GL18378

Overview
NameGL18378
Smed IDSMED30009747
Length (bp)3171
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of GL18378 (SMED30009747) t-SNE clustered cells

Violin plots show distribution of expression levels for GL18378 (SMED30009747) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of GL18378 (SMED30009747) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for GL18378 (SMED30009747) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30009747

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 12

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30009747SMESG000007793.1 SmedASXL_015825SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30009747SMESG000007793.1 dd_Smed_v4_8061_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30009747SMESG000007793.1 dd_Smed_v4_8061_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30009747SMESG000007793.1 dd_Smed_v4_8061_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30009747SMESG000007793.1 dd_Smed_v4_8061_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30009747SMESG000007793.1 dd_Smed_v4_8061_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30009747SMESG000007793.1 dd_Smed_v4_8061_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009747SMESG000007793.1 Contig40048newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009747SMESG000007793.1 Contig40048uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009747SMESG000007793.1 Contig51556newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009747SMESG000007793.1 Contig51556uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
head regionSMED30009747SMESG000007793.1 dd_Smed_v6_8061_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of GL18378 vs. Ensembl Human
Match: CLSTN3 (calsyntenin 3 [Source:HGNC Symbol;Acc:HGNC:18371])

HSP 1 Score: 121.324 bits (303), Expect = 3.446e-27
Identity = 153/652 (23.47%), Postives = 251/652 (38.50%), Query Frame = 3
Query:   96 NTNRPF---KYKGFIYTDSSVAVISPNLQVI-----LKSGEEICNFQLTKSDYNRETLDYNPFRAVVKSAHLGLGEIELLANINLSNFTNADINLIITGQAC-HNPDSW----TEPAEISIKVIDPPE--PLWTKSSYVATITNDAIIGSPVIKVTAYLPPLADPDNKICQYHIENSSNSPFTIDGSGTISTRQNLLNSDVTLVILDVTAEDCSLPTHRQSTVKVFITITPICKIGWTGFYKIFQYLSGSGVIPIGKKLEFRFCSKNPKNNLNQIIENCKLKKKFRVTVSIEFKDLFQFSQESTTNDNDICYLDYKSLKLQRKICDINDNKAVDLL---NALAKQKTGV-IKFPLETNM---FPGLSVVK-----------------QDKFSLLFWMLRK-TPEEN--FDEFIVCHL--HESGDILFSVSISFCNLRI----FLNSSSNVQENSQLFFWEYNLSTICDNKWHHYLLHIQRSRDRNSHEVNILIDGESVEHKIQTSATEPRDFVKSPINEKYNFFIGQ---------------STRTSK-------RYFKGYIAGLIYLPDIIVKSSSVRCLMKCMERLHFNGMNEMNPGMSVSLNSEMQTIIINGHNVEEVAKLVEDVGYANPKWNPIPGLRIIVIKTDMSC 1841
            N ++P+   +Y+G +  + +  +++P L  +     L+   EIC F+L  S          PF AV+     G G I     ++       +    I    C   PD      +  A + ++V D  E  P++ +  Y A +T   +    +++V A     +   ++IC Y I  + N+PF ID  G I   + L  S   L    VTA DC          +V I + P CK  W G+ K  +Y  G+G + +   +    C + P  N+   IE                    Q S  +   D D    +Y    L RK+C     + VDLL      A    G+ + +  ++++   F G   V+                  D F+L FWM    TP +    +E IVC+   +E G   +S+++  C +       L S+  V+     F W+  L  +CD++WHHY L+++         V +  DG S +  +          +  P  E     IG                ST T++        YF GY+AG       +     + CL  C E L +     +  GM V +N     + + G +VE     ++ V Y N      PG+R + + T + C
Sbjct:   23 NKHKPWIEAEYQGIVMENDNTVLLNPPLFALDKDAPLRYAGEICGFRLHGSGV--------PFEAVILDKATGEGLIRAKEPVDCE--AQKEHTFTIQAYDCGEGPDGANTKKSHKATVHVRVNDVNEFAPVFVERLYRAAVTEGKLYDR-ILRVEAIDGDCSPQYSQICYYEIL-TPNTPFLIDNDGNIENTEKLQYSGERLYKFTVTAYDCG-KKRAADDAEVEIQVKPTCKPSWQGWNKRIEYAPGAGSLALFPGIRLETCDE-PLWNIQATIE-------------------LQTSHVAKGCDRD----NYSERAL-RKLCGAATGE-VDLLPMPGPNANWTAGLSVHYSQDSSLIYWFNGTQAVQVPLGGPSGLGSGPQDSLSDHFTLSFWMKHGVTPNKGKKEEETIVCNTVQNEDGFSHYSLTVHGCRIAFLYWPLLESARPVK-----FLWK--LEQVCDDEWHHYALNLEFPT------VTLYTDGISFDPAL----IHDNGLIHPPRREP-ALMIGACWTEEKNKEKEKGDNSTDTTQGDPLSIHHYFHGYLAGFSVRSGRLESREVIECLYACREGLDYRDFESLGKGMKVHVNPSQSLLTLEGDDVETFNHALQHVAYMNTLRFATPGVRPLRLTTAVKC 617          
BLAST of GL18378 vs. Ensembl Human
Match: CLSTN3 (calsyntenin 3 [Source:HGNC Symbol;Acc:HGNC:18371])

HSP 1 Score: 121.324 bits (303), Expect = 3.446e-27
Identity = 153/652 (23.47%), Postives = 251/652 (38.50%), Query Frame = 3
Query:   96 NTNRPF---KYKGFIYTDSSVAVISPNLQVI-----LKSGEEICNFQLTKSDYNRETLDYNPFRAVVKSAHLGLGEIELLANINLSNFTNADINLIITGQAC-HNPDSW----TEPAEISIKVIDPPE--PLWTKSSYVATITNDAIIGSPVIKVTAYLPPLADPDNKICQYHIENSSNSPFTIDGSGTISTRQNLLNSDVTLVILDVTAEDCSLPTHRQSTVKVFITITPICKIGWTGFYKIFQYLSGSGVIPIGKKLEFRFCSKNPKNNLNQIIENCKLKKKFRVTVSIEFKDLFQFSQESTTNDNDICYLDYKSLKLQRKICDINDNKAVDLL---NALAKQKTGV-IKFPLETNM---FPGLSVVK-----------------QDKFSLLFWMLRK-TPEEN--FDEFIVCHL--HESGDILFSVSISFCNLRI----FLNSSSNVQENSQLFFWEYNLSTICDNKWHHYLLHIQRSRDRNSHEVNILIDGESVEHKIQTSATEPRDFVKSPINEKYNFFIGQ---------------STRTSK-------RYFKGYIAGLIYLPDIIVKSSSVRCLMKCMERLHFNGMNEMNPGMSVSLNSEMQTIIINGHNVEEVAKLVEDVGYANPKWNPIPGLRIIVIKTDMSC 1841
            N ++P+   +Y+G +  + +  +++P L  +     L+   EIC F+L  S          PF AV+     G G I     ++       +    I    C   PD      +  A + ++V D  E  P++ +  Y A +T   +    +++V A     +   ++IC Y I  + N+PF ID  G I   + L  S   L    VTA DC          +V I + P CK  W G+ K  +Y  G+G + +   +    C + P  N+   IE                    Q S  +   D D    +Y    L RK+C     + VDLL      A    G+ + +  ++++   F G   V+                  D F+L FWM    TP +    +E IVC+   +E G   +S+++  C +       L S+  V+     F W+  L  +CD++WHHY L+++         V +  DG S +  +          +  P  E     IG                ST T++        YF GY+AG       +     + CL  C E L +     +  GM V +N     + + G +VE     ++ V Y N      PG+R + + T + C
Sbjct:   23 NKHKPWIEAEYQGIVMENDNTVLLNPPLFALDKDAPLRYAGEICGFRLHGSGV--------PFEAVILDKATGEGLIRAKEPVDCE--AQKEHTFTIQAYDCGEGPDGANTKKSHKATVHVRVNDVNEFAPVFVERLYRAAVTEGKLYDR-ILRVEAIDGDCSPQYSQICYYEIL-TPNTPFLIDNDGNIENTEKLQYSGERLYKFTVTAYDCG-KKRAADDAEVEIQVKPTCKPSWQGWNKRIEYAPGAGSLALFPGIRLETCDE-PLWNIQATIE-------------------LQTSHVAKGCDRD----NYSERAL-RKLCGAATGE-VDLLPMPGPNANWTAGLSVHYSQDSSLIYWFNGTQAVQVPLGGPSGLGSGPQDSLSDHFTLSFWMKHGVTPNKGKKEEETIVCNTVQNEDGFSHYSLTVHGCRIAFLYWPLLESARPVK-----FLWK--LEQVCDDEWHHYALNLEFPT------VTLYTDGISFDPAL----IHDNGLIHPPRREP-ALMIGACWTEEKNKEKEKGDNSTDTTQGDPLSIHHYFHGYLAGFSVRSGRLESREVIECLYACREGLDYRDFESLGKGMKVHVNPSQSLLTLEGDDVETFNHALQHVAYMNTLRFATPGVRPLRLTTAVKC 617          
BLAST of GL18378 vs. Ensembl Human
Match: CLSTN2 (calsyntenin 2 [Source:HGNC Symbol;Acc:HGNC:17448])

HSP 1 Score: 114.005 bits (284), Expect = 6.613e-25
Identity = 134/629 (21.30%), Postives = 247/629 (39.27%), Query Frame = 3
Query:   81 LSLAWNTNRPF---KYKGFIYTDSSVAVISPNLQVILKSGE-----EICNFQLTKSDYNRETLDYNPFRAVVKSAHLGLGEIELLANINLSNFTNADINLIITGQACH---NPDSW--TEPAEISIKVIDPPE--PLWTKSSYVATITNDAIIGSPVIKVTAYLPPLADPDNKICQYHIENSSNSPFTIDGSGTISTRQNLLNSDVTLVILDVTAEDCSLPTHRQSTVKVFITITPICKIGWTGFYKIFQYLSGSGVIPIGKKLEFRFCSKNPKNNLNQIIENCKLKKKFRVTVSIEFKDLFQFSQESTTND-NDICYLDYKSLKLQRKICDINDNKAVDLLNALAKQKTGVIKFPLETN----MFPGLSVVK----------QDKFSLLFWMLRKTPEENF---DEFIVCHLH--ESGDILFSVSISFCNLRIFLNSSSNVQENSQLFFWEYNLSTICDNKWHHYLLHIQRSRDRNSHEVNILIDGESVEHKIQTSATEPRDFVKSPINEKYNFFIG---QSTRTSK----RYFKGYIAGLIYLPDIIVKSSSVRCLMKCMERLHFNGMNEMNPGMSVSLNSEMQTIIINGHNVEEVAKLVEDVGYANPKWNPIPGLRIIVIKTDMSC 1841
            L+   N ++P+    Y G I  ++   ++ P L  + K        EIC F++   +         PF AVV +   G G +   + I+       +   II    C    +  +W  +  A + I+V D  E  P + + +Y A +T   I  S +++V A     +   ++IC Y I  +++ PF ID +G I   + L         + VTA DC      Q T+ V + + P+CK GW  + K  +Y  GSG +P+   +    C     +                           Q   E  TN     C  +  S K  +K+C  +    +DLL + +          ++++     F G    K           D+F++  WM +  P        E I+C+    E     +++ +  C L   L    +  +  +   + + L  ICD +WH+Y+++++         V + +DG + E  + T+     D+   P +      +G   Q    +K    ++F G +A L   P  +     + CL  C E L  N +  +  G+    N     +++ G ++  + + ++ V Y N +  P  G+R + + + + C
Sbjct:   33 LAAKVNKHKPWIETSYHGVITENNDTVILDPPLVALDKDAPVPFAGEICAFKIHGQEL--------PFEAVVLNKTSGEGRLRAKSPIDCE--LQKEYTFIIQAYDCGAGPHETAWKKSHKAVVHIQVKDVNEFAPTFKEPAYKAVVTEGKIYDS-ILQVEAIDEDCSPQYSQICNYEI-VTTDVPFAIDRNGNIRNTEKLSYDKQHQYEILVTAYDCGQKPAAQDTL-VQVDVKPVCKPGWQDWTKRIEYQPGSGSMPLFPSIHLETCDGAVSS--------------------------LQIVTELQTNYIGKGCDRETYSEKSLQKLCGASSG-IIDLLPSPSAATNWTAGLLVDSSEMIFKFDGRQGAKVPDGIVPKNLTDQFTITMWM-KHGPSPGVRAEKETILCNSDKTEMNRHHYALYVHNCRLVFLLRKDFDQADTFRPAEFHWKLDQICDKEWHYYVINVEFPV------VTLYMDGATYEPYLVTN-----DWPIHPSHIAMQLTVGACWQGGEVTKPQFAQFFHGSLASLTIRPGKMESQKVISCLQACKEGLDINSLESLGQGIKYHFNPSQSILVMEGDDIGNINRALQKVSYINSRQFPTAGVRRLKVSSKVQC 609          
BLAST of GL18378 vs. Ensembl Human
Match: CLSTN1 (calsyntenin 1 [Source:HGNC Symbol;Acc:HGNC:17447])

HSP 1 Score: 111.309 bits (277), Expect = 3.667e-24
Identity = 137/640 (21.41%), Postives = 246/640 (38.44%), Query Frame = 3
Query:   96 NTNRPF---KYKGFIYTDSSVAVISPNLQVI-----LKSGEEICNFQLTKSDYNRETLDYNPFRAVVKSAHLGLGEIELLANINLSNFTNADINLIITGQAC-HNPDSW----TEPAEISIKVIDPPE--PLWTKSSYVATITNDAIIGSPVIKVTAYLPPLADPDNKICQYHIENSSNSPFTIDGSGTISTRQNLLNSDVTLVILDVTAEDCSLPTHRQSTVKVFITITPICKIGWTGFYKIFQYLSGSGVIPIGKKLEFRFCSKNPKNNLNQIIENCKLKKKFRVTVSIEFKDLFQFSQESTTNDNDICYLDYKSLKLQRKICDINDNKAVDLLNALAKQKTGVIKFPLETNM-------FPG----------LSVVKQDKFSLLFWMLRKTPEENFDEFIVCHLHESGDI---LFSVSISFCNLRIFLNSSSNVQENSQLFFWEYNLSTICDNKWHHYLLHIQRSRDRNSHEVNILIDGESVEHKIQTSATEPRDFVKSPINEKYNFFIGQSTRT-----------------------SKRYFKGYIAGLIYLPDIIVKSSSVRCLMKCMERLHFNGMNEMNPGMSVSLNSEMQTIIINGHNVEEVAKLVEDVGYANPKWNPIPGLRIIVIKTDMSC 1841
            N ++P+    Y G +  + +  ++ P L  +     L+   EIC F++   +         PF AVV     G G I     ++       D +  I    C   PD      +  A + I+V D  E  P++ + SY AT+       S +++V A     +   ++IC Y I  + + PFT+D  G I   + L         L VTA DC      +  V V I+I P C  GW G+    +Y  G+G + +   +    C +   +               + TV +E           T++    C  D  S K   ++C      A +LL + +      +  P +          F G          +SV  ++ F++  WM R  P     E I+C   ++ D+    +S+ +  C L        + ++  +   + + L+ +CD +WHHY+L+++         V + +DG S E     S TE  D+   P   +    +G   +                          ++F+G +AGL      +     + CL  C E L    + +   G+ +  +     + + G ++ E+ K ++ + Y N +  P PG+R + I + + C
Sbjct:   32 NKHKPWLEPTYHGIVTENDNTVLLDPPLIALDKDAPLRFAGEICGFKIHGQNV--------PFDAVVVDKSTGEGVIRSKEKLDCE--LQKDYSFTIQAYDCGKGPDGTNVKKSHKATVHIQVNDVNEYAPVFKEKSYKATVIEGKQYDS-ILRVEAVDADCSPQFSQICSYEI-ITPDVPFTVDKDGYIKNTEKLNYGKEHQYKLTVTAYDCGKKRATED-VLVKISIKPTCTPGWQGWNNRIEYEPGTGALAVFPNIHLETCDEPVAS--------------VQATVELE-----------TSHIGKGCDRDTYSEKSLHRLCGAAAGTA-ELLPSPSGSLNWTMGLPTDNGHDSDQVFEFNGTQAVRIPDGVVSVSPKEPFTISVWM-RHGPFGRKKETILCSSDKT-DMNRHHYSLYVHGCRLIFLFRQDPSEEKKYRPAEFHWKLNQVCDEEWHHYVLNVEFP------SVTLYVDGTSHE---PFSVTE--DYPLHPSKIETQLVVGACWQEFSGVENDNETEPVTVASAGGDLHMTQFFRGNLAGLTLRSGKLADKKVIDCLYTCKEGLDLQVLEDSGRGVQIQAHPSQLVLTLEGEDLGELDKAMQHISYLNSRQFPTPGIRRLKITSTIKC 619          
BLAST of GL18378 vs. Ensembl Human
Match: CLSTN1 (calsyntenin 1 [Source:HGNC Symbol;Acc:HGNC:17447])

HSP 1 Score: 107.071 bits (266), Expect = 8.933e-23
Identity = 137/650 (21.08%), Postives = 246/650 (37.85%), Query Frame = 3
Query:   96 NTNRPF---KYKGFIYTDSSVAVISPNL---------------QVILKSGEEICNFQLTKSDYNRETLDYNPFRAVVKSAHLGLGEIELLANINLSNFTNADINLIITGQAC-HNPDSW----TEPAEISIKVIDPPE--PLWTKSSYVATITNDAIIGSPVIKVTAYLPPLADPDNKICQYHIENSSNSPFTIDGSGTISTRQNLLNSDVTLVILDVTAEDCSLPTHRQSTVKVFITITPICKIGWTGFYKIFQYLSGSGVIPIGKKLEFRFCSKNPKNNLNQIIENCKLKKKFRVTVSIEFKDLFQFSQESTTNDNDICYLDYKSLKLQRKICDINDNKAVDLLNALAKQKTGVIKFPLETNM-------FPG----------LSVVKQDKFSLLFWMLRKTPEENFDEFIVCHLHESGDI---LFSVSISFCNLRIFLNSSSNVQENSQLFFWEYNLSTICDNKWHHYLLHIQRSRDRNSHEVNILIDGESVEHKIQTSATEPRDFVKSPINEKYNFFIGQSTRT-----------------------SKRYFKGYIAGLIYLPDIIVKSSSVRCLMKCMERLHFNGMNEMNPGMSVSLNSEMQTIIINGHNVEEVAKLVEDVGYANPKWNPIPGLRIIVIKTDMSC 1841
            N ++P+    Y G +  + +  ++ P L               +V +    EIC F++   +         PF AVV     G G I     ++       D +  I    C   PD      +  A + I+V D  E  P++ + SY AT+       S +++V A     +   ++IC Y I  + + PFT+D  G I   + L         L VTA DC      +  V V I+I P C  GW G+    +Y  G+G + +   +    C +   +               + TV +E           T++    C  D  S K   ++C      A +LL + +      +  P +          F G          +SV  ++ F++  WM R  P     E I+C   ++ D+    +S+ +  C L        + ++  +   + + L+ +CD +WHHY+L+++         V + +DG S E     S TE  D+   P   +    +G   +                          ++F+G +AGL      +     + CL  C E L    + +   G+ +  +     + + G ++ E+ K ++ + Y N +  P PG+R + I + + C
Sbjct:   32 NKHKPWLEPTYHGIVTENDNTVLLDPPLIALDKDAPLRFAESFEVTVTKEGEICGFKIHGQNV--------PFDAVVVDKSTGEGVIRSKEKLDCE--LQKDYSFTIQAYDCGKGPDGTNVKKSHKATVHIQVNDVNEYAPVFKEKSYKATVIEGKQYDS-ILRVEAVDADCSPQFSQICSYEI-ITPDVPFTVDKDGYIKNTEKLNYGKEHQYKLTVTAYDCGKKRATED-VLVKISIKPTCTPGWQGWNNRIEYEPGTGALAVFPNIHLETCDEPVAS--------------VQATVELE-----------TSHIGKGCDRDTYSEKSLHRLCGAAAGTA-ELLPSPSGSLNWTMGLPTDNGHDSDQVFEFNGTQAVRIPDGVVSVSPKEPFTISVWM-RHGPFGRKKETILCSSDKT-DMNRHHYSLYVHGCRLIFLFRQDPSEEKKYRPAEFHWKLNQVCDEEWHHYVLNVEFPS------VTLYVDGTSHE---PFSVTE--DYPLHPSKIETQLVVGACWQEFSGVENDNETEPVTVASAGGDLHMTQFFRGNLAGLTLRSGKLADKKVIDCLYTCKEGLDLQVLEDSGRGVQIQAHPSQLVLTLEGEDLGELDKAMQHISYLNSRQFPTPGIRRLKITSTIKC 629          
BLAST of GL18378 vs. Ensembl Celegans
Match: casy-1 (CAlSYntenin/Alcadein homolog; Calsyntenin [Source:UniProtKB/TrEMBL;Acc:G5ED46])

HSP 1 Score: 130.183 bits (326), Expect = 2.442e-30
Identity = 164/793 (20.68%), Postives = 311/793 (39.22%), Query Frame = 3
Query:  123 GFIYTDSSVAVISPNLQVILKSGEEICNFQLTKSDYNRETLDYNPFRAVVKSAHLGLGEIELLANINLSNFTNADINLIITGQACHNPDSWTEPAEISIKVID----PPE---PLWTKSSYVATITNDAIIGSPVIKVTAYLPPLADPDNKICQYHIENSSNS-PFTIDGSGTISTRQNLLNSDVTLVILDVTAEDCSLPTHRQSTVKVFITITPICKIGWTGFYKIFQYLSGSGVIPIGKKLEFRFCSKNPKNNLNQIIENCKLKKKFRVTVSIEFKDLFQFSQESTTNDNDI---CYLDYKSLKL--QRKICDINDNKAVDLLNALAKQKTGVIKFPLETNMFPGLSVVKQ-------DKFSLLFWMLRKT---PEENFDEFIVCHLHESGDI-----LFSVSISFCNLRIFLNSSSNVQENSQLFFWEYNLSTICDNKWHHYLLHIQRSRDRNSHEVNILIDGESVEHKIQTSATEPRDFVKSPINE----KYNFFIGQ--STRTSK--RYFKGYIAGLIYLPDIIVKSSSVRCLMKCMERLHFNGMNEMNPGMSVSLNSEMQTIIINGHNVEEVAKLVEDVGYANPKWNPIPGLRIIVIKTDMSCDKHXXXXXXXXXXXXXSRQNDVVTYGKLXXXXXXXXXXXXXXXDDVSQIRSTTGVGLSVFANATISIYAIPXXXXXXXXXXXXXXXRCIVSVHPELVKTKEYFDWPQQALDTLNSENHLIKVTNNSKKIIFFGDFNYQIYQFIIQHLSYFSSSIPNFNRR-FQLQCSSDVGMAIIDSNILVVKI 2390
              +  D ++    P+  ++ ++G  +CN+ LT    N E +   PF   V   + G   + +     L +    + NL +    C N +  +E   + I+V D     PE   P +T       +  +         + A       P+ +IC+Y I N     PF I+  G + T Q L  +     IL V A DC++   + S V V +     C  G T   +   Y  G G   +   +   FC K          E     K  +  + +    + Q     T  DN     C L   ++KL  +  +    +N+       LA Q        +E +   G++V  +       D F+L F M        E++  + I+C   ES D       FSV I  C L + L   +    + +   W +++  +CDN+WH Y L      D     VN+++DG+S     +     P      P+++    K    +G     R  K  ++F+G ++ L  L   +    +++C   C E+L F G++E+    S + + +  ++ +     +++ ++++ V Y N +  P PG R+ +++T+++C +    +   +            + G +          +      +   +    VG ++  + TI+I             ++  I  C + + P      EYF  P   +  LN     I+  ++   I+  G+ + Q Y+ ++  + YF++   ++ +R + +QC+   G  +  SN L V +
Sbjct:   39 AVVREDENIISTVPDFAILSETGP-VCNYLLTSQ--NNEPV---PFDIQVVDKYTGAAVLRVKDAATL-DCKKPEYNLQVQAVKCDNDNVKSEGVSLKIRVKDTNNHAPEIENPWYTFHVEEGKVVEEVG------VLKASDKDCGHPNGEICEYEITNGLKELPFAINNHGVLRTTQPLNFTQSKSYILTVVAIDCAMRKSKSSLVTVHVDEK--CVQGITAMNERVNYAPGVGSKLLLPDVSLEFCEK----------ETICEPKSVQSVIELRAGHVTQGCARDTVYDNQTIQSCGLSTATVKLLNEEALTSSAENQI------LADQG-------IEFDGARGVTVSDENHQGLIPDHFTLSFSMKHAAGTKDEQSNKQNILC---ESDDFNMNRHHFSVYIRHCKLEVVLRREAGATSDFRAAEWRWSMPEVCDNEWHSYSLLFNGIDD-----VNVIVDGKS----FKADERNPEILDDWPLHKTKATKTKLVVGACWHGRQQKLAQFFRGQLSSLYLLSGAVESERAIKCAHTCPEQLQFTGVDELLESQSATFSPDQTSLTLKAETSKQIGQMLKRVAYVNTQEKPAPGHRVFLVETEVTCKQDDKKMKLPS------------SKGYVFVQQAAEPTLSISASSQLKSNQHMVKVGQAMVPDLTITISQNNADGELEDVTQSHKIDYCKMHLQPARDMDVEYFSSPASLIAALN-----IEFEHDKDGILLRGEESAQGYKEVLSKVHYFNTRPESYAKRVYTVQCAMLKGRVL--SNQLFVTM 762          
BLAST of GL18378 vs. Ensembl Fly
Match: Cals (gene:FBgn0039928 transcript:FBtr0089207)

HSP 1 Score: 104.76 bits (260), Expect = 2.261e-22
Identity = 136/605 (22.48%), Postives = 251/605 (41.49%), Query Frame = 3
Query:  117 YKGFIYTDSSVAVISPNLQVILKSGEEICNFQLTKSDYNRETLDYNPFRAVVKSAHLGLGEIELLANINLSNFTNADINLIITGQACHNPDSWTEPAEISIKVIDPPE--PLWTKSSYVATITNDAIIGSPVIKVTAYLPPLADPDNKICQYHIENSSNSPFTIDGSGTISTRQNLLNSDVTLVILDVTAEDCSLPTHRQSTVKVFITITPICKIGWTGFYKIFQYLSGSGVIPIGKKLEFRFCSKNPKNNLNQIIENCKLKKKFRVTVSIEFKDLFQFSQESTTNDNDICYLDYKSLKLQRKICDINDNKAVDLLNALAKQK--TGVIKFPLETNMFPGLSVVKQDKFSL----LFWMLRKTPE----ENFDEFIVCHLHESGDILFSVSISFCNLRIFLNSSSNVQENSQLFF----WEYNLSTICDNKWHHYLLHIQRSRDRNSHEVNILIDGESVEHKIQTSATEPRDFVKSPINEKY----NFFIGQSTRT----SKRYFKGYIAGLIYLPDIIVKSSSVRCLMKCMER------LHFNGMNEMNPGMSVSLNSEMQTIIINGHNVEEVAKLVEDVGYANPKWNPIPGLRIIVIKTDMSC 1841
            Y G I  + ++  I+P ++V   + E+ICNF + K  Y+       PF+  + +    LG ++    +N  N      +  I    C    S T  A + I VID  E  P + + SYV  + ++  + + +++V A           +C+Y I N+ + PF+ID  G+I   + L +      IL V A DC++     + + V I +  +C+  + G  +   Y SGS      + L+       P   L+    +CK ++  R+  SI  K         T + +  C  D  +    +K+ D+  + A +    L+  +    +  F   T +    +V+    FS     +  + R   +    ++  E IVC   +       +++   N R+      N  E     F    W + +  +CDN+WHHY+L+++     +S +V++ IDG   E+ I+   + P      P++  +    +  IG   ++     K  F G I+ +    + ++ +  ++C   C E       L  N     +    +  N EM  I I+  N  ++ + +  V Y N K  P  G R I + T ++C
Sbjct:   46 YHGLIRENETLVEITPLIKV---NEEKICNFHILKKPYHEI-----PFKIELVN---NLGILKARRTLNCEN--RKSYHFEICAIYCDGTPSNT--ANVHITVIDVNEYAPTFLEPSYVIEV-DEGRLYNEILRVEASDKDCTPLFGDVCKYEILNN-DEPFSIDNEGSIKNTEPLSHKASHNHILSVVAYDCAMK--ESAPIMVSIKVRRVCETKFVGMPERIDYTSGST-----ESLQLF-----PNARLDLCDISCKNEEDLRIHSSIALK---------TKHISFGCDRDISNCTSGQKVKDLLPHGA-EWTKELSYDEGLEPIFHFDGSTGVVVPATVIDHYDFSSQPFSILTLFRHNSQVEINKHVKEHIVCSADDHKMNRHHMALFVRNCRLIFLLRKNFNEGDLNIFSPAEWRWKIPEVCDNEWHHYVLNVE-----DSSKVDLFIDGVRFENSIENRHSNPEVIDDWPLHAAHGVNTSLAIGACYQSLENRLKHGFNGDISEVKVSLNSVLTAEDIKCGTTCAEHLLAPKPLQSNNEKSYSDNSQIKENIEMNEIYISAKNKHDIEQFMRKVQYINTKQKPTVGRRNIEVLTTLNC 606          
BLAST of GL18378 vs. Ensembl Fly
Match: Cals (gene:FBgn0039928 transcript:FBtr0089208)

