Flotillin-2

Overview
NameFlotillin-2
Smed IDSMED30009745
Length (bp)1533
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Flotillin-2 (SMED30009745) t-SNE clustered cells

Violin plots show distribution of expression levels for Flotillin-2 (SMED30009745) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Flotillin-2 (SMED30009745) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Flotillin-2 (SMED30009745) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30009745

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 11

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30009745h1SMcG0005444 SmedASXL_007697SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pigment cellSMED30009745h1SMcG0005444 SmedASXL_011175SmedAsxl_ww_GCZZ01PMID:29158443
He et al., 2017
whole organism asexual adult RNA-sequencing evidence
Smed sexual biotypeSMED30009745h1SMcG0005444 Contig21211newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009745h1SMcG0005444 Contig21211uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009745h1SMcG0005444 Contig39768newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009745h1SMcG0005444 Contig39768uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009745h1SMcG0005444 Contig21671uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009745h1SMcG0005444 Contig21671newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
cephalic gangliaSMED30009745h1SMcG0005444 dd_Smed_v4_6436_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30009745h1SMcG0005444 dd_Smed_v4_6436_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 2 cellSMED30009745h1SMcG0005444 dd_Smed_v4_6436_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Flotillin-2 vs. Ensembl Human
Match: FLOT2 (flotillin 2 [Source:HGNC Symbol;Acc:HGNC:3758])

HSP 1 Score: 389.037 bits (998), Expect = 3.773e-131
Identity = 213/357 (59.66%), Postives = 289/357 (80.95%), Query Frame = 3
Query:  153 LKYKGVAQVKVMNEENLLRVACEQFLGKKREDIANTILQTLEGHLRAILGTLTVEAVYQDRDQFAQLVREVASPDVSKMGIEILSFTIKDVYDKVEYLNSLGRAQTANVKKDADIGVAEAERDAGIREAECEKLRMNIRYQANTEIADAERNFNMQKAIFETQVNQQKAESELAYELQAAKEKQRIRTEEIQXXXXXXXXXXXXXXXXXLRRENDLIASVKKPAESEAYKIERTAEGYKVQQIFXXXXXXXXXXXXXXXXXXVIGEIGKAEASRMKLRAEAFKKYGKTAILNQIIDSMPRIAAEVTSPLQRTKNITIMDSGTGGSLATEVAKLLGSLPPTIQAITGIDITNALSKIP 1223
            L   GVAQVK+M E+ LL VACEQFLGK  +DI N +LQTLEGHLR+ILGTLTVE +YQDRDQFA+LVREVA+PDV +MGIEILSFTIKDVYDKV+YL+SLG+ QTA V++DADIGVAEAERDAGIREAEC+K  +++++ A+T+IAD++R F +QK+ F  +VN + AE++LAYELQ A+E+Q+IR EEI+IEVV++ KQI +E  E+LR + +LIA+V++PAE+EA++I++ AEG KV+Q+ LA+AEA+KI   GEAEA VI  +GKAEA RMKL+AEA++KYG  A +  +++++P+IAA++ +PL +   I ++ SG    + +EV +LL  LP ++ A+TG+D    LSKIP
Sbjct:   67 LTVTGVAQVKIMTEKELLAVACEQFLGKNVQDIKNVVLQTLEGHLRSILGTLTVEQIYQDRDQFAKLVREVAAPDVGRMGIEILSFTIKDVYDKVDYLSSLGKTQTAVVQRDADIGVAEAERDAGIREAECKKEMLDVKFMADTKIADSKRAFELQKSAFSEEVNIKTAEAQLAYELQGAREQQKIRQEEIEIEVVQRKKQIAVEAQEILRTDKELIATVRRPAEAEAHRIQQIAEGEKVKQVLLAQAEAEKIRKIGEAEAAVIEAMGKAEAERMKLKAEAYQKYGDAAKMALVLEALPQIAAKIAAPLTKVDEIVVL-SGDNSKVTSEVNRLLAELPASVHALTGVD----LSKIP 418          

HSP 2 Score: 65.4698 bits (158), Expect = 1.042e-10
Identity = 25/43 (58.14%), Postives = 34/43 (79.07%), Query Frame = 1
Query:   16 IVGGWGWSWWLVCEVQMLSLEVMTLTPKCEQVETSEGVPITVT 144
            + GGW W+WW + + Q +SLE+MTL P+CE VET+EGV +TVT
Sbjct:   28 VFGGWAWAWWCISDTQRISLEIMTLQPRCEDVETAEGVALTVT 70          
BLAST of Flotillin-2 vs. Ensembl Human
Match: FLOT2 (flotillin 2 [Source:HGNC Symbol;Acc:HGNC:3758])

HSP 1 Score: 387.882 bits (995), Expect = 1.081e-130
Identity = 212/353 (60.06%), Postives = 288/353 (81.59%), Query Frame = 3
Query:  165 GVAQVKVMNEENLLRVACEQFLGKKREDIANTILQTLEGHLRAILGTLTVEAVYQDRDQFAQLVREVASPDVSKMGIEILSFTIKDVYDKVEYLNSLGRAQTANVKKDADIGVAEAERDAGIREAECEKLRMNIRYQANTEIADAERNFNMQKAIFETQVNQQKAESELAYELQAAKEKQRIRTEEIQXXXXXXXXXXXXXXXXXLRRENDLIASVKKPAESEAYKIERTAEGYKVQQIFXXXXXXXXXXXXXXXXXXVIGEIGKAEASRMKLRAEAFKKYGKTAILNQIIDSMPRIAAEVTSPLQRTKNITIMDSGTGGSLATEVAKLLGSLPPTIQAITGIDITNALSKIP 1223
            GVAQVK+M E+ LL VACEQFLGK  +DI N +LQTLEGHLR+ILGTLTVE +YQDRDQFA+LVREVA+PDV +MGIEILSFTIKDVYDKV+YL+SLG+ QTA V++DADIGVAEAERDAGIREAEC+K  +++++ A+T+IAD++R F +QK+ F  +VN + AE++LAYELQ A+E+Q+IR EEI+IEVV++ KQI +E  E+LR + +LIA+V++PAE+EA++I++ AEG KV+Q+ LA+AEA+KI   GEAEA VI  +GKAEA RMKL+AEA++KYG  A +  +++++P+IAA++ +PL +   I ++ SG    + +EV +LL  LP ++ A+TG+D    LSKIP
Sbjct:   71 GVAQVKIMTEKELLAVACEQFLGKNVQDIKNVVLQTLEGHLRSILGTLTVEQIYQDRDQFAKLVREVAAPDVGRMGIEILSFTIKDVYDKVDYLSSLGKTQTAVVQRDADIGVAEAERDAGIREAECKKEMLDVKFMADTKIADSKRAFELQKSAFSEEVNIKTAEAQLAYELQGAREQQKIRQEEIEIEVVQRKKQIAVEAQEILRTDKELIATVRRPAEAEAHRIQQIAEGEKVKQVLLAQAEAEKIRKIGEAEAAVIEAMGKAEAERMKLKAEAYQKYGDAAKMALVLEALPQIAAKIAAPLTKVDEIVVL-SGDNSKVTSEVNRLLAELPASVHALTGVD----LSKIP 418          

