pitx

Overview
Namepitx (AGS83410.1)
Smed IDSMED30009752
Length (bp)1335
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of pitx (SMED30009752) t-SNE clustered cells

Violin plots show distribution of expression levels for pitx (SMED30009752) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of pitx (SMED30009752) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for pitx (SMED30009752) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30009752

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 13

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30009752SMESG000080359.1 dd_Smed_v4_15253_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30009752SMESG000080359.1 dd_Smed_v4_15253_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30009752SMESG000080359.1 dd_Smed_v4_15253_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30009752SMESG000080359.1 dd_Smed_v6_15253_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
ventral region of the whole animalSMED30009752SMESG000080359.1 KC568450smed_ncbi_20200123PMID:24131630
März et al., 2013
whole organism asexual adult fluorescence in situ hybridization evidence
serotonergic neuronSMED30009752SMESG000080359.1 KC568450smed_ncbi_20200123PMID:24131630
März et al., 2013
whole organism asexual adult fluorescence in situ hybridization evidence
body wall musculatureSMED30009752SMESG000080359.1 dd_Smed_v4_15253_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
secretory cellSMED30009752SMESG000080359.1 KF134113smed_ncbi_20200123PMID:23903188
Currie et al., 2013
whole organism asexual adult fluorescence in situ hybridization evidence
ventral region of the whole animalSMED30009752SMESG000080359.1 KF134113smed_ncbi_20200123PMID:23903188
Currie et al., 2013
whole organism asexual adult fluorescence in situ hybridization evidence
parapharyngeal regionSMED30009752SMESG000080359.1 KF134113smed_ncbi_20200123PMID:23903188
Currie et al., 2013
whole organism asexual adult fluorescence in situ hybridization evidence
cholinergic neuronSMED30009752SMESG000080359.1 KF134113smed_ncbi_20200123PMID:23903188
Currie et al., 2013
whole organism asexual adult fluorescence in situ hybridization evidence
GABAergic neuronSMED30009752SMESG000080359.1 KF134113smed_ncbi_20200123PMID:23903188
Currie et al., 2013
whole organism asexual adult fluorescence in situ hybridization evidence
serotonergic neuronSMED30009752SMESG000080359.1 KF134113smed_ncbi_20200123PMID:23903188
Currie et al., 2013
whole organism asexual adult fluorescence in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of pitx vs. Ensembl Human
Match: PITX3 (paired like homeodomain 3 [Source:HGNC Symbol;Acc:HGNC:9006])

HSP 1 Score: 155.992 bits (393), Expect = 1.734e-43
Identity = 88/146 (60.27%), Postives = 102/146 (69.86%), Query Frame = 2
Query:  551 NRSQRRQRTHFTSQQLQELESTFSRNRYPDMNTREEIAVWTNLTEARVRVWFKNRRAKWRKRER--QFEAFKGSCFSTPFGTLMSPFDEXXXXXXXXXXXXXXVAWG-ATKPFPWSFNPVTNFNNPTSQNMFTFPQSAINISGVPN 979
             + QRRQRTHFTSQQLQELE+TF RNRYPDM+TREEIAVWTNLTEARVRVWFKNRRAKWRKRER  Q E  KGS F+ P G L+ P++E             A+A   A K FP++FN V N     SQ +F+ P S+I  S VP+
Sbjct:   59 KKKQRRQRTHFTSQQLQELEATFQRNRYPDMSTREEIAVWTNLTEARVRVWFKNRRAKWRKRERSQQAELCKGS-FAAPLGGLVPPYEEVYPGYSYGNWPPKALAPPLAAKTFPFAFNSV-NVGPLASQPVFS-PPSSIAASMVPS 201          
BLAST of pitx vs. Ensembl Human
Match: PITX3 (paired like homeodomain 3 [Source:HGNC Symbol;Acc:HGNC:9006])

HSP 1 Score: 155.992 bits (393), Expect = 1.734e-43
Identity = 88/146 (60.27%), Postives = 102/146 (69.86%), Query Frame = 2
Query:  551 NRSQRRQRTHFTSQQLQELESTFSRNRYPDMNTREEIAVWTNLTEARVRVWFKNRRAKWRKRER--QFEAFKGSCFSTPFGTLMSPFDEXXXXXXXXXXXXXXVAWG-ATKPFPWSFNPVTNFNNPTSQNMFTFPQSAINISGVPN 979
             + QRRQRTHFTSQQLQELE+TF RNRYPDM+TREEIAVWTNLTEARVRVWFKNRRAKWRKRER  Q E  KGS F+ P G L+ P++E             A+A   A K FP++FN V N     SQ +F+ P S+I  S VP+
Sbjct:   59 KKKQRRQRTHFTSQQLQELEATFQRNRYPDMSTREEIAVWTNLTEARVRVWFKNRRAKWRKRERSQQAELCKGS-FAAPLGGLVPPYEEVYPGYSYGNWPPKALAPPLAAKTFPFAFNSV-NVGPLASQPVFS-PPSSIAASMVPS 201          
BLAST of pitx vs. Ensembl Human
Match: PITX2 (paired like homeodomain 2 [Source:HGNC Symbol;Acc:HGNC:9005])

HSP 1 Score: 140.198 bits (352), Expect = 6.902e-38
Identity = 87/147 (59.18%), Postives = 101/147 (68.71%), Query Frame = 2
Query:  518 EENSKKITSVSNRSQRRQRTHFTSQQLQELESTFSRNRYPDMNTREEIAVWTNLTEARVRVWFKNRRAKWRKRER--QFEAFKGSCFSTPFGTLMSPFDEXXXXXXXXXXXXXXV--AWGATKPFPWSFNPVTNFNNPTSQNMFTFP 946
            E+ SKK      + QRRQRTHFTSQQLQELE+TF RNRYPDM+TREEIAVWTNLTEARVRVWFKNRRAKWRKRER  Q E  K   F   F  LM P+D+       N  +A  +  A  +TK FP+ FN + N N  +SQ+MF+ P
Sbjct:   31 EDPSKK------KRQRRQRTHFTSQQLQELEATFQRNRYPDMSTREEIAVWTNLTEARVRVWFKNRRAKWRKRERNQQAELCKNG-FGPQFNGLMQPYDDMYPGYSYNNWAAKGLTSASLSTKSFPF-FNSM-NVNPLSSQSMFSPP 168          
BLAST of pitx vs. Ensembl Human
Match: PITX2 (paired like homeodomain 2 [Source:HGNC Symbol;Acc:HGNC:9005])

HSP 1 Score: 140.198 bits (352), Expect = 6.902e-38
Identity = 87/147 (59.18%), Postives = 101/147 (68.71%), Query Frame = 2
Query:  518 EENSKKITSVSNRSQRRQRTHFTSQQLQELESTFSRNRYPDMNTREEIAVWTNLTEARVRVWFKNRRAKWRKRER--QFEAFKGSCFSTPFGTLMSPFDEXXXXXXXXXXXXXXV--AWGATKPFPWSFNPVTNFNNPTSQNMFTFP 946
            E+ SKK      + QRRQRTHFTSQQLQELE+TF RNRYPDM+TREEIAVWTNLTEARVRVWFKNRRAKWRKRER  Q E  K   F   F  LM P+D+       N  +A  +  A  +TK FP+ FN + N N  +SQ+MF+ P
Sbjct:   31 EDPSKK------KRQRRQRTHFTSQQLQELEATFQRNRYPDMSTREEIAVWTNLTEARVRVWFKNRRAKWRKRERNQQAELCKNG-FGPQFNGLMQPYDDMYPGYSYNNWAAKGLTSASLSTKSFPF-FNSM-NVNPLSSQSMFSPP 168          
BLAST of pitx vs. Ensembl Human
Match: PITX2 (paired like homeodomain 2 [Source:HGNC Symbol;Acc:HGNC:9005])

HSP 1 Score: 141.739 bits (356), Expect = 7.160e-38
Identity = 87/147 (59.18%), Postives = 101/147 (68.71%), Query Frame = 2
Query:  518 EENSKKITSVSNRSQRRQRTHFTSQQLQELESTFSRNRYPDMNTREEIAVWTNLTEARVRVWFKNRRAKWRKRER--QFEAFKGSCFSTPFGTLMSPFDEXXXXXXXXXXXXXXV--AWGATKPFPWSFNPVTNFNNPTSQNMFTFP 946
            E+ SKK      + QRRQRTHFTSQQLQELE+TF RNRYPDM+TREEIAVWTNLTEARVRVWFKNRRAKWRKRER  Q E  K   F   F  LM P+D+       N  +A  +  A  +TK FP+ FN + N N  +SQ+MF+ P
Sbjct:   84 EDPSKK------KRQRRQRTHFTSQQLQELEATFQRNRYPDMSTREEIAVWTNLTEARVRVWFKNRRAKWRKRERNQQAELCKNG-FGPQFNGLMQPYDDMYPGYSYNNWAAKGLTSASLSTKSFPF-FNSM-NVNPLSSQSMFSPP 221          
BLAST of pitx vs. Ensembl Celegans
Match: unc-30 (Homeobox protein unc-30 [Source:UniProtKB/Swiss-Prot;Acc:P52906])

HSP 1 Score: 120.168 bits (300), Expect = 2.300e-30
Identity = 76/168 (45.24%), Postives = 95/168 (56.55%), Query Frame = 2
Query:  563 RRQRTHFTSQQLQELESTFSRNRYPDMNTREEIAVWTNLTEARVRVWFKNRRAKWRKRERQFEAFKGSCFS-------TPFGTLMSPFDEXXXXXXXXXXXXXXV------AWGATKPFPWSFNPVTNFNNPTSQNMFTFPQSAINISGVPNLGSMSNLTSNTNYSTA 1027
            RRQRTHFTS QL ELE+ FSRNRYPDM  REEIAVW +LTE RVRVWFKNRRAKWRKRER +    G   +        P G+L + F +++  + S+    +AV       +G      W  NP  + NN T+ N    PQ       +P    MS  T+ + +STA
Sbjct:  113 RRQRTHFTSHQLTELENWFSRNRYPDMACREEIAVWISLTEPRVRVWFKNRRAKWRKRERNYVIDNGQGTTKVTAQSLDPLGSLQNTFPQTLLQSSSSQLDDSAVTSSSFYGYGGA----WQQNPYYSRNNQTTFNWQIKPQDQFQFQTIP----MSPTTATSRFSTA 272          
BLAST of pitx vs. Ensembl Celegans
Match: unc-30 (Homeobox protein unc-30 [Source:UniProtKB/Swiss-Prot;Acc:P52906])

HSP 1 Score: 115.161 bits (287), Expect = 1.423e-28
Identity = 76/168 (45.24%), Postives = 95/168 (56.55%), Query Frame = 2
Query:  563 RRQRTHFTSQQLQELESTFSRNRYPDMNTREEIAVWTNLTEARVRVWFKNRRAKWRKRERQFEAFKGSCFS-------TPFGTLMSPFDEXXXXXXXXXXXXXXV------AWGATKPFPWSFNPVTNFNNPTSQNMFTFPQSAINISGVPNLGSMSNLTSNTNYSTA 1027
            RRQRTHFTS QL ELE+ FSRNRYPDM  REEIAVW +LTE RVRVWFKNRRAKWRKRER +    G   +        P G+L + F +++  + S+    +AV       +G      W  NP  + NN T+ N    PQ       +P    MS  T+ + +STA
Sbjct:  113 RRQRTHFTSHQLTELENWFSRNRYPDMACREEIAVWISLTEPRVRVWFKNRRAKWRKRERNYVIDNGQGTTKVTAQSLDPLGSLQNTFPQTLLQSSSSQLDDSAVTSSSFYGYGGA----WQQNPYYSRNNQTTFNWQIKPQ----FQTIP----MSPTTATSRFSTA 268          
BLAST of pitx vs. Ensembl Celegans
Match: ceh-17 (C. Elegans Homeobox; CEH-17 [Source:UniProtKB/TrEMBL;Acc:G5EC89])

HSP 1 Score: 88.9669 bits (219), Expect = 5.162e-20
Identity = 41/63 (65.08%), Postives = 51/63 (80.95%), Query Frame = 2
Query:  554 RSQRRQRTHFTSQQLQELESTFSRNRYPDMNTREEIAVWTNLTEARVRVWFKNRRAKWRKRER 742
            R QRR RT FTS QL+ELE +F    YPD+ TREEIA+  +LTEARV+VWF+NRRAK+RK+E+
Sbjct:  147 RKQRRIRTTFTSGQLKELERSFCETHYPDIYTREEIAMRIDLTEARVQVWFQNRRAKYRKQEK 209          
BLAST of pitx vs. Ensembl Celegans
Match: alr-1 (AristaLess (Drosophila homeodomain) Related [Source:UniProtKB/TrEMBL;Acc:Q21836])

