHLARHLQENTQLHMRLLAQAVHNVNLALRPCDAASPSRGCRPEDPNYEETIKQLESRLVRQDHQIRELTAKMETQSMYVGELKRTIRTLEDKVAEMEAQQCNGIYIWKIGNFGMHLKSQEEERPVVIHSPGFYTGRPGYKLCMRLHLQLPTAQRCANYISLFVHTMQGEYDSHLPWPFQGTIRLTILDQ-SEALIRQNHEEVMDAKPELLA-----FQRPTIPRNPKGFGYVTFMHLEALRQGTFIKDDTLLVRCEV 507          
BLAST of TNF receptor-associated factor 4 vs. Ensembl Mouse
Match: Traf3 (TNF receptor-associated factor 3 [Source:MGI Symbol;Acc:MGI:108041])

HSP 1 Score: 152.91 bits (385), Expect = 2.020e-39
Identity = 145/553 (26.22%), Postives = 230/553 (41.59%), Query Frame = 1
Query:  412 SSVSIDSVGIFHNQIKNPPIITNSNN---------QNDVDVIFIDPLEKKYACVVCDQVLRYPVQFDECGHHCCSSCLPELMRVA-PRCPIDQCHIERDKVYVDKEFQKEIDNLGVRCSFYQKG-----------------------------CIWTGVLKELSNHLE-SCLHR---------------------------MITCPNNCNVEFEIRF--------------------LEKHKQDDCPKRIIQCQFCEASLIAEVEANHLKVCNKFPIPCPNGCKKKEILRENLAEHLESKCVKQEQDCPFSEYGCDFKGKKKRVREHLNDDFVSHLTLMCEAIKE-------------NTRIVEEQ----SKIITQYQTEVGTFEKRIESLEKL-YGPQLIWKIDNYQEKFNEAKTGKKTTIFSAPFMTSRFGYKMALSVCLYGDGKARGKHFSLFICICKGDYDSLLLWPFSHRITFTLIDQCQDPEARKNVVYTVKPNTCKENAPFLGRPTTDRNASFGAQKFVELDVLNTLDYIRDDAIFIKAQVDCDEM 1755
            SS  +D+ G       NPP+    +          Q      F+  +E KY C  C  VL  P Q  ECGH  C SC+  L+  + P+C   Q  I +DKV+ D   ++EI  L V C    +G                             C    + K+L +H+E +C +R                           +++CP+ C+V+  +R                     L K   +   K++   Q         +++ H ++C+ F I      ++KE+LR N ++ L  + V   Q     E   + +  ++   E   D   S +  +   + E             NT ++E Q     ++++ +   +   + R + LE   Y   LIWKI +Y+ +  EA  GK  +++S PF T  FGYKM   V L GDG  +G H SLF  I +G+YD+LL WPF  ++T  L+DQ     +R+++    KP+    N+    +PT + N + G   FV   VL    YI+DD IFIK  VD  ++
Sbjct:    3 SSKKMDAAGTLQ---PNPPLKLQPDRGAGSVLVPEQGGYKEKFVKTVEDKYKCEKCRLVLCNPKQ-TECGHRFCESCMAALLSSSSPKCTACQESIIKDKVFKDNCCKREILALQVYCRNEGRGCAEQLTLGHLLVHLKNECQFEELPCLRADCKEKVLRKDLRDHVEKACKYREATCSHCKSQVPMIKLQKHEDTDCPCVVVSCPHKCSVQTLLRSEGTNQQIKAHEASSAVQHVNLLKEWSNSLEKKVSLLQNESVEKNKSIQSLHNQICS-FEIEIE---RQKEMLRNNESKILHLQRVIDSQAEKLKELDKEIRPFRQNWEE--ADSMKSSVESLQNRVTELESVDKSAGQAARNTGLLESQLSRHDQMLSVHDIRLADMDLRFQVLETASYNGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQ---GSSRRHLGDAFKPDP---NSSSFKKPTGEMNIASGCPVFVAQTVLENGTYIKDDTIFIKVIVDTSDL 539          
BLAST of TNF receptor-associated factor 4 vs. UniProt/SwissProt
Match: sp|Q61382|TRAF4_MOUSE (TNF receptor-associated factor 4 OS=Mus musculus OX=10090 GN=Traf4 PE=1 SV=2)

HSP 1 Score: 245.358 bits (625), Expect = 4.475e-73
Identity = 143/479 (29.85%), Postives = 222/479 (46.35%), Query Frame = 1
Query:  502 DVIFIDPLEKKYACVVCDQVLRYPVQFDECGHHCCSSCLPELMRVAP-RCPIDQCHIERDKVYVDKEFQKEIDNLGVRCSFYQKGCIWTGVLKELSNHLESCLHRMITCPNNCNVEFEIRFLEKHKQDDCPKRIIQCQF---------------------------CEASLIAEVEANHLKV---------------------------CNKFPIPCPNGCKKKEILRENLAEHLESKCVKQEQDCPFSEYGCDFKGKKKRVREHLNDDFVSHLTLMCEAIKENTRIVEEQSKIITQYQTEVGTFEKRIESLEKLYGPQLIWKIDNYQEKFNEAKTGKKTTIFSAPFMTSRFGYKMALSVCLYGDGKARGKHFSLFICICKGDYDSLLLWPFSHRITFTLIDQCQDPEARK--NVVYTVKPNTCKEN--APFLGRPTTDRNA-SFGAQKFVELDVLNTLDYIRDDAIFIKAQVDCDEMI 1758
            D  F++  +++  C +C + +R PVQ   CGH  C +CL E +     +CP DQ  ++  K+Y D E + ++  L +RC   ++GC W+G L+ L  HL +C   ++ CPN C  +   R L  H Q DCPKR ++C+F                           C A ++  + A H                              C + P+PCPN C    + RE+L  HL+  C      CPF E GC  +  K  +  H+ +    HL +MC               ++++ + E+    + +E L       LIWKI +Y  +  EAK       FS  F T ++GYK+ +S  L G+G   G H S++I +  G +D+LL WPF+ R+TF+L+DQ  DP   K  +V  T  P+   +N   P   R + D ++  FG  KF+    +   +Y+RDDA+FI+A V+    I
Sbjct:    5 DYKFLEKPKRRLLCPLCGKPMREPVQVSTCGHRFCDTCLQEFLSEGVFKCPEDQLPLDYAKIYPDPELEVQVLGLAIRCIHSEEGCRWSGPLRHLQGHLNTCSFNVVPCPNRCPAKLSRRDLPAHLQHDCPKRRLKCEFCGCDFSGEAYESHEGVCPQESVYCENKCGARMMRRLLAQHATSECPKRTQPCAYCTKEFVYDTIQSHQYQCPRLPVPCPNQCGVGTVAREDLPTHLKDSCSTAFVLCPFKESGCKHRCPKLAMGRHVEESVKPHLAMMC--------------ALVSRQRQELQELRRELEELSIGSDGVLIWKIGSYGRRLQEAKAKPNLECFSPAFYTHKYGYKLQVSAFLNGNGSGEGTHLSIYIRVLPGAFDNLLEWPFARRVTFSLLDQ-SDPGLAKPQHVTETFHPDPNWKNFQKPGTWRGSLDESSLGFGYPKFISHQDIRKRNYVRDDAVFIRASVELPRKI 468          
BLAST of TNF receptor-associated factor 4 vs. UniProt/SwissProt
Match: sp|Q9BUZ4|TRAF4_HUMAN (TNF receptor-associated factor 4 OS=Homo sapiens OX=9606 GN=TRAF4 PE=1 SV=1)

HSP 1 Score: 226.483 bits (576), Expect = 4.899e-66
Identity = 136/479 (28.39%), Postives = 214/479 (44.68%), Query Frame = 1
Query:  502 DVIFIDPLEKKYACVVCDQVLRYPVQFDECGHHCCSSCLPELMRVAP-RCPIDQCHIERDKVYVDKEFQKEIDNLGVRCSFYQKGCIWTGVLK---------------------------ELSNHLES---------------------------CLHRMITCPNNCNVEFEIRFLEKHKQDDCPKRIIQCQFCEASLIAEVEANHLKVCNKFPIPCPNGCKKKEILRENLAEHLESKCVKQEQDCPFSEYGCDFKGKKKRVREHLNDDFVSHLTLMCEAIKENTRIVEEQSKIITQYQTEVGTFEKRIESLEKLYGPQLIWKIDNYQEKFNEAKTGKKTTIFSAPFMTSRFGYKMALSVCLYGDGKARGKHFSLFICICKGDYDSLLLWPFSHRITFTLIDQCQDPEARK--NVVYTVKPNTCKEN--APFLGRPTTDRNA-SFGAQKFVELDVLNTLDYIRDDAIFIKAQVDCDEMI 1758
            D  F++  +++  C +C + +R PVQ   CGH  C +CL E +     +CP DQ  ++  K+Y D E + ++  L +RC   ++GC W+G L+                           +L  HL+                            C    + C N C      R L +H   +CPKR   C +C    + +   +H   C + P+ CPN C    + RE+L  HL+  C      CPF + GC  +  K  +  H+ +    HL +MC               ++++ + E+    + +E L       LIWKI +Y  +  EAK       FS  F T ++GYK+ +S  L G+G   G H SL+I +  G +D+LL WPF+ R+TF+L+DQ  DP   K  +V  T  P+   +N   P   R + D ++  FG  KF+    +   +Y+RDDA+FI+A V+    I
Sbjct:    5 DYKFLEKPKRRLLCPLCGKPMREPVQVSTCGHRFCDTCLQEFLSEGVFKCPEDQLPLDYAKIYPDPELEVQVLGLPIRCIHSEEGCRWSGPLRHLQGHLNTCSFNVIPCPNRCPMKLSRRDLPAHLQHDCPKRRLKCEFCGCDFSGEAYESHEGMCPQESVYCENKCGARMMRRLLAQHATSECPKRTQPCTYCTKEFVFDTIQSHQYQCPRLPVACPNQCGVGTVAREDLPGHLKDSCNTALVLCPFKDSGCKHRCPKLAMARHVEESVKPHLAMMC--------------ALVSRQRQELQELRRELEELSVGSDGVLIWKIGSYGRRLQEAKAKPNLECFSPAFYTHKYGYKLQVSAFLNGNGSGEGTHLSLYIRVLPGAFDNLLEWPFARRVTFSLLDQ-SDPGLAKPQHVTETFHPDPNWKNFQKPGTWRGSLDESSLGFGYPKFISHQDIRKRNYVRDDAVFIRAAVELPRKI 468          
BLAST of TNF receptor-associated factor 4 vs. UniProt/SwissProt
Match: sp|Q12933|TRAF2_HUMAN (TNF receptor-associated factor 2 OS=Homo sapiens OX=9606 GN=TRAF2 PE=1 SV=2)

HSP 1 Score: 201.83 bits (512), Expect = 1.691e-56
Identity = 153/484 (31.61%), Postives = 221/484 (45.66%), Query Frame = 1
Query:  523 LEKKYACVVCDQVLRYPVQFDECGHHCCSSCLPELMRVAPRCPIDQCH----------IERDKVYVDKEFQKEIDNLGVRCSFYQKGCIWTGVLKEL-SNHLESCLHRMITCPNNCNVEFEIRFLEKHKQDDCPKRIIQCQFCEASLI-AEVEANHLKVCNKFPIPCPNGCKKKEILRENLAEHLESKCVKQEQDCPFSEYGC--DFKGKKKR------VREHL----------------NDDFVSHLTLMCEAIKENTRIVE--------------------------EQSKI------ITQYQTEVGTFEKRIESLEK--------LYGPQLIWKIDNYQEKFNEAKTGKKTTIFSAPFMTSRFGYKMALSVCLYGDGKARGKHFSLFICICKGDYDSLLLWPFSHRITFTLIDQCQDPEARKNVVYTVKPNTCKENAPFLGRPTTDRNASFGAQKFVELDVLNTLD-YIRDDAIFIKAQVD 1743
            LE KY C  C  VLR P Q  +CGH  CS CL  ++   P+      H          +E    + D   ++E+++L   C     GC W G LKE  S H   C   +  CP  C     +   E+H + +CP+R + C+ C A    A+V+A+H +VC KFP+ C +GC KK+I RE   +H+++ C K    C F   GC    +G+K++      +REHL                     S L   CE++++ T   E                          +Q KI      + Q +  +G  +  +  LE+         Y    IWKI ++  K  EA  G+   IFS  F TSR+GYKM L + L GDG  RG H SLF  + KG  D+LL WPF+ ++T  L+DQ      R++V+   +P+    +     RP  D N + G   F  +  +   + Y+RDDAIFIKA VD
Sbjct:   28 LEAKYLCSACRNVLRRPFQ-AQCGHRYCSFCLASILSSGPQNCAACVHEGIYEEGISILESSSAFPDNAARREVESLPAVCP--SDGCTWKGTLKEYESCHEGRCPLMLTECPA-CKGLVRLGEKERHLEHECPERSLSCRHCRAPCCGADVKAHH-EVCPKFPLTC-DGCGKKKIPREKFQDHVKT-CGKCRVPCRFHAIGCLETVEGEKQQEHEVQWLREHLAMLLSSVLEAKPLLGDQSHAGSELLQRCESLEKKTATFENIVCVLNREVERVAMTAEACSRQHRLDQDKIEALSSKVQQLERSIGLKDLAMADLEQKVLEMEASTYDGVFIWKISDFARKRQEAVAGRIPAIFSPAFYTSRYGYKMCLRIYLNGDGTGRGTHLSLFFVVMKGPNDALLRWPFNQKVTLMLLDQ----NNREHVIDAFRPDVTSSS---FQRPVNDMNIASGCPLFCPVSKMEAKNSYVRDDAIFIKAIVD 497          
BLAST of TNF receptor-associated factor 4 vs. UniProt/SwissProt
Match: sp|P39429|TRAF2_MOUSE (TNF receptor-associated factor 2 OS=Mus musculus OX=10090 GN=Traf2 PE=1 SV=1)