HSP 1 Score: 104.76 bits (260), Expect = 2.261e-22
Identity = 136/605 (22.48%), Postives = 251/605 (41.49%), Query Frame = 3
Query:  117 YKGFIYTDSSVAVISPNLQVILKSGEEICNFQLTKSDYNRETLDYNPFRAVVKSAHLGLGEIELLANINLSNFTNADINLIITGQACHNPDSWTEPAEISIKVIDPPE--PLWTKSSYVATITNDAIIGSPVIKVTAYLPPLADPDNKICQYHIENSSNSPFTIDGSGTISTRQNLLNSDVTLVILDVTAEDCSLPTHRQSTVKVFITITPICKIGWTGFYKIFQYLSGSGVIPIGKKLEFRFCSKNPKNNLNQIIENCKLKKKFRVTVSIEFKDLFQFSQESTTNDNDICYLDYKSLKLQRKICDINDNKAVDLLNALAKQK--TGVIKFPLETNMFPGLSVVKQDKFSL----LFWMLRKTPE----ENFDEFIVCHLHESGDILFSVSISFCNLRIFLNSSSNVQENSQLFF----WEYNLSTICDNKWHHYLLHIQRSRDRNSHEVNILIDGESVEHKIQTSATEPRDFVKSPINEKY----NFFIGQSTRT----SKRYFKGYIAGLIYLPDIIVKSSSVRCLMKCMER------LHFNGMNEMNPGMSVSLNSEMQTIIINGHNVEEVAKLVEDVGYANPKWNPIPGLRIIVIKTDMSC 1841
            Y G I  + ++  I+P ++V   + E+ICNF + K  Y+       PF+  + +    LG ++    +N  N      +  I    C    S T  A + I VID  E  P + + SYV  + ++  + + +++V A           +C+Y I N+ + PF+ID  G+I   + L +      IL V A DC++     + + V I +  +C+  + G  +   Y SGS      + L+       P   L+    +CK ++  R+  SI  K         T + +  C  D  +    +K+ D+  + A +    L+  +    +  F   T +    +V+    FS     +  + R   +    ++  E IVC   +       +++   N R+      N  E     F    W + +  +CDN+WHHY+L+++     +S +V++ IDG   E+ I+   + P      P++  +    +  IG   ++     K  F G I+ +    + ++ +  ++C   C E       L  N     +    +  N EM  I I+  N  ++ + +  V Y N K  P  G R I + T ++C
Sbjct:   46 YHGLIRENETLVEITPLIKV---NEEKICNFHILKKPYHEI-----PFKIELVN---NLGILKARRTLNCEN--RKSYHFEICAIYCDGTPSNT--ANVHITVIDVNEYAPTFLEPSYVIEV-DEGRLYNEILRVEASDKDCTPLFGDVCKYEILNN-DEPFSIDNEGSIKNTEPLSHKASHNHILSVVAYDCAMK--ESAPIMVSIKVRRVCETKFVGMPERIDYTSGST-----ESLQLF-----PNARLDLCDISCKNEEDLRIHSSIALK---------TKHISFGCDRDISNCTSGQKVKDLLPHGA-EWTKELSYDEGLEPIFHFDGSTGVVVPATVIDHYDFSSQPFSILTLFRHNSQVEINKHVKEHIVCSADDHKMNRHHMALFVRNCRLIFLLRKNFNEGDLNIFSPAEWRWKIPEVCDNEWHHYVLNVE-----DSSKVDLFIDGVRFENSIENRHSNPEVIDDWPLHAAHGVNTSLAIGACYQSLENRLKHGFNGDISEVKVSLNSVLTAEDIKCGTTCAEHLLAPKPLQSNNEKSYSDNSQIKENIEMNEIYISAKNKHDIEQFMRKVQYINTKQKPTVGRRNIEVLTTLNC 606          
BLAST of GL18378 vs. Ensembl Fly
Match: Cals (gene:FBgn0039928 transcript:FBtr0345193)

HSP 1 Score: 104.76 bits (260), Expect = 2.261e-22
Identity = 136/605 (22.48%), Postives = 251/605 (41.49%), Query Frame = 3
Query:  117 YKGFIYTDSSVAVISPNLQVILKSGEEICNFQLTKSDYNRETLDYNPFRAVVKSAHLGLGEIELLANINLSNFTNADINLIITGQACHNPDSWTEPAEISIKVIDPPE--PLWTKSSYVATITNDAIIGSPVIKVTAYLPPLADPDNKICQYHIENSSNSPFTIDGSGTISTRQNLLNSDVTLVILDVTAEDCSLPTHRQSTVKVFITITPICKIGWTGFYKIFQYLSGSGVIPIGKKLEFRFCSKNPKNNLNQIIENCKLKKKFRVTVSIEFKDLFQFSQESTTNDNDICYLDYKSLKLQRKICDINDNKAVDLLNALAKQK--TGVIKFPLETNMFPGLSVVKQDKFSL----LFWMLRKTPE----ENFDEFIVCHLHESGDILFSVSISFCNLRIFLNSSSNVQENSQLFF----WEYNLSTICDNKWHHYLLHIQRSRDRNSHEVNILIDGESVEHKIQTSATEPRDFVKSPINEKY----NFFIGQSTRT----SKRYFKGYIAGLIYLPDIIVKSSSVRCLMKCMER------LHFNGMNEMNPGMSVSLNSEMQTIIINGHNVEEVAKLVEDVGYANPKWNPIPGLRIIVIKTDMSC 1841
            Y G I  + ++  I+P ++V   + E+ICNF + K  Y+       PF+  + +    LG ++    +N  N      +  I    C    S T  A + I VID  E  P + + SYV  + ++  + + +++V A           +C+Y I N+ + PF+ID  G+I   + L +      IL V A DC++     + + V I +  +C+  + G  +   Y SGS      + L+       P   L+    +CK ++  R+  SI  K         T + +  C  D  +    +K+ D+  + A +    L+  +    +  F   T +    +V+    FS     +  + R   +    ++  E IVC   +       +++   N R+      N  E     F    W + +  +CDN+WHHY+L+++     +S +V++ IDG   E+ I+   + P      P++  +    +  IG   ++     K  F G I+ +    + ++ +  ++C   C E       L  N     +    +  N EM  I I+  N  ++ + +  V Y N K  P  G R I + T ++C
Sbjct:   46 YHGLIRENETLVEITPLIKV---NEEKICNFHILKKPYHEI-----PFKIELVN---NLGILKARRTLNCEN--RKSYHFEICAIYCDGTPSNT--ANVHITVIDVNEYAPTFLEPSYVIEV-DEGRLYNEILRVEASDKDCTPLFGDVCKYEILNN-DEPFSIDNEGSIKNTEPLSHKASHNHILSVVAYDCAMK--ESAPIMVSIKVRRVCETKFVGMPERIDYTSGST-----ESLQLF-----PNARLDLCDISCKNEEDLRIHSSIALK---------TKHISFGCDRDISNCTSGQKVKDLLPHGA-EWTKELSYDEGLEPIFHFDGSTGVVVPATVIDHYDFSSQPFSILTLFRHNSQVEINKHVKEHIVCSADDHKMNRHHMALFVRNCRLIFLLRKNFNEGDLNIFSPAEWRWKIPEVCDNEWHHYVLNVE-----DSSKVDLFIDGVRFENSIENRHSNPEVIDDWPLHAAHGVNTSLAIGACYQSLENRLKHGFNGDISEVKVSLNSVLTAEDIKCGTTCAEHLLAPKPLQSNNEKSYSDNSQIKENIEMNEIYISAKNKHDIEQFMRKVQYINTKQKPTVGRRNIEVLTTLNC 606          
BLAST of GL18378 vs. Ensembl Fly
Match: Cals (gene:FBgn0039928 transcript:FBtr0333700)

HSP 1 Score: 104.76 bits (260), Expect = 2.322e-22
Identity = 136/605 (22.48%), Postives = 251/605 (41.49%), Query Frame = 3
Query:  117 YKGFIYTDSSVAVISPNLQVILKSGEEICNFQLTKSDYNRETLDYNPFRAVVKSAHLGLGEIELLANINLSNFTNADINLIITGQACHNPDSWTEPAEISIKVIDPPE--PLWTKSSYVATITNDAIIGSPVIKVTAYLPPLADPDNKICQYHIENSSNSPFTIDGSGTISTRQNLLNSDVTLVILDVTAEDCSLPTHRQSTVKVFITITPICKIGWTGFYKIFQYLSGSGVIPIGKKLEFRFCSKNPKNNLNQIIENCKLKKKFRVTVSIEFKDLFQFSQESTTNDNDICYLDYKSLKLQRKICDINDNKAVDLLNALAKQK--TGVIKFPLETNMFPGLSVVKQDKFSL----LFWMLRKTPE----ENFDEFIVCHLHESGDILFSVSISFCNLRIFLNSSSNVQENSQLFF----WEYNLSTICDNKWHHYLLHIQRSRDRNSHEVNILIDGESVEHKIQTSATEPRDFVKSPINEKY----NFFIGQSTRT----SKRYFKGYIAGLIYLPDIIVKSSSVRCLMKCMER------LHFNGMNEMNPGMSVSLNSEMQTIIINGHNVEEVAKLVEDVGYANPKWNPIPGLRIIVIKTDMSC 1841
            Y G I  + ++  I+P ++V   + E+ICNF + K  Y+       PF+  + +    LG ++    +N  N      +  I    C    S T  A + I VID  E  P + + SYV  + ++  + + +++V A           +C+Y I N+ + PF+ID  G+I   + L +      IL V A DC++     + + V I +  +C+  + G  +   Y SGS      + L+       P   L+    +CK ++  R+  SI  K         T + +  C  D  +    +K+ D+  + A +    L+  +    +  F   T +    +V+    FS     +  + R   +    ++  E IVC   +       +++   N R+      N  E     F    W + +  +CDN+WHHY+L+++     +S +V++ IDG   E+ I+   + P      P++  +    +  IG   ++     K  F G I+ +    + ++ +  ++C   C E       L  N     +    +  N EM  I I+  N  ++ + +  V Y N K  P  G R I + T ++C
Sbjct:   46 YHGLIRENETLVEITPLIKV---NEEKICNFHILKKPYHEI-----PFKIELVN---NLGILKARRTLNCEN--RKSYHFEICAIYCDGTPSNT--ANVHITVIDVNEYAPTFLEPSYVIEV-DEGRLYNEILRVEASDKDCTPLFGDVCKYEILNN-DEPFSIDNEGSIKNTEPLSHKASHNHILSVVAYDCAMK--ESAPIMVSIKVRRVCETKFVGMPERIDYTSGST-----ESLQLF-----PNARLDLCDISCKNEEDLRIHSSIALK---------TKHISFGCDRDISNCTSGQKVKDLLPHGA-EWTKELSYDEGLEPIFHFDGSTGVVVPATVIDHYDFSSQPFSILTLFRHNSQVEINKHVKEHIVCSADDHKMNRHHMALFVRNCRLIFLLRKNFNEGDLNIFSPAEWRWKIPEVCDNEWHHYVLNVE-----DSSKVDLFIDGVRFENSIENRHSNPEVIDDWPLHAAHGVNTSLAIGACYQSLENRLKHGFNGDISEVKVSLNSVLTAEDIKCGTTCAEHLLAPKPLQSNNEKSYSDNSQIKENIEMNEIYISAKNKHDIEQFMRKVQYINTKQKPTVGRRNIEVLTTLNC 606          
BLAST of GL18378 vs. Ensembl Zebrafish
Match: clstn1 (calsyntenin 1 [Source:ZFIN;Acc:ZDB-GENE-040426-1064])

HSP 1 Score: 133.265 bits (334), Expect = 4.312e-31
Identity = 147/619 (23.75%), Postives = 245/619 (39.58%), Query Frame = 3
Query:   96 NTNRPF---KYKGFIYTDSSVAVISPNLQVI-----LKSGEEICNFQLTKSDYNRETLDYNPFRAVVKSAHLGLGEIELLANINLSNFTNADINLIITGQAC-HNPDSW----TEPAEISIKVIDPPE--PLWTKSSYVATITNDAIIGSPVIKVTAYLPPLADPDNKICQYHIENSSNSPFTIDGSGTISTRQNLLNSDVTLVILDVTAEDCSLPTHRQSTVKVFITITPICKIGWTGFYKIFQYLSGSGVIPIGKKLEFRFCSKNPKNNLNQIIENCKLKKKFRVTVSIEFKDLFQFSQESTTNDNDICYLDYKSLKLQRKICDINDNKAVDLLNALAKQKTGVIKFPLETNM-------FPGLSVVK----------QDKFSLLFWMLRKTPEENFDEFIVCHLH--ESGDILFSVSISFCNLRIFLNSSSNVQENSQLFFWEYNLSTICDNKWHHYLLHIQRSRDRNSHEVNILIDGESVEHKIQTSATEPRDFVKSPINEKYNF---FIGQSTRTSKRYFKGYIAGLIYLPDIIVKSSSVRCLMKCMERLHFNGMNEMNPGMSVSLNSEMQTIIINGHNVEEVAKLVEDVGYANPKWNPIPGLRIIVIKTDMSC 1841
            N ++P+    Y G +  +    ++ P L  +     L+   EIC F++   +         PF AVV     G G I   A   L      +    I    C   PD      +  A + I+V D  E  P++ + SY AT+       S ++KV A     +   ++IC Y I  + + PFTID  G I   + L      +  L VTA DC         V V I I P CK  W GF K  +Y  G+G + +   +    C + P  ++             + ++ +E           T +    C  D  S K   K+C  +    V+LL A +      +  P +          F G   +K          ++ F++  WM R  P     E I+C+    E     +S+ +  C L + L       E+ +   + + L  +CD +WHHY+L+I+         V + +DG + E  +    TE      S I  +      + G S R ++ +F+G +AGL+     +     + CL  C E L      E+   + V  N    ++ + G ++E   K+++ + Y N +  P PG+R + + T + C
Sbjct:   29 NKHKPWIETTYHGIVTENDDKVLLDPPLIALDKDAPLRYAGEICGFRIHGQNV--------PFEAVVLDKSTGEGVIR--AKDKLDCELQKEHTFTIQAYDCGEGPDGGNMKKSHKATVHIQVNDVNEYSPVFKEKSYKATVIEGKKYDS-IMKVEAVDADCSFQFSQICSYEI-VTPDVPFTIDKDGNIKNTEKLNYGKERMYKLTVTAYDCG-KNRASEDVLVKINIKPTCKPSWQGFNKRIEYEPGTGSLALFPSMHLETCEE-PITSI-------------QASIMLE-----------TNHIGKGCDRDTYSEKSLHKLCGASSG-TVELLPAPSNSANWTVGLPTDNGHDSDQVFEFNGTQAIKVPEGVVSTTLKEPFTISVWM-RHGPGGREKETILCNSDKTEMNRHHYSLYVHNCRLVLLLRQEPTESESYKPAEFHWKLDQVCDKEWHHYVLNIEFPA------VTLFVDGGTFEPFL---VTEDYPLHTSKIETQLTIGACWQGGSARMTQ-FFRGNLAGLMIRSGKLENKKVIDCLYTCKEGLDVQLPEEVASAVKVEFNPNQSSLSLEGDDIESFEKVMQHISYLNSRQFPTPGIRHLRVSTTVKC 597          
BLAST of GL18378 vs. Ensembl Zebrafish
Match: BX001019.1 (calsyntenin 3 [Source:NCBI gene;Acc:555627])

HSP 1 Score: 131.724 bits (330), Expect = 1.208e-30
Identity = 143/639 (22.38%), Postives = 251/639 (39.28%), Query Frame = 3
Query:   60 VTQFCLSLSLAWNTNRPF---KYKGFIYTDSSVAVISPNLQVI-----LKSGEEICNFQLTKSDYNRETLDYNPFRAVVKSAHLGLGEIELLANINLSNFTNADINLIITGQAC-HNPDSW----TEPAEISIKVIDPPE--PLWTKSSYVATITNDAIIGSPVIKVTAYLPPLADPDNKICQYHIENSSNSPFTIDGSGTISTRQNLLNSDVTLVILDVTAEDCSLPTHRQSTVKVFITITPICKIGWTGFYKIFQYLSGSGVIPIGKKLEFRFCSKNPKNNLNQIIENCKLKKKFRVTVSIEFKDLFQFSQESTTNDNDICYLDYKSLKLQRKICDINDNKAVDLLNALAKQKTGVIKFPLETNMFPGL------------------SVVKQDKFSLLFWMLR-------KTPEENFDEFIVCHLHESGDIL--FSVSISFCNLRIFLNSSSNVQENSQLFFWEYNLSTICDNKWHHYLLHIQRSRDRNSHEVNILIDGESVEHKI---QTSATEPRDFVKSPINEKYNFFIGQSTRTSKRYFKGYIAGLIYLPDIIVKSSSVRCLMKCMERLHFNGMNEMNPGMSVSLNSEMQTIIINGHNVEEVAKLVEDVGYANPKWNPIPGLRIIVIKTDMSC 1841
            V+ FC   S + N ++P+   +Y+G +  + +  +++P L  +     L    EIC F++        +     F AVV     G G +     ++    +  + +  I    C   PD      +  A + ++V D  E  P++ +  Y A++    +    +++V A     +   ++IC Y I  + N PFTID  G I   + L +    +    VTA DC      Q+  +V +T+ P CK GW G+ K  +Y  GSG IP+   L    C +   N                +  ++E +         T++    C  D  S +  R++C     + VDLL   +         P   +    L                  S V  D F+L  WM R       +   +  +  ++C    + D    +S+S+  C L +F     +     + F W+  L  +CD++WHH  L +Q         V + +DG + +  +     +   P    +  I   +  FI          +KG ++G+   P  +   S V CL  C E L F  +  +  GM V +N     +++ G ++E   + V+ V Y N      PG+R + + T + C
Sbjct:    1 VSCFC-DFSFSANKHKPWIETEYQGIVMENDNTVLLNPPLFALDKDAPLHYAGEICGFRVHNGPGGSGSAQ---FEAVVLDRSTGEGLVRSKEPLDCE--SQKEHSFTIQAYDCGEGPDGTNSKKSHKATVHVRVNDVNEFSPVFVERRYEASVPEGRLFDR-IVRVEAVDADCSPQYSQICFYDI-ITPNVPFTIDNDGNIKNTEPLDSKRQRVHSFWVTAFDCG-KNRAQADAQVIVTVKPSCKPGWIGWTKRIEYTPGSGSIPLFPNLHLETCEETVWN----------------IQATVELQ---------TSHIGKGCDRDSYSDRSVRRLCGAVRGE-VDLLPPPSPATNWTAALPTLPSSDSSLVFSFNGSTHVAVVPDSVASAVSGDHFTLQLWMRRGGATNQARGTRKEEETIVLCETELNNDSYSHYSLSVHGCRLSLFYWPDVSAARPVK-FLWK--LEQVCDSEWHHLSLSVQFP------SVTLYVDGVTFDPALIHDNGAIPNPAPHQRLVIGACWGNFIIIG-------YKGLLSGVTVRPGNVEPHSVVECLYACREGLDFGDLETLGSGMKVHVNPSQSVLVLEGDDIESFNRAVQQVTYRNSLRFATPGVRPLKLTTSLRC 588          
BLAST of GL18378 vs. Ensembl Zebrafish
Match: BX001019.1 (calsyntenin 3 [Source:NCBI gene;Acc:555627])

HSP 1 Score: 130.954 bits (328), Expect = 2.023e-30
Identity = 146/655 (22.29%), Postives = 254/655 (38.78%), Query Frame = 3
Query:   60 VTQFCLSLSLAWNTNRPF---KYKGFIYTDSSVAVISPNLQVI-----LKSGEEICNFQLTKSDYNRETLDYNPFRAVVKSAHLGLGEIELLANINLSNFTNADINLIITGQAC-HNPDSW----TEPAEISIKVIDPPE--PLWTKSSYVATITNDAIIGSPVIKVTAYLPPLADPDNKICQYHIENSSNSPFTIDGSGTISTRQNLLNSDVTLVILDVTAEDCSLPTHRQSTVKVFITITPICKIGWTGFYKIFQYLSGSGVIPIGKKLEFRFCSKNPKNNLNQIIENCKLKKKFRVTVSIEFKDLFQFSQESTTNDNDICYLDYKSLKLQRKICDINDNKAVDLLNALAKQKTGVIKFPLETNMFPGL------------------SVVKQDKFSLLFWMLR-------KTPEENFDEFIVCHLHESGDIL--FSVSISFCNLRIFLNSSSNVQENSQLFFWEYNLSTICDNKWHHYLLHIQRSRDRNSHEVNILIDGESVE-------HKIQTSATEPRDFV------------KSPINEKYNFFIGQSTRTSKRYFKGYIAGLIYLPDIIVKSSSVRCLMKCMERLHFNGMNEMNPGMSVSLNSEMQTIIINGHNVEEVAKLVEDVGYANPKWNPIPGLRIIVIKTDMSC 1841
            V+ FC   S + N ++P+   +Y+G +  + +  +++P L  +     L    EIC F++        +     F AVV     G G +     ++    +  + +  I    C   PD      +  A + ++V D  E  P++ +  Y A++    +    +++V A     +   ++IC Y I  + N PFTID  G I   + L +    +    VTA DC      Q+  +V +T+ P CK GW G+ K  +Y  GSG IP+   L    C +   N                +  ++E +         T++    C  D  S +  R++C     + VDLL   +         P   +    L                  S V  D F+L  WM R       +   +  +  ++C    + D    +S+S+  C L +F     +     + F W+  L  +CD++WHH  L +Q         V + +DG + +         I   A   R  +             S +N  ++F  G         +KG ++G+   P  +   S V CL  C E L F  +  +  GM V +N     +++ G ++E   + V+ V Y N      PG+R + + T + C
Sbjct:    1 VSCFC-DFSFSANKHKPWIETEYQGIVMENDNTVLLNPPLFALDKDAPLHYAGEICGFRVHNGPGGSGSAQ---FEAVVLDRSTGEGLVRSKEPLDCE--SQKEHSFTIQAYDCGEGPDGTNSKKSHKATVHVRVNDVNEFSPVFVERRYEASVPEGRLFDR-IVRVEAVDADCSPQYSQICFYDI-ITPNVPFTIDNDGNIKNTEPLDSKRQRVHSFWVTAFDCG-KNRAQADAQVIVTVKPSCKPGWIGWTKRIEYTPGSGSIPLFPNLHLETCEETVWN----------------IQATVELQ---------TSHIGKGCDRDSYSDRSVRRLCGAVRGE-VDLLPPPSPATNWTAALPTLPSSDSSLVFSFNGSTHVAVVPDSVASAVSGDHFTLQLWMRRGGATNQARGTRKEEETIVLCETELNNDSYSHYSLSVHGCRLSLFYWPDVSAARPVK-FLWK--LEQVCDSEWHHLSLSVQFP------SVTLYVDGVTFDPALIHDNGAIPNPAPHQRLVIGACWEREDDNSQDSTLNHNHSFVSG---------YKGLLSGVTVRPGNVEPHSVVECLYACREGLDFGDLETLGSGMKVHVNPSQSVLVLEGDDIESFNRAVQQVTYRNSLRFATPGVRPLKLTTSLRC 602          
BLAST of GL18378 vs. Ensembl Zebrafish
Match: CT027619.1 (calsyntenin 3 [Source:NCBI gene;Acc:555627])

HSP 1 Score: 130.183 bits (326), Expect = 4.123e-30
Identity = 143/648 (22.07%), Postives = 249/648 (38.43%), Query Frame = 3
Query:   36 LIVFLIISVTQFCLSLSLAWNTNRPFKYKGFIYTDSSVAVISPNLQVI-----LKSGEEICNFQLTKSDYNRETLDYNPFRAVVKSAHLGLGEIELLANINLSNFTNADINLIITGQAC-HNPDSW----TEPAEISIKVIDPPE--PLWTKSSYVATITNDAIIGSPVIKVTAYLPPLADPDNKICQYHIENSSNSPFTIDGSGTISTRQNLLNSDVTLVILDVTAEDCSLPTHRQSTVKVFITITPICKIGWTGFYKIFQYLSGSGVIPIGKKLEFRFCSKNPKNNLNQIIENCKLKKKFRVTVSIEFKDLFQFSQESTTNDNDICYLDYKSLKLQRKICDINDNKAVDLLNALAKQKTGVIKFPLETNMFPGL------------------SVVKQDKFSLLFWMLR-------KTPEENFDEFIVCHLHESGDIL--FSVSISFCNLRIFLNSSSNVQENSQLFFWEYNLSTICDNKWHHYLLHIQRSRDRNSHEVNILIDGESVE-------HKIQTSATEPRDFVKSPINEKYNFFIGQSTRTSKRYFKGYIAGLIYLPDIIVKSSSVRCLMKCMERLHFNGMNEMNPGMSVSLNSEMQTIIINGHNVEEVAKLVEDVGYANPKWNPIPGLRIIVIKTDMSC 1841
            LI  L   + Q C +    W      +Y+G +  + +  +++P L  +     L    EIC F++        +     F AVV     G G +     ++    +  + +  I    C   PD      +  A + ++V D  E  P++ +  Y A++    +    +++V A     +   ++IC Y I  + N PFTID  G I   + L +    +    VTA DC      Q+  +V +T+ P CK GW G+ K  +Y  GSG IP+   L    C +   N                +  ++E +         T++    C  D  S +  R++C     + VDLL   +         P   +    L                  S V  D F+L  WM R       +   +  +  ++C    + D    +S+S+  C L +F     +     + F W+  L  +CD++WHH  L +Q         V + +DG + +         I   A   R  + +    + +     +   S   +KG ++G+   P  +   S V CL  C E L F  +  +  GM V +N     +++ G ++E   + V+ V Y N      PG+R + + T + C
Sbjct:   10 LISLLAKHLVQSCTNKHKPWIET---EYQGIVMENDNTVLLNPPLFALDKDAPLHYAGEICGFRVHNGPGGSGSAQ---FEAVVLDRSTGEGLVRSKEPLDCE--SQKEHSFTIQAYDCGEGPDGTNSKKSHKATVHVRVNDVNEFSPVFVERRYEASVPEGRLFDR-IVRVEAVDADCSPQYSQICFYDI-ITPNVPFTIDNDGNIKNTEPLDSKRQRVHSFWVTAFDCG-KNRAQADAQVIVTVKPSCKPGWIGWTKRIEYTPGSGSIPLFPNLHLETCEETVWN----------------IQATVELQ---------TSHIGKGCDRDSYSDRSVRRLCGAVRGE-VDLLPPPSPATNWTAALPTLPSSDSSLVFSFNGSTHVAVVPDSVASAVSGDHFTLQLWMRRGGATNQARGTRKEEETIVLCETELNNDSYSHYSLSVHGCRLSLFYWPDVSAARPVK-FLWK--LEQVCDSEWHHLSLSVQFP------SVTLYVDGVTFDPALIHDNGAIPNPAPHQRLVIGACWEREDDNSQDSTLNHSHGGYKGLLSGVTVRPGNVEPHSVVECLYACREGLDFGDLETLGSGMKVHVNPSQSVLVLEGDDIESFNRAVQQVTYRNSLRFATPGVRPLKLTTSLRC 611          
BLAST of GL18378 vs. Ensembl Zebrafish
Match: clstn1 (calsyntenin 1 [Source:ZFIN;Acc:ZDB-GENE-040426-1064])