HSP 1 Score: 88.5817 bits (218), Expect = 4.229e-19
Identity = 40/63 (63.49%), Postives = 49/63 (77.78%), Query Frame = 2
Query:  554 RSQRRQRTHFTSQQLQELESTFSRNRYPDMNTREEIAVWTNLTEARVRVWFKNRRAKWRKRER 742
            R QRR RT F++ QL ELE  F+R  YPD+ TREE+A    LTEARV+VWF+NRRAK+RK+ER
Sbjct:  115 RKQRRYRTTFSAFQLDELEKVFARTHYPDVFTREELATRVQLTEARVQVWFQNRRAKYRKQER 177          
BLAST of pitx vs. Ensembl Celegans
Match: unc-42 (pep chromosome:WBcel235:V:9764645:9769361:-1 gene:WBGene00006778.1 transcript:F58E6.10a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:unc-42)

HSP 1 Score: 86.2705 bits (212), Expect = 7.278e-19
Identity = 45/91 (49.45%), Postives = 59/91 (64.84%), Query Frame = 2
Query:  536 ITSVSNR-SQRRQRTHFTSQQLQELESTFSRNRYPDMNTREEIAVWTNLTEARVRVWFKNRRAKWRKRERQFEAF---KGSCFSTPFGTLM 796
            I  V+N  ++RR RT FT +QLQEL++ F ++ YPD+  REE+A  T L EAR++VWF+NRRAK RK E+Q         S  S P  TLM
Sbjct:   76 IAGVTNTPARRRHRTTFTQEQLQELDAAFQKSHYPDIYVREELARITKLNEARIQVWFQNRRAKHRKHEKQLNKAINPPHSFLSNPANTLM 166          
BLAST of pitx vs. Ensembl Fly
Match: Ptx1 (gene:FBgn0020912 transcript:FBtr0089389)

HSP 1 Score: 148.673 bits (374), Expect = 2.876e-39
Identity = 96/184 (52.17%), Postives = 115/184 (62.50%), Query Frame = 2
Query:  500 TVKSKREENSKKITSVSNRSQRRQRTHFTSQQLQELESTFSRNRYPDMNTREEIAVWTNLTEARVRVWFKNRRAKWRKRERQFEAFKGSC--FSTPFGT-LMSPF-DEXXXXXXXXXXXXXXVAWGATKPFPWSFNPVTNF----NNPTSQNMFTFPQSAI-----NISGVPNLGSMSNLTSNT 1012
            T   +  +N KK     N+ QRRQRTHFTSQQLQELE TFSRNRYPDM+TREEIA+WTNLTEARVRVWFKNRRAKWRKRER       +   F + FGT  M PF D+S+Y++Y   N     +   TKPFPW  NP+ +     ++  S N F    S +     N S +P  GSM +  SNT
Sbjct:  249 TTSGEEPKNDKK-----NKRQRRQRTHFTSQQLQELEHTFSRNRYPDMSTREEIAMWTNLTEARVRVWFKNRRAKWRKRERNAMNAAVAAADFKSGFGTQFMQPFADDSLYSSYPYNNWTKVPSPLGTKPFPWPVNPLGSMVAGNHHQNSVNCFNTGASGVAVSMNNASMLP--GSMGSSLSNT 425          
BLAST of pitx vs. Ensembl Fly
Match: Ptx1 (gene:FBgn0020912 transcript:FBtr0089391)

HSP 1 Score: 148.673 bits (374), Expect = 3.205e-39
Identity = 96/184 (52.17%), Postives = 115/184 (62.50%), Query Frame = 2
Query:  500 TVKSKREENSKKITSVSNRSQRRQRTHFTSQQLQELESTFSRNRYPDMNTREEIAVWTNLTEARVRVWFKNRRAKWRKRERQFEAFKGSC--FSTPFGT-LMSPF-DEXXXXXXXXXXXXXXVAWGATKPFPWSFNPVTNF----NNPTSQNMFTFPQSAI-----NISGVPNLGSMSNLTSNT 1012
            T   +  +N KK     N+ QRRQRTHFTSQQLQELE TFSRNRYPDM+TREEIA+WTNLTEARVRVWFKNRRAKWRKRER       +   F + FGT  M PF D+S+Y++Y   N     +   TKPFPW  NP+ +     ++  S N F    S +     N S +P  GSM +  SNT
Sbjct:  254 TTSGEEPKNDKK-----NKRQRRQRTHFTSQQLQELEHTFSRNRYPDMSTREEIAMWTNLTEARVRVWFKNRRAKWRKRERNAMNAAVAAADFKSGFGTQFMQPFADDSLYSSYPYNNWTKVPSPLGTKPFPWPVNPLGSMVAGNHHQNSVNCFNTGASGVAVSMNNASMLP--GSMGSSLSNT 430          
BLAST of pitx vs. Ensembl Fly
Match: Ptx1 (gene:FBgn0020912 transcript:FBtr0330094)

HSP 1 Score: 149.828 bits (377), Expect = 3.268e-39
Identity = 96/184 (52.17%), Postives = 115/184 (62.50%), Query Frame = 2
Query:  500 TVKSKREENSKKITSVSNRSQRRQRTHFTSQQLQELESTFSRNRYPDMNTREEIAVWTNLTEARVRVWFKNRRAKWRKRERQFEAFKGSC--FSTPFGT-LMSPF-DEXXXXXXXXXXXXXXVAWGATKPFPWSFNPVTNF----NNPTSQNMFTFPQSAI-----NISGVPNLGSMSNLTSNT 1012
            T   +  +N KK     N+ QRRQRTHFTSQQLQELE TFSRNRYPDM+TREEIA+WTNLTEARVRVWFKNRRAKWRKRER       +   F + FGT  M PF D+S+Y++Y   N     +   TKPFPW  NP+ +     ++  S N F    S +     N S +P  GSM +  SNT
Sbjct:  249 TTSGEEPKNDKK-----NKRQRRQRTHFTSQQLQELEHTFSRNRYPDMSTREEIAMWTNLTEARVRVWFKNRRAKWRKRERNAMNAAVAAADFKSGFGTQFMQPFADDSLYSSYPYNNWTKVPSPLGTKPFPWPVNPLGSMVAGNHHQNSVNCFNTGASGVAVSMNNASMLP--GSMGSSLSNT 425          
BLAST of pitx vs. Ensembl Fly
Match: al (gene:FBgn0000061 transcript:FBtr0078053)

HSP 1 Score: 95.1301 bits (235), Expect = 4.652e-21
Identity = 42/64 (65.62%), Postives = 51/64 (79.69%), Query Frame = 2
Query:  551 NRSQRRQRTHFTSQQLQELESTFSRNRYPDMNTREEIAVWTNLTEARVRVWFKNRRAKWRKRER 742
             R QRR RT FTS QL+ELE  FSR  YPD+ TREE+A+   LTEAR++VWF+NRRAKWRK+E+
Sbjct:   82 KRKQRRYRTTFTSFQLEELEKAFSRTHYPDVFTREELAMKIGLTEARIQVWFQNRRAKWRKQEK 145          
BLAST of pitx vs. Ensembl Fly
Match: Drgx (gene:FBgn0085369 transcript:FBtr0302391)

HSP 1 Score: 95.9005 bits (237), Expect = 7.106e-21
Identity = 42/63 (66.67%), Postives = 52/63 (82.54%), Query Frame = 2
Query:  554 RSQRRQRTHFTSQQLQELESTFSRNRYPDMNTREEIAVWTNLTEARVRVWFKNRRAKWRKRER 742
            R QRR RT FT QQL+ELE+ F++  YPD+ TRE++A+  NLTEARV+VWF+NRRAKWRK ER
Sbjct:   50 RKQRRNRTTFTLQQLEELETAFAQTHYPDVFTREDLAMKINLTEARVQVWFQNRRAKWRKAER 112          
BLAST of pitx vs. Ensembl Zebrafish
Match: pitx3 (paired-like homeodomain 3 [Source:NCBI gene;Acc:402974])

HSP 1 Score: 140.584 bits (353), Expect = 4.157e-38
Identity = 81/137 (59.12%), Postives = 95/137 (69.34%), Query Frame = 2
Query:  554 RSQRRQRTHFTSQQLQELESTFSRNRYPDMNTREEIAVWTNLTEARVRVWFKNRRAKWRKRER--QFEAFKGSCFSTPFGTLMSPFDEXXXXXXXXXXXXXXVAWG--ATKPFPWSFNPVTNFNNPTSQNMFTFPQS 952
            + QRRQRTHFTSQQLQELE+TF RNRYPDM+TREEIAVWTNLTEARVRVWFKNRRAKWRKRER  Q E  K   F   F  LM P+D+       N  +  ++A    + K FP+ FN + N +  +SQ MF+ P S
Sbjct:   58 KKQRRQRTHFTSQQLQELEATFQRNRYPDMSTREEIAVWTNLTEARVRVWFKNRRAKWRKRERNQQAELCKNG-FGAQFNGLMQPYDDMYSGYSYNNWATKSLASSPLSAKSFPF-FNSM-NVSPLSSQPMFSPPSS 191          
BLAST of pitx vs. Ensembl Zebrafish
Match: pitx3 (paired-like homeodomain 3 [Source:NCBI gene;Acc:402974])

HSP 1 Score: 141.354 bits (355), Expect = 4.738e-38
Identity = 81/137 (59.12%), Postives = 95/137 (69.34%), Query Frame = 2
Query:  554 RSQRRQRTHFTSQQLQELESTFSRNRYPDMNTREEIAVWTNLTEARVRVWFKNRRAKWRKRER--QFEAFKGSCFSTPFGTLMSPFDEXXXXXXXXXXXXXXVAWG--ATKPFPWSFNPVTNFNNPTSQNMFTFPQS 952
            + QRRQRTHFTSQQLQELE+TF RNRYPDM+TREEIAVWTNLTEARVRVWFKNRRAKWRKRER  Q E  K   F   F  LM P+D+       N  +  ++A    + K FP+ FN + N +  +SQ MF+ P S
Sbjct:   71 KKQRRQRTHFTSQQLQELEATFQRNRYPDMSTREEIAVWTNLTEARVRVWFKNRRAKWRKRERNQQAELCKNG-FGAQFNGLMQPYDDMYSGYSYNNWATKSLASSPLSAKSFPF-FNSM-NVSPLSSQPMFSPPSS 204          
BLAST of pitx vs. Ensembl Zebrafish
Match: pitx3 (paired-like homeodomain 3 [Source:NCBI gene;Acc:402974])

HSP 1 Score: 140.584 bits (353), Expect = 4.941e-38
Identity = 81/137 (59.12%), Postives = 95/137 (69.34%), Query Frame = 2
Query:  554 RSQRRQRTHFTSQQLQELESTFSRNRYPDMNTREEIAVWTNLTEARVRVWFKNRRAKWRKRER--QFEAFKGSCFSTPFGTLMSPFDEXXXXXXXXXXXXXXVAWG--ATKPFPWSFNPVTNFNNPTSQNMFTFPQS 952
            + QRRQRTHFTSQQLQELE+TF RNRYPDM+TREEIAVWTNLTEARVRVWFKNRRAKWRKRER  Q E  K   F   F  LM P+D+       N  +  ++A    + K FP+ FN + N +  +SQ MF+ P S
Sbjct:   58 KKQRRQRTHFTSQQLQELEATFQRNRYPDMSTREEIAVWTNLTEARVRVWFKNRRAKWRKRERNQQAELCKNG-FGAQFNGLMQPYDDMYSGYSYNNWATKSLASSPLSAKSFPF-FNSM-NVSPLSSQPMFSPPSS 191          
BLAST of pitx vs. Ensembl Zebrafish
Match: pitx3 (paired-like homeodomain 3 [Source:NCBI gene;Acc:402974])