HSP 1 Score: 198.749 bits (504), Expect = 2.231e-55
Identity = 148/483 (30.64%), Postives = 210/483 (43.48%), Query Frame = 1
Query:  523 LEKKYACVVCDQVLRYPVQFDECGHHCCSSCLPELMRVAPR----CPIDQCH------IERDKVYVDKEFQKEIDNLGVRCSFYQKGCIWTGVLKEL-SNHLESCLHRMITCPNNCNVEFEIRFLEKHKQDDCPKRIIQCQFCEASLIAEVEANHLKVCNKFPIPCPNGCKKKEILRENLAEHLESKCVKQEQDCPFSEYGCDFKGKK--------KRVREHLN--------------------------------------------DDFVSHLTLMCEAIKENTRI----VEEQSKIITQYQTEVGT-------FEKRIESLE-KLYGPQLIWKIDNYQEKFNEAKTGKKTTIFSAPFMTSRFGYKMALSVCLYGDGKARGKHFSLFICICKGDYDSLLLWPFSHRITFTLIDQCQDPEARKNVVYTVKPNTCKENAPFLGRPTTDRNASFGAQKFVELDVLNTLD-YIRDDAIFIKAQVD 1743
            LE KY C  C  +LR P Q  +CGH  CS CL  ++   P+    C  +  +      +E    + D   ++E+++L   C     GC W G LKE  S H   C   +  CP  C     +   E H + +CPKR + CQ C A         H +VC KFP+ C +GC KK+I RE   +H+ + C K    C F   GC    +         +R+REHL                                             +  V  + +  EA     R+    +E  S  + Q +  +G         E+++  LE   Y    IWKI ++  K  EA  G+   IFS  F TSR+GYKM L V L GDG  RG H SLF  + KG  D+LL WPF+ ++T  L+D       R++V+   +P+    +     RP +D N + G   F  +  +   + Y+RDDAIFIKA VD
Sbjct:   28 LEAKYLCSACKNILRRPFQ-AQCGHRYCSFCLTSILSSGPQNCAACVYEGLYEEGISILESSSAFPDNAARREVESLPAVCP--NDGCTWKGTLKEYESCHEGLCPFLLTECPA-CKGLVRLSEKEHHTEQECPKRSLSCQHCRAPCSHVDLEVHYEVCPKFPLTC-DGCGKKKIPRETFQDHVRA-CSKCRVLCRFHTVGCSEMVETENLQDHELQRLREHLALLLSSFLEAQASPGTLNQVGPELLQRCQILEQKIATFENIVCVLNREVERVAVTAEACSRQHRLDQDKIEALSNKVQQLERSIGLKDLAMADLEQKVSELEVSTYDGVFIWKISDFTRKRQEAVAGRTPAIFSPAFYTSRYGYKMCLRVYLNGDGTGRGTHLSLFFVVMKGPNDALLQWPFNQKVTLMLLDH----NNREHVIDAFRPDVTSSS---FQRPVSDMNIASGCPLFCPVSKMEAKNSYVRDDAIFIKAIVD 497          
BLAST of TNF receptor-associated factor 4 vs. UniProt/SwissProt
Match: sp|Q6IWL4|TRAF6_DANRE (TNF receptor-associated factor 6 OS=Danio rerio OX=7955 GN=traf6 PE=1 SV=2)

HSP 1 Score: 172.17 bits (435), Expect = 2.727e-45
Identity = 132/501 (26.35%), Postives = 219/501 (43.71%), Query Frame = 1
Query:  442 FHNQIKNPPIITNSN----NQNDVDVIFIDPLEKKYACVVCDQVLRYPVQFDECGHHCCSSCLPELMR-VAPRCPIDQCHIERDKVYVDKEFQKEIDNLGVRCSFYQKGCIWTGVLKELSNHLESCLHRMITCPNNCNVEFEIRFLEKHKQDDCPKRIIQCQFCEASLIAEVEANHLKVCNKFPIPCPNGCKKKEILRENLAEHLESKCVKQEQDCPFSEYGCDFKGKKKRVREHLNDDFVSHLTLMCEAIKENT---------------------------------------RIVEEQSKIITQYQ-------------TEVGTFEKRIESLE--------KLYGPQLIWKIDNYQEKFNEAKTGKKTTIFSAPFMTSRFGYKMALSVCLYGDGKARGKHF-SLFICICKGDYDSLLLWPFSHRITFTLIDQCQDPEARKNV-VYTVKPNTCKENAPFLGRPTTDRNA-SFGAQKFVELDVLNTLDYIRDDAIFIKAQV 1740
            F +  +NP  I+ S+    +Q   DV F  PLE KY C +C   LR  VQ   CGH  C SC+ + +R    +CP+D   +  ++++ D   ++EI +L V+CS +  GC     L++L  HL  C      CP  C     I  L++HK   C +RI+ C  C  S +  V+ NH + C      C   C + E++R+ LA H ++ C+K    C FS +GC  K  +  + +H+ +    H+  M E ++  T                                        ++E + +++ Q Q              +V    +++ SLE        + Y    +W+++N+       + G+   + S PF T R GYK+ L + L      R  +F SLF+   +G++DS L WP    I   ++DQ    E + ++ V   KP+          RPT  RN   FG   F+ L  L    ++++D + ++ +V
Sbjct:   34 FLSPTENPSTISVSSSMPPDQQGYDVEFDPPLESKYECPICLMGLRSAVQ-TPCGHRFCDSCIRKSIRDTGQKCPVDNEVLLEEQLFPDNFAKREILSLTVKCSNF--GCSEKMELRQLEKHLSQCRFATAPCP-QCQESVPISHLDEHKSQHCLQRIMTCPDCAGSFVYAVKQNHEQFCPFANTVC-EYC-EMELIRDQLALHCDTDCLKAPVACTFSTFGCREKMTRNELAQHMQEFTQMHMRYMAEFLRSQTLNNCTMPSAAAHLSSDDRGASARSPDSCQCKQELLNLRETVLELEGRLVRQDQQIRELCIHNDTQKNQVTELRRKLVSLEESTRELEAQQYQGIYVWRVENFSHHLRNQEAGQPIVLHSPPFYTGRPGYKLCLRLHLQTPSAPRCSNFISLFVHTMQGEFDSQLSWPLQGTIRLAVLDQV---EGQHHIEVMETKPDL-----QAFQRPTVMRNPKGFGYVTFLHLQALRQRGFVKEDVLLVRCEV 520          
BLAST of TNF receptor-associated factor 4 vs. TrEMBL
Match: A0A267ELC7 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig027678g1 PE=4 SV=1)

HSP 1 Score: 589.726 bits (1519), Expect = 0.000e+0
Identity = 264/420 (62.86%), Postives = 335/420 (79.76%), Query Frame = 1
Query:  496 DVDVIFIDPLEKKYACVVCDQVLRYPVQFDECGHHCCSSCLPELMRVAPRCPIDQCHIERDKVYVDKEFQKEIDNLGVRCSFYQKGCIWTGVLKELSNHLESCLHRMITCPNNCNVEFEIRFLEKHKQDDCPKRIIQCQFCEASLIAEVEANHLKVCNKFPIPCPNGCKKKEILRENLAEHLESKCVKQEQDCPFSEYGCDFKGKKKRVREHLNDDFVSHLTLMCEAIKENTRIVEEQSKIITQYQTEVGTFEKRIESLEKLYGPQLIWKIDNYQEKFNEAKTGKKTTIFSAPFMTSRFGYKMALSVCLYGDGKARGKHFSLFICICKGDYDSLLLWPFSHRITFTLIDQCQDPEARKNVVYTVKPNTCKENAPFLGRPTTDRNASFGAQKFVELDVLNTLDYIRDDAIFIKAQVDCDEM 1755
            +V+V+F++ L+KKY C VC QVLRYPVQF+ECGH CCSSCLP+L+RVAPRCP+DQ  I++DKVYVDK FQKE DNLGV+CSF  +GC WTG+L EL  H+E C   M TCP  C VEFE RFLEKH+ DDCPKR I CQFCE  LIAE EA HL++C KF +PCPN CK++E+ RE L EHLE++C+KQ+ +CPF+ YGC F GKKK ++EH+    ++H+ ++C A+K+  +  E Q K I + + ++   E+RI  LE LYGPQLIWKIDNY+EK  EAK+GKK+TIFS PF+T+R GYK+A+S CLYGDGK+RGK+ SLF+CICKGD D LL WPF+++ITF LIDQC+D  AR+N+VY VKPNTCKEN PFLGRP  +RNASFGA +F EL+V+ TLDYI+DD ++IK +VDC++M
Sbjct:   70 EVEVVFLEQLDKKYECPVCGQVLRYPVQFEECGHRCCSSCLPDLLRVAPRCPLDQVAIDKDKVYVDKAFQKETDNLGVKCSFSARGCPWTGLLLELMAHMEGCDRMMTTCPMRCGVEFEKRFLEKHRNDDCPKREIHCQFCEIRLIAENEAEHLEICPKFLVPCPNKCKRREVARERLTEHLENECMKQDLNCPFASYGCQFTGKKKAMKEHVAAKQLNHMEILCAAVKQGDKNRENQDKAIQEMEKKMLGIERRINGLENLYGPQLIWKIDNYEEKLAEAKSGKKSTIFSPPFLTNRHGYKLAMSACLYGDGKSRGKYMSLFVCICKGDNDPLLAWPFAYKITFHLIDQCEDVAARRNIVYVVKPNTCKENRPFLGRPVGERNASFGAARFAELEVIGTLDYIKDDTMYIKVEVDCEDM 489          
BLAST of TNF receptor-associated factor 4 vs. TrEMBL
Match: A0A267DPF2 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig027678g2 PE=4 SV=1)

HSP 1 Score: 587.8 bits (1514), Expect = 0.000e+0
Identity = 263/420 (62.62%), Postives = 335/420 (79.76%), Query Frame = 1
Query:  496 DVDVIFIDPLEKKYACVVCDQVLRYPVQFDECGHHCCSSCLPELMRVAPRCPIDQCHIERDKVYVDKEFQKEIDNLGVRCSFYQKGCIWTGVLKELSNHLESCLHRMITCPNNCNVEFEIRFLEKHKQDDCPKRIIQCQFCEASLIAEVEANHLKVCNKFPIPCPNGCKKKEILRENLAEHLESKCVKQEQDCPFSEYGCDFKGKKKRVREHLNDDFVSHLTLMCEAIKENTRIVEEQSKIITQYQTEVGTFEKRIESLEKLYGPQLIWKIDNYQEKFNEAKTGKKTTIFSAPFMTSRFGYKMALSVCLYGDGKARGKHFSLFICICKGDYDSLLLWPFSHRITFTLIDQCQDPEARKNVVYTVKPNTCKENAPFLGRPTTDRNASFGAQKFVELDVLNTLDYIRDDAIFIKAQVDCDEM 1755
            +V+V+F++ L+KKY C VC QVLRYPVQF+ECGH CCSSCLP+L+RVAPRCP+DQ  I+++KVYVDK FQKE DNLGV+CSF  +GC WTG+L EL  H+E C   M TCP  C VEFE RFLEKH+ DDCPKR I CQFCE  LIAE EA HL++C KF +PCPN CK++E+ RE L EHLE++C+KQ+ +CPF+ YGC F GKKK ++EH+    ++H+ ++C A+K+  +  E Q K I + + ++   E+RI  LE LYGPQLIWKIDNY+EK  EAK+GKK+TIFS PF+T+R GYK+A+S CLYGDGK+RGK+ SLF+CICKGD D LL WPF+++ITF LIDQC+D  AR+N+VY VKPNTCKEN PFLGRP  +RNASFGA +F EL+V+ TLDYI+DD ++IK +VDC++M
Sbjct:   70 EVEVVFLEQLDKKYECPVCGQVLRYPVQFEECGHRCCSSCLPDLLRVAPRCPLDQVAIDKEKVYVDKAFQKETDNLGVKCSFSARGCPWTGLLLELMAHMEGCDRMMTTCPMRCGVEFEKRFLEKHRNDDCPKREIHCQFCEIRLIAENEAEHLEICPKFLVPCPNKCKRREVARERLTEHLENECMKQDLNCPFASYGCQFTGKKKAMKEHVAAKQLNHMEILCAAVKQGDKNRENQDKAIQEMEKKMLGIERRINGLENLYGPQLIWKIDNYEEKLAEAKSGKKSTIFSPPFLTNRHGYKLAMSACLYGDGKSRGKYMSLFVCICKGDNDPLLAWPFAYKITFHLIDQCEDVAARRNIVYVVKPNTCKENRPFLGRPVGERNASFGAARFAELEVIGTLDYIKDDTMYIKVEVDCEDM 489          
BLAST of TNF receptor-associated factor 4 vs. TrEMBL
Match: A0A1I8I4E9 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 584.334 bits (1505), Expect = 0.000e+0
Identity = 254/423 (60.05%), Postives = 333/423 (78.72%), Query Frame = 1
Query:  496 DVDVIFIDPLEKKYACVVCDQVLRYPVQFDECGHHCCSSCLPELMRVAPRCPIDQCHIERDKVYVDKEFQKEIDNLGVRCSFYQKGCIWTGVLKELSNHLESCLHRMITCPNNCNVEFEIRFLEKHKQDDCPKRIIQCQFCEASLIAEVEANHLKVCNKFPIPCPNGCKKKEILRENLAEHLESKCVKQEQDCPFSEYGCDFKGKKKRVREHLNDDFVSHLTLMCEAIKENTRIVEEQSKIITQYQTEVGTFEKRIESLEKLYGPQLIWKIDNYQEKFNEAKTGKKTTIFSAPFMTSRFGYKMALSVCLYGDGKARGKHFSLFICICKGDYDSLLLWPFSHRITFTLIDQCQDPEARKNVVYTVKPNTCKENAPFLGRPTTDRNASFGAQKFVELDVLNTLDYIRDDAIFIKAQVDCDEMINI 1764
            +VDV+F++ L+KKY C VC QVLRYPVQF+ECGH CCSSCLP+L+RVAPRCPIDQ  I++DKVY DK FQKE D+LGV+CSF+++GC WTGVL EL +H+E C   + TCP  C VEF+ RFLEKH+ +DCPKR IQCQFCE  L+AE EA HL+ C KF +PCPN CKKKE+ RE + EHLE++C++Q+  CPFS YGCDF G+KK+++EH+ +  ++H+ ++C A+K+  +  E+Q K I + + ++   E+R+  LE L+GPQL+W+IDNYQEK  EAK GKK TIFS PF+T+R GYK+ALS CLYGDGK RG++ SLF CICKG+ D+LL WPF++++TF LIDQC+D  ARKN+VYTV PN CKEN PFLGRP  +RNASFGA +F ELD +  LDYI+DD +++K  VD + ++ +
Sbjct: 1083 EVDVVFLESLDKKYECPVCGQVLRYPVQFEECGHRCCSSCLPDLLRVAPRCPIDQQTIDKDKVYADKAFQKETDSLGVKCSFFERGCNWTGVLSELMSHIEGCDRMLTTCPMRCGVEFQKRFLEKHRLEDCPKRDIQCQFCEIGLVAEQEAGHLETCPKFLVPCPNKCKKKEVAREMMQEHLENECMRQDLCCPFSTYGCDFSGRKKQLKEHIAEKQLNHMEILCSAVKQGDKNQEKQQKQILEMEKKLVGVERRVGGLENLFGPQLVWRIDNYQEKLAEAKAGKKATIFSPPFLTNRHGYKLALSACLYGDGKFRGQYMSLFACICKGENDALLAWPFAYKLTFQLIDQCEDVSARKNIVYTVTPNPCKENRPFLGRPLGERNASFGAARFAELDAIGKLDYIKDDTMYVKVTVDLENLLPL 1505          
BLAST of TNF receptor-associated factor 4 vs. TrEMBL
Match: A0A1S3KE24 (TNF receptor-associated factor 4 OS=Lingula unguis OX=7574 GN=LOC106181010 PE=4 SV=1)