HSP 2 Score: 61.6178 bits (148), Expect = 1.532e-9
Identity = 25/43 (58.14%), Postives = 33/43 (76.74%), Query Frame = 1
Query:   16 IVGGWGWSWWLVCEVQMLSLEVMTLTPKCEQVETSEGVPITVT 144
            + GGW W+WW + + Q LSLEVMT+  +CE +ETSEGVP+ VT
Sbjct:   28 VFGGWAWAWWCISDTQRLSLEVMTILCRCENIETSEGVPLFVT 70          
BLAST of Flotillin-2 vs. Ensembl Human
Match: FLOT2 (flotillin 2 [Source:HGNC Symbol;Acc:HGNC:3758])

HSP 1 Score: 388.652 bits (997), Expect = 3.326e-130
Identity = 213/357 (59.66%), Postives = 289/357 (80.95%), Query Frame = 3
Query:  153 LKYKGVAQVKVMNEENLLRVACEQFLGKKREDIANTILQTLEGHLRAILGTLTVEAVYQDRDQFAQLVREVASPDVSKMGIEILSFTIKDVYDKVEYLNSLGRAQTANVKKDADIGVAEAERDAGIREAECEKLRMNIRYQANTEIADAERNFNMQKAIFETQVNQQKAESELAYELQAAKEKQRIRTEEIQXXXXXXXXXXXXXXXXXLRRENDLIASVKKPAESEAYKIERTAEGYKVQQIFXXXXXXXXXXXXXXXXXXVIGEIGKAEASRMKLRAEAFKKYGKTAILNQIIDSMPRIAAEVTSPLQRTKNITIMDSGTGGSLATEVAKLLGSLPPTIQAITGIDITNALSKIP 1223
            L   GVAQVK+M E+ LL VACEQFLGK  +DI N +LQTLEGHLR+ILGTLTVE +YQDRDQFA+LVREVA+PDV +MGIEILSFTIKDVYDKV+YL+SLG+ QTA V++DADIGVAEAERDAGIREAEC+K  +++++ A+T+IAD++R F +QK+ F  +VN + AE++LAYELQ A+E+Q+IR EEI+IEVV++ KQI +E  E+LR + +LIA+V++PAE+EA++I++ AEG KV+Q+ LA+AEA+KI   GEAEA VI  +GKAEA RMKL+AEA++KYG  A +  +++++P+IAA++ +PL +   I ++ SG    + +EV +LL  LP ++ A+TG+D    LSKIP
Sbjct:  122 LTVTGVAQVKIMTEKELLAVACEQFLGKNVQDIKNVVLQTLEGHLRSILGTLTVEQIYQDRDQFAKLVREVAAPDVGRMGIEILSFTIKDVYDKVDYLSSLGKTQTAVVQRDADIGVAEAERDAGIREAECKKEMLDVKFMADTKIADSKRAFELQKSAFSEEVNIKTAEAQLAYELQGAREQQKIRQEEIEIEVVQRKKQIAVEAQEILRTDKELIATVRRPAEAEAHRIQQIAEGEKVKQVLLAQAEAEKIRKIGEAEAAVIEAMGKAEAERMKLKAEAYQKYGDAAKMALVLEALPQIAAKIAAPLTKVDEIVVL-SGDNSKVTSEVNRLLAELPASVHALTGVD----LSKIP 473          

HSP 2 Score: 61.2326 bits (147), Expect = 2.129e-9
Identity = 25/43 (58.14%), Postives = 33/43 (76.74%), Query Frame = 1
Query:   16 IVGGWGWSWWLVCEVQMLSLEVMTLTPKCEQVETSEGVPITVT 144
            + GGW W+WW + + Q LSLEVMT+  +CE +ETSEGVP+ VT
Sbjct:   28 VFGGWAWAWWCISDTQRLSLEVMTILCRCENIETSEGVPLFVT 70          

HSP 3 Score: 51.9878 bits (123), Expect = 2.091e-6
Identity = 24/41 (58.54%), Postives = 32/41 (78.05%), Query Frame = 1
Query:   28 WGWS--WWLVCEVQMLSLEVMTLTPKCEQVETSEGVPITVT 144
            WG S  +W +C+V  +SLE+MTL P+CE VET+EGV +TVT
Sbjct:   85 WGNSKGFWKLCQVCQISLEIMTLQPRCEDVETAEGVALTVT 125          
BLAST of Flotillin-2 vs. Ensembl Human
Match: FLOT2 (flotillin 2 [Source:HGNC Symbol;Acc:HGNC:3758])