HSP 1 Score: 140.584 bits (353), Expect = 4.941e-38
Identity = 81/137 (59.12%), Postives = 95/137 (69.34%), Query Frame = 2
Query:  554 RSQRRQRTHFTSQQLQELESTFSRNRYPDMNTREEIAVWTNLTEARVRVWFKNRRAKWRKRER--QFEAFKGSCFSTPFGTLMSPFDEXXXXXXXXXXXXXXVAWG--ATKPFPWSFNPVTNFNNPTSQNMFTFPQS 952
            + QRRQRTHFTSQQLQELE+TF RNRYPDM+TREEIAVWTNLTEARVRVWFKNRRAKWRKRER  Q E  K   F   F  LM P+D+       N  +  ++A    + K FP+ FN + N +  +SQ MF+ P S
Sbjct:   58 KKQRRQRTHFTSQQLQELEATFQRNRYPDMSTREEIAVWTNLTEARVRVWFKNRRAKWRKRERNQQAELCKNG-FGAQFNGLMQPYDDMYSGYSYNNWATKSLASSPLSAKSFPF-FNSM-NVSPLSSQPMFSPPSS 191          
BLAST of pitx vs. Ensembl Zebrafish
Match: pitx2 (paired-like homeodomain 2 [Source:NCBI gene;Acc:30164])

HSP 1 Score: 139.813 bits (351), Expect = 5.997e-38
Identity = 83/135 (61.48%), Postives = 96/135 (71.11%), Query Frame = 2
Query:  554 RSQRRQRTHFTSQQLQELESTFSRNRYPDMNTREEIAVWTNLTEARVRVWFKNRRAKWRKRER--QFEAFKGSCFSTPFGTLMSPFDEXXXXXXXXXXXXXXV--AWGATKPFPWSFNPVTNFNNPTSQNMFTFP 946
            + QRRQRTHFTSQQLQELE+TF RNRYPDM+TREEIAVWTNLTEARVRVWFKNRRAKWRKRER  Q E  K   F   F  LM P+D+   +   N  +A  +  A  +TK FP+ FN + N N  +SQ MF+ P
Sbjct:   35 KRQRRQRTHFTSQQLQELEATFQRNRYPDMSTREEIAVWTNLTEARVRVWFKNRRAKWRKRERNQQAELCKNG-FGPQFNGLMQPYDDMYPSYTYNNWAAKGLTSASLSTKSFPF-FNSM-NVNPLSSQTMFSPP 166          
BLAST of pitx vs. Ensembl Xenopus
Match: tnf (tumor necrosis factor [Source:Xenbase;Acc:XB-GENE-480131])

HSP 1 Score: 142.51 bits (358), Expect = 1.414e-38
Identity = 83/154 (53.90%), Postives = 101/154 (65.58%), Query Frame = 2
Query:  554 RSQRRQRTHFTSQQLQELESTFSRNRYPDMNTREEIAVWTNLTEARVRVWFKNRRAKWRKRER--QFEAFKGSCFSTPFGTLMSPFDEXXXXXXXXXXXXXXVAWG--ATKPFPW----SFNPVTN---FNNPTSQNMFTFPQSAI--NISGVP 976
            + QRRQRTHFTSQQLQELE+TF RNRYPDM+TREEIAVWTNLTEARVRVWFKNRRAKWRKRER  Q E  K S F   F  LM P+D+       N  +   +A    + K FP+    + +P+++   F+ P S    T P S +   ++GVP
Sbjct:   58 KKQRRQRTHFTSQQLQELEATFQRNRYPDMSTREEIAVWTNLTEARVRVWFKNRRAKWRKRERNQQAELCKNS-FGAQFNGLMQPYDDMYSGYSYNNWATKGLATSPLSAKSFPFFNSMNVSPLSSQPMFSPPNSIASMTMPSSMVPSAVTGVP 210          
BLAST of pitx vs. Ensembl Xenopus
Match: ropn1l (rhophilin associated tail protein 1-like [Source:Xenbase;Acc:XB-GENE-945780])

HSP 1 Score: 142.51 bits (358), Expect = 2.064e-38
Identity = 88/148 (59.46%), Postives = 103/148 (69.59%), Query Frame = 2
Query:  506 KSKREENSKKITSVSNRSQRRQRTHFTSQQLQELESTFSRNRYPDMNTREEIAVWTNLTEARVRVWFKNRRAKWRKRER--QFEAFKGSCFSTPFGTLMSPFDEXXXXXXXXXXXXXXV--AWGATKPFPWSFNPVTNFNNPTSQNMF 937
            +SK E++S    S   R QRRQRTHFTSQQLQELE+TF RNRYPDM+TREEIAVWTNLTEARVRVWFKNRRAKWRKRER  Q E  K   F   F  LM P+D+   +   N  +A  +  A  +TK FP+ FN + N N  +SQ+MF
Sbjct:   61 QSKNEDSSTDDPSKKKR-QRRQRTHFTSQQLQELEATFQRNRYPDMSTREEIAVWTNLTEARVRVWFKNRRAKWRKRERNQQAELCKNG-FGPQFNGLMQPYDDMYPSYSYNNWAAKGLTSASLSTKSFPF-FNSM-NVNPLSSQSMF 204          
BLAST of pitx vs. Ensembl Xenopus
Match: ropn1l (rhophilin associated tail protein 1-like [Source:Xenbase;Acc:XB-GENE-945780])

HSP 1 Score: 141.354 bits (355), Expect = 2.176e-38
Identity = 88/148 (59.46%), Postives = 103/148 (69.59%), Query Frame = 2
Query:  506 KSKREENSKKITSVSNRSQRRQRTHFTSQQLQELESTFSRNRYPDMNTREEIAVWTNLTEARVRVWFKNRRAKWRKRER--QFEAFKGSCFSTPFGTLMSPFDEXXXXXXXXXXXXXXV--AWGATKPFPWSFNPVTNFNNPTSQNMF 937
            +SK E++S    S   R QRRQRTHFTSQQLQELE+TF RNRYPDM+TREEIAVWTNLTEARVRVWFKNRRAKWRKRER  Q E  K   F   F  LM P+D+   +   N  +A  +  A  +TK FP+ FN + N N  +SQ+MF
Sbjct:   22 QSKNEDSSTDDPSKKKR-QRRQRTHFTSQQLQELEATFQRNRYPDMSTREEIAVWTNLTEARVRVWFKNRRAKWRKRERNQQAELCKNG-FGPQFNGLMQPYDDMYPSYSYNNWAAKGLTSASLSTKSFPF-FNSM-NVNPLSSQSMF 165          
BLAST of pitx vs. Ensembl Xenopus
Match: ropn1l (rhophilin associated tail protein 1-like [Source:Xenbase;Acc:XB-GENE-945780])

HSP 1 Score: 142.895 bits (359), Expect = 2.948e-38
Identity = 88/148 (59.46%), Postives = 103/148 (69.59%), Query Frame = 2
Query:  506 KSKREENSKKITSVSNRSQRRQRTHFTSQQLQELESTFSRNRYPDMNTREEIAVWTNLTEARVRVWFKNRRAKWRKRER--QFEAFKGSCFSTPFGTLMSPFDEXXXXXXXXXXXXXXV--AWGATKPFPWSFNPVTNFNNPTSQNMF 937
            +SK E++S    S   R QRRQRTHFTSQQLQELE+TF RNRYPDM+TREEIAVWTNLTEARVRVWFKNRRAKWRKRER  Q E  K   F   F  LM P+D+   +   N  +A  +  A  +TK FP+ FN + N N  +SQ+MF
Sbjct:   82 QSKNEDSSTDDPSKKKR-QRRQRTHFTSQQLQELEATFQRNRYPDMSTREEIAVWTNLTEARVRVWFKNRRAKWRKRERNQQAELCKNG-FGPQFNGLMQPYDDMYPSYSYNNWAAKGLTSASLSTKSFPF-FNSM-NVNPLSSQSMF 225          
BLAST of pitx vs. Ensembl Xenopus
Match: ropn1l (rhophilin associated tail protein 1-like [Source:Xenbase;Acc:XB-GENE-945780])

HSP 1 Score: 140.584 bits (353), Expect = 2.949e-36
Identity = 88/148 (59.46%), Postives = 103/148 (69.59%), Query Frame = 2
Query:  506 KSKREENSKKITSVSNRSQRRQRTHFTSQQLQELESTFSRNRYPDMNTREEIAVWTNLTEARVRVWFKNRRAKWRKRER--QFEAFKGSCFSTPFGTLMSPFDEXXXXXXXXXXXXXXV--AWGATKPFPWSFNPVTNFNNPTSQNMF 937
            +SK E++S    S   R QRRQRTHFTSQQLQELE+TF RNRYPDM+TREEIAVWTNLTEARVRVWFKNRRAKWRKRER  Q E  K   F   F  LM P+D+   +   N  +A  +  A  +TK FP+ FN + N N  +SQ+MF
Sbjct:  239 QSKNEDSSTDDPSKKKR-QRRQRTHFTSQQLQELEATFQRNRYPDMSTREEIAVWTNLTEARVRVWFKNRRAKWRKRERNQQAELCKNG-FGPQFNGLMQPYDDMYPSYSYNNWAAKGLTSASLSTKSFPF-FNSM-NVNPLSSQSMF 382          
BLAST of pitx vs. Ensembl Mouse
Match: Pitx3 (paired-like homeodomain transcription factor 3 [Source:MGI Symbol;Acc:MGI:1100498])

HSP 1 Score: 155.992 bits (393), Expect = 1.228e-43
Identity = 90/180 (50.00%), Postives = 109/180 (60.56%), Query Frame = 2
Query:  551 NRSQRRQRTHFTSQQLQELESTFSRNRYPDMNTREEIAVWTNLTEARVRVWFKNRRAKWRKRER--QFEAFKGSCFSTPFGTLMSPFDEXXXXXXXXXXXXXXVAWG-ATKPFPWSFN-----PVTN---FNNPTSQNMFTFPQSAINISGVPNLGSMSNL-TSNTNYSTATFSDSLVSV 1054
             + QRRQRTHFTSQQLQELE+TF RNRYPDM+TREEIAVWTNLTEARVRVWFKNRRAKWRKRER  Q E  KG  F+ P G L+ P++E             A+A   A K FP++FN     P+ +   F+ P+S      P +A     VP  G++  L  +    + A  S   VS 
Sbjct:   59 KKKQRRQRTHFTSQQLQELEATFQRNRYPDMSTREEIAVWTNLTEARVRVWFKNRRAKWRKRERSQQAELCKGG-FAAPLGGLVPPYEEVYPGYSYGNWPPKALAPPLAAKTFPFAFNSVNVGPLASQPVFSPPSSIAASMVPSAAAAPGTVPGPGALQGLGGAPPGLAPAAVSSGAVSC 237          
BLAST of pitx vs. Ensembl Mouse
Match: Pitx2 (paired-like homeodomain transcription factor 2 [Source:MGI Symbol;Acc:MGI:109340])

HSP 1 Score: 140.198 bits (352), Expect = 4.739e-38
Identity = 87/147 (59.18%), Postives = 101/147 (68.71%), Query Frame = 2
Query:  518 EENSKKITSVSNRSQRRQRTHFTSQQLQELESTFSRNRYPDMNTREEIAVWTNLTEARVRVWFKNRRAKWRKRER--QFEAFKGSCFSTPFGTLMSPFDEXXXXXXXXXXXXXXV--AWGATKPFPWSFNPVTNFNNPTSQNMFTFP 946
            E+ SKK      + QRRQRTHFTSQQLQELE+TF RNRYPDM+TREEIAVWTNLTEARVRVWFKNRRAKWRKRER  Q E  K   F   F  LM P+D+       N  +A  +  A  +TK FP+ FN + N N  +SQ+MF+ P
Sbjct:   31 EDPSKK------KRQRRQRTHFTSQQLQELEATFQRNRYPDMSTREEIAVWTNLTEARVRVWFKNRRAKWRKRERNQQAELCKNG-FGPQFNGLMQPYDDMYPGYSYNNWAAKGLTSASLSTKSFPF-FNSM-NVNPLSSQSMFSPP 168          
BLAST of pitx vs. Ensembl Mouse
Match: Pitx2 (paired-like homeodomain transcription factor 2 [Source:MGI Symbol;Acc:MGI:109340])