HSP 1 Score: 575.089 bits (1481), Expect = 0.000e+0
Identity = 270/457 (59.08%), Postives = 344/457 (75.27%), Query Frame = 1
Query:  394 HKNSNLSSVSIDSVGIFHNQIKNPPIITNSNNQNDVDVIFIDPLEKKYACVVCDQVLRYPVQFDECGHHCCSSCLPELMRVAPRCPIDQCHIERDKVYVDKEFQKEIDNLGVRCSFYQKGCIWTGVLKELSNHLESCLHRMITCPNNCNVEFEIRFLEKHKQDDCPKRIIQCQFCEASLIAEVEANHLKVCNKFPIPCPNGCKKKEILRENLAEHLESKCVKQEQDCPFSEYGCDFKGKKKRVREHLNDDFVSHLTLMCEAIKENTRIVEEQSKIITQYQTEVGTFEKRIESLEKLYGPQLIWKIDNYQEKFNEAKTGKKTTIFSAPFMTSRFGYKMALSVCLYGDGKARGKHFSLFICICKGDYDSLLLWPFSHRITFTLIDQCQDPEARKNVVYTVKPNTCKENAPFLGRPTTDRNASFGAQKFVELDVLNTLDYIRDDAIFIKAQVDCDEMINI 1764
            H  S LSSVS +S G               +++ ++++ F +PLEKKY C VC QVLRYP+QFDECGH CCSSCLPEL+RVAPRCPIDQ HI+RDKVYVDK FQ++ID+LGV+CS  +  C WTG LKEL  H E C +++I CP  C  EFE RFL+KH+ +DCPKR I C+FC+++++ E E  HL +C +FPIPCPNGCK+K+I RE +AEH+E  C KQ   CPF + GC+++  +K++  H+N++   HL+L+ E I  +  I+++    +  +  ++   EKRIE LEKLYG Q +WKID+YQEK +EAK G K TIFS PF+TSR GYKMALS CL+GDGKARGK  SLF CICKG+ D+LL WPFSHR+TFTL+DQC+DP AR+NV YTVKPNTCK+N PFLGRP+ DRNASFGAQKFVEL+V++TLDYIRDD IFIK  VD D+M+ +
Sbjct:   20 HLGSALSSVSRNSNGSL------------VSDRPNLEITFQEPLEKKYECPVCCQVLRYPIQFDECGHRCCSSCLPELLRVAPRCPIDQRHIDRDKVYVDKAFQRDIDHLGVKCSNGR--CKWTGALKELVPHQEDCKYKVIPCPKGCGAEFEKRFLDKHRDEDCPKRKIACEFCKSNILFEEEIEHLNLCKRFPIPCPNGCKRKDIPREEVAEHMEGDCPKQTVPCPFVDCGCEYRCNRKKLTAHVNEEPTMHLSLVAETIARHKEILDKYKLSMEDHTEKLAGMEKRIEGLEKLYGAQFVWKIDSYQEKLDEAKAGTKRTIFSQPFLTSRNGYKMALSACLFGDGKARGKFMSLFACICKGESDALLSWPFSHRVTFTLMDQCEDPAARRNVTYTVKPNTCKDNKPFLGRPSGDRNASFGAQKFVELEVMSTLDYIRDDTIFIKVNVDMDDMVKM 462          
BLAST of TNF receptor-associated factor 4 vs. TrEMBL
Match: A0A1I8J068 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 572.778 bits (1475), Expect = 0.000e+0
Identity = 254/423 (60.05%), Postives = 333/423 (78.72%), Query Frame = 1
Query:  496 DVDVIFIDPLEKKYACVVCDQVLRYPVQFDECGHHCCSSCLPELMRVAPRCPIDQCHIERDKVYVDKEFQKEIDNLGVRCSFYQKGCIWTGVLKELSNHLESCLHRMITCPNNCNVEFEIRFLEKHKQDDCPKRIIQCQFCEASLIAEVEANHLKVCNKFPIPCPNGCKKKEILRENLAEHLESKCVKQEQDCPFSEYGCDFKGKKKRVREHLNDDFVSHLTLMCEAIKENTRIVEEQSKIITQYQTEVGTFEKRIESLEKLYGPQLIWKIDNYQEKFNEAKTGKKTTIFSAPFMTSRFGYKMALSVCLYGDGKARGKHFSLFICICKGDYDSLLLWPFSHRITFTLIDQCQDPEARKNVVYTVKPNTCKENAPFLGRPTTDRNASFGAQKFVELDVLNTLDYIRDDAIFIKAQVDCDEMINI 1764
            +VDV+F++ L+KKY C VC QVLRYPVQF+ECGH CCSSCLP+L+RVAPRCPIDQ  I++DKVY DK FQKE D+LGV+CSF+++GC WTGVL EL +H+E C   + TCP  C VEF+ RFLEKH+ +DCPKR IQCQFCE  L+AE EA HL+ C KF +PCPN CKKKE+ RE + EHLE++C++Q+  CPFS YGCDF G+KK+++EH+ +  ++H+ ++C A+K+  +  E+Q K I + + ++   E+R+  LE L+GPQL+W+IDNYQEK  EAK GKK TIFS PF+T+R GYK+ALS CLYGDGK RG++ SLF CICKG+ D+LL WPF++++TF LIDQC+D  ARKN+VYTV PN CKEN PFLGRP  +RNASFGA +F ELD +  LDYI+DD +++K  VD + ++ +
Sbjct:   45 EVDVVFLESLDKKYECPVCGQVLRYPVQFEECGHRCCSSCLPDLLRVAPRCPIDQQTIDKDKVYADKAFQKETDSLGVKCSFFERGCNWTGVLSELMSHIEGCDRMLTTCPMRCGVEFQKRFLEKHRLEDCPKRDIQCQFCEIGLVAEQEAGHLETCPKFLVPCPNKCKKKEVAREMMQEHLENECMRQDLCCPFSTYGCDFSGRKKQLKEHIAEKQLNHMEILCSAVKQGDKNQEKQQKQILEMEKKLVGVERRVGGLENLFGPQLVWRIDNYQEKLAEAKAGKKATIFSPPFLTNRHGYKLALSACLYGDGKFRGQYMSLFACICKGENDALLAWPFAYKLTFQLIDQCEDVSARKNIVYTVTPNPCKENRPFLGRPLGERNASFGAARFAELDAIGKLDYIKDDTMYVKVTVDLENLLPL 467          
BLAST of TNF receptor-associated factor 4 vs. Ensembl Cavefish
Match: traf4a (TNF receptor associated factor 4 [Source:NCBI gene;Acc:103024022])

HSP 1 Score: 268.085 bits (684), Expect = 9.080e-83
Identity = 151/482 (31.33%), Postives = 237/482 (49.17%), Query Frame = 1
Query:  502 DVIFIDPLEKKYACVVCDQVLRYPVQFDECGHHCCSSCLPELMRVAP-RCPIDQCHIERDKVYVDKEFQKEIDNLGVRCSFYQKGCIWTGVLKELSNHLESCLHRMITCPNNCNVEFEIRFLEKHKQDDCPKRIIQCQF---------------------------CEASLIAEVEA---------------------------NHLKVCNKFPIPCPNGCKKKEILRENLAEHLESKCVKQEQDCPFSEYGCDFKGKKKRVREHLNDDFVSHLTLMCEAIKENTRIVEEQSKIITQYQTEVGTFEKRIESLEKLYGPQLIWKIDNYQEKFNEAKTGKKTTIFSAPFMTSRFGYKMALSVCLYGDGKARGKHFSLFICICKGDYDSLLLWPFSHRITFTLIDQCQDPEARK--NVVYTVKPNTCKENAPFLGRPTTDRNA------SFGAQKFVELDVLNTLDYIRDDAIFIKAQVDCDEMI 1758
            D  F++  ++++ C +C + +R PVQ   CGH  C +CL E +     +CP DQ  ++  K+Y D E +++I  L +RC   ++GC WTG +K+L  H  +C   +I CPN C V+   R L +H Q DCPKR ++C+F                           C A ++  + A                           NH   C +FP+ CPN C    I RE+LA H++  C      CPF + GC  +  K  +  HL +   SHLT+MC               ++ + + E+    + +E L   +   LIWK+++Y  K  EAK       FS PF T R+GYK+ +S  L G+G   G H S++I +  G+YD+LL WPF++++TF+++DQ  DP   K  ++  T  P+   +N     +P++ RN+       FG  KF+  D +   +YIRD+AIF+KA ++  + I
Sbjct:    5 DYKFLEKPKRRFQCPLCSKAMREPVQVSTCGHRFCDTCLQEFLSEGVFKCPEDQLPLDYAKIYPDPELEQQILALPIRCIHSEEGCRWTGQMKQLQGHFSTCAFNVIPCPNRCAVKLTRRDLPEHLQHDCPKRKVKCEFCGSEFTGEAFENHQGICPQESVYCENKCGARMMRRLLAQHTMAECPKRTQPCKYCGKEFVYDTIQNHQYHCPRFPVQCPNQCGTPNIAREDLATHVKESCGSALVLCPFKDAGCKHRCPKLAIGRHLEETTKSHLTMMC--------------SLVGRQRQEIIELRREMEELSVSHDGVLIWKLNDYSRKLQEAKLHNNHEFFSPPFYTHRYGYKLQVSAFLNGNGSGEGSHLSIYIRVLPGEYDNLLEWPFAYKVTFSILDQ-SDPSLSKPQHITETFNPDPNWKN---FQKPSSSRNSLDESTLGFGYPKFISHDEIRKRNYIRDNAIFLKASIEIPQKI 468          
BLAST of TNF receptor-associated factor 4 vs. Ensembl Cavefish
Match: traf4b (TNF receptor-associated factor 4-like [Source:NCBI gene;Acc:103043275])

HSP 1 Score: 228.794 bits (582), Expect = 1.025e-67
Identity = 142/488 (29.10%), Postives = 232/488 (47.54%), Query Frame = 1
Query:  499 VDVIFIDPLEKKYACVVCDQVLRYPVQFDECGHHCCSSCLPELMRVAP-RCPIDQCHIERDKVYVDKEFQKEIDNLGVRCSFYQKGCIWTGVLKELSNHLESCLHRMITCPN---------------------------NCNVEFE---------------------------IRFLEKHKQDDCPKRIIQCQFCEASLIAEVEANHLKVCNKFPIPCPNGCKKKEILRENLAEHLESKCVKQEQDCPFSEYGCDFKGKKKRVREHLNDDFVSHLTLMCEAIKENTRIVEEQSKIITQYQTEVGTFEKRIESLEKLYGPQLIWKIDNYQEKFNEAKTGKKTT--IFSAPFMTSRFGYKMALSVCLYGDGKARGKHFSLFICICKGDYDSLLLWPFSHRITFTLIDQCQDPEARK--NVVYTVKPNTCKEN--APFLGRPTTDRNAS-------FGAQKFVELDVLNTLDYIRDDAIFIKAQVDCDEMI 1758
            +D  F++   +++ C +C + +R PVQ   CGH  C +CL E +     +CP DQ  ++  K++ D E +++I  L +RC   ++GC W+   K+L  HL +C + +++CPN                           +C++EF                             R L +H   +C KR + C++C    + +   +H   C +FP+ CPN C    I RE+L  H++  C      CPF E GC ++  K  V  HL D   SHL+L+C               ++ + + E+    +R+E L       L+WKI +Y  +  EA+T    +  +FS  F + R GY++ +S  L G+G   G + S++I +  G+YD LL WPF +R+TF+L+DQ  DP   K  ++V +  P+   +N   P  G   + R  S       FG  KF+  + +   +YIRD+AIFI+A +D  + I
Sbjct:    4 LDYKFLERPRRRFLCPLCSKPMREPVQVSTCGHRFCDTCLQEFLSEGVFKCPEDQLPLDYAKIFPDVELEQQILALPIRCIHSEEGCRWSAQNKQLQAHLSACAYNVVSCPNRCSVKLLRRDLLDHLQHDCSKRKLRCDHCSLEFTGEAHERHQDACPEESVYCENKCGARMVRRLLAQHTLSECSKRKLPCKYCNKEFLYDTIQHHQNQCPRFPVQCPNKCGTPGIAREDLMTHVKESCGTAMVFCPFKEAGCKYRCIKPAVPHHLEDATHSHLSLLC--------------GLVNRQRLELRDLRRRVEELSGSQDGVLLWKIPDYCRRLQEARTRTTGSAELFSPAFYSHRHGYRLQVSAFLNGNGSGEGSYLSIYIRVLPGEYDGLLEWPFPYRVTFSLLDQ-SDPALSKPQHIVESFSPDPNWKNFQRPQPGAMGSIRAGSLDESMLGFGYPKFISHEQMRKRNYIRDNAIFIQASIDVVQRI 476          
BLAST of TNF receptor-associated factor 4 vs. Ensembl Cavefish
Match: traf2a (TNF receptor-associated factor 2-like [Source:NCBI gene;Acc:103036375])

HSP 1 Score: 189.889 bits (481), Expect = 1.751e-53
Identity = 139/487 (28.54%), Postives = 219/487 (44.97%), Query Frame = 1
Query:  451 QIKNPPIITNSNNQNDVDVIFIDPLEKKYACVVCDQVLRYPVQFDECGHHCCSSCLPELMRVAPRCPIDQCHIERDKVYVDKEFQKEIDNLGVRCSFYQKGCIWTGVLKEL-SNHLESCLHRMITCPNNCNVEFEIRFLEKHKQDDCPKRIIQCQFCEASLIAEVEANHLKVCNKFPIPCPNGCKKKEILRENLAEHLESKCVKQEQDCPFSEYGCDFKGKKKR------VREHLNDDF--------VSHLTLMCEAIK------EN-----TRIVEEQSKIITQY-------QTEVGTFEKRIESLEKLYGPQ----------------------LIWKIDNYQEKFNEAKTGKKTTIFSAPFMTSRFGYKMALSVCLYGDGKARGKHFSLFICICKGDYDSLLLWPFSHRITFTLIDQCQDPEARKNVVYTVKPNTCKENAPFLGRPTTDRNASFGAQKFVELDVLNTLD-YIRDDAIFIKAQVD 1743
            Q  +PP     N       I  + LE K+ C +C ++LR P Q  +CGH           R +P              + D   ++E++ L   C    +GC WTG +KE  + H   C   +I CP+ C        LE+H + +CP+R + C++C+     +    H ++C K+P+ C  GC KK+I RE   +H++  C K    C F   GCD    K +       R+ L   F        V+ L+  C+ ++      EN      R +E  +  +  Y       Q ++     ++  LE+  G +                       +WKI ++ +K  +A  G+   +FS  F TS++GYKM L + L GDG  RG H SLF  + +G  D+LL WPF+ ++T  L+DQ      R++++   +P+    +     RP +D N + G   F  L  L++ + YIRDD IFIKA VD
Sbjct:    4 QEPSPPSSLEGNKPGFPRKILANKLEDKHLCNICQKILRRPFQ-AQCGH-----------RFSP-----------ASAFPDNAAKREVEALEAVC--INEGCSWTGTIKEYEATHEGQCDFMIIPCPS-CKELLRANELERHNERECPERTLNCKYCKEPFHFKNIKAHDEICPKYPMIC-EGCAKKKIPREKYVDHIKL-CTKFRTPCRFHVVGCDMSVSKPQWNLILTPRDLLYTSFTVPLSQTKVAELSRRCQELELKVGTFENIVCVLNREMERSATTMEAYNRQHRLDQDKIEILNNKVRQLERTVGLRDLSIVEMEGKMREMSAATYDGVFVWKISDFSKKRQDAVAGRAPAMFSPAFYTSKYGYKMCLRIYLNGDGTGRGTHLSLFFVVMRGHSDALLKWPFNQKVTLMLLDQ----NNREHIIDAFRPDISSSS---FQRPVSDMNIASGCPLFCPLSKLDSKNSYIRDDTIFIKAIVD 455          
BLAST of TNF receptor-associated factor 4 vs. Ensembl Cavefish
Match: traf6 (TNF receptor associated factor 6 [Source:NCBI gene;Acc:103021325])