HSP 1 Score: 264.233 bits (674), Expect = 5.840e-85
Identity = 142/240 (59.17%), Postives = 189/240 (78.75%), Query Frame = 3
Query:  165 GVAQVKVMNEENLLRVACEQFLGKKREDIANTILQTLEGHLRAILGTLTVEAVYQDRDQFAQLVREVASPDVSKMGIEILSFTIKDVYDKVEYLNSLGRAQTANVKKDADIGVAEAERDAGIREAECEKLRMNIRYQANTEIADAERNFNMQKAIFETQVNQQKAESELAYELQAAKEKQRIRTEEIQXXXXXXXXXXXXXXXXXLRRENDLIASVKKPAESEAYKIERTAEGYKVQQIF 884
            GVAQVK+M E+ LL VACEQFLG                       TLTVE +YQDRDQFA+LVREVA+PDV +MGIEILSFTIKDVYDKV+YL+SLG+ QTA V++DADIGVAEAERDAGIREAEC+K  +++++ A+T+IAD++R F +QK+ F  +VN + AE++LAYELQ A+E+Q+IR EEI+IEVV++ KQI +E  E+LR + +LIA+V++PAE+EA++I++ AEG KV+Q+ 
Sbjct:   28 GVAQVKIMTEKELLAVACEQFLG-----------------------TLTVEQIYQDRDQFAKLVREVAAPDVGRMGIEILSFTIKDVYDKVDYLSSLGKTQTAVVQRDADIGVAEAERDAGIREAECKKEMLDVKFMADTKIADSKRAFELQKSAFSEEVNIKTAEAQLAYELQGAREQQKIRQEEIEIEVVQRKKQIAVEAQEILRTDKELIATVRRPAEAEAHRIQQIAEGEKVKQVL 244          
BLAST of Flotillin-2 vs. Ensembl Human
Match: FLOT1 (flotillin 1 [Source:HGNC Symbol;Acc:HGNC:3757])

HSP 1 Score: 269.626 bits (688), Expect = 1.025e-84
Identity = 155/352 (44.03%), Postives = 252/352 (71.59%), Query Frame = 3
Query:  165 GVAQVKVMNE-ENLLRVACEQFLGKKREDIANTILQTLEGHLRAILGTLTVEAVYQDRDQFAQLVREVASPDVSKMGIEILSFTIKDVYDKVEYLNSLGRAQTANVKKDADIGVAEAERDAGIREAECEKLRMNIRYQANTEIADAERNFNMQKAIFETQVNQQKAESELAYELQAAKEKQRIRTEEIQXXXXXXXXXXXXXXXXXLRRENDLIASVKKPAESEAYKIERTAEGYKVQQIFXXXXXXXXXXXXXXXXXXVIGEIGKAEASRMKLRAEAFKKYGKTAILNQIIDSMPRIAAEVTSPLQRTKNITIMDSGTG----GSLATEVAKLLGSLPPTIQAITGIDITN 1205
            G+AQVK+  + + +L  AC+ FLGK   +IA+  L+TLEGH RAI+  +TVE +Y+DR +F++ V +VAS D+  MGI ++S+T+KD++D  +YL+SLG+A+TA V+KDA IG AEA+RDAGIREA+ ++ +++ +Y +  E+A A+R++ ++KA ++ +VN ++A+++LAY+LQ AK KQ+I  + +Q++VVE+ +Q+ ++E E+ RRE +L A V+KPAE+E YK+ER AE  K Q I  A+AEA  + ++GEAEA  IG   +AEA +M  +AEAF+ Y + A L+ +++ +P++A E++ PL     IT++ SG+G      +  EV  +L  LP +++ +TG+ I+ 
Sbjct:   67 GIAQVKIQGQNKEMLAAACQMFLGKTEAEIAHIALETLEGHQRAIMAHMTVEEIYKDRQKFSEQVFKVASSDLVNMGISVVSYTLKDIHDDQDYLHSLGKARTAQVQKDARIGEAEAKRDAGIREAKAKQEKVSAQYLSEIEMAKAQRDYELKKAAYDIEVNTRRAQADLAYQLQVAKTKQQIEEQRVQVQVVERAQQVAVQEQEIARREKELEARVRKPAEAERYKLERLAEAEKSQLIMQAEAEAASVRMRGEAEAFAIGARARAEAEQMAKKAEAFQLYQEAAQLDMLLEKLPQVAEEISGPLTSANKITLVSSGSGTMGAAKVTGEVLDILTRLPESVERLTGVSISQ 418          
BLAST of Flotillin-2 vs. Ensembl Fly
Match: Flo2 (gene:FBgn0264078 transcript:FBtr0073952)

HSP 1 Score: 371.318 bits (952), Expect = 1.547e-124
Identity = 210/360 (58.33%), Postives = 274/360 (76.11%), Query Frame = 3
Query:  153 LKYKGVAQVKVMNEENLLRVACEQFLGKKREDIANTILQTLEGHLRAILGTLTVEAVYQDRDQFAQLVREVASPDVSKMGIEILSFTIKDVYDKVEYLNSLGRAQTANVKKDADIGVAEAERDAGIREAECEKLRMNIRYQANTEIADAERNFNMQKAIFETQVNQQKAESELAYELQAAKEKQRIRTEEIQXXXXXXXXXXXXXXXXXLRRENDLIASVKKPAESEAYKIERTAEGYKVQQIFXXXXXXXXXXXXXXXXXXVIGEIGKAEASRMKLRAEAFKKYGKTAILNQIIDSMPRIAAEVTSPLQRTKNITIMDSGTGGSLATEVAKLLGSLPPTIQAITGIDITNALSKIPGAE 1232
            L   GVAQ K+M  + LL  A EQFLGK  ++I  TILQTLEGHLRAILGTLTVE VY+DRDQFA LVREVA+PDV +MGIEILSFTIKDVYD V+YL SLG+AQTA VK+DAD GVAEA RDAGIREAECEK  M+++Y  +T+I D  R + +QKA F+ ++N  KAES+LAYELQAAK +QRIR EEIQIEVVE+ KQI IE  EV R++ +L  +VK PAE+EA++++  A+  + Q I  A+AEA++I   G AEA  I  +GKAEA RM+++A  +K+YG  AI+N +++S+P+IAAEV +PL +T  I ++  G   ++  +V +L+  LPP+I A+TG+D++  LSKIPGA+
Sbjct:   67 LTVTGVAQCKIMKADELLGTASEQFLGKSVKEIKQTILQTLEGHLRAILGTLTVEEVYKDRDQFAALVREVAAPDVGRMGIEILSFTIKDVYDDVQYLASLGKAQTAVVKRDADAGVAEANRDAGIREAECEKSAMDVKYSTDTKIEDNTRMYKLQKANFDQEINTAKAESQLAYELQAAKIRQRIRNEEIQIEVVERRKQIEIESQEVQRKDRELTGTVKLPAEAEAFRLQTLAQAKQCQTIEGARAEAERIRKIGSAEAHAIELVGKAEAERMRMKAHVYKQYGDAAIMNIVLESLPKIAAEVAAPLAKTDEIVLI--GGNDNITNDVTRLVAQLPPSINALTGVDLSKVLSKIPGAK 424          