HSP 1 Score: 141.354 bits (355), Expect = 6.489e-38
Identity = 87/147 (59.18%), Postives = 101/147 (68.71%), Query Frame = 2
Query:  518 EENSKKITSVSNRSQRRQRTHFTSQQLQELESTFSRNRYPDMNTREEIAVWTNLTEARVRVWFKNRRAKWRKRER--QFEAFKGSCFSTPFGTLMSPFDEXXXXXXXXXXXXXXV--AWGATKPFPWSFNPVTNFNNPTSQNMFTFP 946
            E+ SKK      + QRRQRTHFTSQQLQELE+TF RNRYPDM+TREEIAVWTNLTEARVRVWFKNRRAKWRKRER  Q E  K   F   F  LM P+D+       N  +A  +  A  +TK FP+ FN + N N  +SQ+MF+ P
Sbjct:   84 EDPSKK------KRQRRQRTHFTSQQLQELEATFQRNRYPDMSTREEIAVWTNLTEARVRVWFKNRRAKWRKRERNQQAELCKNG-FGPQFNGLMQPYDDMYPGYSYNNWAAKGLTSASLSTKSFPF-FNSM-NVNPLSSQSMFSPP 221          
BLAST of pitx vs. Ensembl Mouse
Match: Pitx2 (paired-like homeodomain transcription factor 2 [Source:MGI Symbol;Acc:MGI:109340])

HSP 1 Score: 140.584 bits (353), Expect = 1.114e-37
Identity = 87/147 (59.18%), Postives = 101/147 (68.71%), Query Frame = 2
Query:  518 EENSKKITSVSNRSQRRQRTHFTSQQLQELESTFSRNRYPDMNTREEIAVWTNLTEARVRVWFKNRRAKWRKRER--QFEAFKGSCFSTPFGTLMSPFDEXXXXXXXXXXXXXXV--AWGATKPFPWSFNPVTNFNNPTSQNMFTFP 946
            E+ SKK      + QRRQRTHFTSQQLQELE+TF RNRYPDM+TREEIAVWTNLTEARVRVWFKNRRAKWRKRER  Q E  K   F   F  LM P+D+       N  +A  +  A  +TK FP+ FN + N N  +SQ+MF+ P
Sbjct:   77 EDPSKK------KRQRRQRTHFTSQQLQELEATFQRNRYPDMSTREEIAVWTNLTEARVRVWFKNRRAKWRKRERNQQAELCKNG-FGPQFNGLMQPYDDMYPGYSYNNWAAKGLTSASLSTKSFPF-FNSM-NVNPLSSQSMFSPP 214          
BLAST of pitx vs. Ensembl Mouse
Match: Pitx2 (paired-like homeodomain transcription factor 2 [Source:MGI Symbol;Acc:MGI:109340])

HSP 1 Score: 140.198 bits (352), Expect = 1.136e-37
Identity = 87/147 (59.18%), Postives = 101/147 (68.71%), Query Frame = 2
Query:  518 EENSKKITSVSNRSQRRQRTHFTSQQLQELESTFSRNRYPDMNTREEIAVWTNLTEARVRVWFKNRRAKWRKRER--QFEAFKGSCFSTPFGTLMSPFDEXXXXXXXXXXXXXXV--AWGATKPFPWSFNPVTNFNNPTSQNMFTFP 946
            E+ SKK      + QRRQRTHFTSQQLQELE+TF RNRYPDM+TREEIAVWTNLTEARVRVWFKNRRAKWRKRER  Q E  K   F   F  LM P+D+       N  +A  +  A  +TK FP+ FN + N N  +SQ+MF+ P
Sbjct:   64 EDPSKK------KRQRRQRTHFTSQQLQELEATFQRNRYPDMSTREEIAVWTNLTEARVRVWFKNRRAKWRKRERNQQAELCKNG-FGPQFNGLMQPYDDMYPGYSYNNWAAKGLTSASLSTKSFPF-FNSM-NVNPLSSQSMFSPP 201          
BLAST of pitx vs. UniProt/SwissProt
Match: sp|O75364|PITX3_HUMAN (Pituitary homeobox 3 OS=Homo sapiens OX=9606 GN=PITX3 PE=1 SV=1)

HSP 1 Score: 155.992 bits (393), Expect = 8.328e-43
Identity = 88/146 (60.27%), Postives = 102/146 (69.86%), Query Frame = 2
Query:  551 NRSQRRQRTHFTSQQLQELESTFSRNRYPDMNTREEIAVWTNLTEARVRVWFKNRRAKWRKRER--QFEAFKGSCFSTPFGTLMSPFDEXXXXXXXXXXXXXXVAWG-ATKPFPWSFNPVTNFNNPTSQNMFTFPQSAINISGVPN 979
             + QRRQRTHFTSQQLQELE+TF RNRYPDM+TREEIAVWTNLTEARVRVWFKNRRAKWRKRER  Q E  KGS F+ P G L+ P++E             A+A   A K FP++FN V N     SQ +F+ P S+I  S VP+
Sbjct:   59 KKKQRRQRTHFTSQQLQELEATFQRNRYPDMSTREEIAVWTNLTEARVRVWFKNRRAKWRKRERSQQAELCKGS-FAAPLGGLVPPYEEVYPGYSYGNWPPKALAPPLAAKTFPFAFNSV-NVGPLASQPVFS-PPSSIAASMVPS 201          
BLAST of pitx vs. UniProt/SwissProt
Match: sp|O35160|PITX3_MOUSE (Pituitary homeobox 3 OS=Mus musculus OX=10090 GN=Pitx3 PE=1 SV=1)

HSP 1 Score: 155.992 bits (393), Expect = 8.593e-43
Identity = 90/180 (50.00%), Postives = 109/180 (60.56%), Query Frame = 2
Query:  551 NRSQRRQRTHFTSQQLQELESTFSRNRYPDMNTREEIAVWTNLTEARVRVWFKNRRAKWRKRER--QFEAFKGSCFSTPFGTLMSPFDEXXXXXXXXXXXXXXVAWG-ATKPFPWSFN-----PVTN---FNNPTSQNMFTFPQSAINISGVPNLGSMSNL-TSNTNYSTATFSDSLVSV 1054
             + QRRQRTHFTSQQLQELE+TF RNRYPDM+TREEIAVWTNLTEARVRVWFKNRRAKWRKRER  Q E  KG  F+ P G L+ P++E             A+A   A K FP++FN     P+ +   F+ P+S      P +A     VP  G++  L  +    + A  S   VS 
Sbjct:   59 KKKQRRQRTHFTSQQLQELEATFQRNRYPDMSTREEIAVWTNLTEARVRVWFKNRRAKWRKRERSQQAELCKGG-FAAPLGGLVPPYEEVYPGYSYGNWPPKALAPPLAAKTFPFAFNSVNVGPLASQPVFSPPSSIAASMVPSAAAAPGTVPGPGALQGLGGAPPGLAPAAVSSGAVSC 237          
BLAST of pitx vs. UniProt/SwissProt
Match: sp|P81062|PITX3_RAT (Pituitary homeobox 3 OS=Rattus norvegicus OX=10116 GN=Pitx3 PE=1 SV=2)

HSP 1 Score: 155.992 bits (393), Expect = 9.638e-43
Identity = 90/180 (50.00%), Postives = 109/180 (60.56%), Query Frame = 2
Query:  551 NRSQRRQRTHFTSQQLQELESTFSRNRYPDMNTREEIAVWTNLTEARVRVWFKNRRAKWRKRER--QFEAFKGSCFSTPFGTLMSPFDEXXXXXXXXXXXXXXVAWG-ATKPFPWSFN-----PVTN---FNNPTSQNMFTFPQSAINISGVPNLGSMSNL-TSNTNYSTATFSDSLVSV 1054
             + QRRQRTHFTSQQLQELE+TF RNRYPDM+TREEIAVWTNLTEARVRVWFKNRRAKWRKRER  Q E  KG  F+ P G L+ P++E             A+A   A K FP++FN     P+ +   F+ P+S      P +A     VP  G++  L  +    + A  S   VS 
Sbjct:   59 KKKQRRQRTHFTSQQLQELEATFQRNRYPDMSTREEIAVWTNLTEARVRVWFKNRRAKWRKRERSQQAELCKGG-FAAPLGGLVPPYEEVYPGYTYGNWPPKALAPPLAAKTFPFAFNSVNVGPLASQPVFSPPSSIAASMVPSAAAAPGTVPGPGALQGLGGAPPGLAPAAVSSGAVSC 237          
BLAST of pitx vs. UniProt/SwissProt
Match: sp|O18400|PITX_DROME (Pituitary homeobox homolog Ptx1 OS=Drosophila melanogaster OX=7227 GN=Ptx1 PE=2 SV=2)

HSP 1 Score: 148.673 bits (374), Expect = 2.883e-38
Identity = 96/184 (52.17%), Postives = 115/184 (62.50%), Query Frame = 2
Query:  500 TVKSKREENSKKITSVSNRSQRRQRTHFTSQQLQELESTFSRNRYPDMNTREEIAVWTNLTEARVRVWFKNRRAKWRKRERQFEAFKGSC--FSTPFGT-LMSPF-DEXXXXXXXXXXXXXXVAWGATKPFPWSFNPVTNF----NNPTSQNMFTFPQSAI-----NISGVPNLGSMSNLTSNT 1012
            T   +  +N KK     N+ QRRQRTHFTSQQLQELE TFSRNRYPDM+TREEIA+WTNLTEARVRVWFKNRRAKWRKRER       +   F + FGT  M PF D+S+Y++Y   N     +   TKPFPW  NP+ +     ++  S N F    S +     N S +P  GSM +  SNT
Sbjct:  249 TTSGEEPKNDKK-----NKRQRRQRTHFTSQQLQELEHTFSRNRYPDMSTREEIAMWTNLTEARVRVWFKNRRAKWRKRERNAMNAAVAAADFKSGFGTQFMQPFADDSLYSSYPYNNWTKVPSPLGTKPFPWPVNPLGSMVAGNHHQNSVNCFNTGASGVAVSMNNASMLP--GSMGSSLSNT 425          
BLAST of pitx vs. UniProt/SwissProt
Match: sp|Q9I8K3|PITX3_XENLA (Pituitary homeobox 3 OS=Xenopus laevis OX=8355 GN=pitx3 PE=2 SV=1)

HSP 1 Score: 141.739 bits (356), Expect = 1.337e-37
Identity = 69/99 (69.70%), Postives = 77/99 (77.78%), Query Frame = 2
Query:  521 ENSKKITSVSNRSQRRQRTHFTSQQLQELESTFSRNRYPDMNTREEIAVWTNLTEARVRVWFKNRRAKWRKRER--QFEAFKGSCFSTPFGTLMSPFDE 811
            ++S     +  + QRRQRTHFTSQQLQELE+TF RNRYPDM+TREEIAVWTNLTEARVRVWFKNRRAKWRKRER  Q E  K S F   F  LM P+D+
Sbjct:   47 DDSNPEDGILKKKQRRQRTHFTSQQLQELEATFQRNRYPDMSTREEIAVWTNLTEARVRVWFKNRRAKWRKRERNQQAELCKNS-FGAQFNGLMQPYDD 144          
BLAST of pitx vs. TrEMBL
Match: S5VYL1 (Pitx OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 699.508 bits (1804), Expect = 0.000e+0
Identity = 380/380 (100.00%), Postives = 380/380 (100.00%), Query Frame = 2
Query:  101 MHNHSNHNIYLQPPVTSHLIYNPSHNQIFGNSLFVENNIYQFEKANSCLASTENGKKLVXXXXXXXXXXXXXXGAIKNATNPSQVVVKSEFCSQNIDNIQTFSRHSPSAHAIGSLPVQAKELAGXXXXXXXTATVKSKREENSKKITSVSNRSQRRQRTHFTSQQLQELESTFSRNRYPDMNTREEIAVWTNLTEARVRVWFKNRRAKWRKRERQFEAFKGSCFSTPFGTLMSPFDEXXXXXXXXXXXXXXVAWGATKPFPWSFNPVTNFNNPTSQNMFTFPQSAINISGVPNLGSMSNLTSNTNYSTATFSDSLVSVNTSTTEPDAFDNQFRFKTRSYFNDSLTASSSFNLGYKPIHYRQPMLSTYQCSPNNPASLFSP 1240
            MHNHSNHNIYLQPPVTSHLIYNPSHNQIFGNSLFVENNIYQFEKANSCLASTENGKKLVNNNSNNNNNSNSNNGAIKNATNPSQVVVKSEFCSQNIDNIQTFSRHSPSAHAIGSLPVQAKELAGNNNPNNPTATVKSKREENSKKITSVSNRSQRRQRTHFTSQQLQELESTFSRNRYPDMNTREEIAVWTNLTEARVRVWFKNRRAKWRKRERQFEAFKGSCFSTPFGTLMSPFDESIYNNYSNYNSAAAVAWGATKPFPWSFNPVTNFNNPTSQNMFTFPQSAINISGVPNLGSMSNLTSNTNYSTATFSDSLVSVNTSTTEPDAFDNQFRFKTRSYFNDSLTASSSFNLGYKPIHYRQPMLSTYQCSPNNPASLFSP
Sbjct:    1 MHNHSNHNIYLQPPVTSHLIYNPSHNQIFGNSLFVENNIYQFEKANSCLASTENGKKLVNNNSNNNNNSNSNNGAIKNATNPSQVVVKSEFCSQNIDNIQTFSRHSPSAHAIGSLPVQAKELAGNNNPNNPTATVKSKREENSKKITSVSNRSQRRQRTHFTSQQLQELESTFSRNRYPDMNTREEIAVWTNLTEARVRVWFKNRRAKWRKRERQFEAFKGSCFSTPFGTLMSPFDESIYNNYSNYNSAAAVAWGATKPFPWSFNPVTNFNNPTSQNMFTFPQSAINISGVPNLGSMSNLTSNTNYSTATFSDSLVSVNTSTTEPDAFDNQFRFKTRSYFNDSLTASSSFNLGYKPIHYRQPMLSTYQCSPNNPASLFSP 380          
BLAST of pitx vs. TrEMBL
Match: V5SK41 (Homeobox protein OS=Schmidtea mediterranea OX=79327 GN=pitx PE=2 SV=1)