HSP 1 Score: 150.599 bits (379), Expect = 7.599e-39
Identity = 128/473 (27.06%), Postives = 211/473 (44.61%), Query Frame = 1
Query:  457 KNPPIITNSN----NQNDVDVIFIDPLEKKYACVVCDQVLRYPVQFDECGHHCCSSCLPELMR-VAPRCPIDQCHIERDKVYVDKEFQKEIDNLGVRCSFYQKGCIWTGVLKELSNHLESCLHRMITCPNNCNVEFEIRFLEKHKQDDCPKRIIQCQFCEASLI-AEVE-ANHLKV-CNKFPIPCPN---GCKKKEILRENLAEHLES------------------------------KCVKQEQDCPFSEYGCDFKGKKKRVREHLNDDFVSHLTLMCEAIKENTRIVEEQSKIITQYQTEVGTFEKRIESLE-KLYGPQLIWKIDNYQEKFNEAKTGKKTTIFSAPFMTSRFGYKMALSVCLYGDGKAR-GKHFSLFICICKGDYDSLLLWPFSHRITFTLIDQCQDPEARKNV-VYTVKPNTCKENAPFLGRPTTDRNA-SFGAQKFVELDVLNTLDYIRDDAIFIKAQV 1740
            +NP  ++ S     +Q   DV F  PLE KY C +C   LR  VQ   CGH  C+ C+ + +R    +CP+D   +  D+++ D   ++EI +L VRC     GC+    L+ L NH+  C    + CP  C        LE+H   +C  R+I C  C  ++I AE + A+H    C K P+ C     GC++K +LR +LA H++                                           E  C    + +++RE + +   S L      ++E +   E QS  +T+ + ++ + E+ +  L+ + Y    +W+++ +       + G    + S PF T R GYK+ L + L      R   + SLF+   +G++DS L WP    I   ++DQ    E + +V V   KP+          RPT  RN   FG   F++L  L+   ++RDD + ++ +V
Sbjct:   38 ENPSTLSVSPSLQPDQQGYDVDFDPPLESKYECPICLMGLRSAVQ-TPCGHRFCNCCIRKSIRDTGQKCPVDNEVLTEDQLFPDNFAKREILSLTVRCR--NVGCMEKMELRHLENHIPHCKFATVPCPQ-CQESVWKSELEEHINQECSHRLITCPDCAENIIYAEKQLASHCDTDCLKAPVACTFSIFGCREK-MLRNDLALHMQEFTQMHMRYMADVLRNQTINGLISSHSASAASPTDSRGASSRPEGACQCNQELQQMRETVLE-LESRLVRQDHKLRELSIRNETQSTQMTELRKKLASLEESMRELQAQQYQGVYVWRLEGFSTHIRNQEAGHPVVLHSPPFYTGRPGYKLCLRLHLQTPNAPRCSNYISLFVHTMQGEFDSQLSWPLQGTIRLAVLDQA---EGQHHVEVMETKPDL-----QAFQRPTVQRNPKGFGYVTFMQLQALHQRGFVRDDVLMVRCEV 496          
BLAST of TNF receptor-associated factor 4 vs. Ensembl Cavefish
Match: traf6 (TNF receptor associated factor 6 [Source:NCBI gene;Acc:103021325])

HSP 1 Score: 144.05 bits (362), Expect = 2.010e-36
Identity = 127/497 (25.55%), Postives = 209/497 (42.05%), Query Frame = 1
Query:  457 KNPPIITNSN----NQNDVDVIFIDPLEKKYACVVCDQVLRYPVQFDECGHHCCSSCLPELMR-VAPRCPIDQCHIERDKVYVDKEFQKEIDNLGVRCSFYQKGCIWTGVLKELSNHLESCLHRMITCPNNCNVEFEIRFLEKHKQDDCPKRIIQC--------------------------QFCEASLIAEVEANHLKV-CNKFPIPCPN---GCKKKEILRENLAEHLES------------------------------KCVKQEQDCPFSEYGCDFKGKKKRVREHLNDDFVSHLTLMCEAIKENTRIVEEQSKIITQYQTEVGTFEKRIESLE-KLYGPQLIWKIDNYQEKFNEAKTGKKTTIFSAPFMTSRFGYKMALSVCLYGDGKAR-GKHFSLFICICKGDYDSLLLWPFSHRITFTLIDQCQDPEARKNV-VYTVKPNTCKENAPFLGRPTTDRNA-SFGAQKFVELDVLNTLDYIRDDAIFIKAQV 1740
            +NP  ++ S     +Q   DV F  PLE KY C +C   LR  VQ   CGH  C+ C+ + +R    +CP+D   +  D+++ D   ++EI +L VRC     GC+    L+ L NH+  C    + CP  C        LE+H   +C  R+I C                          ++C   LI    A+H    C K P+ C     GC++K +LR +LA H++                                           E  C    + +++RE + +   S L      ++E +   E QS  +T+ + ++ + E+ +  L+ + Y    +W+++ +       + G    + S PF T R GYK+ L + L      R   + SLF+   +G++DS L WP    I   ++DQ    E + +V V   KP+          RPT  RN   FG   F++L  L+   ++RDD + ++ +V
Sbjct:   38 ENPSTLSVSPSLQPDQQGYDVDFDPPLESKYECPICLMGLRSAVQ-TPCGHRFCNCCIRKSIRDTGQKCPVDNEVLTEDQLFPDNFAKREILSLTVRCR--NVGCMEKMELRHLENHIPHCKFATVPCPQ-CQESVWKSELEEHINQECSHRLITCPDCAENIIYAEKQFHEQLCLFANTVCEYCNMELIRNQLASHCDTDCLKAPVACTFSIFGCREK-MLRNDLALHMQEFTQMHMRYMADVLRNQTINGLISSHSASAASPTDSRGASSRPEGACQCNQELQQMRETVLE-LESRLVRQDHKLRELSIRNETQSTQMTELRKKLASLEESMRELQAQQYQGVYVWRLEGFSTHIRNQEAGHPVVLHSPPFYTGRPGYKLCLRLHLQTPNAPRCSNYISLFVHTMQGEFDSQLSWPLQGTIRLAVLDQA---EGQHHVEVMETKPDL-----QAFQRPTVQRNPKGFGYVTFMQLQALHQRGFVRDDVLMVRCEV 520          
BLAST of TNF receptor-associated factor 4 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000074.1 (pep scaffold:Pmarinus_7.0:GL482142:165593:173010:-1 gene:ENSPMAG00000000066.1 transcript:ENSPMAT00000000074.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 145.591 bits (366), Expect = 5.687e-38
Identity = 106/366 (28.96%), Postives = 161/366 (43.99%), Query Frame = 1
Query:  733 CSFYQKGCIWTGVLKELSNHLESCL--HRMITCPNNCNVEFEIRFLEKHKQDDCPKRIIQCQFCEASLIAEVEANHLKVCNKFPIPCPNGCKKKE----ILRENLAEHLESKCVKQEQDCPFSEYGCDFKGKKKRVREHLNDDFVS--HLTLMCEAIKEN----------TRIVEEQSKI------ITQYQTEVGTFEKRIESLEKL-YGPQLIWKIDNYQEKFNEAKTGKKTTIFSAPFMTSRFGYKMALSVCLYGDGKARGKHFSLFICICKGDYDSLLLWPFSHRITFTLIDQCQDPEARKNVVYTVKPNTCKENAPFLGRPTTDRNASFGAQKFVELDVLNTLDYIRDDAIFIKAQVDCDEM 1755
            C F Q GC + G L+ L  H       H  +    + N+E ++  L             Q Q  E +  A++    ++   K  I       K E    +++  LA   E     QE     S  G   +     +R  L+    +   L     AI+E+          TR+    S +      +  + T +   + R + LE   Y  +L+WKI +Y  +  +A +G+  +++S PF TS FGY+M     L GDG  RG H SLF  + +G+YD+LL WPF  R+T TL+DQ     AR+ +  T KP+    +     RPT+D N + G   FV    L +  Y++DD IFIK  VD  E+
Sbjct:  133 CFFSQFGCKYKGTLQGLKEHESGATQQHLSLVTARSANLELKVSML-------------QSQLAERANSADLLGTRVRELEKELISVGQTASKNESVLCVVQRMLAVQTERLLRLQE-----SMQGTTRRADHDALRGDLDGTAATLHELGTRVAAIEESGGSVTHSSTPTRLAALDSALSRHDTQLFAHDTRLAEMDLRFQVLETASYNGKLVWKIRDYARRKQDAVSGRTLSLYSQPFYTSPFGYRMCARAYLNGDGVGRGTHLSLFFVVMRGEYDALLPWPFRQRVTLTLLDQ---GAARRQLSDTFKPDPASSS---FRRPTSDMNIASGCPLFVSHVALESASYLQDDTIFIKVVVDTGEL 474          

HSP 2 Score: 89.7373 bits (221), Expect = 3.069e-19
Identity = 53/165 (32.12%), Postives = 86/165 (52.12%), Query Frame = 1
Query:  679 KVYVDKEFQKEIDNLGVRCSFYQKGCIWTGVLKELSNHLESCLHRMITCPNNCNVEFEIRF-LEKHKQDDCPKRIIQCQFCEASL-IAEVEANHLKVCNKFPIPCPNGCKKKEILRENLAEHLESKCVKQEQDCPFSEYGCDFKGKKKRVREHLNDDFVSHLTLM 1167
            +V+ D   ++EI  L V C     GC     L +L  H+  C+H  + CP+    E  +R  L  H    C  R   C++C   + +AE   ++   C ++PIPCPN C+++ I RE L  HL   C  ++ +C FS++GC +KG  + ++EH +     HL+L+
Sbjct:    1 QVFRDNCCRREILALRVHCRNDTAGCKQIVELGKLQEHMAVCVHEAVNCPHAGCTERLLRGELVNHVALGCHFRTESCRYCNQQVPLAEKRKHYETRCPRYPIPCPNKCEEQSIAREELVSHL-GICPYKQAECFFSQFGCKYKGTLQGLKEHESGATQQHLSLV 164          
BLAST of TNF receptor-associated factor 4 vs. Ensembl Sea Lamprey
Match: traf6 (TNF receptor-associated factor 6 [Source:NCBI gene;Acc:554561])

HSP 1 Score: 134.806 bits (338), Expect = 9.479e-34
Identity = 123/522 (23.56%), Postives = 201/522 (38.51%), Query Frame = 1
Query:  511 FIDPLEKKYACVVCDQVLRYPVQFDECGHHCCSSCLPELMRV---APRCPIDQCHIERDKVYVDKEFQKEIDNLGVRCSFYQKGCIWTGVLKELSNHLESCLHRMITCPNNCNVEFEIRFLEKHKQDDCPKRII--------------------------QCQFCEASLIAEVEANHLKV-CNKFPIPC---PNGCKKK-------------------------EILRENLAEHLESKCVKQEQDCPFS-------------------------EYGCDFKGKKKRVREHLNDDFVSHLTLMCEAIKENTRIVEEQSKIITQYQTEVGTFEKRI-ESLEKLYGPQLIWKIDNYQEKF----------NEAKTGKKTTIFSAPFMTSRFGYKMAL-----------------SVCLYGDGKARGKHFSLFICICKGDYDSLLLWPFSHRITFTLIDQCQDPEARKNVVYTVKPNTCKENAPFLGRPTTDRNA-SFGAQKFVELDVLNTLDYIRDDAIFIKAQV 1740
            F  PLE KY C +C   LR PVQ   CGH  C +C+   MR+    P+CP+D   +   +++ D   ++EI +L VRC    K C   G L+ L  H   C +  + C   C +    R L KH++ +C +RI+                           C+ C+  LI E    HL+V C +  +PC   P GC+ +                         +ILR  + +  +          P S                            CD   +  R+RE +       + L    I+E +   + Q  ++ +    V + E R+ ES  +L      W+++ +              +         + S+ F T   GY++ L                 SV L G    R  H +LF+ + +GDYD  L WPF  RI  +++DQC+     ++ V+  +            RP+  RN   FG   F++++ L+   Y+RDD + ++ +V
Sbjct:   55 FEPPLESKYECPICLMALREPVQ-TPCGHRFCRACILHSMRLRDAGPKCPVDNAVLHEGQLFPDNFAKREILSLTVRCP--NKPCGHRGELRALQEHQLRCEYAQVPC-VRCEMPVCRRDLAKHEEQECMRRIVTCLHCCEKMAYKDSKNHEQMCPLVVVNCKHCQQELIREQLGPHLEVDCQQAQVPCTFSPLGCEAQMVRSLLAAHMHEHTQVHMRLLANGLKILRIQVGQGAQPSSAAGSSAPPNSLSWLSSTSGGDVQTAGASRSQGSRDRAACDCAQELDRLRE-ITRTLEERVVLQLHQIRELSAKTDNQQGLLAEATRLVRSLEARVAESESRLCAGIFTWRVERFSRLLPGGLASGFASDGMHPDAPAVMHSSGFYTGVPGYRLCLRLQVLSGREVPAGAASPSVLLAG----RQPHLALFVHLLQGDYDHRLPWPFKGRIRISVVDQCE-----RDSVHVTEMMDADPQLSAFQRPSVHRNPKGFGYMNFMDINTLHHRSYLRDDCLVVRCEV 562          
BLAST of TNF receptor-associated factor 4 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002130.1 (pep scaffold:Pmarinus_7.0:GL484662:8457:12718:-1 gene:ENSPMAG00000001936.1 transcript:ENSPMAT00000002130.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 131.339 bits (329), Expect = 1.737e-33
Identity = 66/176 (37.50%), Postives = 98/176 (55.68%), Query Frame = 1
Query: 1219 ITQYQTEVGTFEKRIESLEKL-YGPQLIWKIDNYQEKFNEAKTGKKTTIFSAPFMTSRFGYKMALSVCLYGDGKARGKHFSLFICICKGDYDSLLLWPFSHRITFTLIDQCQDPEARKNVVYTVKPNTCKENAPFLGRPTTDRNASFGAQKFVELDVLNTLDYIRDDAIFIKAQVD 1743
            +T +   + T E+R++ LE   Y  +L+WKI +Y  +  EA +G+  +++S PF TS FGYKM     L GDG  RG H SLF  + +G+YD+LL WPF  R+T +L+DQ     AR+++  T  P+    +     RP  D N + G   FV    L    Y+ DD +F++  VD
Sbjct:  244 LTMHDGLLDTAERRLQVLETAGYSGKLVWKIRDYARRKQEAASGRTLSLYSQPFYTSPFGYKMCARAYLNGDGVGRGTHLSLFFVVMRGEYDALLEWPFRRRVTLSLLDQ---GAARRHLSDTFTPDPASGS---FRRPDGDMNVASGCPLFVSHVALEGSSYLVDDTVFVRVVVD 413          