HSP 1 Score: 129.798 bits (325), Expect = 4.919e-30
Identity = 144/614 (23.45%), Postives = 240/614 (39.09%), Query Frame = 3
Query:   87 LAWNTNRPFKYKGFIYTDSSVAVISPNLQVILKSGEEICNFQLTKSDYNRETLDYNPFRAVVKSAHLGLGEIELLANINLSNFTNADINLIITGQAC-HNPDSW----TEPAEISIKVIDPPE--PLWTKSSYVATITNDAIIGSPVIKVTAYLPPLADPDNKICQYHIENSSNSPFTIDGSGTISTRQNLLNSDVTLVILDVTAEDCSLPTHRQSTVKVFITITPICKIGWTGFYKIFQYLSGSGVIPIGKKLEFRFCSKNPKNNLNQIIENCKLKKKFRVTVSIEFKDLFQFSQESTTNDNDICYLDYKSLKLQRKICDINDNKAVDLLNALAKQKTGVIKFPLETNM-------FPGLSVVK----------QDKFSLLFWMLRKTPEENFDEFIVCHLH--ESGDILFSVSISFCNLRIFLNSSSNVQENSQLFFWEYNLSTICDNKWHHYLLHIQRSRDRNSHEVNILIDGESVEHKIQTSATEPRDFVKSPINEKYNF---FIGQSTRTSKRYFKGYIAGLIYLPDIIVKSSSVRCLMKCMERLHFNGMNEMNPGMSVSLNSEMQTIIINGHNVEEVAKLVEDVGYANPKWNPIPGLRIIVIKTDMSC 1841
            +A + + P +Y             + + +V      EIC F++   +         PF AVV     G G I   A   L      +    I    C   PD      +  A + I+V D  E  P++ + SY AT+       S ++KV A     +   ++IC Y I  + + PFTID  G I   + L      +  L VTA DC         V V I I P CK  W GF K  +Y  G+G + +   +    C + P  ++             + ++ +E           T +    C  D  S K   K+C  +    V+LL A +      +  P +          F G   +K          ++ F++  WM R  P     E I+C+    E     +S+ +  C L + L       E+ +   + + L  +CD +WHHY+L+I+         V + +DG + E  +    TE      S I  +      + G S R ++ +F+G +AGL+     +     + CL  C E L      E+   + V  N    ++ + G ++E   K+++ + Y N +  P PG+R + + T + C
Sbjct:   57 IALDKDAPLRY-------------AESFEVTFTKEGEICGFRIHGQNV--------PFEAVVLDKSTGEGVIR--AKDKLDCELQKEHTFTIQAYDCGEGPDGGNMKKSHKATVHIQVNDVNEYSPVFKEKSYKATVIEGKKYDS-IMKVEAVDADCSFQFSQICSYEI-VTPDVPFTIDKDGNIKNTEKLNYGKERMYKLTVTAYDCG-KNRASEDVLVKINIKPTCKPSWQGFNKRIEYEPGTGSLALFPSMHLETCEE-PITSI-------------QASIMLE-----------TNHIGKGCDRDTYSEKSLHKLCGASSG-TVELLPAPSNSANWTVGLPTDNGHDSDQVFEFNGTQAIKVPEGVVSTTLKEPFTISVWM-RHGPGGREKETILCNSDKTEMNRHHYSLYVHNCRLVLLLRQEPTESESYKPAEFHWKLDQVCDKEWHHYVLNIEFPA------VTLFVDGGTFEPFL---VTEDYPLHTSKIETQLTIGACWQGGSARMTQ-FFRGNLAGLMIRSGKLENKKVIDCLYTCKEGLDVQLPEEVASAVKVEFNPNQSSLSLEGDDIESFEKVMQHISYLNSRQFPTPGIRHLRVSTTVKC 607          
BLAST of GL18378 vs. Ensembl Xenopus
Match: gsk3a (glycogen synthase kinase 3 alpha [Source:Xenbase;Acc:XB-GENE-487251])

HSP 1 Score: 135.961 bits (341), Expect = 8.845e-32
Identity = 148/657 (22.53%), Postives = 264/657 (40.18%), Query Frame = 3
Query:   12 FQIIMLKKLIVFLIISVTQFCLSLSLAWNTNRPF---KYKGFIYTDSSVAVISPNLQVI-----LKSGEEICNFQLTKSDYNRETLDYNPFRAVVKSAHLGLGEIELLANINLSNFTNADINLIITGQAC-HNPDSW----TEPAEISIKVIDPPE--PLWTKSSYVATITNDAIIGSPVIKVTAYLPPLADPDNKICQYHIENSSNSPFTIDGSGTISTRQNLLNSDVTLVILDVTAEDCSLPTHRQSTVKVFITITPICKIGWTGFYKIFQYLSGSGVIPIGKKLEFRFCSKNPKNNLNQIIENCKLKKKFRVTVSIEFKDLFQFSQESTTNDNDICYLDYKSLKLQRKICDINDNKAVDLLNALAKQKTGVIKFPLETNM-------FPGLSVVK------------QDKFSLLFWML-------RKTPEENFDEFIVCHLHESGDI-LFSVSISFCNLRI----FLNSSSNVQENSQLFFWEYNLSTICDNKWHHYLLHIQRSRDRNSHEVNILIDGESVEHK-IQTSATEPRDFVKSPINEKYNFFIGQSTRTSKRYFKGYIAGLIYLPDIIVKSSSVRCLMKCMERLHFNGMNEMNPGMSVSLNSEMQTIIINGHNVEEVAKLVEDVGYANPKWNPIPGLRIIVIKTDMSC 1841
            F + +++  + + +   +  C+    A N ++P+   +Y+G I  +    +++P L  +     L+   EIC F++  S          PF AVV     G G I     ++       +    I    C   PD      +  A + ++V D  E  P++ +  + A++T   +    V++V A+    +   +++C Y I  + N PFTID  G I   Q L  S   L+   VTA DC          +V I + P CK  W G+ K  +Y+ GSG + +   +    C + P  N+             + TV I+           T++    C  D  S K  RK+C  +    VDL+   +         P++          F G   V+             D  +L FW+        R   EE   E ++C+  ++GD   +++++  C +       L S+  V+     F W+  L  +CD +WHHY L ++         V++ +DG + +   I  +   P      P   +    IG     + R+ +GY++GL      +     + CL  C E L +   + +  GM V +N     + + G +    ++ ++ V Y N    P PG+R + ++T + C
Sbjct:   10 FLLAVIQPSVTWAVYRASTSCVLCFRAGNKHKPWIEAQYQGIIMENDHTVLLNPPLFALDKDAPLRYAGEICGFRIHGSG--------TPFEAVVLDRTTGEGLIRAKGPVDCE--AQREHTFTIQAHDCGEGPDGVNSKKSHKATVHVRVNDVNEFAPVFGERVFKASVTEGRMY-ERVLRVQAWDQDCSPQYSQVCFYQIL-TPNVPFTIDNDGYIKNTQPLQASGEKLIRFTVTAYDCG-KKRAVEDAEVEIQVKPTCKPSWKGWNKRIEYVPGSGSLALFPNIHLETCDE-PVGNI-------------QATVEIQ-----------TSHIAKGCDRDNYSEKALRKLCGASPGD-VDLMPPPSPIHNWTHSLPVQDTQDSSLVFWFNGSQSVEVAPSHLPAGGRTADHLTLSFWLKHAGGSGGRAGKEE---EVLLCNTVQNGDFSHYTLAVHGCRISFLYWSLLESARPVK-----FLWK--LEQVCDVEWHHYALSLEFP------TVSLYVDGVTYDPALIHDNGALP------PPRRQARLMIGGC--WAGRFLRGYMSGLTLRLGPVDSREVIECLYSCKEGLQYTDFDSLGKGMKVHVNPAQSQLSLEGDDAHSFSRALQHVEYLNSLQFPTPGVRPLKLQTIVKC 603          
BLAST of GL18378 vs. Ensembl Xenopus
Match: gsk3a (glycogen synthase kinase 3 alpha [Source:Xenbase;Acc:XB-GENE-487251])

HSP 1 Score: 132.88 bits (333), Expect = 6.922e-31
Identity = 150/666 (22.52%), Postives = 265/666 (39.79%), Query Frame = 3
Query:   12 FQIIMLKKLIVFLIISVTQFCLSLSLAWNTNRPF---KYKGFIYTDSSVAVISPNLQVI-----LKSGEEICNFQLTKSDYNRETLDYNPFRAVVKSAHLGLGEIELLANINLSNFTNADINLIITGQAC-HNPDSW----TEPAEISIKVIDPPE--PLWTKSSYVATITNDAIIGSPVIKVTAYLPPLADPDNKICQYHIENSSNSPFTIDGSGTISTRQNLLNSDVTLVILDVTAEDCSLPTHRQSTVKVFITITPICKIGWTGFYKIFQYLSGSGVIPIGKKLEFRFCSKNPKNNLNQIIENCKLKKKFRVTVSIEFKDLFQFSQESTTNDNDICYLDYKSLKLQRKICDINDNKAVDLLNALAKQKTGVIKFPLETNM-------FPGLSVVK------------QDKFSLLFWML-------RKTPEENFDEFIVCHLHESGDILFS---VSISFCNLRI----FLNSSSNVQENSQLFFWEYNLSTICDNKWHHYLLHIQRSRDRNSHEVNILIDGESVEHKI---QTSATEPRDFVKSPI-----NEKYNFFIGQSTRTSKRYFKGYIAGLIYLPDIIVKSSSVRCLMKCMERLHFNGMNEMNPGMSVSLNSEMQTIIINGHNVEEVAKLVEDVGYANPKWNPIPGLRIIVIKTDMSC 1841
            F + +++  + + +   +  C+    A N ++P+   +Y+G I  +    +++P L  +     L+   EIC F++  S          PF AVV     G G I     ++       +    I    C   PD      +  A + ++V D  E  P++ +  + A++T   +    V++V A+    +   +++C Y I  + N PFTID  G I   Q L  S   L+   VTA DC          +V I + P CK  W G+ K  +Y+ GSG + +   +    C + P  N+             + TV I+           T++    C  D  S K  RK+C  +    VDL+   +         P++          F G   V+             D  +L FW+        R   EE   E ++C+  ++GD  FS   +++  C +       L S+  V+     F W+  L  +CD +WHHY L ++         V++ +DG + +  +     +   PR   +  I      E      G +     R+ +GY++GL      +     + CL  C E L +   + +  GM V +N     + + G +    ++ ++ V Y N    P PG+R + ++T + C
Sbjct:   10 FLLAVIQPSVTWAVYRASTSCVLCFRAGNKHKPWIEAQYQGIIMENDHTVLLNPPLFALDKDAPLRYAGEICGFRIHGSG--------TPFEAVVLDRTTGEGLIRAKGPVDCE--AQREHTFTIQAHDCGEGPDGVNSKKSHKATVHVRVNDVNEFAPVFGERVFKASVTEGRMY-ERVLRVQAWDQDCSPQYSQVCFYQIL-TPNVPFTIDNDGYIKNTQPLQASGEKLIRFTVTAYDCG-KKRAVEDAEVEIQVKPTCKPSWKGWNKRIEYVPGSGSLALFPNIHLETCDE-PVGNI-------------QATVEIQ-----------TSHIAKGCDRDNYSEKALRKLCGASPGD-VDLMPPPSPIHNWTHSLPVQDTQDSSLVFWFNGSQSVEVAPSHLPAGGRTADHLTLSFWLKHAGGSGGRAGKEE---EVLLCNTVQNGDGSFSHYTLAVHGCRISFLYWSLLESARPVK-----FLWK--LEQVCDVEWHHYALSLEFP------TVSLYVDGVTYDPALIHDNGALPPPRRQARLMIGGCWAGEDRWEGEGNTGTFPGRFLRGYMSGLTLRLGPVDSREVIECLYSCKEGLQYTDFDSLGKGMKVHVNPAQSQLSLEGDDAHSFSRALQHVEYLNSLQFPTPGVRPLKLQTIVKC 620          
BLAST of GL18378 vs. Ensembl Xenopus
Match: gsk3a (glycogen synthase kinase 3 alpha [Source:Xenbase;Acc:XB-GENE-487251])

HSP 1 Score: 130.954 bits (328), Expect = 3.010e-30
Identity = 149/668 (22.31%), Postives = 267/668 (39.97%), Query Frame = 3
Query:   12 FQIIMLKKLIVFLIISVTQFCLSLSLAWNTNRPF---KYKGFIYTDSSVAVISPNLQVI-----LKSGEEICNFQLTKSDYNRETLDYNPFRAVVKSAHLGLGEIELLANINLSNFTNADINLIITGQAC-HNPDSW----TEPAEISIKVIDPPE--PLWTKSSYVATITNDAIIGSPVIKVTAYLPPLADPDNKICQYHIENSSNSPFTIDGSGTISTRQNLLNSDVTLVILDVTAEDCSLPTHRQSTVKVFITITPICKIGWTGFYKIFQYLSGSGVIPIGKKLEFRFCSKNPKNNLNQIIENCKLKKKFRVTVSIEFKDLFQFSQESTTNDNDICYLDYKSLKLQRKICDINDNKAVDLLNALAKQKTGVIKFPLETNM-------FPGLSVVK------------QDKFSLLFWML-------RKTPEENFDEFIVCHLHESGDILFS---VSISFCNLRI----FLNSSSNVQENSQLFFWEYNLSTICDNKWHHYLLHIQRSRDRNSHEVNILIDGESVEHKI---QTSATEPRDFVKSPINEKY---NFFIGQSTRTS----KRYFKGYIAGLIYLPDIIVKSSSVRCLMKCMERLHFNGMNEMNPGMSVSLNSEMQTIIINGHNVEEVAKLVEDVGYANPKWNPIPGLRIIVIKTDMSC 1841
            F + +++  + + +   +  C+    A N ++P+   +Y+G I  +    +++P L  +     L+   EIC F++  S          PF AVV     G G I     ++       +    I    C   PD      +  A + ++V D  E  P++ +  + A++T   +    V++V A+    +   +++C Y I  + N PFTID  G I   Q L  S   L+   VTA DC          +V I + P CK  W G+ K  +Y+ GSG + +   +    C + P  N+             + TV I+           T++    C  D  S K  RK+C  +    VDL+   +         P++          F G   V+             D  +L FW+        R   EE   E ++C+  ++GD  FS   +++  C +       L S+  V+     F W+  L  +CD +WHHY L ++         V++ +DG + +  +     +   PR   +  I   +   + + G+          R+ +GY++GL      +     + CL  C E L +   + +  GM V +N     + + G +    ++ ++ V Y N    P PG+R + ++T + C
Sbjct:   10 FLLAVIQPSVTWAVYRASTSCVLCFRAGNKHKPWIEAQYQGIIMENDHTVLLNPPLFALDKDAPLRYAGEICGFRIHGSG--------TPFEAVVLDRTTGEGLIRAKGPVDCE--AQREHTFTIQAHDCGEGPDGVNSKKSHKATVHVRVNDVNEFAPVFGERVFKASVTEGRMY-ERVLRVQAWDQDCSPQYSQVCFYQIL-TPNVPFTIDNDGYIKNTQPLQASGEKLIRFTVTAYDCG-KKRAVEDAEVEIQVKPTCKPSWKGWNKRIEYVPGSGSLALFPNIHLETCDE-PVGNI-------------QATVEIQ-----------TSHIAKGCDRDNYSEKALRKLCGASPGD-VDLMPPPSPIHNWTHSLPVQDTQDSSLVFWFNGSQSVEVAPSHLPAGGRTADHLTLSFWLKHAGGSGGRAGKEE---EVLLCNTVQNGDGSFSHYTLAVHGCRISFLYWSLLESARPVK-----FLWK--LEQVCDVEWHHYALSLEFP------TVSLYVDGVTYDPALIHDNGALPPPRRQARLMIGGCWAGEDRWEGEGNTADLLPIWRFLRGYMSGLTLRLGPVDSREVIECLYSCKEGLQYTDFDSLGKGMKVHVNPAQSQLSLEGDDAHSFSRALQHVEYLNSLQFPTPGVRPLKLQTIVKC 622          
BLAST of GL18378 vs. Ensembl Xenopus
Match: gsk3a (glycogen synthase kinase 3 alpha [Source:Xenbase;Acc:XB-GENE-487251])

HSP 1 Score: 130.183 bits (326), Expect = 4.315e-30
Identity = 150/658 (22.80%), Postives = 262/658 (39.82%), Query Frame = 3
Query:   42 VFLIISVTQFCLSLSLAWNTNRPF---KYKGFIYTDSSVAVISPNLQVI-----LKSGEEICNFQLTKSDYNRETLDYNPFRAVVKSAHLGLGEIELLANINLSNFTNADINLIITGQAC-HNPDSW----TEPAEISIKVIDPPE--PLWTKSSYVATITNDAIIGSPVIKVTAYLPPLADPDNKICQYHIENSSNSPFTIDGSGTISTRQNLLNSDVTLVILDVTAEDCSLPTHRQSTVKVFITITPICKIGWTGFYKIFQYLSGSGVIPIGKKLEFRFCSKNPKNNLNQIIENCKLKKKFRVTVSIEFKDLFQFSQESTTNDNDICYLDYKSLKLQRKICDINDNKAVDLLNALAKQKTGVIKFPLETNM-------FPGLSVVK------------QDKFSLLFWML-------RKTPEENFDEFIVCHLHESGDILFS---VSISFCNLRI----FLNSSSNVQENSQLFFWEYNLSTICDNKWHHYLLHIQRSRDRNSHEVNILIDGESVEHKI---QTSATEPRDFVKSPINEKY---NFFIGQSTRTSK----RYFKGYIAGLIYLPDIIVKSSSVRCLMKCMERLHFNGMNEMNPGMSVSLNSEMQTIIINGHNVEEVAKLVEDVGYANPKWNPIPGLRIIVIKTDMSC 1841
            + L + V   C+    A N ++P+   +Y+G I  +    +++P L  +     L+   EIC F++  S          PF AVV     G G I     ++       +    I    C   PD      +  A + ++V D  E  P++ +  + A++T   +    V++V A+    +   +++C Y I  + N PFTID  G I   Q L  S   L+   VTA DC          +V I + P CK  W G+ K  +Y+ GSG + +   +    C + P  N+             + TV I+           T++    C  D  S K  RK+C  +    VDL+   +         P++          F G   V+             D  +L FW+        R   EE   E ++C+  ++GD  FS   +++  C +       L S+  V+     F W+  L  +CD +WHHY L ++         V++ +DG + +  +     +   PR   +  I   +   + + G+          R+ +GY++GL      +     + CL  C E L +   + +  GM V +N     + + G +    ++ ++ V Y N    P PG+R + ++T + C
Sbjct:    4 MLLSLRVVSHCVLCFRAGNKHKPWIEAQYQGIIMENDHTVLLNPPLFALDKDAPLRYAGEICGFRIHGSG--------TPFEAVVLDRTTGEGLIRAKGPVDCE--AQREHTFTIQAHDCGEGPDGVNSKKSHKATVHVRVNDVNEFAPVFGERVFKASVTEGRMY-ERVLRVQAWDQDCSPQYSQVCFYQIL-TPNVPFTIDNDGYIKNTQPLQASGEKLIRFTVTAYDCG-KKRAVEDAEVEIQVKPTCKPSWKGWNKRIEYVPGSGSLALFPNIHLETCDE-PVGNI-------------QATVEIQ-----------TSHIAKGCDRDNYSEKALRKLCGASPGD-VDLMPPPSPIHNWTHSLPVQDTQDSSLVFWFNGSQSVEVAPSHLPAGGRTADHLTLSFWLKHAGGSGGRAGKEE---EVLLCNTVQNGDGSFSHYTLAVHGCRISFLYWSLLESARPVK-----FLWK--LEQVCDVEWHHYALSLEFP------TVSLYVDGVTYDPALIHDNGALPPPRRQARLMIGGCWAGEDRWEGEGNTADLLPIWRFLRGYMSGLTLRLGPVDSREVIECLYSCKEGLQYTDFDSLGKGMKVHVNPAQSQLSLEGDDAHSFSRALQHVEYLNSLQFPTPGVRPLKLQTIVKC 606          
BLAST of GL18378 vs. Ensembl Xenopus
Match: gsk3a (glycogen synthase kinase 3 alpha [Source:Xenbase;Acc:XB-GENE-487251])

HSP 1 Score: 130.183 bits (326), Expect = 5.209e-30
Identity = 151/653 (23.12%), Postives = 262/653 (40.12%), Query Frame = 3
Query:   69 FCLSLSLAWNTNRPF---KYKGFIYTDSSVAVISPNLQVI-----LKSGEEICNFQLTKSDYNRETLDYNPFRAVVKSAHLGLGEIELLANINLSNFTNADINLIITGQAC-HNPDSW----TEPAEISIKVIDPPE--PLWTKSSYVATITNDAIIGSPVIKVTAYLPPLADPDNKICQYHIENSSNSPFTIDGSGTISTRQNLLNSDVTLVILDVTAEDCSLPTHRQSTVKVFITITPICKIGWTGFYKIFQYLSGSGVIPIGKKLEFRFCSKNPKNNLNQIIENCKLKKKFRVTVSIEFKDLFQFSQESTTNDNDICYLDYKSLKLQRKICDINDNKAVDLLNALAKQKTGVIKFPLETNM-------FPGLSVVK------------QDKFSLLFWML-------RKTPEENFDEFIVCHLHESGDILFS---VSISFCNLRI----FLNSSSNVQENSQLFFWEYNLSTICDNKWHHYLLHIQRSRDRNSHEVNILIDGESVEHKI---QTSATEPRDFVKSPIN-----EKYNFFI--GQSTRTS----KRYFKGYIAGLIYLPDIIVKSSSVRCLMKCMERLHFNGMNEMNPGMSVSLNSEMQTIIINGHNVEEVAKLVEDVGYANPKWNPIPGLRIIVIKTDMSC 1841
             C+    A N ++P+   +Y+G I  +    +++P L  +     L+   EIC F++  S          PF AVV     G G I     ++       +    I    C   PD      +  A + ++V D  E  P++ +  + A++T   +    V++V A+    +   +++C Y I  + N PFTID  G I   Q L  S   L+   VTA DC          +V I + P CK  W G+ K  +Y+ GSG + +   +    C + P  N+             + TV I+           T++    C  D  S K  RK+C  +    VDL+   +         P++          F G   V+             D  +L FW+        R   EE   E ++C+  ++GD  FS   +++  C +       L S+  V+     F W+  L  +CD +WHHY L ++         V++ +DG + +  +     +   PR   +  I      EK +  +   ++TR +     R+ +GY++GL      +     + CL  C E L +   + +  GM V +N     + + G +    ++ ++ V Y N    P PG+R + ++T + C
Sbjct:    8 LCVLCFRAGNKHKPWIEAQYQGIIMENDHTVLLNPPLFALDKDAPLRYAGEICGFRIHGSG--------TPFEAVVLDRTTGEGLIRAKGPVDCE--AQREHTFTIQAHDCGEGPDGVNSKKSHKATVHVRVNDVNEFAPVFGERVFKASVTEGRMY-ERVLRVQAWDQDCSPQYSQVCFYQIL-TPNVPFTIDNDGYIKNTQPLQASGEKLIRFTVTAYDCG-KKRAVEDAEVEIQVKPTCKPSWKGWNKRIEYVPGSGSLALFPNIHLETCDE-PVGNI-------------QATVEIQ-----------TSHIAKGCDRDNYSEKALRKLCGASPGD-VDLMPPPSPIHNWTHSLPVQDTQDSSLVFWFNGSQSVEVAPSHLPAGGRTADHLTLSFWLKHAGGSGGRAGKEE---EVLLCNTVQNGDGSFSHYTLAVHGCRISFLYWSLLESARPVK-----FLWK--LEQVCDVEWHHYALSLEFP------TVSLYVDGVTYDPALIHDNGALPPPRRQARLMIGGCWAEEKLSVKVDDNETTRVTGTFPGRFLRGYMSGLTLRLGPVDSREVIECLYSCKEGLQYTDFDSLGKGMKVHVNPAQSQLSLEGDDAHSFSRALQHVEYLNSLQFPTPGVRPLKLQTIVKC 605          
BLAST of GL18378 vs. Ensembl Mouse
Match: Clstn3 (calsyntenin 3 [Source:MGI Symbol;Acc:MGI:2178323])

HSP 1 Score: 125.561 bits (314), Expect = 1.201e-28
Identity = 157/649 (24.19%), Postives = 249/649 (38.37%), Query Frame = 3
Query:   96 NTNRPF---KYKGFIYTDSSVAVISPNLQVI-----LKSGEEICNFQLTKSDYNRETLDYNPFRAVVKSAHLGLGEIELLANINLSNFTNADINLIITGQAC-HNPDSW----TEPAEISIKVIDPPE--PLWTKSSYVATITNDAIIGSPVIKVTAYLPPLADPDNKICQYHIENSSNSPFTIDGSGTISTRQNLLNSDVTLVILDVTAEDCSLPTHRQSTVKVFITITPICKIGWTGFYKIFQYLSGSGVIPIGKKLEFRFCSKNPKNNLNQIIENCKLKKKFRVTVSIEFKDLFQFSQESTTNDNDICYLDYKSLKLQRKICDINDNKAVDLLNALAKQK----------------------TGVIKFPLETNMFPGLSVVKQDKFS----LLFWMLRK-TPEEN--FDEFIVCHL--HESGDILFSVSISFCNLRI----FLNSSSNVQENSQLFFWEYNLSTICDNKWHHYLLHIQRSRDRNSHEVNILIDGESVEHK-------IQTSATEPRDFVKSPINEKYNFFI--GQ-STRTSK-------RYFKGYIAGLIYLPDIIVKSSSVRCLMKCMERLHFNGMNEMNPGMSVSLNSEMQTIIINGHNVEEVAKLVEDVGYANPKWNPIPGLRIIVIKTDMSC 1841
            N ++P+   +Y+G +  + +  +++P L  +     L+   EIC F+L  S          PF AV+     G G I     ++       +    I    C   PD      +  A + ++V D  E  P++ +  Y A +T   +    +++V A     +   ++IC Y I  + N+PF ID  G I   + L  S   L    VTA DC          +V I + P CK  W G+ K  +Y  G+G + +   +    C + P  N+   IE                    Q S  +   D D    +Y    L RK+C     + VDLL                             T  ++ PL      GL    QD FS    L FWM    TP +    +E IVC+   +E G   +S+++  C +       L S+  V+     F W+  L  +CD++WHHY L+++         V +  DG S +         I     EP   + +   E+ N     G+ ST T+         YF GY+AG       +     + CL  C E L +     +  GM V +N     + + G +VE     ++ V Y N      PG+R + + T + C
Sbjct:   23 NKHKPWIEAEYQGIVMENDNTVLLNPPLFALDKDAPLRYAGEICGFRLHGSGV--------PFEAVILDKATGEGLIRAKEPVDCE--AQKEHTFTIQAYDCGEGPDGTNTKKSHKATVHVRVNDVNEFAPVFVERLYRAAVTEGKLYDR-ILRVEAIDGDCSPQYSQICYYEIL-TPNTPFLIDNDGNIENTEKLQYSGEKLYKFTVTAYDCG-KKRAADDAEVEIQVKPTCKPSWQGWNKRIEYAPGAGSLALFPGIRLETCDE-PLWNIQATIE-------------------LQTSHVAKGCDRD----NYSERAL-RKLCGAATGE-VDLLPMPGPNANWTAGLSVHYSQDSSLIYWFNGTQAVQVPLGGPA--GLGSGPQDGFSDHFTLSFWMKHSVTPSKGKKEEETIVCNTVQNEDGYSHYSLTVHGCRIAFLYWPLLESARPVK-----FLWK--LEQVCDDEWHHYALNLEFPT------VTLYTDGISFDPALIHDNGLIHPPRREPALMIGACWTEEKNKEKKGGENSTDTASGDPLLIHHYFHGYLAGFSVRSGRLESREVIECLYACREGLDYRDFESLGKGMKVHVNPSQSLLTLEGDDVETFNHALQHVAYMNTLRFATPGVRPLRLTTAVKC 617          
BLAST of GL18378 vs. Ensembl Mouse
Match: Clstn3 (calsyntenin 3 [Source:MGI Symbol;Acc:MGI:2178323])