HSP 1 Score: 695.271 bits (1793), Expect = 0.000e+0
Identity = 378/380 (99.47%), Postives = 378/380 (99.47%), Query Frame = 2
Query:  101 MHNHSNHNIYLQPPVTSHLIYNPSHNQIFGNSLFVENNIYQFEKANSCLASTENGKKLVXXXXXXXXXXXXXXGAIKNATNPSQVVVKSEFCSQNIDNIQTFSRHSPSAHAIGSLPVQAKELAGXXXXXXXTATVKSKREENSKKITSVSNRSQRRQRTHFTSQQLQELESTFSRNRYPDMNTREEIAVWTNLTEARVRVWFKNRRAKWRKRERQFEAFKGSCFSTPFGTLMSPFDEXXXXXXXXXXXXXXVAWGATKPFPWSFNPVTNFNNPTSQNMFTFPQSAINISGVPNLGSMSNLTSNTNYSTATFSDSLVSVNTSTTEPDAFDNQFRFKTRSYFNDSLTASSSFNLGYKPIHYRQPMLSTYQCSPNNPASLFSP 1240
            MHNHSNHNIYLQPPVTSHLIYNPSHNQIFGNSLF ENNIYQFEKANSCLASTENGKKLVNNNSNNNNNSNSNNGAIKNATNPSQVVVKSEFCSQNIDNIQTFSRHSPSAHAIGSLPVQAKELAGNNNPNNPTATVKSKREENSKKI SVSNRSQRRQRTHFTSQQLQELESTFSRNRYPDMNTREEIAVWTNLTEARVRVWFKNRRAKWRKRERQFEAFKGSCFSTPFGTLMSPFDESIYNNYSNYNSAAAVAWGATKPFPWSFNPVTNFNNPTSQNMFTFPQSAINISGVPNLGSMSNLTSNTNYSTATFSDSLVSVNTSTTEPDAFDNQFRFKTRSYFNDSLTASSSFNLGYKPIHYRQPMLSTYQCSPNNPASLFSP
Sbjct:    1 MHNHSNHNIYLQPPVTSHLIYNPSHNQIFGNSLFGENNIYQFEKANSCLASTENGKKLVNNNSNNNNNSNSNNGAIKNATNPSQVVVKSEFCSQNIDNIQTFSRHSPSAHAIGSLPVQAKELAGNNNPNNPTATVKSKREENSKKIASVSNRSQRRQRTHFTSQQLQELESTFSRNRYPDMNTREEIAVWTNLTEARVRVWFKNRRAKWRKRERQFEAFKGSCFSTPFGTLMSPFDESIYNNYSNYNSAAAVAWGATKPFPWSFNPVTNFNNPTSQNMFTFPQSAINISGVPNLGSMSNLTSNTNYSTATFSDSLVSVNTSTTEPDAFDNQFRFKTRSYFNDSLTASSSFNLGYKPIHYRQPMLSTYQCSPNNPASLFSP 380          
BLAST of pitx vs. TrEMBL
Match: A0A2K5VRV8 (Homeobox protein OS=Macaca fascicularis OX=9541 GN=PITX3 PE=3 SV=1)

HSP 1 Score: 157.918 bits (398), Expect = 4.743e-41
Identity = 91/180 (50.56%), Postives = 110/180 (61.11%), Query Frame = 2
Query:  551 NRSQRRQRTHFTSQQLQELESTFSRNRYPDMNTREEIAVWTNLTEARVRVWFKNRRAKWRKRER--QFEAFKGSCFSTPFGTLMSPFDEXXXXXXXXXXXXXXVAWG-ATKPFPWSFN-----PVTN---FNNPTSQNMFTFPQSAINISGVPNLGSMSNL-TSNTNYSTATFSDSLVSV 1054
             + QRRQRTHFTSQQLQELE+TF RNRYPDM+TREEIAVWTNLTEARVRVWFKNRRAKWRKRER  Q E  KGS F+ P G L+ P++E             A+A   A K FP++FN     P+ +   F+ P+S      P +A     VP  G++  L  +    + A  S   VS 
Sbjct:   59 KKKQRRQRTHFTSQQLQELEATFQRNRYPDMSTREEIAVWTNLTEARVRVWFKNRRAKWRKRERSQQAELCKGS-FAAPLGGLVPPYEEVYPGYSYGNWPPKALAPPLAAKTFPFAFNSVNVGPLASQPVFSPPSSIAASMVPSAAAAPGTVPGPGALQGLGGAPPGLAPAAVSSGAVSC 237          
BLAST of pitx vs. TrEMBL
Match: A0A5F7ZI64 (Homeobox protein OS=Macaca mulatta OX=9544 GN=PITX3 PE=3 SV=1)

HSP 1 Score: 157.918 bits (398), Expect = 4.743e-41
Identity = 91/180 (50.56%), Postives = 110/180 (61.11%), Query Frame = 2
Query:  551 NRSQRRQRTHFTSQQLQELESTFSRNRYPDMNTREEIAVWTNLTEARVRVWFKNRRAKWRKRER--QFEAFKGSCFSTPFGTLMSPFDEXXXXXXXXXXXXXXVAWG-ATKPFPWSFN-----PVTN---FNNPTSQNMFTFPQSAINISGVPNLGSMSNL-TSNTNYSTATFSDSLVSV 1054
             + QRRQRTHFTSQQLQELE+TF RNRYPDM+TREEIAVWTNLTEARVRVWFKNRRAKWRKRER  Q E  KGS F+ P G L+ P++E             A+A   A K FP++FN     P+ +   F+ P+S      P +A     VP  G++  L  +    + A  S   VS 
Sbjct:   59 KKKQRRQRTHFTSQQLQELEATFQRNRYPDMSTREEIAVWTNLTEARVRVWFKNRRAKWRKRERSQQAELCKGS-FAAPLGGLVPPYEEVYPGYSYGNWPPKALAPPLAAKTFPFAFNSVNVGPLASQPVFSPPSSIAASMVPSAAAAPGTVPGPGALQGLGGAPPGLAPAAVSSGAVSC 237          
BLAST of pitx vs. TrEMBL
Match: A0A2K5IS04 (Homeobox protein OS=Colobus angolensis palliatus OX=336983 GN=PITX3 PE=3 SV=1)

HSP 1 Score: 157.918 bits (398), Expect = 6.031e-41
Identity = 91/180 (50.56%), Postives = 110/180 (61.11%), Query Frame = 2
Query:  551 NRSQRRQRTHFTSQQLQELESTFSRNRYPDMNTREEIAVWTNLTEARVRVWFKNRRAKWRKRER--QFEAFKGSCFSTPFGTLMSPFDEXXXXXXXXXXXXXXVAWG-ATKPFPWSFN-----PVTN---FNNPTSQNMFTFPQSAINISGVPNLGSMSNL-TSNTNYSTATFSDSLVSV 1054
             + QRRQRTHFTSQQLQELE+TF RNRYPDM+TREEIAVWTNLTEARVRVWFKNRRAKWRKRER  Q E  KGS F+ P G L+ P++E             A+A   A K FP++FN     P+ +   F+ P+S      P +A     VP  G++  L  +    + A  S   VS 
Sbjct:   59 KKKQRRQRTHFTSQQLQELEATFQRNRYPDMSTREEIAVWTNLTEARVRVWFKNRRAKWRKRERSQQAELCKGS-FAAPLGGLVPPYEEVYPGYSYGNWPPKALAPPLAAKTFPFAFNSVNVGPLASQPVFSPPSSIAASMVPSAAAAPGTVPGPGALQGLGGAPPGLAPAAVSSGAVSC 237          
BLAST of pitx vs. Ensembl Cavefish
Match: pitx3 (pituitary homeobox 3 [Source:NCBI gene;Acc:103027456])

HSP 1 Score: 140.584 bits (353), Expect = 5.094e-38
Identity = 83/154 (53.90%), Postives = 102/154 (66.23%), Query Frame = 2
Query:  554 RSQRRQRTHFTSQQLQELESTFSRNRYPDMNTREEIAVWTNLTEARVRVWFKNRRAKWRKRER--QFEAFKGSCFSTPFGTLMSPFDEXXXXXXXXXXXXXXVAWG--ATKPFPWSFNPVTNFNNPTSQNMFTFPQSAINISGVPNLGSMSNLT 1003
            + QRRQRTHFTSQQLQELE+TF RNRYPDM+TREEIAVWTNLTEARVRVWFKNRRAKWRKRER  Q E  K   F   F  LM P+D+       N  +  ++A    + K FP+ FN + N +  +SQ MF+ P      S +P++   S++ 
Sbjct:   58 KKQRRQRTHFTSQQLQELEATFQRNRYPDMSTREEIAVWTNLTEARVRVWFKNRRAKWRKRERNQQAELCKNG-FGAQFNGLMQPYDDMYSGYSYNNWATKSLASSPLSAKSFPF-FNSM-NVSPLSSQPMFSPP------SSIPSMNMASSMV 202          
BLAST of pitx vs. Ensembl Cavefish
Match: pitx2 (Astyanax mexicanus paired like homeodomain 2 (pitx2), mRNA. [Source:RefSeq mRNA;Acc:NM_001291267])

HSP 1 Score: 135.576 bits (340), Expect = 1.638e-36
Identity = 65/91 (71.43%), Postives = 72/91 (79.12%), Query Frame = 2
Query:  545 VSNRSQRRQRTHFTSQQLQELESTFSRNRYPDMNTREEIAVWTNLTEARVRVWFKNRRAKWRKRER--QFEAFKGSCFSTPFGTLMSPFDE 811
               + QRRQRTHFTS QLQELE+TF RNRYPDM+TREEIAVWTNLTEARVRVWFKNRRAKWRKRER  Q E  KG  F   F  L+ P+++
Sbjct:   31 CKKKRQRRQRTHFTSAQLQELEATFQRNRYPDMSTREEIAVWTNLTEARVRVWFKNRRAKWRKRERNQQAELCKGG-FGAQFNGLVQPYED 120          
BLAST of pitx vs. Ensembl Cavefish
Match: pitx2 (Astyanax mexicanus paired like homeodomain 2 (pitx2), mRNA. [Source:RefSeq mRNA;Acc:NM_001291267])

HSP 1 Score: 136.346 bits (342), Expect = 2.207e-36
Identity = 65/88 (73.86%), Postives = 72/88 (81.82%), Query Frame = 2
Query:  554 RSQRRQRTHFTSQQLQELESTFSRNRYPDMNTREEIAVWTNLTEARVRVWFKNRRAKWRKRER--QFEAFKGSCFSTPFGTLMSPFDE 811
            + QRRQRTHFTS QLQELE+TF RNRYPDM+TREEIAVWTNLTEARVRVWFKNRRAKWRKRER  Q E  KG  F   F  L+ P+++
Sbjct:   74 KRQRRQRTHFTSAQLQELEATFQRNRYPDMSTREEIAVWTNLTEARVRVWFKNRRAKWRKRERNQQAELCKGG-FGAQFNGLVQPYED 160          
BLAST of pitx vs. Ensembl Cavefish
Match: pitx1 (paired-like homeodomain 1 [Source:ZFIN;Acc:ZDB-GENE-060421-3623])