HSP 2 Score: 73.9442 bits (180), Expect = 2.572e-14
Identity = 49/175 (28.00%), Postives = 78/175 (44.57%), Query Frame = 1
Query:  802 CLHRMITCP-NNCNVEFEIRFLEKHKQDDCPKRIIQCQFCEASLIAEV-EANHLKVCNKFPIPCPNGCKKKEILRENLAEHLESKCVKQEQDCPFSEYGCDFK-GKKKRVREHLNDDFVSHLTLMCEAIKENTRI----------VEEQSKIITQYQTEVGTFEKRIESLEKLYG 1287
            C H  + C    C    +   L  H+   CP R   C++C A++   + E +H + C ++P+PCPN C++  I R  L++H+ S C    + C F   GC FK G  + VREH      SH TL+   I  N+ +          +E+ + +       V   E+ +     L G
Sbjct:    1 CPHERVLCDFPRCGTSVQRTRLAAHRAS-CPHRAEFCKYCSAAVTCSLLERHHKEECAQYPLPCPNNCEEHGIPRAELSQHM-SACAMSTKLCGFHMLGCTFKQGTSESVREHEESAVRSHFTLV---ISRNSELELQCARLQCSIEDHTNMSEMLTQRVAQLEQDLSHWSTLTG 170          
BLAST of TNF receptor-associated factor 4 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008091.1 (pep scaffold:Pmarinus_7.0:GL477915:34322:50582:-1 gene:ENSPMAG00000007312.1 transcript:ENSPMAT00000008091.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 96.2857 bits (238), Expect = 1.229e-21
Identity = 94/403 (23.33%), Postives = 148/403 (36.72%), Query Frame = 1
Query:  532 KYACVVCDQVLRYPVQFDECGHHCCSSCLPELMRVAPRCPIDQCHIERDKVYV------DKEFQKEIDNLGVRCSFYQKGCIWTGVLKELS-NHLESCLHRMITCPNNCNVEFEIRF-LEKHKQDDCPKRIIQCQFCEASLIAEVEANHLKVCNKFPIPCPNGCKKKEILRENLAEHLESKCVKQEQDCPFSEYGCDFKGKKKRVREHLNDDFVSHLTLMCEAIKE-----------------NTRIVEEQSKIIT----------------------------------QYQTEVGTFE--------------KRIESLEK-LYGPQLIWKIDNYQEKFNEAKTG--KKTTIFSAPFMTSRFGYKMALSVCLYGDGKARGKHFSLFICICKGDYDSLLLWPF 1512
            ++AC  C  +LR  VQ   CGH  C  C+  L+    R   D        VY       D   ++E+  L VRC    +GC W G L E    H+E C   ++ C          R  L +H   +C  R + C  C   L       H   C          C +K I  +    H E +C+K    CP+S  GC ++G  + +  H  +    HL ++ +A K+                 + R+V  ++++ T                                  + Q ++   E              +R+  LE   Y    +WKI +   +  EA  G  +   I S  F T+R+GY++ L +C  G+      H S +  +  G YD+ L WP+
Sbjct:    2 RFACGSCQGLLRDAVQ-THCGHRFCKPCIARLITSVHRSCNDTLMNSNFLVYSPTQFFPDAALRREMGVLPVRC--VSEGCEWRGRLLEYDVAHVERCDWVLVPCLLAGCALLLPRAELHRHVAQECSVRPVPCAACAQLLPYRQLQKHQLHCRSRRTRECKLCGQKSIPEDKWQHHEERRCMKNRDTCPYSPLGCLYRGHGESLHNHDKNSVEVHLAIVYDAFKKTFEQLIKGHADNIKHPPSARLVAAEAQLATMDRRVEEVAKRVERDVRVSEASTRQGNIDRDETARLQNKMARVEHSDQETERSILGLTRRLAELENTAYNGMFLWKIKHVINRLREAGNGAERPPQIDSPAFFTTRYGYRLRLRLCRSGE------HVSAYAMLGPGPYDATLAWPY 395          
BLAST of TNF receptor-associated factor 4 vs. Ensembl Nematostella
Match: EDO32851 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7STV5])

HSP 1 Score: 347.051 bits (889), Expect = 9.339e-114
Identity = 164/424 (38.68%), Postives = 257/424 (60.61%), Query Frame = 1
Query:  508 IFIDPLEKKYACVVCDQVLRYPVQFDECGHHCCSSCLPELMRVAPRCPIDQCHIERDKVYVDKEFQKEIDNLGVRCSFYQKGCIWTGVLKELSNHLESCLHRMITCPNNCNVEFEIRFLEKHKQDDCPKRIIQCQFCEASLIAEVEANHLKVCNKFPIPCPNGCKKK-EILRENLAEHLESKCVKQEQDCPFSEYGCDFK-------GKKKRVREHLNDDFVSHLTLMCEAIKENTRIVEEQSKIITQYQTEVGTFEKRIESLEKLYGPQLIWKIDNYQEKFNEAKTGKKTTIFSAPFMTSRFGYKMALSVCLYGDGKARGKHFSLFICICKGDYDSLLLWPFSHRITFTLIDQCQDPEARKNVVYTVKPNTCKENAPFLGRPTTDRNASFGAQKFVELDVLNTLDYIRDDAIFIKAQVDCDEM 1755
            +F+ PL+KKY C+ C+ +L YPVQ   CGH  C+ C  +L+  + RCP     +  +   +DK F +EI  L V+C   +  C W G + E S+H+E C +  I C N+C  +F+ RFL KH   DCP+++I C +C+   + + +  HL+ C   P PCPN C KK  I R  L  H+E+ C + +  C +   GC  +       G ++++ +H   + ++H+ ++ +   +N  ++   S+ ++++ T +   EKR+  LEK+   QLIW+I++Y  K  EAK G   T+FS  F TS+ GY++  SVCL GDGK +G H S+FI + KG +D+LL WPF +R+TF L+DQ  DP  RK++ +++KPN C +N PFLGRP  ++NASFG  KF + + + + +YI++D IF+K  VDCD +
Sbjct:   34 LFVYPLQKKYICLDCEGLLWYPVQIKPCGHRVCTKCYTKLLSSSARCPGCMDELNENIPDIDKAFHEEIQELDVKCRNVEWNCKWEGCVNEFSSHVEKCDYSDILCENDCGAKFQRRFLTKHLDKDCPEKLITCLYCDEKHLRKDKKGHLENCPLLPCPCPNKCDKKLTIHRCELDSHVENDCPRTKLMCEYEVLGCGHRITGLEGGGSREKMPKHNKTNIIAHVKMVADLALKNKELIMRFSEKLSEHGTLIEKHEKRLNDLEKIAHSQLIWRIEDYTRKMKEAKAGNTDTLFSPTFTTSKHGYRLCASVCLNGDGKGKGTHMSVFISVLKGAFDALLKWPFDYRVTFVLLDQNDDPAQRKHIRFSIKPNPCADNEPFLGRPRLEKNASFGGAKFAKHEEIVSRNYIKEDTIFLKISVDCDGL 457          
BLAST of TNF receptor-associated factor 4 vs. Ensembl Nematostella
Match: EDO32849 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7STV3])

HSP 1 Score: 317.39 bits (812), Expect = 3.404e-102
Identity = 149/412 (36.17%), Postives = 244/412 (59.22%), Query Frame = 1
Query:  526 EKKYACVVCDQVLRYPVQFDECGHHCCSSCLPELMRVA-PRCPIDQCHIERDKVYVDKEFQKEIDNLGVRCSFYQKGCIWTGVLKELSNHLESCLHRMITCPNNCNVEFEIRFLEKHKQDDCPKRIIQCQFCEASLIAEVEANHLKVCNKFPIPCPNGCKKK-EILRENLAEHLESKCVKQEQDCPFSEYGCDFKGKKKRVREHLNDDFVSHLTLMCEAIKENTRIVEEQSKIITQYQTEVGTFEKRIESLEKLYGPQLIWKIDNYQEKFNEAKTGKKTTIFSAPFMTSRFGYKMALSVCLYGDGKARGKHFSLFICICKGDYDSLLLWPFSHRITFTLIDQCQDPEARKNVVYTVKPNTCKENAPFLGRPTTDRNASFGAQKFVELDVLNTLDYIRDDAIFIKAQVDCDEM 1755
            E+K+ C VC+ +   PVQ  ECGH  C  C   + R   P+CP     ++     VD+ F+ +++ L  RC  ++ GC       ++  H   C +  I C N+C  +F+ RF +KH   DCPK+II C +C+   + E +  HL+ C   P+PCPN C K   I R  L EH+E +C + +  C F   GC  +  ++++ +H+  + + H+ ++   + E    ++  ++   +++T +   + R+  LEK+   Q+IW+I++Y  K  EAK G   T+FS  F TS+ GY++  SVCL GDGK +G H S+F+ + KG +D+LL WPF +R+TF L++Q ++PE RK+V +++KPN   +N PFLGRP  ++NASFG  KF++ + + + ++I+DD +F+K  VDCD +
Sbjct:   50 ERKHLCPVCEDIFVSPVQIKECGHRLCQHCYKTIWRSPEPKCPKCSGDLDDKIPDVDQAFENDMNELPCRCINHEWGCKVEVPFTQMITHKGECEYSDILCDNDCGAKFQRRFKQKHLDKDCPKKIISCPYCDDRHLRENKKEHLEDCLLIPLPCPNKCDKTLTIPRGQLDEHIEKECPRAKLMCEFESLGCQHRCSREKMAKHMKSEIIGHVKMIFGVVLEQKEKLDNHAQKFEEHETIMKQVDSRVGDLEKIAHSQIIWRIEDYTRKLKEAKAGNAETLFSPTFTTSKHGYRLCASVCLNGDGKGKGTHMSVFVSVLKGAFDALLKWPFHYRVTFFLLNQHENPEERKHVKFSIKPNPIPDNEPFLGRPRLEKNASFGGAKFIKHEEIESGNFIKDDTVFLKVSVDCDGL 461          
BLAST of TNF receptor-associated factor 4 vs. Ensembl Nematostella
Match: EDO49545 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGK7])

HSP 1 Score: 266.929 bits (681), Expect = 1.652e-83
Identity = 151/417 (36.21%), Postives = 221/417 (53.00%), Query Frame = 1
Query:  511 FIDPLEKKYACVVCDQVLRYPVQFDECGHHCCSSCLPELMRVAPR---CPIDQCHIERDKVYVDKEFQKEIDNLGVRCSFYQKGCIWTGVLKELSNHLESCLHRMITCPN-NCNVEFEIRFLEKHKQDDCPKRIIQCQFCEASLIAEVEANHLKVCNKFPIPCPNGCKKKEILRENLAEHLESKCVKQEQDCPFSEYGCDFKGKKKRVREHLNDDFVSHLTLMCEAIKENTRIVEEQSKIITQYQTEVGTFEKRIESLEKLYGPQLIWKIDNYQEKFNEA-KTGKKTTIFSAPFMTSRFGYKMALSVCLYGDGKARGKHFSLFICICKGDYDSLLLWPFSHRITFTLIDQCQDPEARKNVVYTVKPNTCKENAPFL-GRPTTDRNASFGAQKFVELDVLNTLDYIRDDAIFIKAQVD 1743
            F++PL ++Y C +C    R P+Q +ECGH  C SCL EL R+      CP+D+  I   KV+VDK  ++ I  LGV+C  +++ C WTG L  +  H ++C H  + C N  CN     R L+ H    C  RI+ C FC      +    H+K C + PI C N C  K+I RE +  H+ S+C      C + + GC FKG++  + EH  +   +HL + C+ I+EN     E   + T      G F               +WKI NY+ ++++A  + ++  IFS PF TS++GYK+ L   L G  + +G H SL+I I KGDYD+LL WPF  +ITF LIDQ    E + +  + + PN    N   +  RPT   N   G   FV  +VL + +Y++DD +FIKA V+
Sbjct:   16 FVEPLPEEYECPICQLAFRDPIQIEECGHRFCQSCLQELRRLQGSPVLCPMDRRPISSTKVFVDKAARRAILGLGVKCWNWKRKCEWTGELSNIEEHAKNCAHEDVHCTNPECNEVMPRRSLQYHLVSKCKWRIVSCHFCTEMYTYKDGKTHMKSCKRLPIECVNKCGAKDIPREEMPFHM-SECPLAVHPCMYRDIGCPFKGRRDALEEHCKNAVHTHLNIACQKIREN-----ESRSLCTN-----GIF---------------LWKISNYKHQYDQAVASPEELAIFSPPFYTSQYGYKLRLKAYLNGRDRGKGTHLSLYIIIMKGDYDALLEWPFKQKITFYLIDQ---SEKQNHRTHLLSPNRSLPNIKVVFNRPTVKENLGIGNPCFVPNEVLESGEYVKDDVMFIKAVVE 403          
BLAST of TNF receptor-associated factor 4 vs. Ensembl Nematostella
Match: EDO45915 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRA4])

HSP 1 Score: 256.144 bits (653), Expect = 3.667e-79
Identity = 137/417 (32.85%), Postives = 219/417 (52.52%), Query Frame = 1
Query:  502 DVIFIDPLEKKYACVVCDQVLRYPVQFDECGHHCCSSCLPELMR-VAPRCPIDQCHIERDKVYVDKEFQKEIDNLGVRCSFYQKGCIWTGVLKELSNHLE-SCLHRMITCPNNCNVEFEIRFLEKHKQDDCPKRIIQCQFCEASLIAEVEANHLKVCNKFPIPCPNGCKKKEILRENLAEHLESKCVKQEQDCPFSEYGCDFKGKKKRVREHLNDDFVSHLTLMCEAIKENTRIVEEQSKIITQYQTEVGTFEKRIESLEKLYGPQLIWKIDNYQEKFNEAKTGKKT-TIFSAPFMTSRFGYKMALSVCLYGDGKARGKHFSLFICICKGDYDSLLLWPFSHRITFTLIDQCQDPEARKNVVYTVKPNTCKENAPFLGRPTTDRNASFGAQKFVELDVLNTLDYIRDDAIFIKAQVD 1743
            +V F+ PL+K + C VC   LR PVQ   CGH  C +C+  ++R   PRCP+D   +   K++ D    ++I ++ + C  +  GC W G + +L  HLE  C    + CP +C    E   LE H   +C +R++ C  C   ++      HL+ C  FPI CP  C  K++ +E LA HL  +C      C F+E GC FK K++++  H+ +   SH+ ++C+ + E    +  Q + +   +  +    + +E   +    + IWKI  +  K  +AKTG+ +  + S  F TS  GYKM   V L G G  RG++ S+ + +  G++DS+L WP   R TFTL+DQ +D + +++VV T +P +       + RP+ DR    GA++FV  D +    Y +D+ IFIK  V 
Sbjct:    5 EVRFVVPLDKSFECPVCLMALRDPVQVTPCGHRVCQTCIKPIIRNRRPRCPLDNLTLNVGKIFPDNACHRQILSMDILCPHHGDGCEWQGTISDLEKHLERGCNLSEVRCPKDCGASVERGKLEGH-YPECSRRLVNCTHCNKEVVFADMNVHLQSCASFPISCPLTCGAKDLTKEALAVHLNQECPLLVIPCRFAEAGCTFKAKRQKMAAHVQESLTSHVAMLCDLVCEQKLQISAQKERLLLQKEHIQL--QIVECRSRCANGEFIWKIQCFSRKLMDAKTGRASEPMISEAFYTSPHGYKMCAGVWLNGIGTGRGRYISVGLQVQSGEFDSILKWPLYPRYTFTLLDQSEDTKTKRDVVATFEPQS-------ISRPSADRQLGKGARRFVLQDEVCGTTYCKDNTIFIKFSVS 411          
BLAST of TNF receptor-associated factor 4 vs. Ensembl Nematostella
Match: EDO40665 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S6K0])