HSP 2 Score: 77.411 bits (189), Expect = 6.256e-15
Identity = 34/47 (72.34%), Postives = 39/47 (82.98%), Query Frame = 1
Query:    4 KVKTIVGGWGWSWWLVCEVQMLSLEVMTLTPKCEQVETSEGVPITVT 144
            K +TIVGGW W+WWLV +VQ LSL VMTL P CE VETS+GVP+TVT
Sbjct:   24 KKRTIVGGWAWAWWLVTDVQRLSLNVMTLNPMCENVETSQGVPLTVT 70          
BLAST of Flotillin-2 vs. Ensembl Fly
Match: Flo2 (gene:FBgn0264078 transcript:FBtr0073950)

HSP 1 Score: 371.318 bits (952), Expect = 1.547e-124
Identity = 210/360 (58.33%), Postives = 274/360 (76.11%), Query Frame = 3
Query:  153 LKYKGVAQVKVMNEENLLRVACEQFLGKKREDIANTILQTLEGHLRAILGTLTVEAVYQDRDQFAQLVREVASPDVSKMGIEILSFTIKDVYDKVEYLNSLGRAQTANVKKDADIGVAEAERDAGIREAECEKLRMNIRYQANTEIADAERNFNMQKAIFETQVNQQKAESELAYELQAAKEKQRIRTEEIQXXXXXXXXXXXXXXXXXLRRENDLIASVKKPAESEAYKIERTAEGYKVQQIFXXXXXXXXXXXXXXXXXXVIGEIGKAEASRMKLRAEAFKKYGKTAILNQIIDSMPRIAAEVTSPLQRTKNITIMDSGTGGSLATEVAKLLGSLPPTIQAITGIDITNALSKIPGAE 1232
            L   GVAQ K+M  + LL  A EQFLGK  ++I  TILQTLEGHLRAILGTLTVE VY+DRDQFA LVREVA+PDV +MGIEILSFTIKDVYD V+YL SLG+AQTA VK+DAD GVAEA RDAGIREAECEK  M+++Y  +T+I D  R + +QKA F+ ++N  KAES+LAYELQAAK +QRIR EEIQIEVVE+ KQI IE  EV R++ +L  +VK PAE+EA++++  A+  + Q I  A+AEA++I   G AEA  I  +GKAEA RM+++A  +K+YG  AI+N +++S+P+IAAEV +PL +T  I ++  G   ++  +V +L+  LPP+I A+TG+D++  LSKIPGA+
Sbjct:   67 LTVTGVAQCKIMKADELLGTASEQFLGKSVKEIKQTILQTLEGHLRAILGTLTVEEVYKDRDQFAALVREVAAPDVGRMGIEILSFTIKDVYDDVQYLASLGKAQTAVVKRDADAGVAEANRDAGIREAECEKSAMDVKYSTDTKIEDNTRMYKLQKANFDQEINTAKAESQLAYELQAAKIRQRIRNEEIQIEVVERRKQIEIESQEVQRKDRELTGTVKLPAEAEAFRLQTLAQAKQCQTIEGARAEAERIRKIGSAEAHAIELVGKAEAERMRMKAHVYKQYGDAAIMNIVLESLPKIAAEVAAPLAKTDEIVLI--GGNDNITNDVTRLVAQLPPSINALTGVDLSKVLSKIPGAK 424          

HSP 2 Score: 77.411 bits (189), Expect = 6.256e-15
Identity = 34/47 (72.34%), Postives = 39/47 (82.98%), Query Frame = 1
Query:    4 KVKTIVGGWGWSWWLVCEVQMLSLEVMTLTPKCEQVETSEGVPITVT 144
            K +TIVGGW W+WWLV +VQ LSL VMTL P CE VETS+GVP+TVT
Sbjct:   24 KKRTIVGGWAWAWWLVTDVQRLSLNVMTLNPMCENVETSQGVPLTVT 70          
BLAST of Flotillin-2 vs. Ensembl Fly
Match: Flo2 (gene:FBgn0264078 transcript:FBtr0330217)

HSP 1 Score: 371.703 bits (953), Expect = 1.818e-124
Identity = 210/360 (58.33%), Postives = 274/360 (76.11%), Query Frame = 3
Query:  153 LKYKGVAQVKVMNEENLLRVACEQFLGKKREDIANTILQTLEGHLRAILGTLTVEAVYQDRDQFAQLVREVASPDVSKMGIEILSFTIKDVYDKVEYLNSLGRAQTANVKKDADIGVAEAERDAGIREAECEKLRMNIRYQANTEIADAERNFNMQKAIFETQVNQQKAESELAYELQAAKEKQRIRTEEIQXXXXXXXXXXXXXXXXXLRRENDLIASVKKPAESEAYKIERTAEGYKVQQIFXXXXXXXXXXXXXXXXXXVIGEIGKAEASRMKLRAEAFKKYGKTAILNQIIDSMPRIAAEVTSPLQRTKNITIMDSGTGGSLATEVAKLLGSLPPTIQAITGIDITNALSKIPGAE 1232
            L   GVAQ K+M  + LL  A EQFLGK  ++I  TILQTLEGHLRAILGTLTVE VY+DRDQFA LVREVA+PDV +MGIEILSFTIKDVYD V+YL SLG+AQTA VK+DAD GVAEA RDAGIREAECEK  M+++Y  +T+I D  R + +QKA F+ ++N  KAES+LAYELQAAK +QRIR EEIQIEVVE+ KQI IE  EV R++ +L  +VK PAE+EA++++  A+  + Q I  A+AEA++I   G AEA  I  +GKAEA RM+++A  +K+YG  AI+N +++S+P+IAAEV +PL +T  I ++  G   ++  +V +L+  LPP+I A+TG+D++  LSKIPGA+
Sbjct:   67 LTVTGVAQCKIMKADELLGTASEQFLGKSVKEIKQTILQTLEGHLRAILGTLTVEEVYKDRDQFAALVREVAAPDVGRMGIEILSFTIKDVYDDVQYLASLGKAQTAVVKRDADAGVAEANRDAGIREAECEKSAMDVKYSTDTKIEDNTRMYKLQKANFDQEINTAKAESQLAYELQAAKIRQRIRNEEIQIEVVERRKQIEIESQEVQRKDRELTGTVKLPAEAEAFRLQTLAQAKQCQTIEGARAEAERIRKIGSAEAHAIELVGKAEAERMRMKAHVYKQYGDAAIMNIVLESLPKIAAEVAAPLAKTDEIVLI--GGNDNITNDVTRLVAQLPPSINALTGVDLSKVLSKIPGAK 424          