HSP 1 Score: 119.398 bits (298), Expect = 7.430e-27
Identity = 150/613 (24.47%), Postives = 229/613 (37.36%), Query Frame = 3
Query:  180 LKSGEEICNFQLTKSDYNRETLDYNPFRAVVKSAHLGLGEIELLANINLSNFTNADINLIITGQAC-HNPDSW----TEPAEISIKVIDPPE--PLWTKSSYVATITNDAIIGSPVIKVTAYLPPLADPDNKICQYHIENSSNSPFTIDGSGTISTRQNLLNSDVTLVILDVTAEDCSLPTHRQSTVKVFITITPICKIGWTGFYKIFQYLSGSGVIPIGKKLEFRFCSKNPKNNLNQIIENCKLKKKFRVTVSIEFKDLFQFSQESTTNDNDICYLDYKSLKLQRKICDINDNKAVDLLNALAKQK----------------------TGVIKFPLETNMFPGLSVVKQDKFS----LLFWMLRK-TPEEN--FDEFIVCHL--HESGDILFSVSISFCNLRI----FLNSSSNVQENSQLFFWEYNLSTICDNKWHHYLLHIQRSRDRNSHEVNILIDGESVEHK-------IQTSATEPRDFVKSPINEKYN---FFIGQSTRTSK-------RYFKGYIAGLIYLPDIIVKSSSVRCLMKCMERLHFNGMNEMNPGMSVSLNSEMQTIIINGHNVEEVAKLVEDVGYANPKWNPIPGLRIIVIKTDMSC 1841
            L+   EIC F+L  S          PF AV+     G G I     ++       +    I    C   PD      +  A + ++V D  E  P++ +  Y A +T   +    +++V A     +   ++IC Y I  + N+PF ID  G I   + L  S   L    VTA DC          +V I + P CK  W G+ K  +Y  G+G + +   +    C + P  N+   IE                    Q S  +   D D    +Y    L RK+C     + VDLL                             T  ++ PL      GL    QD FS    L FWM    TP +    +E IVC+   +E G   +S+++  C +       L S+  V+     F W+  L  +CD++WHHY L+++         V +  DG S +         I     EP   + +   E+ N        ST T+         YF GY+AG       +     + CL  C E L +     +  GM V +N     + + G +VE     ++ V Y N      PG+R + + T + C
Sbjct:   22 LRYAGEICGFRLHGSGV--------PFEAVILDKATGEGLIRAKEPVDCE--AQKEHTFTIQAYDCGEGPDGTNTKKSHKATVHVRVNDVNEFAPVFVERLYRAAVTEGKLYDR-ILRVEAIDGDCSPQYSQICYYEIL-TPNTPFLIDNDGNIENTEKLQYSGEKLYKFTVTAYDCG-KKRAADDAEVEIQVKPTCKPSWQGWNKRIEYAPGAGSLALFPGIRLETCDE-PLWNIQATIE-------------------LQTSHVAKGCDRD----NYSERAL-RKLCGAATGE-VDLLPMPGPNANWTAGLSVHYSQDSSLIYWFNGTQAVQVPLGGPA--GLGSGPQDGFSDHFTLSFWMKHSVTPSKGKKEEETIVCNTVQNEDGYSHYSLTVHGCRIAFLYWPLLESARPVK-----FLWK--LEQVCDDEWHHYALNLEFPT------VTLYTDGISFDPALIHDNGLIHPPRREPALMIGACWTEEKNKEKKGGENSTDTASGDPLLIHHYFHGYLAGFSVRSGRLESREVIECLYACREGLDYRDFESLGKGMKVHVNPSQSLLTLEGDDVETFNHALQHVAYMNTLRFATPGVRPLRLTTAVKC 580          
BLAST of GL18378 vs. Ensembl Mouse
Match: Clstn2 (calsyntenin 2 [Source:MGI Symbol;Acc:MGI:1929897])

HSP 1 Score: 113.235 bits (282), Expect = 6.829e-25
Identity = 133/624 (21.31%), Postives = 245/624 (39.26%), Query Frame = 3
Query:   96 NTNRPF---KYKGFIYTDSSVAVISPNLQVILKSGE-----EICNFQLTKSDYNRETLDYNPFRAVVKSAHLGLGEIELLANINLSNFTNADINLIITGQACH---NPDSW--TEPAEISIKVIDPPE--PLWTKSSYVATITNDAIIGSPVIKVTAYLPPLADPDNKICQYHIENSSNSPFTIDGSGTISTRQNLLNSDVTLVILDVTAEDCSLPTHRQSTVKVFITITPICKIGWTGFYKIFQYLSGSGVIPIGKKLEFRFCSKNPKNNLNQIIENCKLKKKFRVTVSIEFKDLFQFSQESTTND-NDICYLDYKSLKLQRKICDINDNKAVDLLNALAKQKTGVIKFPLETN----MFPGLSVVK----------QDKFSLLFWMLRKTPEENF---DEFIVCHLH--ESGDILFSVSISFCNLRIFLNSSSNVQENSQLFFWEYNLSTICDNKWHHYLLHIQRSRDRNSHEVNILIDGESVEHKIQTSATEPRDFVKSPINEKYNFFIG---QSTRTSK----RYFKGYIAGLIYLPDIIVKSSSVRCLMKCMERLHFNGMNEMNPGMSVSLNSEMQTIIINGHNVEEVAKLVEDVGYANPKWNPIPGLRIIVIKTDMSC 1841
            N ++P+    Y G I  ++   ++ P L  + K        EIC F++   +         PF AVV +   G G +   + I+       +   II    C       +W  +  A + I+V D  E  P + + +Y A +T   I  S +++V A     +   ++IC Y I  +++ PF ID +G I   + L         + VTA DC      Q T+ V + + P+CK GW  + K  +Y  GSG +P+   +    C     +                           Q + E  TN     C  +  S K  +K+C  +    +DLL + +          ++++     F G    K           D+F++  WM +  P        E I+C+    E     +++ +  C L   L    +  +  +   + + L  ICD +WH+Y+++++         V + +DG + E  + T+     D+   P +      +G   Q    +K    ++F G +A L   P  +     + CL  C E L  N +  +  G+    N     +++ G ++  + + ++ V Y N +  P  G+R + + + + C
Sbjct:   40 NKHKPWIETSYHGVITENNDTVILDPPLVALDKDAPVPFAGEICAFKIHGQEL--------PFEAVVLNKTSGEGRLRAKSPIDCE--LQKEYTFIIQAYDCGAGPREAAWKKSHKAVVHIQVKDVNEFAPTFKEPAYKAIVTEGKIYDS-ILQVEAIDEDCSPQYSQICNYEI-VTTDVPFAIDRNGNIRNTEKLSYDKQHQYEILVTAYDCGQKPAAQDTL-VQVDVKPVCKPGWQDWTKRIEYQPGSGSMPLFPSIHLETCDGAVSS--------------------------LQVTAELQTNYIGKGCDRETYSEKSLQKLCGASSG-IIDLLPSPSAATNWTAGLLVDSSEMIFKFDGRQGAKIPDGIVPKNLTDQFTITMWM-KHGPSPGVRAEKETILCNSDKTEMNRHHYALYVHNCRLVFLLRKDFDQADTFRPAEFHWKLDQICDKEWHYYVINVEFPV------VTLYMDGATYEPYLVTN-----DWPIHPSHIAMQLTVGACWQGGEVAKPRFAQFFHGSLASLTIRPGKMESQKVISCLQACKEGLDINSLESLGRGIKYHFNPSQSILVMEGDDIGNINRALQKVSYINSRQFPTAGVRRLRLSSKVQC 611          
BLAST of GL18378 vs. Ensembl Mouse
Match: Clstn2 (calsyntenin 2 [Source:MGI Symbol;Acc:MGI:1929897])

HSP 1 Score: 112.849 bits (281), Expect = 9.934e-25
Identity = 133/624 (21.31%), Postives = 245/624 (39.26%), Query Frame = 3
Query:   96 NTNRPF---KYKGFIYTDSSVAVISPNLQVILKSGE-----EICNFQLTKSDYNRETLDYNPFRAVVKSAHLGLGEIELLANINLSNFTNADINLIITGQACH---NPDSW--TEPAEISIKVIDPPE--PLWTKSSYVATITNDAIIGSPVIKVTAYLPPLADPDNKICQYHIENSSNSPFTIDGSGTISTRQNLLNSDVTLVILDVTAEDCSLPTHRQSTVKVFITITPICKIGWTGFYKIFQYLSGSGVIPIGKKLEFRFCSKNPKNNLNQIIENCKLKKKFRVTVSIEFKDLFQFSQESTTND-NDICYLDYKSLKLQRKICDINDNKAVDLLNALAKQKTGVIKFPLETN----MFPGLSVVK----------QDKFSLLFWMLRKTPEENF---DEFIVCHLH--ESGDILFSVSISFCNLRIFLNSSSNVQENSQLFFWEYNLSTICDNKWHHYLLHIQRSRDRNSHEVNILIDGESVEHKIQTSATEPRDFVKSPINEKYNFFIG---QSTRTSK----RYFKGYIAGLIYLPDIIVKSSSVRCLMKCMERLHFNGMNEMNPGMSVSLNSEMQTIIINGHNVEEVAKLVEDVGYANPKWNPIPGLRIIVIKTDMSC 1841
            N ++P+    Y G I  ++   ++ P L  + K        EIC F++   +         PF AVV +   G G +   + I+       +   II    C       +W  +  A + I+V D  E  P + + +Y A +T   I  S +++V A     +   ++IC Y I  +++ PF ID +G I   + L         + VTA DC      Q T+ V + + P+CK GW  + K  +Y  GSG +P+   +    C     +                           Q + E  TN     C  +  S K  +K+C  +    +DLL + +          ++++     F G    K           D+F++  WM +  P        E I+C+    E     +++ +  C L   L    +  +  +   + + L  ICD +WH+Y+++++         V + +DG + E  + T+     D+   P +      +G   Q    +K    ++F G +A L   P  +     + CL  C E L  N +  +  G+    N     +++ G ++  + + ++ V Y N +  P  G+R + + + + C
Sbjct:   40 NKHKPWIETSYHGVITENNDTVILDPPLVALDKDAPVPFAGEICAFKIHGQEL--------PFEAVVLNKTSGEGRLRAKSPIDCE--LQKEYTFIIQAYDCGAGPREAAWKKSHKAVVHIQVKDVNEFAPTFKEPAYKAIVTEGKIYDS-ILQVEAIDEDCSPQYSQICNYEIV-TTDVPFAIDRNGNIRNTEKLSYDKQHQYEILVTAYDCGQKPAAQDTL-VQVDVKPVCKPGWQDWTKRIEYQPGSGSMPLFPSIHLETCDGAVSS--------------------------LQVTAELQTNYIGKGCDRETYSEKSLQKLCGASSG-IIDLLPSPSAATNWTAGLLVDSSEMIFKFDGRQGAKIPDGIVPKNLTDQFTITMWM-KHGPSPGVRAEKETILCNSDKTEMNRHHYALYVHNCRLVFLLRKDFDQADTFRPAEFHWKLDQICDKEWHYYVINVEFPV------VTLYMDGATYEPYLVTN-----DWPIHPSHIAMQLTVGACWQGGEVAKPRFAQFFHGSLASLTIRPGKMESQKVISCLQACKEGLDINSLESLGRGIKYHFNPSQSILVMEGDDIGNINRALQKVSYINSRQFPTAGVRRLRLSSKVQC 611          
BLAST of GL18378 vs. Ensembl Mouse
Match: Clstn1 (calsyntenin 1 [Source:MGI Symbol;Acc:MGI:1929895])

HSP 1 Score: 108.612 bits (270), Expect = 1.911e-23
Identity = 135/634 (21.29%), Postives = 243/634 (38.33%), Query Frame = 3
Query:   96 NTNRPF---KYKGFIYTDSSVAVISPNLQVI-----LKSGEEICNFQLTKSDYNRETLDYNPFRAVVKSAHLGLGEIELLANINLSNFTNADINLIITGQAC-HNPDSW----TEPAEISIKVIDPPE--PLWTKSSYVATITNDAIIGSPVIKVTAYLPPLADPDNKICQYHIENSSNSPFTIDGSGTISTRQNLLNSDVTLVILDVTAEDCSLPTHRQSTVKVFITITPICKIGWTGFYKIFQYLSGSGVIPIGKKLEFRFCSKNPKNNLNQIIENCKLKKKFRVTVSIEFKDLFQFSQESTTNDNDICYLDYKSLKLQRKICDIND-------------NKAVDLLNALAKQKTGVIKF-PLETNMFPG--LSVVKQDKFSLLFWMLRKTPEENFDEFIVCHLHESGDI---LFSVSISFCNLRIFLNSSSNVQENSQLFFWEYNLSTICDNKWHHYLLHIQRSRDRNSHEVNILIDGESVE-------HKIQTSATEPRDFVKSPINEKYNFFIGQSTRTS-----------KRYFKGYIAGLIYLPDIIVKSSSVRCLMKCMERLHFNGMNEMNPGMSVSLNSEMQTIIINGHNVEEVAKLVEDVGYANPKWNPIPGLRIIVIKTDMSC 1841
            N ++P+    Y G +  + +  ++ P L  +     L+   EIC F++   +         PF AVV     G G I     ++       D    I    C   PD      +  A + I+V D  E  P++ + SY A +  +    S +++V A     +   ++IC Y I  + + PFT+D  G I   + L         L VTA DC      +  V V I++ P C  GW G+    +Y  G+G + +   +    C +   +               + TV +E           T++    C  D  S K   ++C                 N  V L          V +F   +    P   +++  ++ F++  WM R  P     E I+C   ++ D+    +S+ +  C L   L    + ++  +   + + L+ +CD  WHH++L+++         V + +DG   E       + +  +  E +  V +   E      G  T  +            ++F+G +AGL      +     + CL  C E L      + N G+ +  +S    + + G NV E+ K ++ + Y N +  P PG+R + I + + C
Sbjct:   32 NKHKPWLEPTYHGIVTENDNTVLLDPPLIALDKDSPLRFAGEICGFKIHGQNV--------PFDAVVVDKSTGEGIIRSKEKLDCE--LQKDYTFTIQAYDCGKGPDGTGVKKSHKATVHIQVNDVNEYAPVFKEKSYKAAVV-EGKQHSSILRVEAVDADCSPQFSQICSYEI-LTPDVPFTVDKDGYIKNTEKLNYGKEHQYKLTVTAYDCGKKRATED-VLVKISVKPTCSPGWQGWSSRIEYEPGTGALAVFPSIHLETCDEPVAS--------------VQATVELE-----------TSHIGKGCDRDTYSEKSLHRLCGAAAGTSELLPSPSSSFNWTVGLPTDNGHDSDQVFEFNGTQAVRIPDGVVTLDPKEPFTISVWM-RHGPFGRKKETILCSSDKT-DMNRHHYSLYVHGCRLVFLLRQDPSEEKKYRPAEFHWKLNQVCDEDWHHFVLNVEVP------SVTLYVDGIPHEPFSVTEDYPLHPTKIETQLVVGACWQEYSGVESGNETEPATMASAGGDLHMTQFFRGNLAGLTVRSGKLADKKVIDCLYTCKEGLDLQVPEDANRGVQIQASSSQAVLTLEGDNVGELDKAMQHISYLNSRQFPTPGIRRLKITSTVKC 619          
BLAST of GL18378 vs. UniProt/SwissProt
Match: sp|Q5R9Q9|CSTN3_PONAB (Calsyntenin-3 OS=Pongo abelii OX=9601 GN=CLSTN3 PE=2 SV=1)

HSP 1 Score: 126.716 bits (317), Expect = 3.319e-28
Identity = 155/647 (23.96%), Postives = 253/647 (39.10%), Query Frame = 3
Query:   96 NTNRPF---KYKGFIYTDSSVAVISPNLQVI-----LKSGEEICNFQLTKSDYNRETLDYNPFRAVVKSAHLGLGEIELLANINLSNFTNADINLIITGQAC-HNPDSW----TEPAEISIKVIDPPE--PLWTKSSYVATITNDAIIGSPVIKVTAYLPPLADPDNKICQYHIENSSNSPFTIDGSGTISTRQNLLNSDVTLVILDVTAEDCSLPTHRQSTVKVFITITPICKIGWTGFYKIFQYLSGSGVIPIGKKLEFRFCSKNPKNNLNQIIENCKLKKKFRVTVSIEFKDLFQFSQESTTNDNDICYLDYKSLKLQRKICDINDNKAVDLL---NALAKQKTGV-IKFPLETNM---FPGLSVVK-----------------QDKFSLLFWMLRK-TPEEN--FDEFIVCHL--HESGDILFSVSISFCNLRI----FLNSSSNVQENSQLFFWEYNLSTICDNKWHHYLLHIQRSRDRNSHEVNILIDGESVEHK-------IQTSATEPRDFVKSPINEKYNFFIGQ---STRTS-------KRYFKGYIAGLIYLPDIIVKSSSVRCLMKCMERLHFNGMNEMNPGMSVSLNSEMQTIIINGHNVEEVAKLVEDVGYANPKWNPIPGLRIIVIKTDMSC 1841
            N ++P+   +Y+G +  + +  +++P L  +     L+   EIC F+L  S          PF AV+     G G I     ++       +    I    C   PD      +  A + ++V D  E  P++ +  Y A +T   +    +++V A     +   ++IC Y I  + N+PF ID  G I   + L  S   L    VTA DC          +V I + P CK  W G+ K  +Y  G+G + +   +    C + P  N+   IE                    Q S  +   D D    +Y    L RK+C     + VDLL      A    G+ + +  +++    F G   V+                  D F+L FWM    TP +    +E IVC+   +E G   +S+++  C +       L S+  V+     F W+  L  +CD++WHHY L+++         V +  DG S +         I     EP   + +   E  N    +   ST T+       +RYF GY+AG       +     + CL  C E L +     +  GM V +N     + + G +VE     ++ V Y N      PG+R + + T + C
Sbjct:   23 NKHKPWIEAEYQGIVMENDNTVLLNPPLFALDKDAPLRYAGEICGFRLHGSGV--------PFEAVILDKATGEGRIRAKEPMDCE--AQKEHTFTIQAYDCGEGPDGANTKKSHKATVHVRVNDVNEFAPVFVERLYRAAVTEGKLYDR-ILRVEAIDGDCSPQYSQICYYEIL-TPNTPFLIDNDGNIENTEKLQYSGERLYKFTVTAYDCG-KKRAADDAEVEIQVKPTCKPSWQGWNKRIEYAPGAGSLALFPGIRLETCDE-PLWNIQATIE-------------------LQTSHVAKGCDRD----NYSERAL-RKLCGAATGE-VDLLPMPGPNANWTAGLSVHYSQDSSQIYWFNGTQAVQVPLGGPSGLGSGPQDSLSDHFTLSFWMKHGVTPNKGKKEEETIVCNTVQNEDGFSHYSLTVHGCRIAFLYWPLLESARPVK-----FLWK--LEQVCDDEWHHYALNLEFPT------VTLYTDGISFDPALIHDNGLIHPPRREPALMIGACWTEGKNKEKEKGDNSTDTTQGDPLSIQRYFHGYLAGFSVRSGRLESREVIECLYACREGLDYRDFESLGKGMKVHVNPSQSLLTLEGDDVETFNHALQHVAYMNTLRFATPGVRPLRLTTAVKC 617          
BLAST of GL18378 vs. UniProt/SwissProt
Match: sp|Q99JH7|CSTN3_MOUSE (Calsyntenin-3 OS=Mus musculus OX=10090 GN=Clstn3 PE=1 SV=1)

HSP 1 Score: 125.561 bits (314), Expect = 8.398e-28
Identity = 157/649 (24.19%), Postives = 249/649 (38.37%), Query Frame = 3
Query:   96 NTNRPF---KYKGFIYTDSSVAVISPNLQVI-----LKSGEEICNFQLTKSDYNRETLDYNPFRAVVKSAHLGLGEIELLANINLSNFTNADINLIITGQAC-HNPDSW----TEPAEISIKVIDPPE--PLWTKSSYVATITNDAIIGSPVIKVTAYLPPLADPDNKICQYHIENSSNSPFTIDGSGTISTRQNLLNSDVTLVILDVTAEDCSLPTHRQSTVKVFITITPICKIGWTGFYKIFQYLSGSGVIPIGKKLEFRFCSKNPKNNLNQIIENCKLKKKFRVTVSIEFKDLFQFSQESTTNDNDICYLDYKSLKLQRKICDINDNKAVDLLNALAKQK----------------------TGVIKFPLETNMFPGLSVVKQDKFS----LLFWMLRK-TPEEN--FDEFIVCHL--HESGDILFSVSISFCNLRI----FLNSSSNVQENSQLFFWEYNLSTICDNKWHHYLLHIQRSRDRNSHEVNILIDGESVEHK-------IQTSATEPRDFVKSPINEKYNFFI--GQ-STRTSK-------RYFKGYIAGLIYLPDIIVKSSSVRCLMKCMERLHFNGMNEMNPGMSVSLNSEMQTIIINGHNVEEVAKLVEDVGYANPKWNPIPGLRIIVIKTDMSC 1841
            N ++P+   +Y+G +  + +  +++P L  +     L+   EIC F+L  S          PF AV+     G G I     ++       +    I    C   PD      +  A + ++V D  E  P++ +  Y A +T   +    +++V A     +   ++IC Y I  + N+PF ID  G I   + L  S   L    VTA DC          +V I + P CK  W G+ K  +Y  G+G + +   +    C + P  N+   IE                    Q S  +   D D    +Y    L RK+C     + VDLL                             T  ++ PL      GL    QD FS    L FWM    TP +    +E IVC+   +E G   +S+++  C +       L S+  V+     F W+  L  +CD++WHHY L+++         V +  DG S +         I     EP   + +   E+ N     G+ ST T+         YF GY+AG       +     + CL  C E L +     +  GM V +N     + + G +VE     ++ V Y N      PG+R + + T + C
Sbjct:   23 NKHKPWIEAEYQGIVMENDNTVLLNPPLFALDKDAPLRYAGEICGFRLHGSGV--------PFEAVILDKATGEGLIRAKEPVDCE--AQKEHTFTIQAYDCGEGPDGTNTKKSHKATVHVRVNDVNEFAPVFVERLYRAAVTEGKLYDR-ILRVEAIDGDCSPQYSQICYYEIL-TPNTPFLIDNDGNIENTEKLQYSGEKLYKFTVTAYDCG-KKRAADDAEVEIQVKPTCKPSWQGWNKRIEYAPGAGSLALFPGIRLETCDE-PLWNIQATIE-------------------LQTSHVAKGCDRD----NYSERAL-RKLCGAATGE-VDLLPMPGPNANWTAGLSVHYSQDSSLIYWFNGTQAVQVPLGGPA--GLGSGPQDGFSDHFTLSFWMKHSVTPSKGKKEEETIVCNTVQNEDGYSHYSLTVHGCRIAFLYWPLLESARPVK-----FLWK--LEQVCDDEWHHYALNLEFPT------VTLYTDGISFDPALIHDNGLIHPPRREPALMIGACWTEEKNKEKKGGENSTDTASGDPLLIHHYFHGYLAGFSVRSGRLESREVIECLYACREGLDYRDFESLGKGMKVHVNPSQSLLTLEGDDVETFNHALQHVAYMNTLRFATPGVRPLRLTTAVKC 617          
BLAST of GL18378 vs. UniProt/SwissProt
Match: sp|Q8R553|CSTN3_RAT (Calsyntenin-3 OS=Rattus norvegicus OX=10116 GN=Clstn3 PE=2 SV=1)

HSP 1 Score: 122.094 bits (305), Expect = 8.408e-27
Identity = 147/646 (22.76%), Postives = 244/646 (37.77%), Query Frame = 3
Query:   96 NTNRPF---KYKGFIYTDSSVAVISPNLQVI-----LKSGEEICNFQLTKSDYNRETLDYNPFRAVVKSAHLGLGEIELLANINLS-----NFTNADINLIITGQACHNPDSWTEPAEISIKVIDPPEPLWTKSSYVATITNDAIIGSPVIKVTAYLPPLADPDNKICQYHIENSSNSPFTIDGSGTISTRQNLLNSDVTLVILDVTAEDCSLPTHRQSTVKVFITITPICKIGWTGFYKIFQYLSGSGVIPIGKKLEFRFCSKNPKNNLNQIIENCKLKKKFRVTVSIEFKDLFQFSQESTTNDNDICYLDYKSLKLQRKICDINDNKAVDLLNALAKQK----------------------TGVIKFPL--ETNMFPGLSVVKQDKFSLLFWMLRK-TPEEN--FDEFIVCHL--HESGDILFSVSISFCNLRI----FLNSSSNVQENSQLFFWEYNLSTICDNKWHHYLLHIQRSRDRNSHEVNILIDGESVEHK-------IQTSATEPRDFVKS----PINEKYNFFIGQSTRTSK-------RYFKGYIAGLIYLPDIIVKSSSVRCLMKCMERLHFNGMNEMNPGMSVSLNSEMQTIIINGHNVEEVAKLVEDVGYANPKWNPIPGLRIIVIKTDMSC 1841
            N ++P+   +Y+G +  + +  +++P L  +     L+   EIC F+L  S          PF+AV+     G G I     ++        FT    + +      +   S      + +  ++   P++ +  Y A +T   +    +++V A     +   ++IC Y I  + N+PF ID  G I   + L  S   L    VTA DC          +V I + P CK  W G+ K  +Y  G+G + +   +    C + P  N+   IE                    Q S  +   D D    +Y    L RK+C     + VDLL                             T  ++ PL     +  G      D F+L FWM    TP +    +E IVC+   +E G   +S+++  C +       L S+  V+     F W+  L  +CD++WHHY L+++         V +  DG S +         I     EP   + +      N++       ST T+         YF GY+AG       +     + CL  C E L +     +  GM V +N     + + G +VE     ++ V Y N      PG+R + + T + C
Sbjct:   23 NKHKPWIEAEYQGIVMENDNTVLLNPPLFALDKDAPLRYAGEICGFRLHGSGV--------PFKAVILDKATGEGLIRAKEPVDCEAQKEHTFTTQAYDCVDGPDGANTKKSHKATVHVRVNDVNEFAPVFVERLYRAAVTEGKLYDR-ILRVEAIDGDCSPQYSQICYYEIL-TPNTPFLIDNDGNIENTEKLQYSGEKLYKFTVTAYDCG-KKRAADDAEVEIQVKPTCKPSWQGWNKRIEYAPGAGSLALFPGIRLETCDE-PLWNIQATIE-------------------LQTSHVAKGCDRD----NYSERAL-RKLCGAATGE-VDLLPMPGPNANWTAGLSVHYSQDSSLIYWFNGTQAVQVPLGGPAGLGSGPQDGLSDHFTLSFWMKHSVTPSKGKKEEETIVCNTIQNEDGYSHYSLTVHGCRIAFLYWPLLESARPVK-----FLWK--LEQVCDDEWHHYALNLEFPT------VTLYTDGISFDPALIHDNGLIHPPRREPALMIGACWSEEKNKEKEKGGENSTDTTSGDPLPIHHYFHGYLAGFSVRSGRLESREVIECLYACREGLDYRDFESLGKGMKVHVNPSQSLLTLEGDDVETFNHALQHVAYMNTLRFATPGVRPLRLTTAVKC 618          
BLAST of GL18378 vs. UniProt/SwissProt
Match: sp|Q9BQT9|CSTN3_HUMAN (Calsyntenin-3 OS=Homo sapiens OX=9606 GN=CLSTN3 PE=1 SV=1)