HSP 1 Score: 129.028 bits (323), Expect = 3.434e-34
Identity = 82/162 (50.62%), Postives = 105/162 (64.81%), Query Frame = 2
Query:  554 RSQRRQRTHFTSQQLQELESTFSRNRYPDMNTREEIAVWTNLTEARVRVWFKNRRAKWRKRER--QFEAFKGSCFSTPFGTLMSPFDEXXXXXXXXXXXXXXVAWG--ATKPFPW--SFNPVTN---FNNPTSQNMFTFPQSAIN--ISGVPNLG--SMSNL 1000
            +  RRQRTHFTS QLQELE+TF RNRYPDM+TREEIAVWTNLTEARVRVWFKNRRAKWRKRER  Q +  K S +   F  L+ P+++       N  +   +     +TK FP+  S +P+T+   F+ P+S +  T   S  +  +S VP  G  ++SNL
Sbjct:   10 KKARRQRTHFTSAQLQELEATFQRNRYPDMSTREEIAVWTNLTEARVRVWFKNRRAKWRKRERNQQMDLCK-SGYLPQFSGLVQPYEDMYPPYTYNNWTNKGLGPTPLSTKSFPFFNSMSPLTSQSVFSAPSSISSMTMASSMAHSAVSAVPTAGINNISNL 170          
BLAST of pitx vs. Ensembl Cavefish
Match: drgx (dorsal root ganglia homeobox [Source:NCBI gene;Acc:103032566])

HSP 1 Score: 93.2041 bits (230), Expect = 5.842e-21
Identity = 44/71 (61.97%), Postives = 54/71 (76.06%), Query Frame = 2
Query:  554 RSQRRQRTHFTSQQLQELESTFSRNRYPDMNTREEIAVWTNLTEARVRVWFKNRRAKWRKRERQFEAFKGS 766
            R QRR RT FT QQL+ LE+ F++  YPD+ TREE+A+  NLTEARV+VWF+NRRAKWRK ER     +GS
Sbjct:   40 RKQRRNRTTFTLQQLEALEAVFAQTHYPDVFTREELAMKINLTEARVQVWFQNRRAKWRKTERGSSDQEGS 110          
BLAST of pitx vs. Ensembl Sea Lamprey
Match: dmbx1b (diencephalon/mesencephalon homeobox 1b [Source:NCBI gene;Acc:550288])

HSP 1 Score: 88.1965 bits (217), Expect = 1.458e-19
Identity = 39/64 (60.94%), Postives = 50/64 (78.12%), Query Frame = 2
Query:  560 QRRQRTHFTSQQLQELESTFSRNRYPDMNTREEIAVWTNLTEARVRVWFKNRRAKWRKRERQFE 751
            QRR RT FT+QQL+ LE TF +  YPD+  RE +A+ TNL EARV+VWFKNRRAK+RK++R  +
Sbjct:   43 QRRSRTAFTAQQLEALEKTFQKTHYPDVVMRERLAMCTNLPEARVQVWFKNRRAKFRKKQRSLQ 106          
BLAST of pitx vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010761.1 (pep scaffold:Pmarinus_7.0:GL476415:928307:936594:-1 gene:ENSPMAG00000009746.1 transcript:ENSPMAT00000010761.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 78.9518 bits (193), Expect = 1.277e-18
Identity = 38/60 (63.33%), Postives = 46/60 (76.67%), Query Frame = 2
Query:  551 NRSQRRQRTHFTSQQLQELESTFSRNRYPDMNTREEIAVWTNLTEARVRVWFKNRRAKWR 730
            NR QRR+RT FT  QL  LE+ FS+ RYPD+  REE+A+  NL E+RV+VWFKNRRAK R
Sbjct:    3 NRKQRRERTTFTRAQLDVLEALFSKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCR 62          
BLAST of pitx vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001141.1 (pep scaffold:Pmarinus_7.0:GL478075:36995:38394:-1 gene:ENSPMAG00000001023.1 transcript:ENSPMAT00000001141.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 63.1586 bits (152), Expect = 6.453e-13
Identity = 30/57 (52.63%), Postives = 39/57 (68.42%), Query Frame = 2
Query:  563 RRQRTHFTSQQLQELESTFSRNRYPDMNTREEIAVWTNLTEARVRVWFKNRRAKWRK 733
            RR RT F+SQQL ELE  FSR RY     R ++A    LTE +V++WF+NRR KW++
Sbjct:    4 RRPRTAFSSQQLLELERHFSRQRYLSRPQRFQVASALMLTETQVKIWFQNRRMKWKR 60          
BLAST of pitx vs. Ensembl Sea Lamprey
Match: otx5 (orthodenticle homolog 5 [Source:ZFIN;Acc:ZDB-GENE-030508-1])

HSP 1 Score: 63.1586 bits (152), Expect = 2.114e-11
Identity = 31/60 (51.67%), Postives = 41/60 (68.33%), Query Frame = 2
Query:  545 VSNRSQRRQRTHFTSQQLQELESTFSRNRYPDMNTREEIAVWTNLTEARVRVWFKNRRAK 724
             + R QRR+RT FT  QL +LES FS+ RYPD+  REE+A+  NL E+RV++ F   R K
Sbjct:   33 AAPRKQRRERTTFTRAQL-DLESLFSKTRYPDIFMREEVALKINLPESRVQINFPESRVK 91          
BLAST of pitx vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007188.1 (pep scaffold:Pmarinus_7.0:GL477571:301368:307708:1 gene:ENSPMAG00000006495.1 transcript:ENSPMAT00000007188.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 62.7734 bits (151), Expect = 5.816e-11
Identity = 28/59 (47.46%), Postives = 40/59 (67.80%), Query Frame = 2
Query:  569 QRTHFTSQQLQELESTFSRNRYPDMNTREEIAVWTNLTEARVRVWFKNRRAKWRKRERQ 745
            QRT+F+++QL ELE  F  N+Y     R EIA    L E +V++WF+NRR K +KRE++
Sbjct:  300 QRTNFSTKQLTELEKEFHFNKYLTRARRVEIAAALQLNETQVKIWFQNRRMKQKKREKE 358          
BLAST of pitx vs. Ensembl Yeast
Match: PHO2 (Homeobox transcription factor; regulatory targets include genes involved in phosphate metabolism; binds cooperatively with Pho4p to the PHO5 promoter; phosphorylation of Pho2p facilitates interaction with Pho4p; relocalizes to the cytosol in response to hypoxia [Source:SGD;Acc:S000002264])

HSP 1 Score: 50.447 bits (119), Expect = 3.509e-7
Identity = 26/83 (31.33%), Postives = 47/83 (56.63%), Query Frame = 2
Query:  503 VKSKREENSKKITSVSNRS----QRRQRTHFTSQQLQELESTFSRNRYPDMNTREEIAVWTNLTEARVRVWFKNRRAKWRKRE 739
            ++   ++++  +++ SN S    QR +RT    + L  L+  F  N  P +  R++I+    + E  VR+WF+NRRAK RK++
Sbjct:   54 LEHDHDQHTNDMSASSNASDSGPQRPKRTRAKGEALDVLKRKFEINPTPSLVERKKISDLIGMPEKNVRIWFQNRRAKLRKKQ 136          
BLAST of pitx vs. Ensembl Nematostella
Match: EDO49647 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RFR4])

HSP 1 Score: 108.612 bits (270), Expect = 2.647e-29
Identity = 52/66 (78.79%), Postives = 58/66 (87.88%), Query Frame = 2
Query:  545 VSNRSQRRQRTHFTSQQLQELESTFSRNRYPDMNTREEIAVWTNLTEARVRVWFKNRRAKWRKRER 742
            +  R QRRQRTHFTS QLQ+LE TF RNRYPDM  REEIA++TNLTEARVRVWFKNRRAKWRK+E+
Sbjct:    3 LKKRKQRRQRTHFTSFQLQQLEGTFGRNRYPDMQMREEIALYTNLTEARVRVWFKNRRAKWRKKEK 68          
BLAST of pitx vs. Ensembl Nematostella
Match: EDO31796 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SWY2])

HSP 1 Score: 89.7373 bits (221), Expect = 4.956e-22
Identity = 43/67 (64.18%), Postives = 53/67 (79.10%), Query Frame = 2
Query:  542 SVSNRSQRRQRTHFTSQQLQELESTFSRNRYPDMNTREEIAVWTNLTEARVRVWFKNRRAKWRKRER 742
            S + R QRR RT FTS QL+ELE  F++  YPD+ TRE +AV  +LTEARV+VWF+NRRAKWRKRE+
Sbjct:   25 STAKRKQRRYRTTFTSYQLEELERAFAKTHYPDVFTREALAVKIDLTEARVQVWFQNRRAKWRKREK 91          
BLAST of pitx vs. Ensembl Nematostella
Match: EDO38926 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SBH9])

HSP 1 Score: 88.5817 bits (218), Expect = 1.216e-20
Identity = 40/67 (59.70%), Postives = 51/67 (76.12%), Query Frame = 2
Query:  542 SVSNRSQRRQRTHFTSQQLQELESTFSRNRYPDMNTREEIAVWTNLTEARVRVWFKNRRAKWRKRER 742
            S   R +RR RT FT+ QL+E+E  F +  YPD+ TRE++A+   LTEARV+VWF+NRRAKWRKRER
Sbjct:    8 SAPKRKKRRNRTTFTAYQLEEMERVFQKTHYPDVYTREQLALRCALTEARVQVWFQNRRAKWRKRER 74          
BLAST of pitx vs. Ensembl Nematostella
Match: EDO47151 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RMS9])

HSP 1 Score: 84.3445 bits (207), Expect = 2.285e-20
Identity = 38/60 (63.33%), Postives = 46/60 (76.67%), Query Frame = 2
Query:  554 RSQRRQRTHFTSQQLQELESTFSRNRYPDMNTREEIAVWTNLTEARVRVWFKNRRAKWRK 733
            R QRR RT FT QQLQELE  F +  YPD+  REE+A   N++EAR++VWF+NRRAKWRK
Sbjct:   14 RKQRRNRTTFTKQQLQELEKVFEKKHYPDIALREELAAKINISEARIQVWFQNRRAKWRK 73          
BLAST of pitx vs. Ensembl Nematostella
Match: EDO42103 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S2G7])

HSP 1 Score: 86.6557 bits (213), Expect = 1.271e-19
Identity = 38/65 (58.46%), Postives = 50/65 (76.92%), Query Frame = 2
Query:  554 RSQRRQRTHFTSQQLQELESTFSRNRYPDMNTREEIAVWTNLTEARVRVWFKNRRAKWRKRERQF 748
            R  RR RT FT+ QL +LE  F + +YPD+ TREE+A+  +L+EARV+VWF+NRRAKWRKRE+  
Sbjct:   18 RKVRRSRTTFTTYQLHQLERAFEKTQYPDVFTREELALRLDLSEARVQVWFQNRRAKWRKREKAL 82          
BLAST of pitx vs. Ensembl Medaka
Match: pitx1 (paired like homeodomain 1 [Source:NCBI gene;Acc:101170863])

HSP 1 Score: 143.28 bits (360), Expect = 2.478e-39
Identity = 82/149 (55.03%), Postives = 98/149 (65.77%), Query Frame = 2
Query:  554 RSQRRQRTHFTSQQLQELESTFSRNRYPDMNTREEIAVWTNLTEARVRVWFKNRRAKWRKRER--QFEAFKGSCFSTPFGTLMSPFDEXXXXXXXXXXXXXXVAWGATKPFPWSFNPVTNFNNP---TSQNMFTFPQSAINISGVPNLG 985
            + QRRQRTHFTSQQLQELE+TF RNRYPDM+TREEIAVWTNLTEARVRVWFKNRRAKWRKRER  Q +  K S +   F  LM P+D+       N  +   +A     P P S    T FN+    TSQ+MF+ P S  +++    +G
Sbjct:   36 KKQRRQRTHFTSQQLQELEATFQRNRYPDMSTREEIAVWTNLTEARVRVWFKNRRAKWRKRERNQQMDLCKNS-YLPQFSGLMQPYDDMYPAYTYNNWTNKGLA-----PAPLSTKNFTFFNSMSPLTSQSMFSAPNSISSMTMASGMG 178          
BLAST of pitx vs. Ensembl Medaka
Match: pitx1 (paired like homeodomain 1 [Source:NCBI gene;Acc:101170863])