HSP 2 Score: 77.411 bits (189), Expect = 7.141e-15
Identity = 34/47 (72.34%), Postives = 39/47 (82.98%), Query Frame = 1
Query:    4 KVKTIVGGWGWSWWLVCEVQMLSLEVMTLTPKCEQVETSEGVPITVT 144
            K +TIVGGW W+WWLV +VQ LSL VMTL P CE VETS+GVP+TVT
Sbjct:   24 KKRTIVGGWAWAWWLVTDVQRLSLNVMTLNPMCENVETSQGVPLTVT 70          
BLAST of Flotillin-2 vs. Ensembl Fly
Match: Flo2 (gene:FBgn0264078 transcript:FBtr0330214)

HSP 1 Score: 363.999 bits (933), Expect = 1.236e-121
Identity = 211/370 (57.03%), Postives = 274/370 (74.05%), Query Frame = 3
Query:  153 LKYKGVAQVKVMNEEN----------LLRVACEQFLGKKREDIANTILQTLEGHLRAILGTLTVEAVYQDRDQFAQLVREVASPDVSKMGIEILSFTIKDVYDKVEYLNSLGRAQTANVKKDADIGVAEAERDAGIREAECEKLRMNIRYQANTEIADAERNFNMQKAIFETQVNQQKAESELAYELQAAKEKQRIRTEEIQXXXXXXXXXXXXXXXXXLRRENDLIASVKKPAESEAYKIERTAEGYKVQQIFXXXXXXXXXXXXXXXXXXVIGEIGKAEASRMKLRAEAFKKYGKTAILNQIIDSMPRIAAEVTSPLQRTKNITIMDSGTGGSLATEVAKLLGSLPPTIQAITGIDITNALSKIPGAE 1232
            L   GVAQ K+M   N          LL  A EQFLGK  ++I  TILQTLEGHLRAILGTLTVE VY+DRDQFA LVREVA+PDV +MGIEILSFTIKDVYD V+YL SLG+AQTA VK+DAD GVAEA RDAGIREAECEK  M+++Y  +T+I D  R + +QKA F+ ++N  KAES+LAYELQAAK +QRIR EEIQIEVVE+ KQI IE  EV R++ +L  +VK PAE+EA++++  A+  + Q I  A+AEA++I   G AEA  I  +GKAEA RM+++A  +K+YG  AI+N +++S+P+IAAEV +PL +T  I ++  G   ++  +V +L+  LPP+I A+TG+D++  LSKIPGA+
Sbjct:   67 LTVTGVAQCKIMKMMNVYYFHHQADELLGTASEQFLGKSVKEIKQTILQTLEGHLRAILGTLTVEEVYKDRDQFAALVREVAAPDVGRMGIEILSFTIKDVYDDVQYLASLGKAQTAVVKRDADAGVAEANRDAGIREAECEKSAMDVKYSTDTKIEDNTRMYKLQKANFDQEINTAKAESQLAYELQAAKIRQRIRNEEIQIEVVERRKQIEIESQEVQRKDRELTGTVKLPAEAEAFRLQTLAQAKQCQTIEGARAEAERIRKIGSAEAHAIELVGKAEAERMRMKAHVYKQYGDAAIMNIVLESLPKIAAEVAAPLAKTDEIVLI--GGNDNITNDVTRLVAQLPPSINALTGVDLSKVLSKIPGAK 434          

HSP 2 Score: 77.411 bits (189), Expect = 5.891e-15
Identity = 34/47 (72.34%), Postives = 39/47 (82.98%), Query Frame = 1
Query:    4 KVKTIVGGWGWSWWLVCEVQMLSLEVMTLTPKCEQVETSEGVPITVT 144
            K +TIVGGW W+WWLV +VQ LSL VMTL P CE VETS+GVP+TVT
Sbjct:   24 KKRTIVGGWAWAWWLVTDVQRLSLNVMTLNPMCENVETSQGVPLTVT 70          
BLAST of Flotillin-2 vs. Ensembl Fly
Match: Flo2 (gene:FBgn0264078 transcript:FBtr0330216)

HSP 1 Score: 363.229 bits (931), Expect = 3.490e-121
Identity = 212/373 (56.84%), Postives = 276/373 (73.99%), Query Frame = 3
Query:  153 LKYKGVAQVKVM-----------NEE--NLLRVACEQFLGKKREDIANTILQTLEGHLRAILGTLTVEAVYQDRDQFAQLVREVASPDVSKMGIEILSFTIKDVYDKVEYLNSLGRAQTANVKKDADIGVAEAERDAGIREAECEKLRMNIRYQANTEIADAERNFNMQKAIFETQVNQQKAESELAYELQAAKEKQRIRTEEIQXXXXXXXXXXXXXXXXXLRRENDLIASVKKPAESEAYKIERTAEGYKVQQIFXXXXXXXXXXXXXXXXXXVIGEIGKAEASRMKLRAEAFKKYGKTAILNQIIDSMPRIAAEVTSPLQRTKNITIMDSGTGGSLATEVAKLLGSLPPTIQAITGIDITNALSKIPGAE 1232
            L   GVAQ K+M           N+E   LL  A EQFLGK  ++I  TILQTLEGHLRAILGTLTVE VY+DRDQFA LVREVA+PDV +MGIEILSFTIKDVYD V+YL SLG+AQTA VK+DAD GVAEA RDAGIREAECEK  M+++Y  +T+I D  R + +QKA F+ ++N  KAES+LAYELQAAK +QRIR EEIQIEVVE+ KQI IE  EV R++ +L  +VK PAE+EA++++  A+  + Q I  A+AEA++I   G AEA  I  +GKAEA RM+++A  +K+YG  AI+N +++S+P+IAAEV +PL +T  I ++  G   ++  +V +L+  LPP+I A+TG+D++  LSKIPGA+
Sbjct:   67 LTVTGVAQCKIMKSSSYKQTDYHNDEADELLGTASEQFLGKSVKEIKQTILQTLEGHLRAILGTLTVEEVYKDRDQFAALVREVAAPDVGRMGIEILSFTIKDVYDDVQYLASLGKAQTAVVKRDADAGVAEANRDAGIREAECEKSAMDVKYSTDTKIEDNTRMYKLQKANFDQEINTAKAESQLAYELQAAKIRQRIRNEEIQIEVVERRKQIEIESQEVQRKDRELTGTVKLPAEAEAFRLQTLAQAKQCQTIEGARAEAERIRKIGSAEAHAIELVGKAEAERMRMKAHVYKQYGDAAIMNIVLESLPKIAAEVAAPLAKTDEIVLI--GGNDNITNDVTRLVAQLPPSINALTGVDLSKVLSKIPGAK 437          