HSP 1 Score: 121.324 bits (303), Expect = 1.655e-26
Identity = 153/652 (23.47%), Postives = 251/652 (38.50%), Query Frame = 3
Query:   96 NTNRPF---KYKGFIYTDSSVAVISPNLQVI-----LKSGEEICNFQLTKSDYNRETLDYNPFRAVVKSAHLGLGEIELLANINLSNFTNADINLIITGQAC-HNPDSW----TEPAEISIKVIDPPE--PLWTKSSYVATITNDAIIGSPVIKVTAYLPPLADPDNKICQYHIENSSNSPFTIDGSGTISTRQNLLNSDVTLVILDVTAEDCSLPTHRQSTVKVFITITPICKIGWTGFYKIFQYLSGSGVIPIGKKLEFRFCSKNPKNNLNQIIENCKLKKKFRVTVSIEFKDLFQFSQESTTNDNDICYLDYKSLKLQRKICDINDNKAVDLL---NALAKQKTGV-IKFPLETNM---FPGLSVVK-----------------QDKFSLLFWMLRK-TPEEN--FDEFIVCHL--HESGDILFSVSISFCNLRI----FLNSSSNVQENSQLFFWEYNLSTICDNKWHHYLLHIQRSRDRNSHEVNILIDGESVEHKIQTSATEPRDFVKSPINEKYNFFIGQ---------------STRTSK-------RYFKGYIAGLIYLPDIIVKSSSVRCLMKCMERLHFNGMNEMNPGMSVSLNSEMQTIIINGHNVEEVAKLVEDVGYANPKWNPIPGLRIIVIKTDMSC 1841
            N ++P+   +Y+G +  + +  +++P L  +     L+   EIC F+L  S          PF AV+     G G I     ++       +    I    C   PD      +  A + ++V D  E  P++ +  Y A +T   +    +++V A     +   ++IC Y I  + N+PF ID  G I   + L  S   L    VTA DC          +V I + P CK  W G+ K  +Y  G+G + +   +    C + P  N+   IE                    Q S  +   D D    +Y    L RK+C     + VDLL      A    G+ + +  ++++   F G   V+                  D F+L FWM    TP +    +E IVC+   +E G   +S+++  C +       L S+  V+     F W+  L  +CD++WHHY L+++         V +  DG S +  +          +  P  E     IG                ST T++        YF GY+AG       +     + CL  C E L +     +  GM V +N     + + G +VE     ++ V Y N      PG+R + + T + C
Sbjct:   23 NKHKPWIEAEYQGIVMENDNTVLLNPPLFALDKDAPLRYAGEICGFRLHGSGV--------PFEAVILDKATGEGLIRAKEPVDCE--AQKEHTFTIQAYDCGEGPDGANTKKSHKATVHVRVNDVNEFAPVFVERLYRAAVTEGKLYDR-ILRVEAIDGDCSPQYSQICYYEIL-TPNTPFLIDNDGNIENTEKLQYSGERLYKFTVTAYDCG-KKRAADDAEVEIQVKPTCKPSWQGWNKRIEYAPGAGSLALFPGIRLETCDE-PLWNIQATIE-------------------LQTSHVAKGCDRD----NYSERAL-RKLCGAATGE-VDLLPMPGPNANWTAGLSVHYSQDSSLIYWFNGTQAVQVPLGGPSGLGSGPQDSLSDHFTLSFWMKHGVTPNKGKKEEETIVCNTVQNEDGFSHYSLTVHGCRIAFLYWPLLESARPVK-----FLWK--LEQVCDDEWHHYALNLEFPT------VTLYTDGISFDPAL----IHDNGLIHPPRREP-ALMIGACWTEEKNKEKEKGDNSTDTTQGDPLSIHHYFHGYLAGFSVRSGRLESREVIECLYACREGLDYRDFESLGKGMKVHVNPSQSLLTLEGDDVETFNHALQHVAYMNTLRFATPGVRPLRLTTAVKC 617          
BLAST of GL18378 vs. UniProt/SwissProt
Match: sp|Q0VCN6|CSTN3_BOVIN (Calsyntenin-3 OS=Bos taurus OX=9913 GN=CLSTN3 PE=2 SV=2)

HSP 1 Score: 119.013 bits (297), Expect = 7.377e-26
Identity = 151/648 (23.30%), Postives = 248/648 (38.27%), Query Frame = 3
Query:   96 NTNRPF---KYKGFIYTDSSVAVISPNLQVI-----LKSGEEICNFQLTKSDYNRETLDYNPFRAVVKSAHLGLGEIELLANINLSNFTNADINLIITGQAC-HNPDSW----TEPAEISIKVIDPPE--PLWTKSSYVATITNDAIIGSPVIKVTAYLPPLADPDNKICQYHIENSSNSPFTIDGSGTISTRQNLLNSDVTLVILDVTAEDCSLPTHRQSTVKVFITITPICKIGWTGFYKIFQYLSGSGVIPIGKKLEFRFCSKNPKNNLNQIIENCKLKKKFRVTVSIEFKDLFQFSQESTTNDNDICYLDYKSLKLQRKICDINDNKAVDLL---NALAKQKTGV-IKFPLETNM---FPGLSVVK-----------------QDKFSLLFWMLRK-TPEEN--FDEFIVCHL--HESGDILFSVSISFCNLRI----FLNSSSNVQENSQLFFWEYNLSTICDNKWHHYLLHIQRSRDRNSHEVNILIDGESVEHK-------IQTSATEPRDFVKS--PINEKYNFFIGQSTRTSK---------RYFKGYIAGLIYLPDIIVKSSSVRCLMKCMERLHFNGMNEMNPGMSVSLNSEMQTIIINGHNVEEVAKLVEDVGYANPKWNPIPGLRIIVIKTDMSC 1841
            N ++P+   +Y+G +  + +  +++P L  +     L+   EIC F+L  S          PF AV+     G G I     ++       +    I    C   PD      +  A + ++V D  E  P++ +  Y A +T   +    +++V A     +   ++IC Y I  + N+PF ID  G I   + L  S   L    VTA DC          +V I + P CK  W G+ K  +Y  G+G + +   +    C + P  N+   IE                    Q S  +   D D    +Y    L RK+C     + VDLL      A    G+ + +  ++++   F G   V+                  D F+L FWM    TP +    +E IVC+   +E G   +S+++  C +       L S+  V+     F W+  L  +CD++WHHY L+++         V +  DG S +         I     EP   + +     +      G    T            YF GY+AG       +     + CL  C E L +     +  GM V +N     + + G +VE     ++ V Y N      PG+R + + T + C
Sbjct:   23 NKHKPWIEAEYQGIVMENDNTVLLNPPLFALDKDAPLRYAGEICGFRLHGSGV--------PFEAVILDKATGEGLIRAKEPVDCE--AQKEHTFTIQAYDCGEGPDGANTKKSHKATVHVRVNDVNEFAPVFVERLYRAAVTEGKLYDR-ILRVEAIDGDCSPQYSQICYYEIL-TPNTPFLIDNDGNIENTEKLQYSGEKLYKFTVTAYDCG-KKRAADDAEVEIQVKPTCKPSWQGWNKRIEYAPGAGSLALFPGIRLETCDE-PLWNIQATIE-------------------LQTSHVAKGCDRD----NYSERAL-RKLCGAAPGE-VDLLPMPGPNANWTAGLSVHYSQDSSLIYWFNGTQAVQVPLGGAAGLGSGPPDSLSDHFTLSFWMKHGVTPNKGKKEEETIVCNTVQNEDGFSHYSLTVHGCRIAFLYWPLLESARPVK-----FLWK--LEQVCDDEWHHYALNLEFPT------VTLYADGISFDPALIHDNGLIHPPRREPALMIGACWAEEKNKEKEKGGDNSTDATAGDPLPIHHYFHGYLAGFSVRSGRLESREVIECLYACREGLDYRDFESLGKGMKVHVNPSQSLLTLEGDDVETFNHALQHVAYMNTLRFATPGVRPLRLTTAVKC 618          
BLAST of GL18378 vs. TrEMBL
Match: R7UQC1 (Uncharacterized protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_181561 PE=4 SV=1)

HSP 1 Score: 169.088 bits (427), Expect = 5.526e-39
Identity = 161/635 (25.35%), Postives = 273/635 (42.99%), Query Frame = 3
Query:   75 LSLSLAWNTNRPFK---YKGFIYTD-SSVAVISPNLQVILKS-----GEEICNFQLTKSDYNRETLDYNPFRAVVKSAHLGLGEIELLANINLSNFTNADINLIITGQAC----HNPDSWTEPAEISIKVIDPPEPLWTKSSYVATITNDAIIGSPVIKVTAYLPPLADPDNKICQYHIENSSNSPFTIDGSGTISTRQNLLNSDVTLVILDVTAEDCSLPTHRQSTVKVFITITPICKIGWTGFYKIFQYLSGSGVIPIGKKLEFRFCSKNPKNNLNQIIENCKLKKKFRVTVSIEFKDLFQFSQESTTNDNDICYLDYKSLKLQRKICD-------------------INDNKAVDLLNALAKQKTGVIKFPLETNMFPGLSVVKQDKFSLLFWMLRKTPEENFD--EFIVCHLHESGDIL----FSVSISFCNLRIFLNSSSNVQENSQLF---FWEYNLSTICDNKWHHYLLHIQRSRDRNSHEVNILIDGE-SVEHKIQTSATEPRDFVKSPINEKYNFFIGQSTRTSKR----YFKGYIAGLIYLPDIIVKSSSVRCLMKCMERLHFNGMNEMNPGMSVSLNSEMQTIIINGHNVEEVAKLVEDVGYANPKWNPIPGLRIIVIKTDMSC 1841
            L  +++W   R FK   Y G +  D      +S + ++I+       GEEIC + L KS          PF+ ++     GL +I L     L+       +  +    C    H    W     I +K ++   P++T+SSY+  +    ++ S ++ + A     +D  ++IC Y++  +++ PF +   G +S  + L  S     IL V AEDC      ++ V + +  T  C   W G  +   Y +G+G   +        C  NP         +C + ++   TV++            T++    C  D  S+  QRK+C                     +D K  D + AL   K+  ++ P+ T M P L     + F++  WM  +  + N    E I+CH    G+ +    +S+ +  C L + +        +   F    W + +  +CD +WH Y + +      +  EV + IDG+ SV+ K      +     K+         +G   +  ++    YF+GY+AGL  L         ++CL  C E+L F+ M+EM  GMS+SLNSEM  I+I+GHN++EV KL+  VGY N +  P PG R + + T + C
Sbjct:   16 LGSTVSW-AERDFKGRVYHGTVSEDIEEDGEVSLDQELIVHDKSMLVGEEICGYTLYKSHSEM------PFKVILLDRSSGLAKIVLARGYQLNYERRHRYSFQVAAHDCVTGTHTGREW---VYIEVKDVNEHSPVFTQSSYIVNVPEKQMV-SNILTLEATDQDTSDLFHRICSYYLL-TADVPFAVSKEGVLSNTEPLDYSFHHNYILAVQAEDCGGKQSERAMVNIEVVQT--CLPSWKGVEESVVYPAGTGQKTLLPDAHLDLCD-NP---------SC-VPQQVTATVNL-----------VTSHIGKGCDRDTYSILSQRKLCGASEGSVDLLLGQTSDSALPTDDGKEGDQIFAL-DGKSNAMEIPI-TRMDPNLG----EHFTISTWMKHEESKRNSGRKENILCH--SDGENMNRHHYSLFVHNCRLVLLMRQEPGEGIDMNKFKPAEWRWKIPQVCDGQWHLYAVSV------DFPEVRLYIDGKLSVDAKTNPEVIDDWPLHKAKSVHYTKLVVGACWQGGEQHLDQYFEGYLAGLSILKGQTESDRVLQCLSNCKEKLDFHAMSEMETGMSISLNSEMTEIVISGHNIDEVEKLLHRVGYINSRLFPTPGYRTLSLSTQVQC 600          
BLAST of GL18378 vs. TrEMBL
Match: V4ALU3 (Uncharacterized protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_116621 PE=4 SV=1)

HSP 1 Score: 159.458 bits (402), Expect = 4.509e-36
Identity = 159/588 (27.04%), Postives = 250/588 (42.52%), Query Frame = 3
Query:  198 ICNFQLTKSDYNRETLDYNPFRAVVKSAHLGLGEIELLANINLSNFTNADINLIITGQACHNPDSWTEPAEISIKVIDPPE--PLWTKSSYVATITNDAIIGSPVIKVTAYLPPLADPDNKICQYHIENSSNSPFTIDGSGTISTRQNLLNSDVTLVILDVTAEDCSLPTHRQSTVKVFITITPICKIGWTGFYKIFQYLSGSGVIPIGKKLEFRFCSKNPKNNLNQIIENCKLKKKFRVTVSIEFKDLFQFSQESTTNDNDICYLDYKSLKLQRKICDINDNKAVDLL----NALAKQKTGVIKFPLETNMF----PGLSVVKQD--------KFSLLFWMLRKTPEENFD--------EFIVCHLHESGDIL----FSVSISFCNLRIFLNSSSNVQENSQLF---FWEYNLSTICDNKWHHYLLHIQRSRDRNSHEVNILIDGESVEHKIQTSATEPRDFVKSPINEKY--NFFIGQSTRTSK----RYFKGYIAGLIYLPDIIVKSSSVRCLMKCMERLHFNGMNEMNPGMSVSLNSEMQTIIINGHNVEEVAKLVEDVGYANPKWNPIPGLRIIVIKTDMSCD 1844
            IC + + K  + + +L   PF  VV +   GL EI +     L+          I    C      + PA + IKV D  E  P +  +SY ATI  +  +   +I V AY    +   + IC Y I  + N PF ID  G I   + L        I+ V A++C     +  +V +FI    IC  GW G      Y +GSG   +  +   + C            + CK  +   V+V +            T +    C  D  S+  QRKIC  + + + DLL    +A   +  G         +F       ++V +D        +F++  WM +   ++N+         E I+C     G+ +    +++ +    L + L      +E  ++F    W ++L  I DN+WHHY +    SR     +V + IDG+ +    +T   E  D+   P ++ +     +G   +  K     +FKGY+AGL  L D       +RCL  C E L F+ + EM  G SVS N+EM    I+G  V EV KL+ +VGY N +  P PG R + I+T +SC+
Sbjct:   13 ICEYNIVKH-FKKTSL---PFEVVVVNRTTGLAEIRVKEGFKLNYEKRRHYRFNIVAVDCGESKKISNPAVVLIKVKDVDEFVPKFENASYYATI-EEGRVYDQIITVKAYDEDRSPTFHDICDYKIV-TPNVPFEIDNQGNIKNTEALDYKRHRNFIMKVKAQECGGKYSKPVSVNIFIK--EICVTGWRGVEDKVVYFAGSGRQKLAAEARLQICE-----------DTCKPDQVGDVSVKMTL---------GTNHIGKGCDRDTFSITSQRKICGASGD-STDLLPPPSSAEWTKNIGTDDGHESDQVFYFDGDNAAIVPEDHFNHTLDNEFTISTWM-KHVFDDNYQQGHSKHPKEHIMCM--SDGEKMNRHHYALFVHGEKLVLLLRREPTTEEEMEIFKPAEWRWHLPQINDNEWHHYAI---SSRIDIMLQVKLYIDGKLLLQD-KTIFEEIDDWPLHPSSKVHYTKLAVGGCWQGGKSKFGHFFKGYLAGLSVLKDKREDDRVIRCLNNCKESLDFHALGEMKTGSSVSFNNEMTEFNISGKKVSEVEKLLHEVGYVNVRSYPTPGRRKLEIETTISCN 564          
BLAST of GL18378 vs. TrEMBL
Match: A0A1S3HFF3 (calsyntenin-1 isoform X2 OS=Lingula unguis OX=7574 GN=LOC106154842 PE=4 SV=1)

HSP 1 Score: 159.073 bits (401), Expect = 7.651e-36
Identity = 135/497 (27.16%), Postives = 216/497 (43.46%), Query Frame = 3
Query:  441 PLWTKSSYVATITNDAIIGSPVIKVTAYLPPLADPDNKICQYHIENSSNSPFTIDGSGTISTRQNLLNSDVTLVILDVTAEDCSLPTHRQSTVKVFITITPICKIGWTGFYKIFQYLSGSGVIPIGKKLEFRFCSKNPKNNLNQIIENCKLKKKFRVTVSIEFKDLFQFSQESTTNDNDICYLDYKSLKLQRKICDINDNKAVDLLNALAKQKTGVIKFPL-------ETNMFPGLSVVKQ-----------DKFSLLFWM--LRKTPEENFDEFIVCHLHESGDIL----FSVSISFCNLRIFLNSSSNVQENS-QLFFWEYNLSTICDNKWHHYLLHIQRSRDRNSHEVNILIDGESVEHKIQTSATEPRDFVKSPINEKYN-FFIGQSTRTSK----RYFKGYIAGLIYLPDIIVKSSSVRCLMKCMERLHFNGMNEMNPGMSVSLNSEMQTIIINGHNVEEVAKLVEDVGYANPKWNPIPGLRIIVIKTDMSC 1841
            P W    Y   +  + I+   V++V A     ++    +C Y I  + + PF I+  G I     L  S V+  +L V A DC        +V V I + P CK+GWTG     +Y+  SG   + +K EF  C              CK +   R++V ++ +         T +    C  D  S+K QRK+C  N N AVDLL   +  ++     P        + N F G +   +           + F+++ WM   R   E    E I+C+    G+ +    +++ +  C L + L   +    N      W +NL  +CD  WHHY + I         +V + +DG       + S     D+   P +  +    IG   +  K    ++FKGY+A L  L     K + ++C+  C E+L F+ M+++N GMS+S NSEM  I + GH+ EEV  +V  +GY N +  P  G R + I + +SC
Sbjct:  148 PEWDALQYSEEV-QEGIMYEKVLQVKATDKDASEVYKNVCGYLIV-TPDVPFDINRDGVIFNTAKLNASIVSNYMLKVKAVDCG--EKMSESVLVNIKVKPTCKVGWTGISDRIEYMPNSGRKMLFEKAEFSTCDIP-----------CKEE---RLSVKVKLQ---------TDHIGKGCDRDTYSVKSQRKLCGANTN-AVDLLPPASMGESWTKNLPTDDGNEGDQINAFDGATNAAEVPSGKFNHTLSEHFTIMTWMKHQRNPLESGIKEHILCN--SDGENMNRHHYALYLHNCKLVLLLRKEAGNDLNKFSPAEWRWNLPEVCDGNWHHYAISIDFP------QVRLYVDGNMFVATHENSEV-IEDWPLHPTHIHFTRLVIGACYQAGKHKLGQFFKGYLAHLSILRGETEKDNVIKCMNNCQEKLEFHAMDQVNTGMSISFNSEMSEITVTGHDSEEVDTVVRQIGYVNARAFPTVGRRNLEITSSVSC 607          
BLAST of GL18378 vs. TrEMBL
Match: A0A087TLN2 (Calsyntenin-1 (Fragment) OS=Stegodyphus mimosarum OX=407821 GN=X975_22544 PE=4 SV=1)

HSP 1 Score: 158.303 bits (399), Expect = 1.074e-35
Identity = 165/724 (22.79%), Postives = 291/724 (40.19%), Query Frame = 3
Query:  294 GEIELLANINLSNFTNADINLIITGQACHNPDSWTEPAEISIKVIDPPEPLWTKSSYVATITNDAIIGSPVIKVTAYLPPLADPDNKICQYHIENSSNSPFTIDGSGTISTRQNLLNSDVTLVILDVTAEDCSLPTHRQSTVKVFITITPICKIGWTGFYKIFQYLSGSGVIPIGKKLEFRFCSKNPKNNLNQIIENCKLKKKFRVTVSIEFKDLFQFSQESTTNDNDICYLDYKSLKLQRKICDINDNKAVDLLNALAKQKTGVIKFPLETNM-------FPGLS---VVKQ--------DKFSLLFWMLRKT-PEEN---FDEFIVCHL--HESGDILFSVSISFCNLRIFLNSSSNVQENSQLFF---WEYNLSTICDNKWHHYLLHIQRSRDRNSHEVNILIDGESVEHKIQTSATE-PRDFVKSPINEKYNFFIGQSTRTSKRY-----FKGYIAGLIYLPDIIVKSSSVRCLMKCMERLHFNGMNEMNPGMSVSLNSEMQTIIINGHNVEEVAKLVEDVGYANPKWNPIPGLRIIVIKTDMSCDKHXXXXXXXXXXXXXSRQNDVVTYGKLXXXXXXXXXXXXXXXDDVSQIRSTTGVGLSVFANATISI-------YAIPXXXXXXXXXXXXXXXRCIVSVHPELVKTKEYFDWPQQALDTLNSENHLIKVTNNSKKIIFFGDFNYQIYQFIIQHLSYFSSSIPNF-NRRFQLQCSS 2342
            GE +L+A   L+          I    C    S      ++++ ++   P + + +Y A    D +    +++V A     +   + IC+Y I  + + PFTID  G I   + L   +    IL V A DC +   + +TV   I +  +C+IGW  F++  +Y  GSG  P+  +     C              CKL+   RV   +           +T +    C  D  S++ QRK+C  + + ++DLL +           P +          F G S   V+ +        D F++ FWM  +  P+ N     E I+C+   H+     +S+ +  C L I L      QE   +F    W + +  +CDN+WHHY + +      N  E  + +DG+  + KIQT+  +   D+   P  +    F+  +    K       F G++AGL  L         + CL +C E L     + + PGM +  NS++  + + G++   +  L+  VGY N +  P PG R + I T ++C +             +  Q ++ +              T     ++++       G+ +FA+ ++ I       Y++  +   + +     +  C V V+P L    EYF  P   +  L      I    N   +I FG      Y  +++ + Y++     + NR F+L CS 
Sbjct:   10 GEAKLVAKKELNCEKRKAYKFDIAAVGCDKTTSENVTVHLTVEDMNEFAPEFVQETYSADADEDRLYDK-IVQVEADDNDCSAKFSDICKYEIL-TRDQPFTIDQEGRIKNTEPLSWEEAPNHILTVVAYDCGMKRSKPATVN--IKVNRVCRIGWKDFHERIEYTPGSGRRPLFPQARLELCDVP-----------CKLE---RVAAKVSL---------ATRHIGKGCDRDTYSVESQRKLCGASSD-SIDLLPSPGIGAEWTRTLPTDDGHESDQIYEFDGTSNAVVIPETTLNHNLTDNFTVAFWMKHEPYPDHNDTHMKEHIICNADDHKMNRHHYSIFVRNCRL-ILLLRREFYQERPSVFRPAEWRWKMPEVCDNQWHHYAVSV------NFPEATLYVDGQ--QFKIQTNNPDIVDDWPLHPAKDINTTFVVGACWQGKDEKMAFNFHGFLAGLSILRGRTENPEVLACLHRCKEGLEVPPADLLEPGMELLTNSDLSEVTVEGNSKSNLEDLISRVGYVNSREFPTPGRRSVQITTTVTCARGKAVKVPPVEAYIMVLQPELPS-------------ITINGTPNLAREYEAFKQGIQLFASVSVLISQDQEEEYSVHGNQENSPNSLDHKLDSCSVQVYPPLNPDHEYFKLPNSLMTHLG-----IHYKENKDGLIIFGADTIHNYDLVLRQIVYYNRKPAYYLNRAFKLVCSE 678          
BLAST of GL18378 vs. TrEMBL
Match: T1J4B1 (Uncharacterized protein OS=Strigamia maritima OX=126957 PE=4 SV=1)

HSP 1 Score: 157.532 bits (397), Expect = 2.120e-35
Identity = 192/798 (24.06%), Postives = 321/798 (40.23%), Query Frame = 3
Query:  117 YKGFIYTDSSVAVISPNLQVILKSGEEICNFQLTKSDYNRETLDYNPFRAVVKSAHLGLGEIELLANINLSNFTNADINLIITGQACHNPDSWTEPAEISIKVID--PPEPLWTKSSYVATITNDAIIGSPVIKVTAYLPPLADPDNKICQYHIENSSNSPFTIDGSGTISTRQNLLNSDVTLVILDVTAEDCSLPTHRQSTVKVFITITPICKIGWTGFYKIFQYLSGSGVIPIGKKLEFRFCSKNPKNNLNQIIENCKLKKKFRVTVSIEFKDLFQFSQESTTNDNDICYLDYKSLKLQRKICDINDNKAVDLLNALAKQKTGVIKFPLETNM-------FPGLS---VVKQ--------DKFSLLFWMLRKTPEEN---FDEFIVCHL--HESGDILFSVSISFCNLRIFLNSSSNVQENSQLF---FWEYNLSTICDNKWHHYLLHIQRSRDRNSHEVNILIDGESVEHKIQTSATEPRDFVKSPINEKYNF---------FIGQSTRTSKRYFKGYIAGLIYLPDIIVKSSSVRCLMKCMERLHFNGMNEMNPGMSVSLNSEMQTIIINGHNVEEVAKLVEDVGYANPKWNPIPGLRIIVIKTDMSCDKHXXXXXXXXXXXXXSRQNDVVTYGKLXXXXXXXXXXXXXXXDDVSQIRSTTGVGLSVFANATISIYAIPXXXXXXXXXXXXXXXRCIVSVHPELVKTKEYFDWPQQALDTLNSENHLIKVTNNSKKIIFFGD---FNYQIYQFIIQHLSYFSSSIPNFNRRFQLQCSSDVGMAIIDSNILVVKI 2390
            Y G I  D     ++P ++ I   G EIC+F++    +          R V K+     G  EL+A   ++     +    I   +C     ++E A + + VID    EP + + SYV  + ++  I   +I+V A           +C+Y   +  N  F ID  G I   + L        IL V A DC +   R   V V I +  +C +GW G  +  +Y  GSG     +K+ F       ++ L+     C+++    V+ ++           +T +    C  D  S++ QRK+C  + + +VDLL             P +          F G++   V+          + F++  WM  +   EN     E+I+C+   H+ G   ++V +  C L I L      +EN   F    W + LS +CDN+WHHY +++      N  EV + +DG+    K       P      P+++             + G  +R    +F G++AGL  L     K S + CL KC E L   GM  + PGM +  N+++  + I G+N   +  LV+ V Y N +  P PG R + + T + C         +  +  +  Q +  T         I+   +     D  + +     G+ VF + +IS+ +       T       +  C VSV P L    EYF  P+  L  L      I    N   ++  G    FNY+  Q + Q L +  +     NR F+L CS   G  + +  ++ + +
Sbjct:   34 YHGLIKEDELTVEVTPKIRAI---GAEICSFRVVNKPHGEVPFQ---LRLVDKTK----GTAELIAKKEVNCEKRKNYKFSIAAVSCDG--VYSENATVHVSVIDVNEYEPEFLEQSYVVQV-DEGRIYDEIIQVKATDEDCTPKFGDVCKYEFSDP-NQLFVIDSEGKIKNTEALDWGKSHNHILSVYAYDCGM--KRSKPVMVTIKVNRVCHLGWKGIPQRIEYTPGSG-----RKVLFL------ESQLDLCDVPCQVE---HVSTTVRL---------ATQHIGKGCDRDTYSVESQRKLCGASVD-SVDLLPTPGLGAEWTKSLPTDDGHESDQIYEFDGVTNAVVIPPSTLPHHLPNNFTISTWMKHRQHTENNSHVREYIICNADDHKMGRPHYAVFVRNCRL-ILLIRRDYTEENMNTFKPAEWRWKLSQVCDNEWHHYAINV------NFPEVTLYVDGQ----KFHIEKKNPAIIDDWPLHKAKGINTTLVVGACWHGGESRMG-HHFGGFLAGLAILRGRTEKPSVLACLHKCKESLEVPGMELLEPGMELLNNNDLTVVAIEGNNKTNLETLVQKVAYTNSREFPTPGRRNLRLFTSVLCSNGKTLKVPLTESYVMVLQPEQPT---------ITINGSSNTACDYYECKK----GVKVFESVSISV-SRDKDETTTRHAGEYKLDSCTVSVLPPLNLDLEYFILPEHHLSELG-----IVYKQNKDGVVLSGADMIFNYE--QVVRQLLYHIRNPAYYLNRAFKLVCSELNGRFVSNEYLVTLAV 758          
BLAST of GL18378 vs. Ensembl Cavefish
Match: clstn1 (calsyntenin 1 [Source:NCBI gene;Acc:103033297])