HSP 1 Score: 143.665 bits (361), Expect = 5.840e-39
Identity = 82/149 (55.03%), Postives = 98/149 (65.77%), Query Frame = 2
Query:  554 RSQRRQRTHFTSQQLQELESTFSRNRYPDMNTREEIAVWTNLTEARVRVWFKNRRAKWRKRER--QFEAFKGSCFSTPFGTLMSPFDEXXXXXXXXXXXXXXVAWGATKPFPWSFNPVTNFNNP---TSQNMFTFPQSAINISGVPNLG 985
            + QRRQRTHFTSQQLQELE+TF RNRYPDM+TREEIAVWTNLTEARVRVWFKNRRAKWRKRER  Q +  K S +   F  LM P+D+       N  +   +A     P P S    T FN+    TSQ+MF+ P S  +++    +G
Sbjct:   87 KKQRRQRTHFTSQQLQELEATFQRNRYPDMSTREEIAVWTNLTEARVRVWFKNRRAKWRKRERNQQMDLCKNS-YLPQFSGLMQPYDDMYPAYTYNNWTNKGLA-----PAPLSTKNFTFFNSMSPLTSQSMFSAPNSISSMTMASGMG 229          
BLAST of pitx vs. Ensembl Medaka
Match: pitx2 (paired like homeodomain 2 [Source:NCBI gene;Acc:100144366])

HSP 1 Score: 142.124 bits (357), Expect = 2.140e-38
Identity = 87/154 (56.49%), Postives = 102/154 (66.23%), Query Frame = 2
Query:  554 RSQRRQRTHFTSQQLQELESTFSRNRYPDMNTREEIAVWTNLTEARVRVWFKNRRAKWRKRER--QFEAFKGSCFSTPFGTLMSPFDEXXXXXXXXXXXXXXV--AWGATKPFPWSFNPVTNFNNPTSQNMFTFPQS---------AINISGVP 976
            + QRRQRTHFTSQQLQELE+TF RNRYPDM+TREEIAVWTNLTEARVRVWFKNRRAKWRKRER  Q E  K   F   F  LM P+D+   +   N  +A  +  A  +TK FP+ FN + N N  +SQ MF+ P S            ++GVP
Sbjct:   84 KRQRRQRTHFTSQQLQELEATFQRNRYPDMSTREEIAVWTNLTEARVRVWFKNRRAKWRKRERNQQAELCKNG-FGPQFNGLMQPYDDMYPSYTYNNWAAKGLTSASLSTKSFPF-FNSM-NVNPLSSQTMFSPPNSISSMTSSMVPAAVTGVP 234          
BLAST of pitx vs. Ensembl Medaka
Match: pitx3 (pituitary homeobox 3 [Source:NCBI gene;Acc:101166980])

HSP 1 Score: 141.354 bits (355), Expect = 7.206e-38
Identity = 84/149 (56.38%), Postives = 103/149 (69.13%), Query Frame = 2
Query:  518 EENSKKITSVSNRSQRRQRTHFTSQQLQELESTFSRNRYPDMNTREEIAVWTNLTEARVRVWFKNRRAKWRKRER--QFEAFKGSCFSTPFGTLMSPFDEXXXXXXXXXXXXXXVAWG--ATKPFPWSFNPVTNFNNPTSQNMFTFPQS 952
            +E+S +  S+  + QRRQRTHFTSQQLQELE+TF RNRYPDM+TREEIAVWTNLTEARVRVWFKNRRAKWRKRER  Q E  K   F   F  LM P+D+       N  +  ++A    +TK FP+ FN + N +  ++Q MF+ P S
Sbjct:   93 DESSAEDGSLKKK-QRRQRTHFTSQQLQELEATFQRNRYPDMSTREEIAVWTNLTEARVRVWFKNRRAKWRKRERNQQAELCKNG-FGAQFNGLMQPYDDMYTGYSYNNWATKSLASSPLSTKSFPF-FNSM-NVSPLSTQPMFSPPSS 237          
BLAST of pitx vs. Ensembl Medaka
Match: pitx2 (paired like homeodomain 2 [Source:NCBI gene;Acc:100144366])

HSP 1 Score: 141.739 bits (356), Expect = 7.998e-38
Identity = 87/155 (56.13%), Postives = 102/155 (65.81%), Query Frame = 2
Query:  554 RSQRRQRTHFTSQQLQELESTFSRNRYPDMNTREEIAVWTNLTEARVRVWFKNRRAKWRKRER--QFEAFKGSCFSTPFGTLMSPFDEXXXXXXXXXXXXXXV--AWGATKPFPWSFNPVTNFNNPTSQNMFTFPQS---------AINISGVPN 979
            + QRRQRTHFTSQQLQELE+TF RNRYPDM+TREEIAVWTNLTEARVRVWFKNRRAKWRKRER  Q E  K   F   F  LM P+D+   +   N  +A  +  A  +TK FP+ FN + N N  +SQ MF+ P S            ++GVP 
Sbjct:  134 KRQRRQRTHFTSQQLQELEATFQRNRYPDMSTREEIAVWTNLTEARVRVWFKNRRAKWRKRERNQQAELCKNG-FGPQFNGLMQPYDDMYPSYTYNNWAAKGLTSASLSTKSFPF-FNSM-NVNPLSSQTMFSPPNSISSMTSSMVPAAVTGVPG 285          
BLAST of pitx vs. Planmine SMEST
Match: SMESG000080359.1 (SMESG000080359.1)

HSP 1 Score: 696.812 bits (1797), Expect = 0.000e+0
Identity = 379/380 (99.74%), Postives = 379/380 (99.74%), Query Frame = 2
Query:  101 MHNHSNHNIYLQPPVTSHLIYNPSHNQIFGNSLFVENNIYQFEKANSCLASTENGKKLVXXXXXXXXXXXXXXGAIKNATNPSQVVVKSEFCSQNIDNIQTFSRHSPSAHAIGSLPVQAKELAGXXXXXXXTATVKSKREENSKKITSVSNRSQRRQRTHFTSQQLQELESTFSRNRYPDMNTREEIAVWTNLTEARVRVWFKNRRAKWRKRERQFEAFKGSCFSTPFGTLMSPFDEXXXXXXXXXXXXXXVAWGATKPFPWSFNPVTNFNNPTSQNMFTFPQSAINISGVPNLGSMSNLTSNTNYSTATFSDSLVSVNTSTTEPDAFDNQFRFKTRSYFNDSLTASSSFNLGYKPIHYRQPMLSTYQCSPNNPASLFSP 1240
            MHNHSNHNIYLQPPVTSHLIYNPSHNQIFGNSLF ENNIYQFEKANSCLASTENGKKLVNNNSNNNNNSNSNNGAIKNATNPSQVVVKSEFCSQNIDNIQTFSRHSPSAHAIGSLPVQAKELAGNNNPNNPTATVKSKREENSKKITSVSNRSQRRQRTHFTSQQLQELESTFSRNRYPDMNTREEIAVWTNLTEARVRVWFKNRRAKWRKRERQFEAFKGSCFSTPFGTLMSPFDESIYNNYSNYNSAAAVAWGATKPFPWSFNPVTNFNNPTSQNMFTFPQSAINISGVPNLGSMSNLTSNTNYSTATFSDSLVSVNTSTTEPDAFDNQFRFKTRSYFNDSLTASSSFNLGYKPIHYRQPMLSTYQCSPNNPASLFSP
Sbjct:    1 MHNHSNHNIYLQPPVTSHLIYNPSHNQIFGNSLFGENNIYQFEKANSCLASTENGKKLVNNNSNNNNNSNSNNGAIKNATNPSQVVVKSEFCSQNIDNIQTFSRHSPSAHAIGSLPVQAKELAGNNNPNNPTATVKSKREENSKKITSVSNRSQRRQRTHFTSQQLQELESTFSRNRYPDMNTREEIAVWTNLTEARVRVWFKNRRAKWRKRERQFEAFKGSCFSTPFGTLMSPFDESIYNNYSNYNSAAAVAWGATKPFPWSFNPVTNFNNPTSQNMFTFPQSAINISGVPNLGSMSNLTSNTNYSTATFSDSLVSVNTSTTEPDAFDNQFRFKTRSYFNDSLTASSSFNLGYKPIHYRQPMLSTYQCSPNNPASLFSP 380          
BLAST of pitx vs. Planmine SMEST
Match: SMESG000080420.1 (SMESG000080420.1)

HSP 1 Score: 93.9745 bits (232), Expect = 7.432e-21
Identity = 43/65 (66.15%), Postives = 51/65 (78.46%), Query Frame = 2
Query:  548 SNRSQRRQRTHFTSQQLQELESTFSRNRYPDMNTREEIAVWTNLTEARVRVWFKNRRAKWRKRER 742
            S R QRR RT FT QQL+ELE  F +  YPD+ TREE+A+  +LTEARV+VWF+NRRAKWRK ER
Sbjct:   33 SRRKQRRNRTTFTMQQLEELEKAFQQTHYPDVFTREELALRISLTEARVQVWFQNRRAKWRKTER 97          
BLAST of pitx vs. Planmine SMEST
Match: SMESG000080420.1 (SMESG000080420.1)

HSP 1 Score: 93.9745 bits (232), Expect = 8.196e-21
Identity = 43/65 (66.15%), Postives = 51/65 (78.46%), Query Frame = 2
Query:  548 SNRSQRRQRTHFTSQQLQELESTFSRNRYPDMNTREEIAVWTNLTEARVRVWFKNRRAKWRKRER 742
            S R QRR RT FT QQL+ELE  F +  YPD+ TREE+A+  +LTEARV+VWF+NRRAKWRK ER
Sbjct:   26 SRRKQRRNRTTFTMQQLEELEKAFQQTHYPDVFTREELALRISLTEARVQVWFQNRRAKWRKTER 90          
BLAST of pitx vs. Planmine SMEST
Match: SMESG000080420.1 (SMESG000080420.1)

HSP 1 Score: 94.3597 bits (233), Expect = 1.459e-20
Identity = 43/65 (66.15%), Postives = 51/65 (78.46%), Query Frame = 2
Query:  548 SNRSQRRQRTHFTSQQLQELESTFSRNRYPDMNTREEIAVWTNLTEARVRVWFKNRRAKWRKRER 742
            S R QRR RT FT QQL+ELE  F +  YPD+ TREE+A+  +LTEARV+VWF+NRRAKWRK ER
Sbjct:  137 SRRKQRRNRTTFTMQQLEELEKAFQQTHYPDVFTREELALRISLTEARVQVWFQNRRAKWRKTER 201          
BLAST of pitx vs. Planmine SMEST
Match: SMESG000017304.1 (SMESG000017304.1)