HSP 1 Score: 221.09 bits (562), Expect = 2.777e-66
Identity = 141/454 (31.06%), Postives = 218/454 (48.02%), Query Frame = 1
Query:  409 LSSVS-IDSVGIFHNQIKNPPIITNSNNQNDVDVIFIDPLEKKYACVVCDQVLRYPVQFDECGHHCCSSCLPELMRVAPR-CPIDQCHIERDKVYVDKEFQKEIDNLGVRCSFYQKGCIWTGVLKELSNHLESCLHRMITCPNNCNVEFEIRFLEKHKQDDCPKRIIQCQFCEASLIAEVEANHLKVCNKFPIPCPNGCKKKEILRENLAEHLE--SKCVKQEQDCPFSEYGCDFKGKKKRVREHLNDDFVSHLTLMCEAIKENTRIVEEQSKIITQYQTEVGTFEKRIESLEKLYGPQLIWKIDNYQEKFNEAKTGK-KTTIFSAPFMTSRFGYKMALSVCLYGDGKARGKHFSLFICICKGDYDSLLLWPFSHRITFTLIDQCQDPEARKNVVYTVKPNTCKENAPFLGRPTTDRNASFGAQKFVELDVLNTLDYIRDDAIFIKAQVDCDEM 1755
            ++SVS ++   +F++     P + N       +  F+  +   Y C +C    R PVQ  +CGH  C SCL  ++R  P  CPID+  I RDKVY DK  ++ + +L V+C  +   C W G L  L              P+N +  +E+                         + +V   H++ C + PI C N C + +I RE +A H++    C      C +S+ GC  K K+  + +HL D   SHL +    I+E   + + Q KI T      G F               +WKI NY + F ++ T K K  + S PF T ++GYK+     L G G+ +G H SL++ I KGDYDS+L WPF  R+ F LIDQ  D  +R+N  + +   TC  N+ + GRP   ++  FG  KFV  + L + +++RD+ +FI  +V+  +M
Sbjct:    1 MASVSGLNQTALFNSN----PTVLNKKEAGGFEADFVCTIPPDYQCPICQLPFRDPVQTRDCGHRFCESCLEPILRKPPAFCPIDRRCISRDKVYPDKACKRTVLSLTVKCPNHVTDCEWVGELGNL--------------PSNSSNSYEV-------------------------LVKV---HIEACKRVPIKCVNNCGRTDIAREEMAVHIDVDGDCPLATVPCKYSDVGCKTKVKRIEMEKHLQDSMASHLDMAHIRIRE---LEQRQEKICTN-----GKF---------------LWKISNYTQLFQQSATKKEKEKLCSPPFYTGQYGYKLRAEAFLNGLGQGKGTHLSLYVVIMKGDYDSVLPWPFQQRVDFILIDQDDDFTSRQNKTWRL---TCDRNSDYFGRPNKAKSLGFGCPKFVSQETLKSRNFVRDNTVFIMIEVEPLDM 382          
BLAST of TNF receptor-associated factor 4 vs. Ensembl Medaka
Match: traf4a (TNF receptor associated factor 4 [Source:NCBI gene;Acc:101161428])

HSP 1 Score: 251.521 bits (641), Expect = 2.237e-76
Identity = 144/482 (29.88%), Postives = 229/482 (47.51%), Query Frame = 1
Query:  502 DVIFIDPLEKKYACVVCDQVLRYPVQFDECGHHCCSSCLPELMRVAP-RCPIDQCHIERDKVYVDKEFQKEIDNLGVRCSFYQKGCIWTGVL---------------------------KELSNHLES---------------------------CLHRMITCPNNCNVEFEIRFLEKHKQDDCPKRIIQCQFCEASLIAEVEANHLKVCNKFPIPCPNGCKKKEILRENLAEHLESKCVKQEQDCPFSEYGCDFKGKKKRVREHLNDDFVSHLTLMCEAIKENTRIVEEQSKIITQYQTEVGTFEKRIESLEKLYGPQLIWKIDNYQEKFNEAKTGKKTTIFSAPFMTSRFGYKMALSVCLYGDGKARGKHFSLFICICKGDYDSLLLWPFSHRITFTLIDQCQDPEARK--NVVYTVKPNTCKENAPFLGRPTTDRNA------SFGAQKFVELDVLNTLDYIRDDAIFIKAQVDCDEMI 1758
            D  F++  ++++ C +C + +R PVQ   CGH  C +CL E +     +CP DQ  ++  K+Y D E +++I +L +RC   ++GC WTG +                           ++L +HL+                            C    + C N C      R L +H   +CPKR   C++C    + +   NH   C +FP+ CPN C    I RE+LA H++  C      CPF + GC  +  K  +  HL D   SHLT+MC               ++++ + E+    + +E L   +   LIWK+++Y  K  EAK       FS PF T R+GYK+ +S  L G+G   G H S++I +  G+YD+LL WPFS+++TF+++DQ  DP   K  ++  T  P+   +N     +P + RN+       FG  KF+  + +   +YIRD+ IFIKA ++  + I
Sbjct:    5 DYKFLEKPKRRFQCPLCSKAMREPVQVSTCGHRFCDTCLQEFLSEGVFKCPEDQLPLDYAKIYPDPELEQQILSLPIRCIHSEEGCRWTGQMKQLQGHFSTCAFNVIPCPNRCSVKLTRRDLPDHLQHDCPKRKVKCEFCGSEFTGEAFENHQGVCPQESVYCENKCGARMMRRLLSQHGMAECPKRTQPCKYCGKEFVFDTIQNHQFHCPRFPVQCPNQCGTPNIAREDLANHVKDNCGSALVLCPFKDAGCKHRCPKLAIGRHLEDTTKSHLTMMC--------------NLVSRQRQEILELRREMEELSVSHDGVLIWKLNDYSRKLQEAKLRSNHEFFSPPFYTHRYGYKLQVSAFLNGNGSGEGSHLSVYIRVLPGEYDNLLEWPFSYKVTFSILDQ-SDPSLSKPQHITETFNPDPNWKN---FQKPCSTRNSLDESTLGFGYPKFISHEEIKKRNYIRDNCIFIKASIEIPQKI 468          
BLAST of TNF receptor-associated factor 4 vs. Ensembl Medaka
Match: traf4a (TNF receptor associated factor 4 [Source:NCBI gene;Acc:101161428])

HSP 1 Score: 251.906 bits (642), Expect = 3.526e-76
Identity = 144/484 (29.75%), Postives = 230/484 (47.52%), Query Frame = 1
Query:  502 DVIFIDPLEKKYACVVCDQVLRYPVQFDECGHHCCSSCLPELMRVAP-RCPIDQCHIERDKVYVDKEFQKEIDNLGVRCSFYQKGCIWTGVL---------------------------KELSNHLES---------------------------CLHRMITCPNNCNVEFEIRFLEKHKQDDCPKRIIQCQFCEASLIAEVEANHLKVCNKFPIPCPNGCKKKEILRENLAEHLESKCVKQEQDCPFSEYGCDFKGKKKRVREHLNDDFVSHLTLMCEAIKENTRIVEEQSKIITQYQTEVGTFEKRIESLEKLYGPQLIWKIDNYQEKFNEAKTGKKTTIFSAPFMTSRFGYKMALSVCLYGDGKARGKHFSLFICICKGDYDSLLLWPFSHRITFTLIDQCQDPEARK--NVVYTVKPNTCKENAPFLGRPTTDRNA------SFGAQKFVELDVLNTLDYIRDDAIFIKAQVDCDEMINI 1764
            D  F++  ++++ C +C + +R PVQ   CGH  C +CL E +     +CP DQ  ++  K+Y D E +++I +L +RC   ++GC WTG +                           ++L +HL+                            C    + C N C      R L +H   +CPKR   C++C    + +   NH   C +FP+ CPN C    I RE+LA H++  C      CPF + GC  +  K  +  HL D   SHLT+MC               ++++ + E+    + +E L   +   LIWK+++Y  K  EAK       FS PF T R+GYK+ +S  L G+G   G H S++I +  G+YD+LL WPFS+++TF+++DQ  DP   K  ++  T  P+   +N     +P + RN+       FG  KF+  + +   +YIRD+ IFIKA ++  + I +
Sbjct:    5 DYKFLEKPKRRFQCPLCSKAMREPVQVSTCGHRFCDTCLQEFLSEGVFKCPEDQLPLDYAKIYPDPELEQQILSLPIRCIHSEEGCRWTGQMKQLQGHFSTCAFNVIPCPNRCSVKLTRRDLPDHLQHDCPKRKVKCEFCGSEFTGEAFENHQGVCPQESVYCENKCGARMMRRLLSQHGMAECPKRTQPCKYCGKEFVFDTIQNHQFHCPRFPVQCPNQCGTPNIAREDLANHVKDNCGSALVLCPFKDAGCKHRCPKLAIGRHLEDTTKSHLTMMC--------------NLVSRQRQEILELRREMEELSVSHDGVLIWKLNDYSRKLQEAKLRSNHEFFSPPFYTHRYGYKLQVSAFLNGNGSGEGSHLSVYIRVLPGEYDNLLEWPFSYKVTFSILDQ-SDPSLSKPQHITETFNPDPNWKN---FQKPCSTRNSLDESTLGFGYPKFISHEEIKKRNYIRDNCIFIKASIEIPQKIMV 470          
BLAST of TNF receptor-associated factor 4 vs. Ensembl Medaka
Match: traf4a (TNF receptor associated factor 4 [Source:NCBI gene;Acc:101161428])

HSP 1 Score: 239.195 bits (609), Expect = 7.528e-72
Identity = 141/482 (29.25%), Postives = 225/482 (46.68%), Query Frame = 1
Query:  502 DVIFIDPLEKKYACVVCDQVLRYPVQFDECGHHCCSSCLPELMRVA-PRCPIDQCHIERDKVYVDKEFQKEIDNLGVRCSFYQKGCIWTGVL---------------------------KELSNHLES---------------------------CLHRMITCPNNCNVEFEIRFLEKHKQDDCPKRIIQCQFCEASLIAEVEANHLKVCNKFPIPCPNGCKKKEILRENLAEHLESKCVKQEQDCPFSEYGCDFKGKKKRVREHLNDDFVSHLTLMCEAIKENTRIVEEQSKIITQYQTEVGTFEKRIESLEKLYGPQLIWKIDNYQEKFNEAKTGKKTTIFSAPFMTSRFGYKMALSVCLYGDGKARGKHFSLFICICKGDYDSLLLWPFSHRITFTLIDQCQDPEARK--NVVYTVKPNTCKENAPFLGRPTTDRNA------SFGAQKFVELDVLNTLDYIRDDAIFIKAQVDCDEMI 1758
            D  F++  ++++ C +C + +R PVQ   CGH  C +CL E + +  P   + Q       +Y D E +++I +L +RC   ++GC WTG +                           ++L +HL+                            C    + C N C      R L +H   +CPKR   C++C    + +   NH   C +FP+ CPN C    I RE+LA H++  C      CPF + GC  +  K  +  HL D   SHLT+MC               ++++ + E+    + +E L   +   LIWK+++Y  K  EAK       FS PF T R+GYK+ +S  L G+G   G H S++I +  G+YD+LL WPFS+++TF+++DQ  DP   K  ++  T  P+   +N     +P + RN+       FG  KF+  + +   +YIRD+ IFIKA ++  + I
Sbjct:    5 DYKFLEKPKRRFQCPLCSKAMREPVQVSTCGHRFCDTCLQEFLSIFFPMGLLPQ-------IYPDPELEQQILSLPIRCIHSEEGCRWTGQMKQLQGHFSTCAFNVIPCPNRCSVKLTRRDLPDHLQHDCPKRKVKCEFCGSEFTGEAFENHQGVCPQESVYCENKCGARMMRRLLSQHGMAECPKRTQPCKYCGKEFVFDTIQNHQFHCPRFPVQCPNQCGTPNIAREDLANHVKDNCGSALVLCPFKDAGCKHRCPKLAIGRHLEDTTKSHLTMMC--------------NLVSRQRQEILELRREMEELSVSHDGVLIWKLNDYSRKLQEAKLRSNHEFFSPPFYTHRYGYKLQVSAFLNGNGSGEGSHLSVYIRVLPGEYDNLLEWPFSYKVTFSILDQ-SDPSLSKPQHITETFNPDPNWKN---FQKPCSTRNSLDESTLGFGYPKFISHEEIKKRNYIRDNCIFIKASIEIPQKI 461          
BLAST of TNF receptor-associated factor 4 vs. Ensembl Medaka
Match: traf3 (TNF receptor associated factor 3 [Source:NCBI gene;Acc:101161601])

HSP 1 Score: 192.586 bits (488), Expect = 1.630e-54
Identity = 130/434 (29.95%), Postives = 205/434 (47.24%), Query Frame = 1
Query:  511 FIDPLEKKYACVVCDQVLRYPVQFDECGHHCCSSCLPELMRVA-PRCPIDQCHIERDKVYVDKEFQKEIDNLGVRCSFYQKGCIWTGVLKELSNHLESCLHRMITCP-NNCNVEFEIRFLEKHKQDDCPKRIIQCQFCEASL-IAEVEANHLKVCNKFPIPCPNGCKKKEILREN--LAEHLES--------KCVKQEQDCPFSEYGCDFKGKKKRVREHLNDDFVSHLTLMCEAIKENTRI-----VEEQSKIITQYQTEVGTFEKRIESLEKL-YGPQLIWKIDNYQEKFNEAKTGKKTTIFSAPFMTSRFGYKMALSVCLYGDGKARGKHFSLFICICKGDYDSLLLWPFSHRITFTLIDQCQDPEARKNVVYTVKPNTCKENAPFLGRPTTDRNASFGAQKFVELDVLNTLDYIRDDAIFIKAQVDCDEM 1755
            F++  E KY C  C  VL  P Q  ECGH  C SC+ +++    P CP D   + +DK++ D    +EI  L V C     GC     L+++ +H+  C    + CP   C      + + +H    C  R   C+FC+  + + E++ +   VC  FP+ CPN C    + R    ++ H E         + ++Q +D   S      +G    VR  L+            A+++  R      +     +++ ++  +   + R + LE   Y   LIWKI +Y+ +  +A  GK  +++S PF T  FGYKM   V L GDG  +G H SLF  + +G+YD+LL WPF  ++T  L+DQ     +RK++    KP+    +     RP  + N + G   FV   VL +  YI+DD IFIK  VD  ++
Sbjct:   38 FVEAPEAKYCCEACRLVLCQPRQ-TECGHRFCYSCINDILSCPNPVCPADMEPLFKDKIFRDVCCHREIMALKVYCRSEANGCQEQMSLQQIPDHVNVCPFFEVPCPLGKCKERMMRKEIPEHLAWKCKYRESTCEFCKNKMPLTELQKHKETVCPAFPVSCPNHCTSSSLPRSEKLMSSHTEKLLELELELRSLRQLRDEMES-----LRGTLDTVRTRLS------------ALEQGGRASLETQLNRHDDMLSVHEIRLADMDLRFQVLETASYNGTLIWKIRDYKRRKQDAVAGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVVMRGEYDALLPWPFKQKVTLMLMDQ---GPSRKHLGDAFKPDPSSSS---FRRPVAEMNIASGCPLFVSQSVLESGTYIKDDTIFIKVTVDTSDL 447          
BLAST of TNF receptor-associated factor 4 vs. Ensembl Medaka
Match: traf2b (TNF receptor associated factor 2 [Source:NCBI gene;Acc:101159764])