HSP 1 Score: 137.887 bits (346), Expect = 1.223e-32
Identity = 150/619 (24.23%), Postives = 244/619 (39.42%), Query Frame = 3
Query:   96 NTNRPF---KYKGFIYTDSSVAVISPNLQVI-----LKSGEEICNFQLTKSDYNRETLDYNPFRAVVKSAHLGLGEIELLANINLSNFTNADINLIITGQAC-HNPDSW----TEPAEISIKVIDPPE--PLWTKSSYVATITNDAIIGSPVIKVTAYLPPLADPDNKICQYHIENSSNSPFTIDGSGTISTRQNLLNSDVTLVILDVTAEDCSLPTHRQSTVKVFITITPICKIGWTGFYKIFQYLSGSGVIPIGKKLEFRFCSKNPKNNLNQIIENCKLKKKFRVTVSIEFKDLFQFSQESTTNDNDICYLDYKSLKLQRKICDINDNKAVDLLNALAKQKTGVIKFPLETNM-------FPGLSVVK----------QDKFSLLFWMLRKTPEENFDEFIVCHLH--ESGDILFSVSISFCNLRIFLNSSSNVQENSQLFFWEYNLSTICDNKWHHYLLHIQRSRDRNSHEVNILIDGESVEHKIQTSATEPRDFVKSPINEKYNF---FIGQSTRTSKRYFKGYIAGLIYLPDIIVKSSSVRCLMKCMERLHFNGMNEMNPGMSVSLNSEMQTIIINGHNVEEVAKLVEDVGYANPKWNPIPGLRIIVIKTDMSC 1841
            N ++P+    Y G +  +    ++ P L  +     L+   EIC F++   +         PF AV+     G G I   A   L      +    I    C   PD      +  A + I+V D  E  P++ + SY AT+       S ++KV A     +   ++IC Y I  + + PF+ID  G I   + L  S   +  L VTA DC         V V I I P CK  W GF K  +Y  G+G + +   +    C +   +                +  SIE +         T +    C  D  S K   ++C  +    V+LL A +      +  P +          F G   +K          +D F++  WM R  P     E I+C+    E     +S+ +  C L + L       EN +   + + L  +CD +WHHY+L+I+         V + +DG S E  +    TE      S I  +      + G S R ++ YF+G +AGL+     +     + CL  C E L      E+   + V  N    ++ + G ++E   K+++ + Y N +  P PG+R + + T + C
Sbjct:   35 NKHKPWIETTYHGIVTENDDKVLLDPPLIALDKDAPLRYAGEICGFRIHGQNV--------PFEAVMLDKSTGEGVIR--AKDKLDCELQKEHTFTIQAYDCGEGPDGTNMKKSHKATVHIQVNDVNEYSPVFKEKSYKATVIEGKKYDS-IMKVEAVDADCSFQFSQICSYEI-VTPDVPFSIDKDGNIKNTEKLNYSKERMYKLTVTAYDCG-KNRASEDVLVKINIKPTCKPSWQGFNKRIEYEPGTGSLALFPSVRLETCEEPITS----------------IQASIEVE---------TNHIGKGCDRDTYSEKSLHRLCGAS-TGTVELLPAPSSATNWTVGLPTDNGHDSDQVFEFNGTQAIKVPEGVVSTSLKDPFTVSVWM-RHGPGGREKETILCNSDKTEMNRHHYSLYVHNCRLVLLLRQDPTESENYKPAEFHWKLDQVCDKEWHHYVLNIEFPA------VALFVDGASFEPFL---VTEDYPLHASKIETQLTIGACWQGGSARMTQ-YFRGNLAGLMIRSGKLENKKVIDCLYTCKEGLDVQLPEEVASAVKVEFNPNQSSLTLEGDDIESFEKVMQHISYLNSRQFPTPGIRHLRVTTTVKC 603          
BLAST of GL18378 vs. Ensembl Cavefish
Match: clstn1 (calsyntenin 1 [Source:NCBI gene;Acc:103033297])

HSP 1 Score: 134.035 bits (336), Expect = 2.162e-31
Identity = 152/636 (23.90%), Postives = 246/636 (38.68%), Query Frame = 3
Query:   96 NTNRPF---KYKGFIYTDSSVAVISPNLQVI-----LKSGEEICNFQLTKSDYNRETLDYNPFRAVVKSAHLGLGEIELLANINLSNFTNADINLIITGQAC-HNPDSW----TEPAEISIKVIDPPE--PLWTKSSYVATITNDAIIGSPVIKVTAYLPPLADPDNKICQYHIENSSNSPFTIDGSGTISTRQNLLNSDVTLVILDVTAEDCSLPTHRQSTVKVFITITPICKIGWTGFYKIFQYLSGSGVIPIGKKLEFRFCSKNPKNNLNQIIENCKLKKKFRVTVSIEFKDLFQFSQESTTNDNDICYLDYKSLKLQRKICDINDNKAVDLLNALAKQKTGVIKFPLETNM-------FPGLSVVK----------QDKFSLLFWMLRKTPEENFDEFIVCHLH--ESGDILFSVSISFCNLRIFLNSSSNVQENSQLFFWEYNLSTICDNKWHHYLLHIQRSRDRNSHEVNILIDGESVE------------HKIQTSAT--------EPRDFVKSPINEKYNFFIGQSTRTSKRYFKGYIAGLIYLPDIIVKSSSVRCLMKCMERLHFNGMNEMNPGMSVSLNSEMQTIIINGHNVEEVAKLVEDVGYANPKWNPIPGLRIIVIKTDMSC 1841
            N ++P+    Y G +  +    ++ P L  +     L+   EIC F++   +         PF AV+     G G I   A   L      +    I    C   PD      +  A + I+V D  E  P++ + SY AT+       S ++KV A     +   ++IC Y I  + + PF+ID  G I   + L  S   +  L VTA DC         V V I I P CK  W GF K  +Y  G+G + +   +    C +   +                +  SIE +         T +    C  D  S K   ++C  +    V+LL A +      +  P +          F G   +K          +D F++  WM R  P     E I+C+    E     +S+ +  C L + L       EN +   + + L  +CD +WHHY+L+I+         V + +DG S E             KI+T  T           D     ++E      G S R ++ YF+G +AGL+     +     + CL  C E L      E+   + V  N    ++ + G ++E   K+++ + Y N +  P PG+R + + T + C
Sbjct:   35 NKHKPWIETTYHGIVTENDDKVLLDPPLIALDKDAPLRYAGEICGFRIHGQNV--------PFEAVMLDKSTGEGVIR--AKDKLDCELQKEHTFTIQAYDCGEGPDGTNMKKSHKATVHIQVNDVNEYSPVFKEKSYKATVIEGKKYDS-IMKVEAVDADCSFQFSQICSYEI-VTPDVPFSIDKDGNIKNTEKLNYSKERMYKLTVTAYDCG-KNRASEDVLVKINIKPTCKPSWQGFNKRIEYEPGTGSLALFPSVRLETCEEPITS----------------IQASIEVE---------TNHIGKGCDRDTYSEKSLHRLCGAS-TGTVELLPAPSSATNWTVGLPTDNGHDSDQVFEFNGTQAIKVPEGVVSTSLKDPFTVSVWM-RHGPGGREKETILCNSDKTEMNRHHYSLYVHNCRLVLLLRQDPTESENYKPAEFHWKLDQVCDKEWHHYVLNIEFPA------VALFVDGASFEPFLVTEDYPLHASKIETQLTIGACWQDLSGHDNDTETVSEP---LTGGSARMTQ-YFRGNLAGLMIRSGKLENKKVIDCLYTCKEGLDVQLPEEVASAVKVEFNPNQSSLTLEGDDIESFEKVMQHISYLNSRQFPTPGIRHLRVTTTVKC 620          
BLAST of GL18378 vs. Ensembl Cavefish
Match: clstn3 (calsyntenin 3 [Source:NCBI gene;Acc:103027307])

HSP 1 Score: 128.257 bits (321), Expect = 1.396e-29
Identity = 150/666 (22.52%), Postives = 264/666 (39.64%), Query Frame = 3
Query:   33 KLIVFLIISVTQFCLSLSLA----WNTNRPF---KYKGFIYTDSSVAVISPNLQVI-----LKSGEEICNFQLTKSDYNRETLDYNPFRAVVKSAHLGLGEIELLANINLSNFTNADINLIITGQAC-HNPDSW----TEPAEISIKVIDPPE--PLWTKSSYVATITNDAIIGSPVIKVTAYLPPLADPDNKICQYHIENSSNSPFTIDGSGTISTRQNLLNSDVTLVILDVTAEDCSLPTHRQSTVKVFITITPICKIGWTGFYKIFQYLSGSGVIPIGKKLEFRFCSKNPKNNLNQIIENCKLKKKFRVTVSIEFKDLFQFSQESTTNDNDICYLDYKSLKLQRKICDINDNKAVDLLNALAKQKTGVIKFPLETNMFPGL------------------SVVKQDKFSLLFWMLRK----TPEEN-------FDEFIVCHLHESGDIL--FSVSISFCNLRIFLNSSSNVQENSQLFFWEYNLSTICDNKWHHYLLHIQRSR-----DRNSHEVNILIDGESVEHKIQ------TSATEPRDFVKSPINEKYNFFIGQSTRTSK--RYFKGYIAGLIYLPDIIVKSSSVRCLMKCMERLHFNGMNEMNPGMSVSLNSEMQTIIINGHNVEEVAKLVEDVGYANPKWNPIPGLRIIVIKTDMSC 1841
            K+    ++S+  FCL+ S+A     N ++P+   +Y+G +  + +  +++P L  +     L    EIC F++              F AVV     G G +     ++    +  + +  I    C   PD      +  A + ++V D  E  P++ +  Y A++    +    +++V A     +   ++IC Y I  + N PF ID  G I   + L +    +    VTA DC      Q+  +V +T+ P CK GW G+ K  +Y  GSG IP+   L    C +   N                +  ++E +         T +    C  D  S +  R++C     + VDLL   +         P   +    L                  S V  D F+L  WM R      P  N        +E I+C   ++ D    +S+S+  C L +F     +     + F W+  L  +CD++WHH  L +Q        D  + +  ++ D  ++ + +        +  EP +  K  +N      I ++  T K    ++G ++G+   P  +   S V CL  C E L F  +  +  GM V +N     +++ G ++E   + V+ V Y N      PG+R + + T + C
Sbjct:   11 KMARMSLLSILLFCLT-SVANGNKANKHKPWIETEYQGIVMENDNTVLLNPPLFALDKDAPLHYAGEICGFRVHNGPGGSGAAQ---FEAVVLDRSTGEGLVRSKEPLDCE--SQREHSFTIQAYDCGEGPDGTNSKKSHKATVHVRVNDVNEFSPVFVERRYEASVPEGRLFDR-IVRVEALDADCSPQYSQICFYDI-ITPNVPFAIDNDGNIKNTEPLDSKKQRVHSFWVTAFDCG-KNRAQADAQVVVTVKPSCKPGWIGWSKRVEYTPGSGSIPLFPSLHLETCEETVWN----------------IQATVELQ---------TGHIGKGCDRDSYSDRSVRRLCGAVRGE-VDLLPPPSPAANWTAALPTLPSSDSSLVFSFNGSTHVAVVPDSIASTVAGDHFTLQLWMRRGGANTQPPANQARGTRKEEETIICSTVKNDDSYSHYSLSVHGCRLSLFYWPDVSAARPVK-FLWK--LEQVCDSEWHHLSLSVQFPSVTLYVDGVTFDPALIHDNGAIPNPVPRQRLVIGACWEPEEKQKDILNNS----IPEAKDTGKFVGGYRGLLSGVTVRPGSVEPHSVVECLYACREGLDFGDLETLGSGMKVHVNPSQSVLVLEGDDIESFNRAVQQVTYRNSLRFATPGVRPLKLTTSLRC 634          
BLAST of GL18378 vs. Ensembl Cavefish
Match: clstn3 (calsyntenin 3 [Source:NCBI gene;Acc:103027307])

HSP 1 Score: 128.257 bits (321), Expect = 1.396e-29
Identity = 150/666 (22.52%), Postives = 264/666 (39.64%), Query Frame = 3
Query:   33 KLIVFLIISVTQFCLSLSLA----WNTNRPF---KYKGFIYTDSSVAVISPNLQVI-----LKSGEEICNFQLTKSDYNRETLDYNPFRAVVKSAHLGLGEIELLANINLSNFTNADINLIITGQAC-HNPDSW----TEPAEISIKVIDPPE--PLWTKSSYVATITNDAIIGSPVIKVTAYLPPLADPDNKICQYHIENSSNSPFTIDGSGTISTRQNLLNSDVTLVILDVTAEDCSLPTHRQSTVKVFITITPICKIGWTGFYKIFQYLSGSGVIPIGKKLEFRFCSKNPKNNLNQIIENCKLKKKFRVTVSIEFKDLFQFSQESTTNDNDICYLDYKSLKLQRKICDINDNKAVDLLNALAKQKTGVIKFPLETNMFPGL------------------SVVKQDKFSLLFWMLRK----TPEEN-------FDEFIVCHLHESGDIL--FSVSISFCNLRIFLNSSSNVQENSQLFFWEYNLSTICDNKWHHYLLHIQRSR-----DRNSHEVNILIDGESVEHKIQ------TSATEPRDFVKSPINEKYNFFIGQSTRTSK--RYFKGYIAGLIYLPDIIVKSSSVRCLMKCMERLHFNGMNEMNPGMSVSLNSEMQTIIINGHNVEEVAKLVEDVGYANPKWNPIPGLRIIVIKTDMSC 1841
            K+    ++S+  FCL+ S+A     N ++P+   +Y+G +  + +  +++P L  +     L    EIC F++              F AVV     G G +     ++    +  + +  I    C   PD      +  A + ++V D  E  P++ +  Y A++    +    +++V A     +   ++IC Y I  + N PF ID  G I   + L +    +    VTA DC      Q+  +V +T+ P CK GW G+ K  +Y  GSG IP+   L    C +   N                +  ++E +         T +    C  D  S +  R++C     + VDLL   +         P   +    L                  S V  D F+L  WM R      P  N        +E I+C   ++ D    +S+S+  C L +F     +     + F W+  L  +CD++WHH  L +Q        D  + +  ++ D  ++ + +        +  EP +  K  +N      I ++  T K    ++G ++G+   P  +   S V CL  C E L F  +  +  GM V +N     +++ G ++E   + V+ V Y N      PG+R + + T + C
Sbjct:   11 KMARMSLLSILLFCLT-SVANGNKANKHKPWIETEYQGIVMENDNTVLLNPPLFALDKDAPLHYAGEICGFRVHNGPGGSGAAQ---FEAVVLDRSTGEGLVRSKEPLDCE--SQREHSFTIQAYDCGEGPDGTNSKKSHKATVHVRVNDVNEFSPVFVERRYEASVPEGRLFDR-IVRVEALDADCSPQYSQICFYDI-ITPNVPFAIDNDGNIKNTEPLDSKKQRVHSFWVTAFDCG-KNRAQADAQVVVTVKPSCKPGWIGWSKRVEYTPGSGSIPLFPSLHLETCEETVWN----------------IQATVELQ---------TGHIGKGCDRDSYSDRSVRRLCGAVRGE-VDLLPPPSPAANWTAALPTLPSSDSSLVFSFNGSTHVAVVPDSIASTVAGDHFTLQLWMRRGGANTQPPANQARGTRKEEETIICSTVKNDDSYSHYSLSVHGCRLSLFYWPDVSAARPVK-FLWK--LEQVCDSEWHHLSLSVQFPSVTLYVDGVTFDPALIHDNGAIPNPVPRQRLVIGACWEPEEKQKDILNNS----IPEAKDTGKFVGGYRGLLSGVTVRPGSVEPHSVVECLYACREGLDFGDLETLGSGMKVHVNPSQSVLVLEGDDIESFNRAVQQVTYRNSLRFATPGVRPLKLTTSLRC 634          
BLAST of GL18378 vs. Ensembl Cavefish
Match: clstn2 (calsyntenin 2 [Source:NCBI gene;Acc:103023918])

HSP 1 Score: 124.79 bits (312), Expect = 1.542e-28
Identity = 140/620 (22.58%), Postives = 250/620 (40.32%), Query Frame = 3
Query:   72 CLSLSLAWNTNRPF---KYKGFIYTDSSVAVISPNLQVILKSGE-----EICNFQLTKSDYNRETLDYNPFRAVVKSAHLGLGEIELLANINLSNFTNADINLIITGQACHNPDS---W--TEPAEISIKVIDPPE--PLWTKSSYVATITNDAIIGSPVIKVTAYLPPLADPDNKICQYHIENSSNSPFTIDGSGTISTRQNLLNSDVTLVILDVTAEDCSLPTHRQSTVKVFITITPICKIGWTGFYKIFQYLSGSGVIPIGKKLEFRFCSKNPKNNLNQIIENCKLKKKFRVTVSIEFKDLFQFSQESTTNDNDICYLDYKSLKLQRKICDINDNKAVDLLNALAKQKTGVIKFPLETNMFPGLSVVKQ---DKFSLLFWMLRKTPEENF---DEFIVCHLH--ESGDILFSVSISFCNLRIFLNSSSNVQENSQLFFWEYNLSTICDNKWHHYLLHIQRSRDRNSHEVNILIDGESVEHKIQTSATEPRDFVKSPINEKYNFFIGQ-------STRTSKRYFKGYIAGLIYLPDIIVKSSSVRCLMKCMERLHFNGMNEMNPGMSVSLNSEMQTIIINGHNVEEVAKLVEDVGYANPKWNPIPGLRIIVIKTDMSC 1841
            C +L+   N ++P+    Y G I  +    ++ P L  + K        EIC F++    + +E     PF A V +   G G +     I+       +   II    C +  +   W  +  A + I+V D  E  P++ +  Y AT+T   I  S +++V A+    +   ++IC Y I  + ++PF ID +G I   + L         + VTA DC      +S V V I + P+CK GW G+     Y  G+G   +  K+    C   P +++  ++E        + +   +  D   +S++S      +C     S  L       + N    LL    +    + +F           VV Q   D+F++  WM +  P        E ++C+    E     +S+ +  C L   L       +  +   + + L  ICD +WH+Y+++++         V + +DG + E  + T      D+   P        +G        +T    +YF+G ++GL   P  I     + CL  C E L  N +  +  G+    N     +++ G +++ +   +  V Y N +  P PGLR + + T + C
Sbjct:   18 CGTLAGKVNKHKPWIETSYHGVITENMDTVLLDPPLVALDKDAPVPYAGEICAFKI----HGQEA----PFEAEVLNRTSGEGVLRARGPIDCEQ--QKEYTFIIQAYDCGSGPTGAGWKKSHKAVVHIQVDDVNEFSPVFREPVYRATVTEGKIYDS-ILQVEAWDQDCSPQYSQICNYEIV-TQDTPFAIDRNGNIRNTERLSFDKQQHYKILVTAYDCGQKRASES-VPVHIDVKPVCKPGWQGWNNRVDYEPGTGSKQLFPKMHLETCD-GPLSSVRAMVE-------LQTSHIGKGCDRETYSEKSL---QKLCGAASGSTDL-LPAPSASTNWTASLLTDSGRDSDLIFRFDGRQAANIPERVVPQNLTDQFTIATWM-KHGPSPGLRAEKETLLCNSDKTEMNRHHYSLYVHNCRLVFLLRRDFTQMDTFRPAEFHWKLEQICDKEWHYYVINVEFP------AVTLFVDGVTYEPYLVTD-----DWPIHPSQIDVQLTVGACWQGGEVTTPRFTQYFRGSLSGLTIRPGKIETQKVISCLQACKEGLDINSLESLGKGIKFHFNPAQSVLVMEGDDLDSINTAMAKVSYINSRQFPTPGLRKLRVTTTVQC 600          
BLAST of GL18378 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009762.1 (pep scaffold:Pmarinus_7.0:GL478664:4830:30598:1 gene:ENSPMAG00000008824.1 transcript:ENSPMAT00000009762.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 73.9442 bits (180), Expect = 7.545e-14
Identity = 45/174 (25.86%), Postives = 79/174 (45.40%), Query Frame = 3
Query: 1347 ICDNKWHHYLLHIQRSRDRNSHEVNILIDGESVEHKIQTSATEPRDFVKSPINEKYNFFIG-------QSTRTSKRYFKGYIAGLIYLPDIIVKSSSVRCLMKCMERLHFNGMNEMNPGMSVSLNSEMQTII--INGHNVEEVAKLVEDVGYANPKWNPIPGLRIIVIKTDMSC 1841
            +CD +WHHY++ +      ++  V + +DG S +  + T      D+   P   +    IG       Q +    ++F+G IAG   LP  +   + V CL  C E L    +   +  + V  N    T+   + GH++E++ + V+ V Y N +  P PG R + + T + C
Sbjct:    2 VCDKEWHHYVITV------DTPTVTLYVDGVSYQPYLVTD-----DWPIRPGKSQSQLAIGACWHGGEQPSPRFAQFFRGDIAGFTVLPGHVETQAVVACLHACKESLDLPALPNASSAVKVHFNPTRLTLTLEVEGHDLEQLTEAVKRVAYVNTRQFPTPGPRDLHLATVLHC 164          
BLAST of GL18378 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004811.1 (pep scaffold:Pmarinus_7.0:GL480969:15004:24793:1 gene:ENSPMAG00000004373.1 transcript:ENSPMAT00000004811.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 59.6918 bits (143), Expect = 1.035e-9
Identity = 77/324 (23.77%), Postives = 125/324 (38.58%), Query Frame = 3
Query:  411 ISIKVIDPPEPLWTKSSYVATITNDAIIGSPVIKVTAYLPPLADPDNKICQYHIENSSNSPFTIDGSGTISTRQNLLNSDVTLVILDVTAEDCSLPTHRQSTVKVFITIT--PICKIGWTGFYKIFQYLSGSGVIPIGKKLEFRFCSKNPKNNLNQIIENCKLK-KKFRVTVSIEFKDLFQFSQESTTNDNDICYLDYKSLKLQRKICDINDNKAVDLLNALAKQKTGVIKFPLETNMFP---GLSVVKQD------------------KFSLLFWMLRKTP-----EENFDEFIVCHLHESG--DILFSVSISFCNLRIFLNS 1289
            + +K ++   P + +  Y A++   A  G+ +++V A     +    ++C Y I  ++ +PF+ID  G I   + L         L V A DC     R+S     +TI   P+C+ GW G+ K  +Y  GSG    G+ L        P   L    E C  +    R TV ++   + +     T  +N            +RK+C  +    VDLL +     +     P E    P   G  V   D                  +F+L  W LR  P     + +  E I+C+  ++G     +S+ I  C L   L S
Sbjct:    6 VRVKSVNRHAPEFLQGEYSASVDEAAEPGAALVRVEASDGDCSPLFGRVCDYQI-LTAGAPFSIDSDGVIRATERLSYELHGEQQLTVAAYDCG---KRRSAEDALVTIGVRPVCRPGWQGWNKRVEYDPGSG----GRAL-------FPGARL----ETCGRRVASARATVELQTAHIGKGCDRETYAENS-----------RRKLCGASTG-GVDLLPSPELPGSWTQGLPTEVPEGPDSTGERVFLFDGTRAALVPDAAVPANLTHRFTLAAW-LRHGPLSGPAQRSEKEAILCNSDKAGMNRHHYSLYIHNCRLVFLLRS 297          
BLAST of GL18378 vs. Ensembl Nematostella
Match: EDO40379 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S7D3])

HSP 1 Score: 68.1662 bits (165), Expect = 1.612e-11
Identity = 100/471 (21.23%), Postives = 195/471 (41.40%), Query Frame = 3
Query:  555 ICQYHIENSSNSPFTIDGSGTISTRQNLLNSDVTLVILDVTAEDCSLPTHRQSTVKVFITITPICKIGWT-----GFYKIFQYLSGSGVIPIGKKLEFRFCSKNPKNNLNQIIENCKL---------KKKFRVTVSIEFKDLFQFSQESTTNDNDICYLDYKS-LKLQRKICDINDNKA----------VDLLNALAKQKTGVIKFPLETNMFPGLSVVKQDKFSLLFWMLRKTPEENFDEFIV-----CHLHESGDILFSVSISFCNLRIFLNSSSNVQENSQLFF----------WEYNLSTICDNKWHHYLLHIQRSRDRNSHEVNILIDGESV-EHKIQTSATEPRDFVKSPINEKYNFFIGQ----STRTSKRYFKGYIAGLIYLPDIIVKSSSVRCLMKCMERLHFNGMNEMNPGMSVSLNSEMQTIIINGHNVE-EVAKLVEDVGYANPKWNPIPGLRIIVIKT 1829
            +C+Y +  +++ PF I   G +   + L +        +V A DC      ++ V V + I   CK G+      G   I Q +  + + P    LE   CSK  +  +++ +   KL         +++++ +      D++Q        D    +   KS  K+ +++   +++ A          VD+ + +  QK G                   ++F++ FWM  K  ++   + ++      +LH    I F+V++   N    ++   + Q     FF          W+ N   I D KWHH+ + + RS       V++ IDG+ V  H+     T P +F     N K +  +G       +  +++F+G+++G+   P+ +    ++RCLM C E  H N    +  G + ++     T++I G     +  K+++++ Y N  + P  G+R   I T
Sbjct:  276 VCKY-VVRTADVPFKITNDGVLYLDKPLGSDAPEYCAFEVAAVDCGGKISVEN-VNVRVDIKDSCKPGYNMDQLLGKVSIPQCVGKAIITP---DLELNECSK--EIGVSKFVAKIKLNSNAGKGCDRQRYKAS------DMYQLCGADKVRDLLPRFGPGKSWTKILQEVESFSNDDATFFFDGEKDHVDIPDDVFPQKLG-------------------EEFTISFWMATKDKKKRKSDQVILDSSDANLHNR--IHFAVTLKNHNQLFIIHRLESWQGKQNEFFKSTFLYRPDLWKIN---IADTKWHHFTISVNRSL------VSLHIDGQHVGPHR-----TIP-NFRLHASNTKSHAVVGAVWKGKDKKYEKHFRGFLSGMTVRPNKLTSKQTIRCLMGCRE--HINIGTSLPHGFTATM-PRFNTMVIKGTGRPVDFQKILQNLEYQNDLFTPTSGVRNFQIDT 694          
BLAST of GL18378 vs. Ensembl Medaka
Match: clstn3 (calsyntenin 3 [Source:NCBI gene;Acc:101171608])