HSP 2 Score: 77.7962 bits (190), Expect = 5.762e-15
Identity = 34/47 (72.34%), Postives = 39/47 (82.98%), Query Frame = 1
Query:    4 KVKTIVGGWGWSWWLVCEVQMLSLEVMTLTPKCEQVETSEGVPITVT 144
            K +TIVGGW W+WWLV +VQ LSL VMTL P CE VETS+GVP+TVT
Sbjct:   24 KKRTIVGGWAWAWWLVTDVQRLSLNVMTLNPMCENVETSQGVPLTVT 70          
BLAST of Flotillin-2 vs. Ensembl Zebrafish
Match: flot2b (flotillin 2b [Source:ZFIN;Acc:ZDB-GENE-040426-1368])

HSP 1 Score: 387.882 bits (995), Expect = 6.803e-131
Identity = 217/358 (60.61%), Postives = 292/358 (81.56%), Query Frame = 3
Query:  165 GVAQVKVMNEENLLRVACEQFLGKKREDIANTILQTLEGHLRAILGTLTVEAVYQDRDQFAQLVREVASPDVSKMGIEILSFTIKDVYDKVEYLNSLGRAQTANVKKDADIGVAEAERDAGIREAECEKLRMNIRYQANTEIADAERNFNMQKAIFETQVNQQKAESELAYELQAAKEKQRIRTEEIQXXXXXXXXXXXXXXXXXLRRENDLIASVKKPAESEAYKIERTAEGYKVQQIFXXXXXXXXXXXXXXXXXXVIGEIGKAEASRMKLRAEAFKKYGKTAILNQIIDSMPRIAAEVTSPLQRTKNITIMDSGTGGSLATEVAKLLGSLPPTIQAITGIDITNA--LSKIPGAE 1232
            GVAQVKVM +++LL +ACEQFLGK   +I   +LQTLEGHLR+ILGTLTVE +YQDRDQFA+LVREVA+PDV +MGIEILSFTIKDVYDK++YL+SLG+ QTA V++DADIGVAEAERDAGIREAEC+K  M++++ A+T++AD++R   +QKA F  +VN +KAES+LAYELQAAKE+Q+IR EEI+IEVV++ KQI IEE E+ R E +LIA+VK+PAE+EAYK+E+ AEGYK+Q++  A+AEA+KI   GEAEA+ I  +GKAEA RM+L+AEA+++YG+ A    ++D++P+IA +V++PL RT  I I+ SG G  +  EV +LL  LP ++ A+TG+D++    L K+ GA+
Sbjct:   71 GVAQVKVMTDKDLLAIACEQFLGKSVMEIKAVVLQTLEGHLRSILGTLTVEQIYQDRDQFARLVREVAAPDVGRMGIEILSFTIKDVYDKLDYLSSLGKTQTAAVQRDADIGVAEAERDAGIREAECKKEMMDVKFLADTKMADSKRELELQKAAFNQEVNTKKAESQLAYELQAAKEQQKIRLEEIEIEVVQRKKQISIEEREIERTEKELIATVKRPAEAEAYKMEQLAEGYKMQKVLTAQAEAEKIRKIGEAEAISISSVGKAEAERMRLKAEAYQQYGEAAKTALVLDALPKIAGKVSAPLARTNEIVIL-SGDGSRVTGEVNRLLAELPVSVNALTGVDLSKMPLLQKLTGAQ 427          

HSP 2 Score: 70.0922 bits (170), Expect = 1.991e-12
Identity = 28/43 (65.12%), Postives = 36/43 (83.72%), Query Frame = 1
Query:   16 IVGGWGWSWWLVCEVQMLSLEVMTLTPKCEQVETSEGVPITVT 144
            +VGGW W+WWL+ + Q ++LE+MTL PKCE VET+EGV ITVT
Sbjct:   28 VVGGWAWAWWLISDTQRITLEIMTLQPKCEDVETAEGVAITVT 70          
BLAST of Flotillin-2 vs. Ensembl Zebrafish
Match: flot2a (flotillin 2a [Source:NCBI gene;Acc:245698])