HSP 1 Score: 90.8929 bits (224), Expect = 4.118e-20
Identity = 44/82 (53.66%), Postives = 58/82 (70.73%), Query Frame = 2
Query:  503 VKSKREENSKKITSVSNRSQRRQRTHFTSQQLQELESTFSRNRYPDMNTREEIAVWTNLTEARVRVWFKNRRAKWRKRERQF 748
            V S   + +K+I S      RR RT FT  Q+Q+LE  FS+ +YPD+NTREE+A   +L+EARV+VWF+NRRAKWRK E +F
Sbjct:   63 VNSMNSDTNKQIKS------RRSRTTFTGSQIQKLERAFSKCQYPDVNTREELASILDLSEARVQVWFQNRRAKWRKHENKF 138          
The following BLAST results are available for this feature:
BLAST of pitx vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PITX31.734e-4360.27paired like homeodomain 3 [Source:HGNC Symbol;Acc:... [more]
PITX31.734e-4360.27paired like homeodomain 3 [Source:HGNC Symbol;Acc:... [more]
PITX26.902e-3859.18paired like homeodomain 2 [Source:HGNC Symbol;Acc:... [more]
PITX26.902e-3859.18paired like homeodomain 2 [Source:HGNC Symbol;Acc:... [more]
PITX27.160e-3859.18paired like homeodomain 2 [Source:HGNC Symbol;Acc:... [more]
back to top
BLAST of pitx vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
unc-302.300e-3045.24Homeobox protein unc-30 [Source:UniProtKB/Swiss-P... [more]
unc-301.423e-2845.24Homeobox protein unc-30 [Source:UniProtKB/Swiss-P... [more]
ceh-175.162e-2065.08C. Elegans Homeobox; CEH-17 [Source:UniProtKB/TrE... [more]
alr-14.229e-1963.49AristaLess (Drosophila homeodomain) Related [Sour... [more]
unc-427.278e-1949.45pep chromosome:WBcel235:V:9764645:9769361:-1 gene:... [more]
back to top
BLAST of pitx vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ptx12.876e-3952.17gene:FBgn0020912 transcript:FBtr0089389[more]
Ptx13.205e-3952.17gene:FBgn0020912 transcript:FBtr0089391[more]
Ptx13.268e-3952.17gene:FBgn0020912 transcript:FBtr0330094[more]
al4.652e-2165.63gene:FBgn0000061 transcript:FBtr0078053[more]
Drgx7.106e-2166.67gene:FBgn0085369 transcript:FBtr0302391[more]
back to top
BLAST of pitx vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pitx34.157e-3859.12paired-like homeodomain 3 [Source:NCBI gene;Acc:40... [more]
pitx34.738e-3859.12paired-like homeodomain 3 [Source:NCBI gene;Acc:40... [more]
pitx34.941e-3859.12paired-like homeodomain 3 [Source:NCBI gene;Acc:40... [more]
pitx34.941e-3859.12paired-like homeodomain 3 [Source:NCBI gene;Acc:40... [more]
pitx25.997e-3861.48paired-like homeodomain 2 [Source:NCBI gene;Acc:30... [more]
back to top
BLAST of pitx vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tnf1.414e-3853.90tumor necrosis factor [Source:Xenbase;Acc:XB-GENE-... [more]
ropn1l2.064e-3859.46rhophilin associated tail protein 1-like [Source:X... [more]
ropn1l2.176e-3859.46rhophilin associated tail protein 1-like [Source:X... [more]
ropn1l2.948e-3859.46rhophilin associated tail protein 1-like [Source:X... [more]
ropn1l2.949e-3659.46rhophilin associated tail protein 1-like [Source:X... [more]
back to top
BLAST of pitx vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pitx31.228e-4350.00paired-like homeodomain transcription factor 3 [So... [more]
Pitx24.739e-3859.18paired-like homeodomain transcription factor 2 [So... [more]
Pitx26.489e-3859.18paired-like homeodomain transcription factor 2 [So... [more]
Pitx21.114e-3759.18paired-like homeodomain transcription factor 2 [So... [more]
Pitx21.136e-3759.18paired-like homeodomain transcription factor 2 [So... [more]
back to top
BLAST of pitx vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O75364|PITX3_HUMAN8.328e-4360.27Pituitary homeobox 3 OS=Homo sapiens OX=9606 GN=PI... [more]
sp|O35160|PITX3_MOUSE8.593e-4350.00Pituitary homeobox 3 OS=Mus musculus OX=10090 GN=P... [more]
sp|P81062|PITX3_RAT9.638e-4350.00Pituitary homeobox 3 OS=Rattus norvegicus OX=10116... [more]
sp|O18400|PITX_DROME2.883e-3852.17Pituitary homeobox homolog Ptx1 OS=Drosophila mela... [more]
sp|Q9I8K3|PITX3_XENLA1.337e-3769.70Pituitary homeobox 3 OS=Xenopus laevis OX=8355 GN=... [more]
back to top
BLAST of pitx vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
S5VYL10.000e+0100.00Pitx OS=Schmidtea mediterranea OX=79327 PE=2 SV=1[more]
V5SK410.000e+099.47Homeobox protein OS=Schmidtea mediterranea OX=7932... [more]
A0A2K5VRV84.743e-4150.56Homeobox protein OS=Macaca fascicularis OX=9541 GN... [more]
A0A5F7ZI644.743e-4150.56Homeobox protein OS=Macaca mulatta OX=9544 GN=PITX... [more]
A0A2K5IS046.031e-4150.56Homeobox protein OS=Colobus angolensis palliatus O... [more]
back to top
BLAST of pitx vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pitx35.094e-3853.90pituitary homeobox 3 [Source:NCBI gene;Acc:1030274... [more]
pitx21.638e-3671.43Astyanax mexicanus paired like homeodomain 2 (pitx... [more]
pitx22.207e-3673.86Astyanax mexicanus paired like homeodomain 2 (pitx... [more]
pitx13.434e-3450.62paired-like homeodomain 1 [Source:ZFIN;Acc:ZDB-GEN... [more]
drgx5.842e-2161.97dorsal root ganglia homeobox [Source:NCBI gene;Acc... [more]
back to top
BLAST of pitx vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dmbx1b1.458e-1960.94diencephalon/mesencephalon homeobox 1b [Source:NCB... [more]
ENSPMAT00000010761.11.277e-1863.33pep scaffold:Pmarinus_7.0:GL476415:928307:936594:-... [more]
ENSPMAT00000001141.16.453e-1352.63pep scaffold:Pmarinus_7.0:GL478075:36995:38394:-1 ... [more]
otx52.114e-1151.67orthodenticle homolog 5 [Source:ZFIN;Acc:ZDB-GENE-... [more]
ENSPMAT00000007188.15.816e-1147.46pep scaffold:Pmarinus_7.0:GL477571:301368:307708:1... [more]
back to top
BLAST of pitx vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
PHO23.509e-731.33Homeobox transcription factor; regulatory targets ... [more]
back to top
BLAST of pitx vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO496472.647e-2978.79Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO317964.956e-2264.18Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO389261.216e-2059.70Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO471512.285e-2063.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO421031.271e-1958.46Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of pitx vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pitx12.478e-3955.03paired like homeodomain 1 [Source:NCBI gene;Acc:10... [more]
pitx15.840e-3955.03paired like homeodomain 1 [Source:NCBI gene;Acc:10... [more]
pitx22.140e-3856.49paired like homeodomain 2 [Source:NCBI gene;Acc:10... [more]
pitx37.206e-3856.38pituitary homeobox 3 [Source:NCBI gene;Acc:1011669... [more]
pitx27.998e-3856.13paired like homeodomain 2 [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of pitx vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000080359.10.000e+099.74SMESG000080359.1[more]
SMESG000080420.17.432e-2166.15SMESG000080420.1[more]
SMESG000080420.18.196e-2166.15SMESG000080420.1[more]
SMESG000080420.11.459e-2066.15SMESG000080420.1[more]
SMESG000017304.14.118e-2053.66SMESG000017304.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30009752
GenBankAGS83410.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30009752 ID=SMED30009752|Name=pitx|organism=Schmidtea mediterranea sexual|type=transcript|length=1335bp
TTTTAAGTCTCATAAATCTTAATTGATCCCAGGAAATAAATTCATAGTTA
GATCCAGTTTTAAGTACCTATCAGTTCGACAAGGGGATTATAATATCACT
ATGCATAATCACTCAAATCATAATATATATTTACAACCACCTGTTACTTC
TCATTTAATATACAATCCAAGTCACAATCAGATATTCGGCAACTCATTGT
TCGTAGAAAATAATATCTATCAATTTGAAAAAGCAAATTCTTGTTTGGCA
TCAACAGAAAACGGTAAAAAACTTGTCAATAACAACTCTAACAACAACAA
TAACAGTAACAGTAACAATGGTGCAATTAAAAATGCTACTAATCCTTCAC
AAGTTGTAGTAAAATCAGAATTTTGCAGTCAAAACATTGACAATATTCAA
ACGTTTTCGCGTCATTCTCCATCGGCTCATGCGATTGGATCTTTACCTGT
CCAGGCGAAAGAGCTTGCCGGAAATAATAATCCAAATAATCCAACTGCAA
CAGTGAAATCTAAACGTGAAGAAAATTCAAAAAAAATCACATCAGTATCG
AATCGAAGCCAAAGACGACAACGAACCCATTTCACTAGTCAACAGCTTCA
AGAATTAGAGTCTACTTTTTCCAGAAATCGGTACCCGGATATGAATACGA
GAGAAGAAATTGCGGTTTGGACAAATTTAACAGAAGCAAGAGTTAGAGTG
TGGTTCAAAAATCGAAGAGCTAAATGGAGAAAACGTGAACGACAATTTGA
AGCATTTAAAGGCTCATGTTTCAGTACACCTTTTGGAACTCTAATGTCAC
CTTTTGATGAGTCTATTTATAACAACTATTCTAATTATAATTCCGCGGCC
GCCGTTGCATGGGGAGCTACTAAGCCTTTCCCTTGGTCATTCAATCCAGT
AACAAATTTCAACAATCCAACTTCACAAAACATGTTCACATTTCCTCAAA
GTGCTATCAACATAAGCGGAGTACCGAATTTAGGATCAATGTCAAATTTG
ACAAGCAATACTAACTATTCAACTGCCACATTTTCTGACAGTCTTGTTTC
CGTTAACACTTCAACGACAGAACCAGACGCATTCGATAATCAGTTTCGTT
TTAAAACTCGAAGTTATTTCAATGATTCCTTAACGGCTTCTTCCTCTTTC
AATTTGGGATATAAACCTATACATTATCGACAGCCAATGTTGTCAACTTA
CCAGTGTTCCCCAAACAATCCTGCTTCATTATTTTCTCCGTAATTTTTTG
TGAAAATTTTAAACTTTTATTTATTGAGATTAAAAACATTTCTAATTCGA
TTAAAATTGTAAATCTTTATCTGACTTAATAAATA
back to top

protein sequence of SMED30009752-orf-1

>SMED30009752-orf-1 ID=SMED30009752-orf-1|Name=SMED30009752-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=381bp
MHNHSNHNIYLQPPVTSHLIYNPSHNQIFGNSLFVENNIYQFEKANSCLA
STENGKKLVNNNSNNNNNSNSNNGAIKNATNPSQVVVKSEFCSQNIDNIQ
TFSRHSPSAHAIGSLPVQAKELAGNNNPNNPTATVKSKREENSKKITSVS
NRSQRRQRTHFTSQQLQELESTFSRNRYPDMNTREEIAVWTNLTEARVRV
WFKNRRAKWRKRERQFEAFKGSCFSTPFGTLMSPFDESIYNNYSNYNSAA
AVAWGATKPFPWSFNPVTNFNNPTSQNMFTFPQSAINISGVPNLGSMSNL
TSNTNYSTATFSDSLVSVNTSTTEPDAFDNQFRFKTRSYFNDSLTASSSF
NLGYKPIHYRQPMLSTYQCSPNNPASLFSP*
back to top
Aliases
The feature 'pitx' has the following synonyms
Synonym
pitx
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003700transcription factor activity, sequence-specific DNA binding
GO:0003677DNA binding
GO:0043565sequence-specific DNA binding
Vocabulary: biological process
TermDefinition
GO:0007275multicellular organism development
GO:0006355regulation of transcription, DNA-templated
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000105secretory cell
PLANA:0000143ventral region of the whole animal
PLANA:0000240body wall musculature
PLANA:0000418head
PLANA:0000420parapharyngeal region
PLANA:0000463cholinergic neuron
PLANA:0000464GABAergic neuron
PLANA:0000481serotonergic neuron
PLANA:0002056medial muscle cell
Vocabulary: INTERPRO
TermDefinition
IPR001356Homeobox_dom
IPR009057Homeobox-like_sf
IPR017970Homeobox_CS
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001356Homeobox domainSMARTSM00389HOX_1coord: 154..216
e-value: 6.7E-24
score: 95.4
IPR001356Homeobox domainPFAMPF00046Homeodomaincoord: 155..211
e-value: 8.4E-22
score: 76.8
IPR001356Homeobox domainPROSITEPS50071HOMEOBOX_2coord: 152..212
score: 20.811
IPR001356Homeobox domainCDDcd00086homeodomaincoord: 155..213
e-value: 9.56813E-23
score: 88.0692
NoneNo IPR availableGENE3DG3DSA:1.10.10.60coord: 148..217
e-value: 1.9E-26
score: 93.4
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 122..136
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 122..166
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 147..166
NoneNo IPR availablePANTHERPTHR45882FAMILY NOT NAMEDcoord: 97..327
IPR017970Homeobox, conserved sitePROSITEPS00027HOMEOBOX_1coord: 187..210
IPR009057Homeobox-like domain superfamilySUPERFAMILYSSF46689Homeodomain-likecoord: 148..215