HSP 1 Score: 156.377 bits (394), Expect = 9.325e-41
Identity = 138/503 (27.44%), Postives = 207/503 (41.15%), Query Frame = 1
Query:  520 PLEKKYACVVCDQVLRYPVQFDECGHHCCSSCLPELMRVAPRCPIDQCHIER-----------DKVYVDKEFQKEIDNLGVRCSFYQKGCIWTGVLKEL-SNHLESCLHRMITCPNNCNVEFEIRFLEKHKQDDCPKRIIQCQFCEASL-IAEVEA--------------------------NHLKVCNKFPIPCP---NGCKK-------KEILRENLAEHLE----------------SKCVKQEQDCPFSEY-----GCDFKG--------KKKRVREH----LNDDFVSHLTLMCEAIKENTRI----VEEQSKIITQYQTEVGTFEKRIESLEKL--------YGPQLIWKIDNYQEKFNEAKTGKKTTIFSAPFMTSRFGYKMALSVCLYGDGKARGKHFSLFICICKGDYDSLLLWPFSHRITFTLIDQCQDPEARKNVVYTVKPNTCKENAPFLGRPTTDRNASFGAQKFVELDVL-NTLDYIRDDAIFIKAQVD 1743
            P+E KY C  C QVLR PVQ  +CGH  C  C  +L    P+ P   C  E             + + D    +EI +L  RC    +GC WTG +KE  + H   C    I C   C      +  ++H   +C +R + C++C+ +    +++A                          +H K C K    CP    GCK         E    +  EHL                 S   + ++D     Y     GC            KK    E+    LN + V   +L  EA     R+    +E  S  I Q +  +   + ++   E++        Y    +WKI ++  +  EA +G+   +FS  F +S++GYKM L + L GDG  RG H SLF  + +  YD+LL WPFS ++T  L+DQ      R++++   +P+     +    RP ++ N + G   F  L  L     Y+RDD IFIKA VD
Sbjct:   30 PMEDKYKCQQCLQVLRKPVQA-QCGHRFCVHCFRQLTSSGPK-PCQACRKEEIYEEPMSILNSSEAFPDNAAGREIASLPARC--LNQGCDWTGSIKEYEAKHEGRCEFEQIQC-EACQALVLRKDKDRHNDRECEERTLNCKYCKVTFNFKDIKAHDEICQKFPLQCKDCGKKKIPREKFNDHAKSCAKSKSACPFSEVGCKSVVENGKISEHEHSSTMEHLRLLLPMVLSMTRTRLDTSPSGEWQEDSGLGLYRAPDDGCGAAASVPSVDLDKKVSALENIVCVLNRE-VERSSLTLEAFSHQHRLDQEKIENLSNKIRQLERSLTVKDLQLSEAEQMVRELQYCTYDGIFVWKITDFSHRRQEAVSGRAPAMFSPAFYSSKYGYKMCLRLYLNGDGTGRGTHLSLFFVVMRSKYDALLKWPFSQKVTLMLLDQ----NNREHIIDAFRPDI---TSTSFQRPVSEMNIASGCPLFCPLAKLAGKSPYLRDDTIFIKAIVD 519          
BLAST of TNF receptor-associated factor 4 vs. Planmine SMEST
Match: SMESG000016362.1 (SMESG000016362.1)

HSP 1 Score: 786.178 bits (2029), Expect = 0.000e+0
Identity = 379/379 (100.00%), Postives = 379/379 (100.00%), Query Frame = 1
Query:  628 MRVAPRCPIDQCHIERDKVYVDKEFQKEIDNLGVRCSFYQKGCIWTGVLKELSNHLESCLHRMITCPNNCNVEFEIRFLEKHKQDDCPKRIIQCQFCEASLIAEVEANHLKVCNKFPIPCPNGCKKKEILRENLAEHLESKCVKQEQDCPFSEYGCDFKGKKKRVREHLNDDFVSHLTLMCEAIKENTRIVEEQSKIITQYQTEVGTFEKRIESLEKLYGPQLIWKIDNYQEKFNEAKTGKKTTIFSAPFMTSRFGYKMALSVCLYGDGKARGKHFSLFICICKGDYDSLLLWPFSHRITFTLIDQCQDPEARKNVVYTVKPNTCKENAPFLGRPTTDRNASFGAQKFVELDVLNTLDYIRDDAIFIKAQVDCDEMINI 1764
            MRVAPRCPIDQCHIERDKVYVDKEFQKEIDNLGVRCSFYQKGCIWTGVLKELSNHLESCLHRMITCPNNCNVEFEIRFLEKHKQDDCPKRIIQCQFCEASLIAEVEANHLKVCNKFPIPCPNGCKKKEILRENLAEHLESKCVKQEQDCPFSEYGCDFKGKKKRVREHLNDDFVSHLTLMCEAIKENTRIVEEQSKIITQYQTEVGTFEKRIESLEKLYGPQLIWKIDNYQEKFNEAKTGKKTTIFSAPFMTSRFGYKMALSVCLYGDGKARGKHFSLFICICKGDYDSLLLWPFSHRITFTLIDQCQDPEARKNVVYTVKPNTCKENAPFLGRPTTDRNASFGAQKFVELDVLNTLDYIRDDAIFIKAQVDCDEMINI
Sbjct:    1 MRVAPRCPIDQCHIERDKVYVDKEFQKEIDNLGVRCSFYQKGCIWTGVLKELSNHLESCLHRMITCPNNCNVEFEIRFLEKHKQDDCPKRIIQCQFCEASLIAEVEANHLKVCNKFPIPCPNGCKKKEILRENLAEHLESKCVKQEQDCPFSEYGCDFKGKKKRVREHLNDDFVSHLTLMCEAIKENTRIVEEQSKIITQYQTEVGTFEKRIESLEKLYGPQLIWKIDNYQEKFNEAKTGKKTTIFSAPFMTSRFGYKMALSVCLYGDGKARGKHFSLFICICKGDYDSLLLWPFSHRITFTLIDQCQDPEARKNVVYTVKPNTCKENAPFLGRPTTDRNASFGAQKFVELDVLNTLDYIRDDAIFIKAQVDCDEMINI 379          
BLAST of TNF receptor-associated factor 4 vs. Planmine SMEST
Match: SMESG000006747.1 (SMESG000006747.1)

HSP 1 Score: 227.254 bits (578), Expect = 8.094e-67
Identity = 133/436 (30.50%), Postives = 229/436 (52.52%), Query Frame = 1
Query:  490 QNDVDVIFIDPLEKKYACVVCDQVLRYPVQFDECGHHCCSSCLP---ELMRVAPRCPIDQCHIERDKVYVDKEFQKEIDNLGVRCSFYQKGCIWTGVLKELSNHLESCLHRMITCPNNCNVEFEIRFLEKHKQDDCPKRIIQCQFCEASLIAEVEANHLKVCNKFPIPCPNGCK------KKEILRENLAE-HLESKCVKQEQDCPFSEYGCDFKGKKKRVREHLNDDFVSHLTLMCEAIKENTRIVEEQSKIITQYQTEVGTFEKRIESLEKLYGPQLIWKIDNYQEKFNEAKTGKKTTIFSAPFM-TSRFGYKMALSVCL-YGDGKARGKHFSLFICICKGDYDSLLLWPFSHRITFTLIDQCQDPEARKNVVYTVKPNTCKENAPFLGRPTTDRNASFGAQKFVELDVL-NTLDYIRDDAIFIKAQVDCDEMI 1758
            Q +  + F + ++ +Y C  C ++L  P++  +CGH  C +C P           CPID+   + D++   + ++  I NL + CS     C W G+L    +H E+C  + I CP  C+   +    E HK + C  R + CQFC   + ++   +H  VC++  I CPN CK      K  IL++ + + HLE+ C +++  CPF  +GC  K K+K++  HL    + HL ++C   ++NT  +E+Q + + + + ++   + +I+ L   +G QL+WKIDN  EK+  A  G    I S PF  T+ +GYK  + +     + K   ++ S+FI IC   ++ LL WPF  ++   L++Q     + K++ +   PNT  EN PF+ RP T RN  FG +KF   ++  +   ++  +A+FIK  ++  E++
Sbjct:   98 QTNNQLSFREEVKLEYFCEKCSRILWNPIKL-KCGHIICYTCQPFPDSFQNDVMNCPIDEETTKEDEIEQCENYKDNIWNLQIYCSTIL--CDWFGILSNFRSHFETCELKQIKCPQ-CDEMIQWGNFEAHKLNTCEMRSVLCQFCSNPIFSKDAKSHENVCDEKLIECPNSCKFPTDKTKAMILKQGILKFHLENACSERKVPCPFEMFGCKNKSKQKKMHHHLTKYAIIHLEMICSFGRKNTESLEKQVRFMLELKDKLERSDGKIKILNSEFGTQLLWKIDNINEKYQAALVGANEEIVSNPFYSTAPYGYKFIMRLVFNVHNVKLSSQYLSIFISICDSPFNVLLPWPFKLKLNIHLVNQI----SEKHISHCFLPNTIVENYPFINRPKTQRNPYFGIEKFANCNIFHDNSPFVAGNAMFIKILIEPHEIV 525          
BLAST of TNF receptor-associated factor 4 vs. Planmine SMEST
Match: SMESG000003970.1 (SMESG000003970.1)

HSP 1 Score: 213.386 bits (542), Expect = 3.418e-65
Identity = 95/219 (43.38%), Postives = 141/219 (64.38%), Query Frame = 1
Query: 1087 YGCDFKGKKKRVREHLNDDFVSHLTLMCEAIKENTRIVEEQSKIITQYQTEVGTFEKRIESLEKLYGPQLIWKIDNYQEKFNEAKTGKKTTIFSAPFMTSRFGYKMALSVCLYGDGKARGKHFSLFICICKGDYDSLLLWPFSHRITFTLIDQCQDPEARKNVVYTVKPNTCKENAPFLGRPTTDRNASFGAQKFVELDVLNTLD-YIRDDAIFIKAQV 1740
            +GC  +G +  +  HL    + HL LM EA+ +N+  +E   + +   + +    E R+   E+L+G QLIWK++ + +KF++AK+G  TT FS PF +S +GYK+AL +C +GDG A+GK  SLF+CIC+G+YD+LL WPF  ++TF+L+DQ  +   RK+VVY+  PN  K+N PFLGRPT +RN  FGA+KF+ L  L     Y  +  IF K  +
Sbjct:    2 FGCKIQGNENEIENHLKRKAIPHLVLMAEALTKNSLTLENSVQCLLDEKLKCSALESRLTVFERLWGSQLIWKVERFSQKFSDAKSGVTTTFFSPPFFSSHYGYKLALGLCPFGDGIAKGKFLSLFVCICRGEYDNLLQWPFPLKVTFSLLDQAPEFRKRKDVVYSFVPNVIKDNFPFLGRPTGERNPFFGARKFISLSSLMEYGTYTLNQTIFFKVDI 220          
BLAST of TNF receptor-associated factor 4 vs. Planmine SMEST
Match: SMESG000027153.1 (SMESG000027153.1)

HSP 1 Score: 184.882 bits (468), Expect = 1.322e-51
Identity = 131/452 (28.98%), Postives = 223/452 (49.34%), Query Frame = 1
Query:  523 LEKKYACVVCDQVLRYPVQFDECGHHCCSSCLPELMRVAPR-CPIDQCHIERDKVYVDKEFQ------KEIDNLGVRCSFYQKGCIWTGVLKELSNHLESCLHRMITCPNNCNVEFEIRFLEKHKQDDCPKRIIQCQFC-EASLIAEVEANHLK-----VCNKFPIPCPNGCKKKEILRENLAEHLESKCVKQEQDCPFSEYGCDF-KGKKKRVREHLNDDFVSHLTLMCEAIKENTRIVE------EQSKIITQYQTEVG-----TFEKRIESLEKL-------------------YGPQLIWKIDNYQEKFNEAKTGKKTTIFSAPFMTSRFGYKMALSVCLYGDGKARGKHFSLFICICKGDYDSLLLWPFSHRITFTLIDQCQDPEARKNVVYTVKPNTCKENAPFLGRPTTDRNASFGAQKFVELD-VLNTLDYIRDDAIFIKAQVD 1743
            L  +  CV+C ++L+   Q   CG   C +C+   +   P+ CP  Q   E   +++D++        KEI +L V+C F  K C     L+ +  H+ SC  R I+C N C  + + +  E H ++ C  R ++C++C E     ++++ HL       C K+   CPN C      +  L EHL+  C K++ +CPF    C+  K  K+ + +HLN+++VSH + +   IK+    ++      E  K++T+   ++      +  K  E++EKL                        IWK  +++ K  +A++G+K ++ S PF TS FGYKM L +   GDG  +G H S+F  I KG++D LL WPF  ++T +++DQ       K+   T KP+     +    +P  + N + G+ KF+ L  ++N   Y ++D I++K  VD
Sbjct:   22 LSDRLKCVLCQRILKNAKQ-TSCGCKACENCIKSYLANGPKPCPSKQIDCENVMLHMDEDINADNATNKEIASLKVKCPF--KLCSSEMPLRNMVEHINSCEFREISC-NKCQSKLQAKDKESHDKNKCEMRKLKCEYCLEEMSFRDLKSIHLNSDREDFCVKYTAICPNNCDVH--TKVCLKEHLKL-CSKKKLECPFHSLNCNVDKMTKENLMKHLNEEYVSHTSNLISKIKDMENTIKNLTDELENQKVLTKELLDMNKKSSLSVLKTQETIEKLKTKSFPTPIQAVENKSVIFRNATFIWKFTDFESKRIDAESGRKVSVTSDPFYTSEFGYKMCLRIYPAGDGVGKGTHLSVFFAIMKGEFDDLLSWPFKQKVTLSIMDQ---EAGTKHHSDTFKPDA---RSACYQKPVDECNIASGSPKFILLSLIMNNSLYCKNDTIYLKIAVD 460          
BLAST of TNF receptor-associated factor 4 vs. Planmine SMEST
Match: SMESG000027123.1 (SMESG000027123.1)