HSP 1 Score: 385.571 bits (989), Expect = 6.427e-130
Identity = 216/353 (61.19%), Postives = 288/353 (81.59%), Query Frame = 3
Query:  165 GVAQVKVMNEENLLRVACEQFLGKKREDIANTILQTLEGHLRAILGTLTVEAVYQDRDQFAQLVREVASPDVSKMGIEILSFTIKDVYDKVEYLNSLGRAQTANVKKDADIGVAEAERDAGIREAECEKLRMNIRYQANTEIADAERNFNMQKAIFETQVNQQKAESELAYELQAAKEKQRIRTEEIQXXXXXXXXXXXXXXXXXLRRENDLIASVKKPAESEAYKIERTAEGYKVQQIFXXXXXXXXXXXXXXXXXXVIGEIGKAEASRMKLRAEAFKKYGKTAILNQIIDSMPRIAAEVTSPLQRTKNITIMDSGTGGSLATEVAKLLGSLPPTIQAITGIDITNALSKIP 1223
            GVAQVKVM +  LL  ACEQFLGK   +I + ILQTLEGHLR+ILGTLTVE +YQDRDQFA+LVREVA+PDV +MGIEILSFTIKDVYDKV+YL+SLG++QTA V++DADIGVAEAERDAGIREAEC+K  M+I++QA+T++AD++R   MQKA F  +VN +KAE++LAYELQAAKE+Q+IR EEI+IEVV++ KQI IEE E+LR + +LIA+V++PAE+EA+K+E+ AE  K++++  A+AEA+KI+  GEAEA  I  +GKAEA +M+L+AEA+++YG+ A    +++++P+IA +V +PL RT  I I+ SG GG +  EV +LL  LP ++ A+TG+D    LSKIP
Sbjct:   71 GVAQVKVMTDNELLGYACEQFLGKTVTEIKSVILQTLEGHLRSILGTLTVEQIYQDRDQFAKLVREVAAPDVGRMGIEILSFTIKDVYDKVDYLSSLGKSQTAAVQRDADIGVAEAERDAGIREAECKKEMMDIKFQADTKMADSKRELEMQKAAFNQEVNTKKAEAQLAYELQAAKEQQKIRLEEIEIEVVQRKKQISIEEKEILRTDKELIATVRRPAEAEAFKMEQLAEAKKIKKVLTAQAEAEKIKRIGEAEAGSIEAVGKAEAEKMRLKAEAYQQYGEAAKTALVLEALPKIAGKVAAPLGRTNEIVIL-SGDGGRVTGEVNRLLAELPVSVNALTGVD----LSKIP 418          

HSP 2 Score: 69.707 bits (169), Expect = 2.487e-12
Identity = 28/42 (66.67%), Postives = 36/42 (85.71%), Query Frame = 1
Query:   19 VGGWGWSWWLVCEVQMLSLEVMTLTPKCEQVETSEGVPITVT 144
            VGGW W+WWL+ ++Q ++LE+MTL PKCE VET+EGV ITVT
Sbjct:   29 VGGWAWAWWLITDIQKITLEIMTLQPKCEDVETAEGVAITVT 70          
BLAST of Flotillin-2 vs. Ensembl Zebrafish
Match: flot1b (flotillin 1b [Source:ZFIN;Acc:ZDB-GENE-020430-2])

HSP 1 Score: 263.848 bits (673), Expect = 1.123e-82
Identity = 158/353 (44.76%), Postives = 252/353 (71.39%), Query Frame = 3
Query:  165 GVAQVKVMNE-ENLLRVACEQFLGKKREDIANTILQTLEGHLRAILGTLTVEAVYQDRDQFAQLVREVASPDVSKMGIEILSFTIKDVYDKVEYLNSLGRAQTANVKKDADIGVAEAERDAGIREAECEKLRMNIRYQANTEIADAERNFNMQKAIFETQVNQQKAESELAYELQAAKEKQRIRTEEIQXXXXXXXXXXXXXXXXXLRRENDLIASVKKPAESEAYKIERTAEGYKVQQIFXXXXXXXXXXXXXXXXXXVIGEIGKAEASRMKLRAEAFKKYGKTAILNQIIDSMPRIAAEVTSPLQRTKNITIMDSG----TGGSLATEVAKLLGSLPPTIQAITGIDITNA 1208
            G+AQVK+  + + +L  AC+ F+GK   +IAN  L+TLEGH RAI+  LTVE +YQDR +F++ V +VAS D+  MGI ++S+T+KDV+D  +YL+SLG+A+TA V++DA IG A+ +RDA IREA   + +++ +Y+   E+A A+R+F ++KA ++ +VN +KAESE+AY+LQ AK KQRI  E++Q++VVE+ +QI+++E E+ RRE +L A ++KPAE+E Y+IE+ AE  ++Q I  A+AEA+ I +KGEAEA  +   G+AEA +M  +AEAFK Y + A+++ +++ +P +A E++ PL   + +T++ SG        L  EV  ++  LP  ++ +TG++I+ A
Sbjct:   67 GIAQVKIQGQNKEMLAAACQMFMGKSEGEIANIALETLEGHQRAIIAHLTVEEIYQDRKKFSEQVFKVASSDLVNMGIGVVSYTLKDVHDDQDYLSSLGKARTAQVQRDARIGEAQFKRDAVIREAHAMQEKVSAQYKNEIEMAKAQRDFELKKAAYDVEVNTKKAESEMAYQLQVAKTKQRIEEEKMQVQVVERTQQIMLQEQEITRREKELEAKIRKPAEAERYRIEKLAEAERLQLIMEAEAEAESIRMKGEAEAFALEAKGRAEAEQMAKKAEAFKGYKEGAMVDMLLEKLPLMAEEISKPLCAAQKVTMVSSGGSEVGAAKLTGEVLDIMTRLPGAVEKLTGVNISQA 419          
BLAST of Flotillin-2 vs. Ensembl Zebrafish
Match: flot1a (flotillin 1a [Source:ZFIN;Acc:ZDB-GENE-020430-1])