HSP 1 Score: 133.65 bits (335), Expect = 2.718e-31
Identity = 148/643 (23.02%), Postives = 252/643 (39.19%), Query Frame = 3
Query:   96 NTNRPF---KYKGFIYTDSSVAVISPNLQVI-----LKSGEEICNFQLTKSDYNRETLDYNPFRAVVKSAHLGLGEIELLANINLSNFTNADINLIITGQAC-HNPDSW----TEPAEISIKVIDPPE--PLWTKSSYVATITNDAIIGSPVIKVTAYLPPLADPDNKICQYHIENSSNSPFTIDGSGTISTRQNLLNSDVTLVILDVTAEDCSLPTHRQSTVKVFITITPICKIGWTGFYKIFQYLSGSGVIPIGKKLEFRFCSKNPKNNLNQIIENCKLKKKFRVTVSIEFKDLFQFSQESTTNDNDICYLDYKSLKLQRKICDINDNKAVDLL---NALAKQKTGVIKFPLETNMF---------------PGLSVVKQDKFSLLFWMLRKTP-----------EENFDEFIVCHLHESGDIL--FSVSISFCNLRIFLNSSSNVQENSQLFFWEYNLSTICDNKWHHYLLHIQRSRDRNSHEVNILIDGESVE-------HKIQTSATEPRDFVKS--PINEKYNFFIGQSTRTSK---RYFKGY---IAGLIYLPDIIVKSSSVRCLMKCMERLHFNGMNEMNPGMSVSLNSEMQTIIINGHNVEEVAKLVEDVGYANPKWNPIPGLRIIVIKTDMSC 1841
            N ++P+   +Y+G +  + +  +++P L  +     L    EIC F++        T+    F AVV     G G +     ++    +  + +  I    C   PD      +  A + ++V D  E  P++ +  Y A++    +    +++V A     +   ++IC Y I  + N PF ID  G I   + L +    +    VTA DC      Q+  +V IT+ P CK GW G+ K  +Y  GSG IP+   L    C +   N                +  ++E +         T +    C  D  S +  R++C     + VDLL   +  A     +   P   +                 P +S +  D F+L  WM R                  +E IVC   ++ D    +S+S+  C L +F     +     + F W+  L  +CD++WHH  L +Q         V + +DG + +         I   A   R F+ +     EK    +  +   SK   +Y  GY   ++G+   P  +   S V CL  C E L F  +  +  GM V +N     +++ G ++E   + V+ V Y N      PG+R + + T + C
Sbjct:   24 NKHKPWIETEYQGIVMENDNTVLLNPPLFALDKDAPLHYAGEICGFRVHNGPLGSGTVQ---FEAVVLDRSTGEGLVRSKEPLDCE--SQREHSFTIQAYDCGEGPDGVNSKKSHKATVHVRVNDVNEFSPVFVERRYEASVPEGRLFDR-IVRVEALDADCSPQYSQICFYDI-ITPNVPFAIDNDGNIKNTEPLDSKQQHVHTFWVTAFDCG-KNRAQADAQVAITVKPSCKPGWMGWTKRVEYTPGSGSIPLFPSLHLETCEETVWN----------------IQATVELQ---------TGHIGKGCDRDSYSDRSVRRLCGAVRGE-VDLLPPPSPAANWTAALPTLPSSDSSLVFSFNGSNHVAVVPDPVVSALSGDHFTLQLWMRRGGANIQPATTQTRGSRKEEEIIVCSTMKNDDSYSHYSLSVHGCRLSLFYWPDVSAARPVK-FLWK--LEQVCDSEWHHLSLSVQFP------SVTLYVDGVTFDPALIHDNGAIPNPAPRQRMFIGACWEPEEKQKEIVNNTIPESKDAVKYVGGYHGLLSGVTVRPGSVEPHSVVECLYACREGLDFGDLETLGSGMKVHVNPSQSVLVLEGDDIESFNRAVQQVTYRNSLRFATPGVRPLKLTTSLRC 623          
BLAST of GL18378 vs. Ensembl Medaka
Match: clstn1 (calsyntenin 1 [Source:NCBI gene;Acc:101174913])

HSP 1 Score: 132.109 bits (331), Expect = 7.617e-31
Identity = 147/642 (22.90%), Postives = 258/642 (40.19%), Query Frame = 3
Query:   30 KKLIVFLIISVTQFCLSLSLAWNTNRPF---KYKGFIYTDSSVAVISPNLQVI-----LKSGEEICNFQLTKSDYNRETLDYNPFRAVVKSAHLGLGEIELLANINLSNFTNADINLIITGQAC-HNPDSW----TEPAEISIKVIDPPE--PLWTKSSYVATITNDAIIGSPVIKVTAYLPPLADPDNKICQYHIENSSNSPFTIDGSGTISTRQNLLNSDVTLVILDVTAEDCSLPTHRQSTVKVFITITPICKIGWTGFYKIFQYLSGSGVIPIGKKLEFRFCSKNPKNNLNQIIENCKLKKKFRVTVSIEFKDLFQFSQESTTNDNDICYLDYKSLKLQRKICDINDNKAVDLLNALAKQKTGVIKFPLETNM-------FPGLSVVK----------QDKFSLLFWMLRKTPEENFDEFIVCHLHESGDI---LFSVSISFCNLRIFLNSSSNVQENSQLFFWEYNLSTICDNKWHHYLLHIQRSRDRNSHEVNILIDGESVEHKIQTSATEPRDFVKSPINEKYNF---FIGQSTRTSKRYFKGYIAGLIYLPDIIVKSSSVRCLMKCMERLHFNGMNEMNPGMSVSLNSEMQTIIINGHNVEEVAKLVEDVGYANPKWNPIPGLRIIVIKTDMSC 1841
            K+L   + + +   C   +   N ++P+    Y G +  +    ++ P L  +     L+   EIC F++   +         PF AVV     G G I   A   L      +    I    C   PD      +  A + I+V D  E  P++ + +Y AT+       S ++KV A     +   ++IC Y I  + + PFTID  G I   + L      +  L VTA DC         V V I++ P CK  W GF K  +Y  G+G + +   +    C + P +++             R +V +E           T +    C  D  S K   K+C    +  V+LL A +      I  P +          F G   +K          ++ F++  WM R  P  +  E I+C+  ++ D+    +S+ +  C L   L    +  E  +   + + L  +CD +WHHY+L+++          ++ +DG + E  +    TE      + I  +      + G + R ++ +F+G +AGLI     +     + CL  C E L      E+   + V  N    ++ + G +++   K+++ + Y N +  P PG+R + + T + C
Sbjct:    7 KQLASAVGLVLGLLCAVKAAKVNKHKPWIETTYHGIVTENDDKVLLDPPLIALDKDAPLRYAGEICGFRIHGQNV--------PFEAVVLDKSTGEGVIR--AKDKLDCELQKEHTFTIQAYDCGEGPDGANMKKSHKATVHIQVNDINEYSPVFKEKTYKATVLEGKKYDS-ILKVEAVDADCSFQFSQICNYEI-VTPDVPFTIDKDGFIKNTEKLSYGKEHMYKLTVTAYDCG-KNRASEDVLVKISVKPTCKPSWQGFNKRIEYEPGTGSLALFPSMHLETCDE-PVSSI-------------RASVELE-----------TNHIGKGCDRDTYSEKSLHKLCGAT-SGTVELLPAPSSSANWTIGLPTDNGHDSDQVFEFNGTQAIKVPNGVVSTNLKEPFTISVWM-RHGPGAHEKETILCNSDKT-DMNRHHYSLYVHNCRLIFLLRQDPSEAETYKPAEFHWKLDQVCDKEWHHYVLNVEFPT------ASLFVDGTTFEPFL---VTEDYPLHATKIETQLTIGACWQGGNARMAQ-FFRGNLAGLIIRSGKLENKKVIDCLYTCKEGLDVQLPEEVASSVKVEFNPNQSSLTVEGEDIDAFDKVMQHISYLNSRQFPTPGIRHLRVATTVKC 597          
BLAST of GL18378 vs. Ensembl Medaka
Match: clstn3 (calsyntenin 3 [Source:NCBI gene;Acc:101171608])

HSP 1 Score: 129.798 bits (325), Expect = 3.679e-30
Identity = 145/644 (22.52%), Postives = 250/644 (38.82%), Query Frame = 3
Query:   96 NTNRPF---KYKGFIYTDSSVAVISPNLQVI-----LKSGEEICNFQLTKSDYNRETLDYNPFRAVVKSAHLGLGEIELLANINLSNFTNADINLIITGQAC-HNPDSW----TEPAEISIKVIDPPE--PLWTKSSYVATITNDAIIGSPVIKVTAYLPPLADPDNKICQYHIENSSNSPFTIDGSGTISTRQNLLNSDVTLVILDVTAEDCSLPTHRQSTVKVFITITPICKIGWTGFYKIFQYLSGSGVIPIGKKLEFRFCSKNPKNNLNQIIENCKLKKKFRVTVSIEFKDLFQFSQESTTNDNDICYLDYKSLKLQRKICDINDNKAVDLL---NALAKQKTGVIKFPLETNMF---------------PGLSVVKQDKFSLLFWMLRKTP-----------EENFDEFIVCHLHESGDIL--FSVSISFCNLRIFLNSSSNVQENSQLFFWEYNLSTICDNKWHHYLLHIQRSRDRNSHEVNILIDGESVE-------HKIQTSATEPRDFV-----KSPINEKYNFFIG----QSTRTSKRYFKGYIAGLIYLPDIIVKSSSVRCLMKCMERLHFNGMNEMNPGMSVSLNSEMQTIIINGHNVEEVAKLVEDVGYANPKWNPIPGLRIIVIKTDMSC 1841
            N ++P+   +Y+G +  + +  +++P L  +     L    EIC F++        T+    F AVV     G G +   +   L   +  + +  I    C   PD      +  A + ++V D  E  P++ +  Y A++    +    +++V A     +   ++IC Y I  + N PF ID  G I   + L +    +    VTA DC      Q+  +V IT+ P CK GW G+ K  +Y  GSG IP+   L    C +   N                +  ++E +         T +    C  D  S +  R++C     + VDLL   +  A     +   P   +                 P +S +  D F+L  WM R                  +E IVC   ++ D    +S+S+  C L +F     +     + F W+  L  +CD++WHH  L +Q         V + +DG + +         I   A   R F+     K+ I     + +     +       ++ G ++G+   P  +   S V CL  C E L F  +  +  GM V +N     +++ G ++E   + V+ V Y N      PG+R + + T + C
Sbjct:    4 NKHKPWIETEYQGIVMENDNTVLLNPPLFALDKDAPLHYAGEICGFRVHNGPLGSGTVQ---FEAVVLDRSTGEGLVR--SKEPLDCESQREHSFTIQAYDCGEGPDGVNSKKSHKATVHVRVNDVNEFSPVFVERRYEASVPEGRLFDR-IVRVEALDADCSPQYSQICFYDI-ITPNVPFAIDNDGNIKNTEPLDSKQQHVHTFWVTAFDCG-KNRAQADAQVAITVKPSCKPGWMGWTKRVEYTPGSGSIPLFPSLHLETCEETVWN----------------IQATVELQ---------TGHIGKGCDRDSYSDRSVRRLCGAVRGE-VDLLPPPSPAANWTAALPTLPSSDSSLVFSFNGSNHVAVVPDPVVSALSGDHFTLQLWMRRGGANIQPATTQTRGSRKEEEIIVCSTMKNDDSYSHYSLSVHGCRLSLFYWPDVSAARPVK-FLWK--LEQVCDSEWHHLSLSVQFP------SVTLYVDGVTFDPALIHDNGAIPNPAPRQRMFIGACWGKAQICLSLGYILMTDFLKCLNAMSHWYHGLLSGVTVRPGSVEPHSVVECLYACREGLDFGDLETLGSGMKVHVNPSQSVLVLEGDDIESFNRAVQQVTYRNSLRFATPGVRPLKLTTSLRC 604          
BLAST of GL18378 vs. Ensembl Medaka
Match: ENSORLT00000043712.1 (calsyntenin 2 [Source:NCBI gene;Acc:101159373])

HSP 1 Score: 124.405 bits (311), Expect = 1.927e-28
Identity = 151/651 (23.20%), Postives = 260/651 (39.94%), Query Frame = 3
Query:   33 KLIVFLIISVTQFCLSLSLAWNTNRPF---KYKGFIYTDSSVAVISPNLQVILKSGE-----EICNFQLTKSDYNRETLDYNPFRAVVKSAHLGLGEIELLANINLSNFTNADINLIITGQACHNPDSWTE-----PAEISIKVIDPPE--PLWTKSSYVATITNDAIIGSPVIKVTAYLPPLADPDNKICQYHIENSSNSPFTIDGSGTISTRQNLLNSDVTLVILDVTAEDCSLPTHRQSTVKVFITITPICKIGWTGFYKIFQYLSGSGVIPIGKKLEFRFCSKNPKNNLNQIIENCKLKKKFRVTVSIEFKDLFQFSQESTTNDNDICYLDYKSLKLQRKICDINDNKAVDLLNALAKQKTGVIKFPLETN--------MFPGLSVVK----------QDKFSLLFWMLRKTPEENF---DEFIVCHLH--ESGDILFSVSISFCNLRIFLNSSSNVQENS---QLFFWEYNLSTICDNKWHHYLLHIQRSRDRNSHEVNILIDGESVEHKIQTSATEPRDFVKSPINEKYNFFIG---QSTRTSK----RYFKGYIAGLIYLPDIIVKSSSVRCLMKCMERLHFNGMNEMNPGMSVSLNSEMQTIIINGHNVEEVAKLVEDVGYANPKWNPIPGLRIIVIKTDMSC 1841
            +L+  L  +V     + S   N ++P+    Y G I  ++ V ++ P L  + K        EIC F +   D         PF AVV +   G G++   + ++       +   II    C +    TE      A + I+V D  E  P++ +  Y A +T   I  S +++V A     +   ++IC Y I  ++NSPF ID +G I   + L         + VTA DC         V V I + P+CK GW G  K   Y  G+G   +  K+    C + P +++             R TV ++           T++    C  +  S K  +K+C  + + + DLL A +          L  N         F G    K           D+F++  WM +  P        E ++C+    E     +S+ +  C L +FL     +Q ++     F W+  L  ICD +WH+Y+++++         V + +DG + +  + T      D+   P        +G   Q    +K    +YF+G ++GL   P  I     + CL  C E L  N +  ++  +    N     +++   +++ +   V  V Y N +  P PG+R + + T + C
Sbjct:    3 RLVCVLAAAVWGLSAAHSKV-NKHKPWIETSYHGVITENTDVVLLDPPLVALDKDAPVPYAGEICAFNIHGLD--------APFEAVVLNGTSGEGQLRARSLVDCE--LQKEYTFIIQAHDCGSGPRGTEGKKSHKAVVHIQVDDVNEFAPVFREPQYHAAVTEGKIYDS-ILQVEATDQDCSPQYSQICNYQI-TTTNSPFAIDRNGNIRNTEKLSYDSQQHYEILVTAWDCGQ-KRALHPVPVHIDVKPVCKPGWQGLNKRVDYEPGTGSKQLFPKMHLETCGE-PLSSV-------------RTTVELQ-----------TSHIGKGCDRETYSEKSLQKLCGAS-SGSTDLLPAPSAATNWTASL-LSDNGRDSDLIFRFDGHQAAKIPDWVVPQNLTDQFTIATWM-KHGPIPGLRAEKETLLCNSDKTEMNRHHYSLYVHNCRL-VFLLRRDFIQADAFRPAEFHWK--LEQICDKEWHYYVINVEFP------AVTLFVDGVTYDPYLVTD-----DWPIHPSQIDVQLTVGACWQGGEVTKPRFTQYFRGSLSGLTVRPGKIESQKVISCLQACKEGLDINSLESLDKSIKFHFNPAQSILVMEADDLQNMNTAVRKVAYINSRQFPTPGIRRLKVSTAVQC 597          
BLAST of GL18378 vs. Ensembl Medaka
Match: clstn1 (calsyntenin 1 [Source:NCBI gene;Acc:101174913])

HSP 1 Score: 124.405 bits (311), Expect = 2.061e-28
Identity = 148/665 (22.26%), Postives = 259/665 (38.95%), Query Frame = 3
Query:   30 KKLIVFLIISVTQFCLSLSLAWNTNRPF---KYKGFIYTDSSVAVISPNL---------------QVILKSGEEICNFQLTKSDYNRETLDYNPFRAVVKSAHLGLGEIELLANINLSNFTNADINLIITGQAC-HNPDSW----TEPAEISIKVIDPPE--PLWTKSSYVATITNDAIIGSPVIKVTAYLPPLADPDNKICQYHIENSSNSPFTIDGSGTISTRQNLLNSDVTLVILDVTAEDCSLPTHRQSTVKVFITITPICKIGWTGFYKIFQYLSGSGVIPIGKKLEFRFCSKNPKNNLNQIIENCKLKKKFRVTVSIEFKDLFQFSQESTTNDNDICYLDYKSLKLQRKICDINDNKAVDLLNALAKQKTGVIKFPLETNM-------FPGLSVVK----------QDKFSLLFWMLRKTPEENFDEFIVCHLHESGDI---LFSVSISFCNLRIFLNSSSNVQENSQLFFWEYNLSTICDNKWHHYLLHIQRSRDRNSHEVNILIDGESVE------------HKIQTSATEPRDFVKSPINEKYNFFIGQSTRTS----KRYFKGYIAGLIYLPDIIVKSSSVRCLMKCMERLHFNGMNEMNPGMSVSLNSEMQTIIINGHNVEEVAKLVEDVGYANPKWNPIPGLRIIVIKTDMSC 1841
            K+L   + + +   C   +   N ++P+    Y G +  +    ++ P L               +V L    EIC F++   +         PF AVV     G G I   A   L      +    I    C   PD      +  A + I+V D  E  P++ + +Y AT+       S ++KV A     +   ++IC Y I  + + PFTID  G I   + L      +  L VTA DC         V V I++ P CK  W GF K  +Y  G+G + +   +    C + P +++             R +V +E           T +    C  D  S K   K+C    +  V+LL A +      I  P +          F G   +K          ++ F++  WM R  P  +  E I+C+  ++ D+    +S+ +  C L   L    +  E  +   + + L  +CD +WHHY+L+++          ++ +DG + E             KI+T  T    + ++  ++       + T        ++F+G +AGLI     +     + CL  C E L      E+   + V  N    ++ + G +++   K+++ + Y N +  P PG+R + + T + C
Sbjct:    7 KQLASAVGLVLGLLCAVKAAKVNKHKPWIETTYHGIVTENDDKVLLDPPLIALDKDAPLRYAESFEVTLTKEGEICGFRIHGQNV--------PFEAVVLDKSTGEGVIR--AKDKLDCELQKEHTFTIQAYDCGEGPDGANMKKSHKATVHIQVNDINEYSPVFKEKTYKATVLEGKKYDS-ILKVEAVDADCSFQFSQICNYEI-VTPDVPFTIDKDGFIKNTEKLSYGKEHMYKLTVTAYDCG-KNRASEDVLVKISVKPTCKPSWQGFNKRIEYEPGTGSLALFPSMHLETCDE-PVSSI-------------RASVELE-----------TNHIGKGCDRDTYSEKSLHKLCGAT-SGTVELLPAPSSSANWTIGLPTDNGHDSDQVFEFNGTQAIKVPNGVVSTNLKEPFTISVWM-RHGPGAHEKETILCNSDKT-DMNRHHYSLYVHNCRLIFLLRQDPSEAETYKPAEFHWKLDQVCDKEWHHYVLNVEFPT------ASLFVDGTTFEPFLVTEDYPLHATKIETQLTIGACWQENSGHDNETETAPEPTSGGNARMAQFFRGNLAGLIIRSGKLENKKVIDCLYTCKEGLDVQLPEEVASSVKVEFNPNQSSLTVEGEDIDAFDKVMQHISYLNSRQFPTPGIRHLRVATTVKC 624          
BLAST of GL18378 vs. Planmine SMEST
Match: SMESG000007793.1 (SMESG000007793.1)

HSP 1 Score: 1958.73 bits (5073), Expect = 0.000e+0
Identity = 1018/1024 (99.41%), Postives = 1021/1024 (99.71%), Query Frame = 3
Query:   24 MLKKLIVFLIISVTQFCLSLSLAWNTNRPFKYKGFIYTDSSVAVISPNLQVILKSGEEICNFQLTKSDYNRETLDYNPFRAVVKSAHLGLGEIELLANINLSNFTNADINLIITGQACHNPDSWTEPAEISIKVIDPPEPLWTKSSYVATITNDAIIGSPVIKVTAYLPPLADPDNKICQYHIENSSNSPFTIDGSGTISTRQNLLNSDVTLVILDVTAEDCSLPTHRQSTVKVFITITPICKIGWTGFYKIFQYLSGSGVIPIGKKLEFRFCSKNPKNNLNQIIENCKLKKKFRVTVSIEFKDLFQFSQESTTNDNDICYLDYKSLKLQRKICDINDNKAVDLLNALAKQKTGVIKFPLETNMFPGLSVVKQDKFSLLFWMLRKTPEENFDEFIVCHLHESGDILFSVSISFCNLRIFLNSSSNVQENSQLFFWEYNLSTICDNKWHHYLLHIQRSRDRNSHEVNILIDGESVEHKIQTSATEPRDFVKSPINEKYNFFIGQSTRTSKRYFKGYIAGLIYLPDIIVKSSSVRCLMKCMERLHFNGMNEMNPGMSVSLNSEMQTIIINGHNVEEVAKLVEDVGYANPKWNPIPGLRIIVIKTDMSCDKHXXXXXXXXXXXXXSRQNDVVTYGKLXXXXXXXXXXXXXXXDDVSQIRSTTGVGLSVFANATISIYAIPXXXXXXXXXXXXXXXRCIVSVHPELVKTKEYFDWPQQALDTLNSENHLIKVTNNSKKIIFFGDFNYQIYQFIIQHLSYFSSSIPNFNRRFQLQCSSDVGMAIIDSNILVVKIKASSLNKTKLKHSRNARKQNNLKTPLQVESKYLVNESQKSNNPFMHMGAHSNVAKLLEGNNEVKSEKFPKPTKVYSYFLVVGILILVCSFTFMIRKFQKAQAGHYYYLPFKVIDCICLPLQTIREKIRPSSLVRVELSRDYLNRASVKRQEISLELQWDDSELKSNRKYHIIENPIYEKSDLEFDDNYLNNDIPPICXXXXXXXXXXXXXXXXYNLNIKDSQHEKSIMKKRLIDL 3095
            MLKKLIVFLIISVTQFCLSLSLAWNTNRPFKYKGFIYTDSSVAVISPNLQVILKSGEEICNFQLTKSDYNRETLDYNPFRAVVKSAHLGLGEIELLANINLSNFTNADINLIITGQACHNPDSWTEPAEISIKVIDPPEPLWTKSSYVATITNDAIIGSPVIKVTAYLPPLADPDNKICQYHIENSSNSPFTIDGSGTISTRQNLLNSDVTLVILDVTAEDCSLPTHRQSTVKVFITITPICKIGWTGFYKIFQYLSGSGVIPIGKKLEFRFCSKNPKNNLNQIIENCKLKKKFRVTVSIEFKDLF FSQESTTNDNDICYLDYKSLKLQRKICDINDNKAVDLLNALAKQKTGVIKFPLETNMFPGLS+VKQDKFSLLFWMLRKTPEENFDEFIVCHLHESGDILFSVSISFCNLRIFLNSSSNVQENSQLFFWEYNLSTICDNKWHHYLLHIQRSRDRNSHEVNILIDGESVEHKIQT ATEPRDFVKSPINEKYNFFIGQSTRTSKRYFKGYIAGLIYLPDIIVKSSSVRCLMKCMERLHFNGMNEMNPGMSVSLNSEMQTIIINGHNVEEVAKLVEDVGYANPKWNPIPGLRIIVIKTDMSCDKHVINIPNVNITVNVSRQNDVVTYGKLINSIIISSKTTEIIIDDVSQIRSTTGVGLSVFANATISIYAIPLSTAETLSEETLTISRCIVSVHPELVKTKEYFDWPQQALDTLNSENHLIKVTNNSKKIIFFGDFNYQIYQFIIQHLSYFSSSIPNFNRRFQLQCSSDVGMAIIDSNILVVKIKASSLNKTKLKHSRNARKQNNLKTPLQVESKYLVNESQKSN+PFMHMGAHSNVAKLLEGNNEVKSEKFPKPTK YSYFLVVGILILVCSFTFMIRKFQKAQAGHYYYLPFKVIDCICLPLQTIREKIRPSSLVRVELSRDYLNRASVKR+EISLELQWDDSELKSNRKYHIIENPIYEKSDLEFDDNYLNNDIPPICEKEDLTTDDETDEEIDYNLNIKDSQHEKSIMKKRLIDL
Sbjct:    1 MLKKLIVFLIISVTQFCLSLSLAWNTNRPFKYKGFIYTDSSVAVISPNLQVILKSGEEICNFQLTKSDYNRETLDYNPFRAVVKSAHLGLGEIELLANINLSNFTNADINLIITGQACHNPDSWTEPAEISIKVIDPPEPLWTKSSYVATITNDAIIGSPVIKVTAYLPPLADPDNKICQYHIENSSNSPFTIDGSGTISTRQNLLNSDVTLVILDVTAEDCSLPTHRQSTVKVFITITPICKIGWTGFYKIFQYLSGSGVIPIGKKLEFRFCSKNPKNNLNQIIENCKLKKKFRVTVSIEFKDLFLFSQESTTNDNDICYLDYKSLKLQRKICDINDNKAVDLLNALAKQKTGVIKFPLETNMFPGLSMVKQDKFSLLFWMLRKTPEENFDEFIVCHLHESGDILFSVSISFCNLRIFLNSSSNVQENSQLFFWEYNLSTICDNKWHHYLLHIQRSRDRNSHEVNILIDGESVEHKIQTPATEPRDFVKSPINEKYNFFIGQSTRTSKRYFKGYIAGLIYLPDIIVKSSSVRCLMKCMERLHFNGMNEMNPGMSVSLNSEMQTIIINGHNVEEVAKLVEDVGYANPKWNPIPGLRIIVIKTDMSCDKHVINIPNVNITVNVSRQNDVVTYGKLINSIIISSKTTEIIIDDVSQIRSTTGVGLSVFANATISIYAIPLSTAETLSEETLTISRCIVSVHPELVKTKEYFDWPQQALDTLNSENHLIKVTNNSKKIIFFGDFNYQIYQFIIQHLSYFSSSIPNFNRRFQLQCSSDVGMAIIDSNILVVKIKASSLNKTKLKHSRNARKQNNLKTPLQVESKYLVNESQKSNHPFMHMGAHSNVAKLLEGNNEVKSEKFPKPTKAYSYFLVVGILILVCSFTFMIRKFQKAQAGHYYYLPFKVIDCICLPLQTIREKIRPSSLVRVELSRDYLNRASVKRREISLELQWDDSELKSNRKYHIIENPIYEKSDLEFDDNYLNNDIPPICEKEDLTTDDETDEEIDYNLNIKDSQHEKSIMKKRLIDL 1024          
BLAST of GL18378 vs. Planmine SMEST
Match: SMESG000057121.1 (SMESG000057121.1)