HSP 1 Score: 174.096 bits (440), Expect = 7.164e-48
Identity = 133/448 (29.69%), Postives = 214/448 (47.77%), Query Frame = 1
Query:  514 IDPLEKKYACVVCDQVLRYPVQFDECGHHCCSSCLPELMRVAPR-CPIDQC-----HIERDKVYVDKEFQKEIDNLGVRCSFYQKGCIWTGVLKELSNHLESCLHRMITCPNNCNVEFEIRFLEKHKQDDCPKRIIQCQFCEASL----IAEVEANHLK--VCNKFPIPCPNGCKKKEILRENLAEHLESKCVKQEQDCPFSEYGCDFKGKKKRVREHLN---DDFVSHLTLMCEAIKENTRIVEEQSKIITQYQTEVGTFE-------KRIESLEK--------------LYGPQLIWKIDNYQEKFNEAKTGKKTTIFSAPFMTSRFGYKMALSVCLYGDGKARGKHFSLFICICKGDYDSLLLWPFSHRITFTLIDQCQDPEARKNVVYTVKPNTCKENAPFLGRPTTDRNASFGAQKFVELDVL--NTLDYIRDDAIFIKAQVD 1743
            I  L     C++C  +L+   Q  +CG   C +C+ E +   P+ CP  +C      I++D +Y D    KEI NL + C F  KGC     + ++S H++SC +R +TC + C      +  +KH   +C  RI +C+FC  ++    + E+  N  K  +C+++   CPN C + + L  NL  HLE+ C+ ++ D        D       ++E  N    + +  + L+ +  K+    +E Q  II +  T+            K+I +LE                     IWKI + + +   A+  ++ +I S PF TS FGYK+ L V   GDG  +G H S+F  + KG+YD LL WPF  ++T +L+DQ       K+   T KP+     +P   RP  D N + G+ KF  +  L  N++ Y ++D I+IK  VD
Sbjct:   18 IPNLSSSLKCIICSSLLKNAKQ-TKCGCKVCENCINEYLSKGPKDCPNKECLNELLSIDKD-IYNDNATNKEILNLKIACPF--KGCAQLETVFKISQHVKSCEYRDVTC-DPCQKRILAKEKQKHIDGECEMRITKCEFCHKTMTIKYLNEMHLNTTKNELCSEYVGHCPNNCGETKEL--NLKLHLET-CLNRKSD--------DQNDTNYHIQEFSNTQLSNLLKQIALLNQTSKDLLTKLENQDVIIREMSTKYIALTEDNIKLTKKINALEAERSNPVKIIAKTNDFRNGSFIWKIKDLKSQIQNAERSERLSITSDPFYTSEFGYKLCLRVYPSGDGLGKGTHLSVFFALMKGEYDDLLPWPFRQKLTLSLLDQ---ENFTKHYSDTFKPD---PKSPCFQRPILDSNIASGSPKFYSISHLSFNSI-YYKNDTIYIKITVD 442          
The following BLAST results are available for this feature:
BLAST of TNF receptor-associated factor 4 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TRAF41.020e-6628.39TNF receptor associated factor 4 [Source:HGNC Symb... [more]
TRAF23.521e-5731.61TNF receptor associated factor 2 [Source:HGNC Symb... [more]
TRAF43.086e-5326.49TNF receptor associated factor 4 [Source:HGNC Symb... [more]
TRAF33.395e-4830.30TNF receptor associated factor 3 [Source:HGNC Symb... [more]
TRAF61.208e-4427.91TNF receptor associated factor 6 [Source:HGNC Symb... [more]
back to top
BLAST of TNF receptor-associated factor 4 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
trf-15.925e-8736.80TNF Receptor Associated Factor (TRAF) homolog; TRF... [more]
trf-22.182e-3133.77TNF Receptor Associated Factor (TRAF) homolog [So... [more]
back to top
BLAST of TNF receptor-associated factor 4 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Traf41.543e-5127.21gene:FBgn0026319 transcript:FBtr0334401[more]
Traf41.691e-5127.21gene:FBgn0026319 transcript:FBtr0077429[more]
Traf-like3.113e-1427.72gene:FBgn0030748 transcript:FBtr0074273[more]
Traf-like3.212e-1427.72gene:FBgn0030748 transcript:FBtr0074275[more]
Traf-like3.735e-1426.88gene:FBgn0030748 transcript:FBtr0308606[more]
back to top
BLAST of TNF receptor-associated factor 4 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
traf4a4.133e-7629.67tnf receptor-associated factor 4a [Source:ZFIN;Acc... [more]
traf4a4.133e-7629.67tnf receptor-associated factor 4a [Source:ZFIN;Acc... [more]
traf4b1.771e-6327.66tnf receptor-associated factor 4b [Source:ZFIN;Acc... [more]
traf63.612e-4626.35TNF receptor-associated factor 6 [Source:NCBI gene... [more]
traf63.612e-4626.35TNF receptor-associated factor 6 [Source:NCBI gene... [more]
back to top
BLAST of TNF receptor-associated factor 4 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sytl26.755e-8331.54synaptotagmin like 2 [Source:Xenbase;Acc:XB-GENE-9... [more]
TRAF23.103e-4226.55TNF receptor associated factor 2 [Source:NCBI gene... [more]
TRAF25.154e-4225.26TNF receptor associated factor 2 [Source:NCBI gene... [more]
ssh22.532e-3726.63slingshot protein phosphatase 2 [Source:Xenbase;Ac... [more]
slc12a11.817e-3626.36solute carrier family 12 member 1 [Source:Xenbase;... [more]
back to top
BLAST of TNF receptor-associated factor 4 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Traf46.398e-7429.85TNF receptor associated factor 4 [Source:MGI Symbo... [more]
Traf23.190e-5630.64TNF receptor-associated factor 2 [Source:MGI Symbo... [more]
Traf22.466e-5530.41TNF receptor-associated factor 2 [Source:MGI Symbo... [more]
Traf62.373e-4227.65TNF receptor-associated factor 6 [Source:MGI Symbo... [more]
Traf32.020e-3926.22TNF receptor-associated factor 3 [Source:MGI Symbo... [more]
back to top
BLAST of TNF receptor-associated factor 4 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q61382|TRAF4_MOUSE4.475e-7329.85TNF receptor-associated factor 4 OS=Mus musculus O... [more]
sp|Q9BUZ4|TRAF4_HUMAN4.899e-6628.39TNF receptor-associated factor 4 OS=Homo sapiens O... [more]
sp|Q12933|TRAF2_HUMAN1.691e-5631.61TNF receptor-associated factor 2 OS=Homo sapiens O... [more]
sp|P39429|TRAF2_MOUSE2.231e-5530.64TNF receptor-associated factor 2 OS=Mus musculus O... [more]
sp|Q6IWL4|TRAF6_DANRE2.727e-4526.35TNF receptor-associated factor 6 OS=Danio rerio OX... [more]
back to top
BLAST of TNF receptor-associated factor 4 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267ELC70.000e+062.86Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267DPF20.000e+062.62Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8I4E90.000e+060.05Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1S3KE240.000e+059.08TNF receptor-associated factor 4 OS=Lingula unguis... [more]
A0A1I8J0680.000e+060.05Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of TNF receptor-associated factor 4 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
traf4a9.080e-8331.33TNF receptor associated factor 4 [Source:NCBI gene... [more]
traf4b1.025e-6729.10TNF receptor-associated factor 4-like [Source:NCBI... [more]
traf2a1.751e-5328.54TNF receptor-associated factor 2-like [Source:NCBI... [more]
traf67.599e-3927.06TNF receptor associated factor 6 [Source:NCBI gene... [more]
traf62.010e-3625.55TNF receptor associated factor 6 [Source:NCBI gene... [more]
back to top
BLAST of TNF receptor-associated factor 4 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ENSPMAT00000000074.15.687e-3828.96pep scaffold:Pmarinus_7.0:GL482142:165593:173010:-... [more]
traf69.479e-3423.56TNF receptor-associated factor 6 [Source:NCBI gene... [more]
ENSPMAT00000002130.11.737e-3337.50pep scaffold:Pmarinus_7.0:GL484662:8457:12718:-1 g... [more]
ENSPMAT00000008091.11.229e-2123.33pep scaffold:Pmarinus_7.0:GL477915:34322:50582:-1 ... [more]
back to top
BLAST of TNF receptor-associated factor 4 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TNF receptor-associated factor 4 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO328519.339e-11438.68Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO328493.404e-10236.17Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO495451.652e-8336.21Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO459153.667e-7932.85Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO406652.777e-6631.06Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of TNF receptor-associated factor 4 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
traf4a2.237e-7629.88TNF receptor associated factor 4 [Source:NCBI gene... [more]
traf4a3.526e-7629.75TNF receptor associated factor 4 [Source:NCBI gene... [more]
traf4a7.528e-7229.25TNF receptor associated factor 4 [Source:NCBI gene... [more]
traf31.630e-5429.95TNF receptor associated factor 3 [Source:NCBI gene... [more]
traf2b9.325e-4127.44TNF receptor associated factor 2 [Source:NCBI gene... [more]
back to top
BLAST of TNF receptor-associated factor 4 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000016362.10.000e+0100.00SMESG000016362.1[more]
SMESG000006747.18.094e-6730.50SMESG000006747.1[more]
SMESG000003970.13.418e-6543.38SMESG000003970.1[more]
SMESG000027153.11.322e-5128.98SMESG000027153.1[more]
SMESG000027123.17.164e-4829.69SMESG000027123.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30009756 ID=SMED30009756|Name=TNF receptor-associated factor 4|organism=Schmidtea mediterranea sexual|type=transcript|length=1816bp
ACCAATCAAAATCGTTTCGTCTTTATCCATTGTGCACATGCTTGACTGCT
GCAAGCTGTTGCGTTTTTGGGAAAACATCTCATTCCTTTCTGTAAACAAA
ACAATTGGTATACATGCACACGAATTGAGGAAGGCATCTTTTTTCTATTT
GAAAGTATTTGTTTTCTTGTAATCCTAGCAACGACCTGTTTGATAGGAGA
AAATAAAGTTTGGCATTTTTCAATTTTTTTTCAACTTTCAATGTCACTTG
ATGGTCGACAAAATGAAATTGGAAGCAATCCTGAATTGGGAGAAAAGGAT
TACAATAATTCAGAATATAATAGTTTGAAAACCGGATCATTGAGCTCATT
AAATAATGGCTATAATTCCCCAATTCGGCCCCCAGGTTTGATTCATAAAA
ATTCGAATTTAAGTTCCGTCAGCATCGATTCAGTTGGAATATTTCACAAT
CAAATCAAGAATCCCCCAATAATCACTAACTCGAATAATCAAAATGATGT
TGATGTCATTTTTATTGACCCGCTTGAAAAGAAATATGCTTGTGTGGTGT
GCGATCAAGTGTTAAGATATCCCGTTCAATTCGATGAATGCGGTCATCAT
TGTTGTTCATCGTGCTTACCCGAATTGATGCGAGTTGCTCCGCGTTGTCC
AATAGATCAATGTCACATTGAAAGAGATAAAGTCTATGTAGATAAAGAAT
TTCAAAAAGAAATTGACAATCTCGGAGTACGTTGCTCATTCTATCAGAAA
GGTTGTATTTGGACTGGGGTTCTTAAAGAGCTCTCAAATCATTTAGAAAG
TTGCCTTCATAGAATGATTACTTGCCCAAATAATTGCAATGTAGAATTCG
AGATAAGATTTTTGGAAAAACACAAACAGGATGACTGTCCAAAAAGAATA
ATTCAATGCCAATTTTGTGAGGCCTCATTAATTGCTGAAGTAGAAGCAAA
TCATTTGAAAGTCTGTAACAAATTTCCGATTCCATGTCCGAATGGGTGTA
AGAAAAAAGAAATACTGAGAGAAAACCTAGCGGAACATCTTGAAAGCAAA
TGTGTTAAACAGGAGCAAGACTGTCCTTTTAGTGAATACGGATGCGATTT
TAAAGGAAAGAAAAAAAGAGTTAGAGAACATTTAAATGATGATTTTGTGA
GTCACTTAACGCTGATGTGCGAAGCAATTAAAGAGAACACGCGAATTGTT
GAAGAGCAGTCGAAAATTATTACACAATATCAAACTGAAGTTGGAACCTT
TGAAAAGAGAATCGAATCTCTAGAAAAATTATACGGACCCCAATTAATTT
GGAAAATTGATAATTATCAAGAAAAATTCAATGAAGCAAAGACTGGCAAA
AAGACGACTATATTCAGTGCTCCATTCATGACTAGCCGTTTTGGTTACAA
AATGGCACTTTCAGTTTGTTTATATGGCGACGGCAAAGCACGAGGAAAGC
ATTTTTCATTATTTATTTGTATTTGTAAAGGGGACTACGATTCTCTTTTA
TTGTGGCCATTTTCTCATAGAATTACTTTTACACTAATTGACCAATGCCA
GGATCCTGAAGCGAGGAAAAATGTTGTTTACACCGTGAAACCGAACACTT
GCAAAGAAAATGCACCATTTCTTGGTCGACCTACAACTGATAGAAATGCT
AGCTTTGGAGCACAGAAATTCGTTGAACTTGATGTTTTAAATACTCTAGA
TTATATTCGTGATGATGCCATTTTCATTAAAGCGCAAGTAGACTGTGACG
AAATGATCAACATATGATTCCTTATTTTGGACTTTCGGCAACCATTTGAC
ATAGTTTCGTAACCAC
back to top

protein sequence of SMED30009756-orf-1

>SMED30009756-orf-1 ID=SMED30009756-orf-1|Name=SMED30009756-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=509bp
MSLDGRQNEIGSNPELGEKDYNNSEYNSLKTGSLSSLNNGYNSPIRPPGL
IHKNSNLSSVSIDSVGIFHNQIKNPPIITNSNNQNDVDVIFIDPLEKKYA
CVVCDQVLRYPVQFDECGHHCCSSCLPELMRVAPRCPIDQCHIERDKVYV
DKEFQKEIDNLGVRCSFYQKGCIWTGVLKELSNHLESCLHRMITCPNNCN
VEFEIRFLEKHKQDDCPKRIIQCQFCEASLIAEVEANHLKVCNKFPIPCP
NGCKKKEILRENLAEHLESKCVKQEQDCPFSEYGCDFKGKKKRVREHLND
DFVSHLTLMCEAIKENTRIVEEQSKIITQYQTEVGTFEKRIESLEKLYGP
QLIWKIDNYQEKFNEAKTGKKTTIFSAPFMTSRFGYKMALSVCLYGDGKA
RGKHFSLFICICKGDYDSLLLWPFSHRITFTLIDQCQDPEARKNVVYTVK
PNTCKENAPFLGRPTTDRNASFGAQKFVELDVLNTLDYIRDDAIFIKAQV
DCDEMINI*
back to top
Aliases
The feature 'TNF receptor-associated factor 4' has the following synonyms
Synonym
Smed_08711
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0042981regulation of apoptotic process
GO:0016567protein ubiquitination
GO:0007250activation of NF-kappaB-inducing kinase activity
GO:0046330positive regulation of JNK cascade
GO:0007165signal transduction
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000017photoreceptor neuron
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR012227TNF_rcpt-assoc_TRAF_met
IPR043211TNF_rcpt-assoc_TRAF
IPR002083MATH/TRAF_dom
IPR013323SIAH-type
IPR008974TRAF-like
IPR001293Znf_TRAF
IPR013083Znf_RING/FYVE/PHD
IPR001841Znf_RING
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0004842ubiquitin-protein transferase activity
GO:0008270zinc ion binding
GO:0046872metal ion binding
Vocabulary: cellular component
TermDefinition
GO:0005622intracellular
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 198..218
NoneNo IPR availablePANTHERPTHR10131:SF127coord: 7..373
NoneNo IPR availableCDDcd00270MATH_TRAF_Ccoord: 222..372
e-value: 1.1535E-67
score: 208.616
IPR002083MATH/TRAF domainSMARTSM00061math_3coord: 225..354
e-value: 6.6E-8
score: 42.3
IPR002083MATH/TRAF domainPROSITEPS50144MATHcoord: 220..371
score: 16.811
IPR012227TNF receptor-associated factor TRAF, metazoaPIRSFPIRSF015614TRAFcoord: 2..196
e-value: 7.5E-43
score: 144.6
coord: 183..379
e-value: 8.8E-62
score: 207.0
IPR013083Zinc finger, RING/FYVE/PHD-typeGENE3DG3DSA:3.30.40.10coord: 2..67
e-value: 6.1E-7
score: 31.4
IPR013083Zinc finger, RING/FYVE/PHD-typeGENE3DG3DSA:3.30.40.10coord: 68..112
e-value: 6.8E-7
score: 31.2
IPR013083Zinc finger, RING/FYVE/PHD-typeGENE3DG3DSA:3.30.40.10coord: 113..174
e-value: 1.7E-13
score: 52.6
IPR001293Zinc finger, TRAF-typePFAMPF02176zf-TRAFcoord: 109..168
e-value: 2.4E-16
score: 60.1
coord: 55..99
e-value: 3.9E-5
score: 24.2
IPR001293Zinc finger, TRAF-typePROSITEPS50145ZF_TRAFcoord: 109..156
score: 14.465
IPR001293Zinc finger, TRAF-typePROSITEPS50145ZF_TRAFcoord: 55..97
score: 10.815
IPR008974TRAF-likeGENE3DG3DSA:2.60.210.10coord: 186..378
e-value: 6.5E-61
score: 207.1
IPR008974TRAF-likeSUPERFAMILYSSF49599TRAF domain-likecoord: 220..376
IPR008974TRAF-likeSUPERFAMILYSSF49599TRAF domain-likecoord: 32..98
IPR008974TRAF-likeSUPERFAMILYSSF49599TRAF domain-likecoord: 118..185
IPR043211TNF receptor-associated factor TRAFPANTHERPTHR10131TNF RECEPTOR ASSOCIATED FACTORcoord: 7..373