HSP 1 Score: 263.077 bits (671), Expect = 8.130e-73
Identity = 263/1032 (25.48%), Postives = 458/1032 (44.38%), Query Frame = 3
Query:   72 CLS--LSLAWNTNRPFKYKGFIYTDSSVAVISPNLQVILKSGEEICNFQLTKSDYNRETLDYNPFRAVVKSAHLGLGEIELLANINLSNFTNADINLIITGQACHNPDSWTEPAEISIKVIDPPEPLWTKSSYVATITNDAIIGSPVIKVTAYLPPLADPDNKICQYHIENSSNSPFTIDGSGTISTRQNLLNSDVTLVILDVTAEDCSLPTHRQSTVKVFITITPICKIGWTGFYKIFQYLSGSGVIPIGKKLEFRFCSKNPKNNLNQIIENCKLKKKFRVTVSIEFKDLFQFSQESTTNDNDICYLDYKSLKLQRKICDINDNKAVDLL----------NALAKQKTGVIKF-------PLETNMFPGLSVVKQDKFSLLFWMLRKTPEENFD-------EFIVCHLHESGDIL--FSVSISFCNLRIFLNSSSNVQENSQLFFWEYNLSTI--CDNKWHHYLLHIQR----------SRDRNSHEVNILIDGESVEHKIQTSATEPRDFVKSPINE--KYNF---FIGQ--STRTSK--RYFKGYIAGLIYLPDIIVKSSSVRCLMKCMERLHFNGMNEMNPGMSVSLNSEMQTIIINGHNVEEVAKLVEDVGYANPKWNPIPGLRIIVIKTDMSC---DKHXXXXXXXXXXXXXSRQNDVVTYGKLXXXXXXXXXXXXXXXDDVSQIRSTT------GVGLSVFANATIS-----------IYAIPXXXXXXXX---XXXXXXXRCIVSVHPELVKTKEYFDWPQQALDTLNSENHLIKVTNNSKKIIFFGDFNYQIYQFIIQHLSYFSSSIPNFNRR-FQLQCSSDVGMAIIDSNILVVKIKASSLNKTKLKHSRNARKQNNLKTPLQVESKYLVNESQKSNNPFMHMGAHSNVAKLLEGNNEVKSEKFPKPTKVYSYFLVVGILILVCSFTFMIRKFQKAQAGHYYYLPFKVIDCICLPLQTIREKIRPSSLVRVELSRDYLNRASVKR-QEISL---ELQWDDSELKS----NRKYHIIENPIYE 2924
            CLS   S  W+  +   + GFI   S    ++P +++  K   ++CNF LT    N + L   PF   ++S+  G+G I +   +++ N+        I  + C + D +++  ++ +K I    P+W +  Y A + +D   GS VI++ AY P      N IC Y I    ++PF IDG+G + +   L        +L V A DC +P  R S+V V I +  +C+ GW G ++   Y+ GSG+  +GK ++F  C K          + C+ K+    +V +  K+          +D  +C  D +SL+ Q   C +N N+  +LL          +  A   TGV  F        + TN+ P    + ++ F++ FWM      + FD       E I+C+    G     +S+ +  C L     +    ++ S L   E+   +I  CD  WHHY L ++           ++    H   + IDG S     Q     P     SP++E  + +F    IG    ++TS   ++F+G ++G+  L   +  +S ++C+ KC E L F G+++M PG S+S+NS M ++II    ++++ +++E +G+ N +  P PG R+I + T + C    K       +   V + R+        +           ++  D V +I ST       G GL +  N  I+           ++  P S         +E  TI  C++S HP L    EY  +    +  L+ + + + VTN+S  +I  G  N  IY+F+++ + YF+S +  F  + F+L CS D   +I  SN LVVK++ S    TK+KH+          T +     ++  ++Q  N+   H  + S  AKL   +   K EK    + V   F V  I++       ++R  +  Q      +PF       +       +++P SL  +    + +  +++++   ISL   E++WD SE+ S    +    I  NP+ +
Sbjct:   18 CLSEIRSFEWDIGKADHFTGFIDEHSDFVKVTPGIKLKTKPDLKLCNFILTSE--NGQEL---PFLVNLESSTKGIGFIHITGPVHMDNY-----EFYIKAKTC-DQDIYSKELKVILKKIKGEVPIWERLVYNAVVNDDIHPGSEVIRLKAYEPGRT-TGNSICDYKIVVPIDAPFDIDGNGVVRSTNYLDARKHRNYVLRVMAIDCWIPKPRNSSVSVNIEVKRVCRFGWNGIFQQINYVPGSGIRLLGKDIKFDACDKT--------TDECETKES---SVQLTLKN----------SDTKMCDKDIESLRSQWDTCGVN-NQTTELLPSAEQFTREAHGSADSLTGVYSFDGKNTHWEIPTNVIPQNHFLGEN-FTISFWM----KHDKFDGDTKHKKEQILCNSDGDGKNRHHYSLFLHNCKLIFLYRTEPLTKQTSTLTPAEWRFKSIEFCDGGWHHYSLVVKMKYIDNLAEVDAQQNQIHRTQLFIDGIS----FQNDVDNPDIIDDSPMHEIPQVHFTKLVIGACWKSKTSNYIQHFRGQLSGMTVLRGQLESTSVIQCINKCHEHLTFTGVDKMAPGTSLSINSVMSSMIITASRIKDIERIIEQIGFTNSRLRPFPGKRVIQVDTTIKCLISQKVYNVPQKMINIVVLMREPSKEDKKYVNEETQNKDYVMKLTGDPVIEIESTQDVTPGIGQGLPILNNVIITDLSTEGLSSLLLWGKPTSEGNRRRYQIKEVNTIESCLLSAHPILNFPYEYLAFSNNVIKDLSEQGNYLNVTNSSIGLIIEGSQNIAIYKFVLERILYFNSKLDEFKGKIFKLVCSKDSRNSI--SNELVVKLQISKHLNTKVKHT---------ITKIFNAEIHIHEDTQYPNDGVEHQQSLSETAKLKLPSPNSKPEK-SSVSNVMVVFTVCSIIVAALIVLGLLRVIR--QKNQRLGIPFSRNLGPWV-------RLKPDSLKFLGQKENSMRNSNIRKVLPISLNSGEMEWDSSEMYSSSLMDESLQITVNPLLD 985          
BLAST of GL18378 vs. Planmine SMEST
Match: SMESG000002834.1 (SMESG000002834.1)

HSP 1 Score: 108.997 bits (271), Expect = 3.855e-24
Identity = 141/597 (23.62%), Postives = 252/597 (42.21%), Query Frame = 3
Query:  111 FKYKGFIYTDSSVAVISPNLQVILKS----GEEICNFQLTKSDYNRETLDYNPFRAVVKSAHLGLGEIELLANINLSNFTNADINLIITGQACHNPDSWTEPAEISIKVIDPPEPLWTKSSYVATITNDAIIGSPVIKVTAYLPP----LADPDNKICQYHIENSSNSPFTIDGSGTISTRQ-NLLNSDVTLVILDVTAEDCSLPTHRQSTVKVFITITPICKIGWTGFYKIFQYLSGSGVIPIGKKLEFRFCSKNPKNNLNQIIENCKLKKKFRVTVSIEFKDLFQFSQESTTNDNDICYLDYKSLKLQRKICDINDNKAVDLL----NALAKQKTGVIKFPLE----TNMFPGLSVVKQDKFSLLFW-----MLRKTPEENF---DEFIVCHLHESGDILFSVSISFCNLRIFLNSSSNVQENSQLFFWEYN---LSTICDNKWHHYLLHIQRSRDRNSHEVNILIDGESVEHKIQTSATEPRDFVKSPINEKYNFFIGQSTRTSK-----RYFKGYIAGLIYLPDIIVKSSSVRCLMKCMERLHFNGMNE-MNPGMSVSLNSEMQTIIINGHNVEEVAKLVEDVGYANPKWNPI 1799
            + + G +  +  +  ++P L++IL        EIC   +     + E     PF   +     G  +I+L  N+N ++  +      I    C  P  ++E   + +++     P + +SSY  T+      G+ + +++AY  P     + P+  IC+Y I   ++ PF ID  G++ T++   L + +      V A DC     R ++V V + +   C + W G  K  +Y+  SGV+P+     F   S +P  +L+    NC L      T  I  K++ +F+        ++C  D  S+  +  +CD     AV+LL    +++   + G  +F        N F   + +   +FSL FW     ML   P++      +  V + H +     SV +  C L + +   +   E  +    E+    L  +CDN+WHHY + +      N     + IDGE +  K      E R   K P N         S   SK     + F G++AG+  + D +   ++VRCL  C E L    + E +    SV++ S+   +I+   N+ ++  +   + Y N   NP+
Sbjct:   35 WAFLGHLNENERIVKLTPELRIILAENISHSMEICGVYI-----HHEIYSLFPFVHEITDKKRGSIQIKLKDNVNYADLMDR-YTFQIEVYDCDQPPHFSEKKYVLVEIGSVNGPRFLESSYHFTVNYSVPEGTKIGEISAYERPGISQSSQPNQGICKYDILPVNSVPFFIDKYGSLHTQKVEYLPNVMRTYKFYVRATDCDKYQPRIASVLVIVDVRDSCTVHWEGLPKSIKYIRNSGVMPL-----FSMQSTSP--SLHVCSSNC-LSFNIFFTARIVGKNI-KFAAP------ELCKHDLNSIHRREVLCDAYPG-AVNLLKGAPDSMKDHQIGGHRFSFSYVSVENTFDNTNYLFGKRFSLTFWMKHGNMLLNDPKQQILCNSDLKVMNRHHT-----SVFLHNCKLILLIRVENGGSEQDKFMPSEWRFGPLRQVCDNEWHHYGITM------NDGNPILQIDGE-IWSKPPEVLVE-RQLKKLPENITGTRLTVGSCYHSKSNEYTQNFFGHLAGMRLIRDFVEAVNTVRCLATCGESLLLPHIVEALAKDSSVTMFSDY--VIVRSININDLKLMFSKLSYINT--NPL 592          
BLAST of GL18378 vs. Planmine SMEST
Match: SMESG000068054.1 (SMESG000068054.1)

HSP 1 Score: 86.2705 bits (212), Expect = 8.502e-17
Identity = 97/420 (23.10%), Postives = 180/420 (42.86%), Query Frame = 3
Query:  117 YKGFIYTDSSVAVISPNLQVILKSG----EEICNFQLTKSDYNRETLDYNPFRAVVKSAHLGLGEIELLANINLSNFTNADINLIITGQACHNPDSWTEPAEISIKVIDPPEPLWTKSSYVATITNDA----IIGSPVIKVTAYLPPLADPDNKICQYHIENSSNSPFTIDGSGTISTRQNLLNSDVTLVILDVTAEDCSLPTHRQSTVKVFITITPICKIGWTGFYKIFQYLSGSGVIPIGKKLEFRFCSKNPKNNLNQIIENCKLKKKFR-VTVSIEFKDLFQFSQESTTNDNDICYLDYKSLKLQRKICDINDNKAVDLLNALAKQKTGVIKFPLETNMFPGLSVVKQDKFSLLFWMLRKTPEENFDEFIVCHLHESGDILFSVSISFCNLRIFLNSSSNVQ-----ENSQLFFWEY 1334
            Y+G++ ++S    ++P L+  +  G    E+IC F+L        T++  PF   +     G+GE+++  +    N         +    C +   ++  A + I V++   P++   SY  ++  DA    +IG+ + K  A        DN + +Y +++    PF I   G IS R +L+N+  +  ++ V A++ S    +QS V V I I P+C+   T F     Y   +G+  + +  +       P      ++  C L    + VT+ I  K     S++  +   + C  D  + ++QR IC  N +  +DLL      + G+I      ++ P         F+L +WM R++        I C   +   I  S+ +  C L I +N+  NV      E  Q+  W++
Sbjct:   33 YEGYLLSNSKTVFMTPELKASVVKGVSKSEKICGFEL-----RGRTIESVPFAVYLLDELSGVGEMQVKYSNEFDNQLKPLYEFNVEAFDCDSLPHYSHGAPVRIHVVNEFGPIFYNKSYTFSVKKDAKRNSVIGTVIAKSLA--------DNPV-EYSLQHDEKLPFQISQLGVISIRDSLINTKQSDFLIRVVAKERSKGIPKQSLVLVNIEIEPVCQNKLTDFPDQLDYYIKNGIANMMESGQLIQQGHRP------VLTVCSLPSPLKEVTLRISLKS-HSLSEKDHSFKEEFCPTDIPANRIQRAICGANPD-TIDLL----LTEGGIIHINEGDSIGPHNIKALGTDFTLSWWMKRQS---KLKTEIFCLKDDHNSI--SILLENCQLSI-MNNLQNVHIEIPTEKCQINKWQF 420          
The following BLAST results are available for this feature:
BLAST of GL18378 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CLSTN33.446e-2723.47calsyntenin 3 [Source:HGNC Symbol;Acc:HGNC:18371][more]
CLSTN33.446e-2723.47calsyntenin 3 [Source:HGNC Symbol;Acc:HGNC:18371][more]
CLSTN26.613e-2521.30calsyntenin 2 [Source:HGNC Symbol;Acc:HGNC:17448][more]
CLSTN13.667e-2421.41calsyntenin 1 [Source:HGNC Symbol;Acc:HGNC:17447][more]
CLSTN18.933e-2321.08calsyntenin 1 [Source:HGNC Symbol;Acc:HGNC:17447][more]
back to top
BLAST of GL18378 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
casy-12.442e-3020.68CAlSYntenin/Alcadein homolog; Calsyntenin [Source... [more]
back to top
BLAST of GL18378 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Cals2.261e-2222.48gene:FBgn0039928 transcript:FBtr0089207[more]
Cals2.261e-2222.48gene:FBgn0039928 transcript:FBtr0089208[more]
Cals2.261e-2222.48gene:FBgn0039928 transcript:FBtr0345193[more]
Cals2.322e-2222.48gene:FBgn0039928 transcript:FBtr0333700[more]
back to top
BLAST of GL18378 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
clstn14.312e-3123.75calsyntenin 1 [Source:ZFIN;Acc:ZDB-GENE-040426-106... [more]
BX001019.11.208e-3022.38calsyntenin 3 [Source:NCBI gene;Acc:555627][more]
BX001019.12.023e-3022.29calsyntenin 3 [Source:NCBI gene;Acc:555627][more]
CT027619.14.123e-3022.07calsyntenin 3 [Source:NCBI gene;Acc:555627][more]
clstn14.919e-3023.45calsyntenin 1 [Source:ZFIN;Acc:ZDB-GENE-040426-106... [more]
back to top
BLAST of GL18378 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gsk3a8.845e-3222.53glycogen synthase kinase 3 alpha [Source:Xenbase;A... [more]
gsk3a6.922e-3122.52glycogen synthase kinase 3 alpha [Source:Xenbase;A... [more]
gsk3a3.010e-3022.31glycogen synthase kinase 3 alpha [Source:Xenbase;A... [more]
gsk3a4.315e-3022.80glycogen synthase kinase 3 alpha [Source:Xenbase;A... [more]
gsk3a5.209e-3023.12glycogen synthase kinase 3 alpha [Source:Xenbase;A... [more]
back to top
BLAST of GL18378 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Clstn31.201e-2824.19calsyntenin 3 [Source:MGI Symbol;Acc:MGI:2178323][more]
Clstn37.430e-2724.47calsyntenin 3 [Source:MGI Symbol;Acc:MGI:2178323][more]
Clstn26.829e-2521.31calsyntenin 2 [Source:MGI Symbol;Acc:MGI:1929897][more]
Clstn29.934e-2521.31calsyntenin 2 [Source:MGI Symbol;Acc:MGI:1929897][more]
Clstn11.911e-2321.29calsyntenin 1 [Source:MGI Symbol;Acc:MGI:1929895][more]
back to top
BLAST of GL18378 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5R9Q9|CSTN3_PONAB3.319e-2823.96Calsyntenin-3 OS=Pongo abelii OX=9601 GN=CLSTN3 PE... [more]
sp|Q99JH7|CSTN3_MOUSE8.398e-2824.19Calsyntenin-3 OS=Mus musculus OX=10090 GN=Clstn3 P... [more]
sp|Q8R553|CSTN3_RAT8.408e-2722.76Calsyntenin-3 OS=Rattus norvegicus OX=10116 GN=Cls... [more]
sp|Q9BQT9|CSTN3_HUMAN1.655e-2623.47Calsyntenin-3 OS=Homo sapiens OX=9606 GN=CLSTN3 PE... [more]
sp|Q0VCN6|CSTN3_BOVIN7.377e-2623.30Calsyntenin-3 OS=Bos taurus OX=9913 GN=CLSTN3 PE=2... [more]
back to top
BLAST of GL18378 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
R7UQC15.526e-3925.35Uncharacterized protein OS=Capitella teleta OX=283... [more]
V4ALU34.509e-3627.04Uncharacterized protein OS=Lottia gigantea OX=2251... [more]
A0A1S3HFF37.651e-3627.16calsyntenin-1 isoform X2 OS=Lingula unguis OX=7574... [more]
A0A087TLN21.074e-3522.79Calsyntenin-1 (Fragment) OS=Stegodyphus mimosarum ... [more]
T1J4B12.120e-3524.06Uncharacterized protein OS=Strigamia maritima OX=1... [more]
back to top
BLAST of GL18378 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
clstn11.223e-3224.23calsyntenin 1 [Source:NCBI gene;Acc:103033297][more]
clstn12.162e-3123.90calsyntenin 1 [Source:NCBI gene;Acc:103033297][more]
clstn31.396e-2922.52calsyntenin 3 [Source:NCBI gene;Acc:103027307][more]
clstn31.396e-2922.52calsyntenin 3 [Source:NCBI gene;Acc:103027307][more]
clstn21.542e-2822.58calsyntenin 2 [Source:NCBI gene;Acc:103023918][more]
back to top
BLAST of GL18378 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSPMAT00000009762.17.545e-1425.86pep scaffold:Pmarinus_7.0:GL478664:4830:30598:1 ge... [more]
ENSPMAT00000004811.11.035e-923.77pep scaffold:Pmarinus_7.0:GL480969:15004:24793:1 g... [more]
back to top
BLAST of GL18378 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of GL18378 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO403791.612e-1121.23Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of GL18378 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
clstn32.718e-3123.02calsyntenin 3 [Source:NCBI gene;Acc:101171608][more]
clstn17.617e-3122.90calsyntenin 1 [Source:NCBI gene;Acc:101174913][more]
clstn33.679e-3022.52calsyntenin 3 [Source:NCBI gene;Acc:101171608][more]
ENSORLT00000043712.11.927e-2823.20calsyntenin 2 [Source:NCBI gene;Acc:101159373][more]
clstn12.061e-2822.26calsyntenin 1 [Source:NCBI gene;Acc:101174913][more]
back to top
BLAST of GL18378 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000007793.10.000e+099.41SMESG000007793.1[more]
SMESG000057121.18.130e-7325.48SMESG000057121.1[more]
SMESG000002834.13.855e-2423.62SMESG000002834.1[more]
SMESG000068054.18.502e-1723.10SMESG000068054.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30009747 ID=SMED30009747|Name=GL18378|organism=Schmidtea mediterranea sexual|type=transcript|length=3171bp
TTTAAATACTATTTCAAATAATAATGTTAAAAAAATTAATTGTTTTTCTT
ATAATTTCAGTTACTCAATTTTGTTTATCACTGAGTCTTGCTTGGAACAC
AAATAGGCCATTTAAGTACAAGGGTTTTATTTATACAGACTCCTCAGTAG
CAGTTATCAGTCCAAATTTGCAAGTCATACTGAAAAGCGGAGAGGAAATC
TGCAATTTCCAACTAACCAAGTCAGATTACAACAGAGAAACCTTGGATTA
CAATCCGTTCCGAGCTGTAGTAAAATCAGCTCATTTAGGCCTAGGAGAAA
TTGAGCTTCTAGCAAACATTAATTTGAGCAATTTTACCAATGCCGATATT
AACCTCATCATTACAGGCCAAGCGTGCCACAATCCTGACTCTTGGACGGA
ACCAGCTGAAATATCAATCAAGGTTATAGATCCTCCGGAACCGCTGTGGA
CAAAATCATCATACGTGGCGACCATTACCAATGATGCAATCATCGGATCT
CCTGTTATCAAAGTTACTGCTTATTTACCTCCATTGGCAGATCCGGATAA
CAAGATATGCCAATATCATATTGAAAATTCCTCAAATAGTCCATTTACCA
TTGATGGTTCCGGAACTATTTCTACCCGGCAAAATCTCCTGAATTCGGAT
GTCACATTGGTCATTCTTGATGTGACCGCCGAAGACTGCTCCCTACCAAC
TCATAGACAATCGACAGTAAAAGTTTTCATAACGATCACTCCCATTTGCA
AAATAGGGTGGACTGGATTTTACAAGATATTTCAGTATTTATCCGGGTCT
GGCGTCATTCCGATTGGAAAGAAACTTGAATTTCGATTTTGCAGTAAAAA
TCCTAAAAACAATTTAAATCAAATAATAGAAAATTGTAAGCTTAAAAAGA
AATTCAGAGTCACGGTGTCAATTGAGTTTAAAGATCTTTTTCAATTCTCA
CAGGAATCAACGACGAATGATAATGATATATGTTACCTAGACTACAAATC
TCTAAAACTACAGAGAAAAATATGTGATATCAATGATAATAAAGCAGTGG
ATCTCTTAAATGCGTTGGCCAAACAAAAGACGGGAGTCATTAAATTTCCG
TTAGAGACAAATATGTTTCCTGGGTTGTCTGTGGTAAAACAAGACAAATT
CTCATTATTATTCTGGATGCTTAGAAAAACGCCTGAAGAGAATTTTGACG
AGTTTATTGTTTGTCATTTGCATGAATCTGGCGACATATTATTTTCAGTT
TCGATTTCCTTCTGTAATCTCAGAATCTTTTTGAACTCCAGTTCAAATGT
GCAAGAGAATTCACAGTTGTTTTTTTGGGAATATAATTTGTCAACTATTT
GTGACAATAAATGGCATCATTATCTCTTGCACATTCAGAGATCCAGAGAC
AGAAATTCACACGAGGTAAATATATTAATTGACGGAGAATCTGTAGAACA
TAAAATACAGACTTCAGCTACGGAACCTCGCGACTTTGTTAAATCTCCAA
TTAATGAAAAGTATAACTTTTTTATAGGTCAATCAACTAGAACCTCAAAA
AGATATTTCAAAGGTTATATTGCCGGATTAATTTATTTGCCTGACATTAT
CGTGAAAAGCTCCAGCGTACGATGCCTCATGAAATGCATGGAACGACTTC
ATTTTAATGGTATGAATGAAATGAATCCAGGAATGTCTGTGTCATTGAAT
TCGGAAATGCAAACAATTATCATTAATGGACACAATGTAGAAGAAGTAGC
AAAACTGGTTGAGGATGTGGGTTACGCAAATCCTAAATGGAATCCAATTC
CTGGATTGAGAATAATTGTCATTAAAACTGATATGTCATGTGATAAACAT
GTGATAAATATACCAAATGTGAATATAACTGTCAATGTATCCAGGCAAAA
CGATGTGGTCACCTATGGGAAGTTGATCAACTCCATTATAATTTCGTCAA
AAACGACAGAAATTATAATTGATGATGTTTCCCAGATCCGATCGACTACT
GGAGTTGGATTGAGTGTTTTTGCAAATGCTACAATAAGTATTTACGCTAT
CCCACTATCAACGGCAGAAACCTTATCTGAAGAAACCTTAACCATATCTC
GATGCATTGTGTCGGTCCATCCGGAGCTGGTTAAAACCAAGGAATATTTT
GATTGGCCACAGCAAGCTCTGGACACCCTGAACTCTGAAAATCACTTGAT
TAAAGTGACTAATAATTCTAAGAAAATAATTTTCTTTGGGGATTTTAACT
ACCAAATATATCAATTTATTATTCAACATCTTAGTTATTTCAGTTCATCG
ATTCCAAATTTTAATCGCCGATTTCAACTGCAGTGCTCATCTGACGTTGG
AATGGCAATAATCGATTCGAATATTCTTGTTGTCAAGATTAAAGCTTCTT
CCTTAAATAAAACAAAGCTCAAACATTCGCGTAATGCTAGAAAGCAGAAT
AACTTAAAAACCCCTTTGCAAGTAGAATCAAAATACCTAGTAAATGAATC
TCAAAAGTCTAACAACCCCTTCATGCACATGGGAGCTCATTCTAACGTGG
CCAAATTATTAGAAGGAAACAATGAAGTAAAATCAGAAAAATTTCCAAAA
CCAACAAAAGTTTACAGTTATTTTCTTGTTGTGGGCATTCTAATTTTAGT
CTGTTCTTTTACCTTTATGATCAGAAAGTTTCAAAAGGCGCAAGCAGGGC
ACTATTATTATTTACCCTTCAAAGTAATCGACTGCATTTGTTTGCCTTTA
CAAACTATCAGAGAAAAGATAAGACCAAGTTCTTTGGTTCGTGTCGAGTT
ATCTAGAGATTATCTCAATCGGGCATCTGTAAAAAGGCAAGAAATCAGTC
TTGAATTACAGTGGGATGACTCCGAATTGAAATCAAACCGCAAATACCAC
ATAATAGAAAATCCTATTTATGAGAAATCTGATCTAGAATTCGATGACAA
TTATTTGAACAATGATATCCCCCCTATATGCGAAAAGGAAGATTTGACAA
CCGATGACGAAACAGACGAGGAAATAGATTACAATTTAAATATAAAAGAT
TCACAACACGAAAAAAGTATTATGAAGAAGAGATTAATTGACTTATGAAG
ACTATCTTTTTGATAAAATGCATACCGACAGCAATTCTTATTTTATTTCA
TTCGGCTTTGTAGATTTAGAG
back to top

protein sequence of SMED30009747-orf-1

>SMED30009747-orf-1 ID=SMED30009747-orf-1|Name=SMED30009747-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1025bp
MLKKLIVFLIISVTQFCLSLSLAWNTNRPFKYKGFIYTDSSVAVISPNLQ
VILKSGEEICNFQLTKSDYNRETLDYNPFRAVVKSAHLGLGEIELLANIN
LSNFTNADINLIITGQACHNPDSWTEPAEISIKVIDPPEPLWTKSSYVAT
ITNDAIIGSPVIKVTAYLPPLADPDNKICQYHIENSSNSPFTIDGSGTIS
TRQNLLNSDVTLVILDVTAEDCSLPTHRQSTVKVFITITPICKIGWTGFY
KIFQYLSGSGVIPIGKKLEFRFCSKNPKNNLNQIIENCKLKKKFRVTVSI
EFKDLFQFSQESTTNDNDICYLDYKSLKLQRKICDINDNKAVDLLNALAK
QKTGVIKFPLETNMFPGLSVVKQDKFSLLFWMLRKTPEENFDEFIVCHLH
ESGDILFSVSISFCNLRIFLNSSSNVQENSQLFFWEYNLSTICDNKWHHY
LLHIQRSRDRNSHEVNILIDGESVEHKIQTSATEPRDFVKSPINEKYNFF
IGQSTRTSKRYFKGYIAGLIYLPDIIVKSSSVRCLMKCMERLHFNGMNEM
NPGMSVSLNSEMQTIIINGHNVEEVAKLVEDVGYANPKWNPIPGLRIIVI
KTDMSCDKHVINIPNVNITVNVSRQNDVVTYGKLINSIIISSKTTEIIID
DVSQIRSTTGVGLSVFANATISIYAIPLSTAETLSEETLTISRCIVSVHP
ELVKTKEYFDWPQQALDTLNSENHLIKVTNNSKKIIFFGDFNYQIYQFII
QHLSYFSSSIPNFNRRFQLQCSSDVGMAIIDSNILVVKIKASSLNKTKLK
HSRNARKQNNLKTPLQVESKYLVNESQKSNNPFMHMGAHSNVAKLLEGNN
EVKSEKFPKPTKVYSYFLVVGILILVCSFTFMIRKFQKAQAGHYYYLPFK
VIDCICLPLQTIREKIRPSSLVRVELSRDYLNRASVKRQEISLELQWDDS
ELKSNRKYHIIENPIYEKSDLEFDDNYLNNDIPPICEKEDLTTDDETDEE
IDYNLNIKDSQHEKSIMKKRLIDL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR026914Calsyntenin
IPR002126Cadherin-like_dom
IPR013320ConA-like_dom_sf
IPR015919Cadherin-like_sf
Vocabulary: biological process
TermDefinition
GO:0007156homophilic cell adhesion via plasma membrane adhesion molecules
Vocabulary: molecular function
TermDefinition
GO:0005509calcium ion binding
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:2.60.120.200coord: 337..525
e-value: 1.7E-8
score: 36.3
NoneNo IPR availableGENE3DG3DSA:2.60.40.60coord: 138..243
e-value: 4.1E-11
score: 45.2
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 146..241
e-value: 1.13304E-10
score: 57.3234
NoneNo IPR availableSIGNALP_EUKSignalP-TMSignalP-TMcoord: 1..19
score: 0.577
NoneNo IPR availableTMHMMTMhelixcoord: 5..27
NoneNo IPR availableTMHMMTMhelixcoord: 864..883
IPR026914CalsynteninPANTHERPTHR14139CALSYNTENINcoord: 51..1010
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 135..240
IPR013320Concanavalin A-like lectin/glucanase domain superfamilySUPERFAMILYSSF49899Concanavalin A-like lectins/glucanasescoord: 370..538