HSP 1 Score: 262.307 bits (669), Expect = 7.638e-82
Identity = 156/354 (44.07%), Postives = 251/354 (70.90%), Query Frame = 3
Query:  165 GVAQVKVMNE-ENLLRVACEQFLGKKREDIANTILQTLEGHLRAILGTLTVEAVYQDRDQFAQLVREVASPDVSKMGIEILSFTIKDVYDKVEYLNSLGRAQTANVKKDADIGVAEAERDAGIREAECEKLRMNIRYQANTEIADAERNFNMQKAIFETQVNQQKAESELAYELQAAKEKQRIRTEEIQXXXXXXXXXXXXXXXXXLRRENDLIASVKKPAESEAYKIERTAEGYKVQQIFXXXXXXXXXXXXXXXXXXVIGEIGKAEASRMKLRAEAFKKYGKTAILNQIIDSMPRIAAEVTSPLQRTKNITIMDSG----TGGSLATEVAKLLGSLPPTIQAITGIDITNAL 1211
            G+AQ+K+  + + +L  AC+ FLGK   +IA+  L+TLEGH RAI+  LTVE +Y+DR +F++ V +VAS D+  MGI ++S+T+KDV+D  +YL+SLG+A+TA V+KDA IG A+ +RDA IREA   + +++ +Y    E+A A+R++ ++KAI++ +V  +KAESE+AY+LQ AK KQRI  E++Q+ VVE+++QI ++E E+ R+E +L A VKKPAE+E Y++E+ AE  ++Q I  A+AEA+ I ++GEAEA  +   G+AEA +M  +AEAF+ Y + A+++ +++ +P +A E++ PL  T  +T++ SG        L  EV  ++  LP TI+ +TG++I+  +
Sbjct:   67 GIAQMKIQGQNKQMLAAACQMFLGKSDSEIAHIALETLEGHQRAIIAHLTVEEIYKDRKKFSEQVFKVASSDLVNMGISVVSYTLKDVHDDQDYLHSLGKARTAQVQKDARIGEAKNKRDAVIREAHAMQEKVSAQYMNEIEMAKAQRDYELKKAIYDIEVFTKKAESEMAYQLQVAKTKQRIEEEKMQVLVVERSQQITLQEQEISRKEKELEAKVKKPAEAERYRLEKLAEAERLQLIMEAEAEAESIRVRGEAEAYAVEAKGRAEAEQMAKKAEAFQHYKEGAMVDMLLEKLPMMADEISKPLSATNKVTMVSSGGSEIGAAKLTGEVLDIMTKLPETIEKLTGVNISQCI 420          
BLAST of Flotillin-2 vs. Ensembl Zebrafish
Match: flot1a (flotillin 1a [Source:ZFIN;Acc:ZDB-GENE-020430-1])

HSP 1 Score: 261.151 bits (666), Expect = 1.149e-81
Identity = 156/351 (44.44%), Postives = 250/351 (71.23%), Query Frame = 3
Query:  165 GVAQVKVMNE-ENLLRVACEQFLGKKREDIANTILQTLEGHLRAILGTLTVEAVYQDRDQFAQLVREVASPDVSKMGIEILSFTIKDVYDKVEYLNSLGRAQTANVKKDADIGVAEAERDAGIREAECEKLRMNIRYQANTEIADAERNFNMQKAIFETQVNQQKAESELAYELQAAKEKQRIRTEEIQXXXXXXXXXXXXXXXXXLRRENDLIASVKKPAESEAYKIERTAEGYKVQQIFXXXXXXXXXXXXXXXXXXVIGEIGKAEASRMKLRAEAFKKYGKTAILNQIIDSMPRIAAEVTSPLQRTKNITIMDSG----TGGSLATEVAKLLGSLPPTIQAITGIDIT 1202
            G+AQ+K+  + + +L  AC+ FLGK   +IA+  L+TLEGH RAI+  LTVE +Y+DR +F++ V +VAS D+  MGI ++S+T+KDV+D  +YL+SLG+A+TA V+KDA IG A+ +RDA IREA   + +++ +Y    E+A A+R++ ++KAI++ +V  +KAESE+AY+LQ AK KQRI  E++Q+ VVE+++QI ++E E+ R+E +L A VKKPAE+E Y++E+ AE  ++Q I  A+AEA+ I ++GEAEA  +   G+AEA +M  +AEAF+ Y + A+++ +++ +P +A E++ PL  T  +T++ SG        L  EV  ++  LP TI+ +TG++I+
Sbjct:   67 GIAQMKIQGQNKQMLAAACQMFLGKSDSEIAHIALETLEGHQRAIIAHLTVEEIYKDRKKFSEQVFKVASSDLVNMGISVVSYTLKDVHDDQDYLHSLGKARTAQVQKDARIGEAKNKRDAVIREAHAMQEKVSAQYMNEIEMAKAQRDYELKKAIYDIEVFTKKAESEMAYQLQVAKTKQRIEEEKMQVLVVERSQQITLQEQEISRKEKELEAKVKKPAEAERYRLEKLAEAERLQLIMEAEAEAESIRVRGEAEAYAVEAKGRAEAEQMAKKAEAFQHYKEGAMVDMLLEKLPMMADEISKPLSATNKVTMVSSGGSEIGAAKLTGEVLDIMTKLPETIEKLTGVNIS 417          
BLAST of Flotillin-2 vs. Ensembl Xenopus
Match: flot2 (flotillin 2 [Source:NCBI gene;Acc:496443])

HSP 1 Score: 379.022 bits (972), Expect = 3.201e-127
Identity = 211/357 (59.10%), Postives = 287/357 (80.39%), Query Frame = 3
Query:  153 LKYKGVAQVKVMNEENLLRVACEQFLGKKREDIANTILQTLEGHLRAILGTLTVEAVYQDRDQFAQLVREVASPDVSKMGIEILSFTIKDVYDKVEYLNSLGRAQTANVKKDADIGVAEAERDAGIREAECEKLRMNIRYQANTEIADAERNFNMQKAIFETQVNQQKAESELAYELQAAKEKQRIRTEEIQXXXXXXXXXXXXXXXXXLRRENDLIASVKKPAESEAYKIERTAEGYKVQQIFXXXXXXXXXXXXXXXXXXVIGEIGKAEASRMKLRAEAFKKYGKTAILNQIIDSMPRIAAEVTSPLQRTKNITIMDSGTGGSLATEVAKLLGSLPPTIQAITGIDITNALSKIP 1223
            L   GVAQVK+M E  LL VA EQFLGK   +I N +LQTLEGHLR+ILGTLTVE +YQDRDQFA+LVREVA+PDV +MGIEILSFTIKDVYDKVEYL+SLG++QTA V++DADIGVAEAERDAGIREA C++  ++++Y A+T++AD++R F MQKA F  +VN +KAE++LAYELQAAKE+Q+IR EEI+IEVV++ KQI IEE E++R + +LIA+V++PAE+EAY++++ AEG KV+Q+  A+AEA+KI   G+AEA  I  IGKAEA +MKL+A A+++YG+ A +  +++ +P+IAA+V++PL +   I I+ SG    +  E+ +LL  +P ++QA+TG+D+T    KIP
Sbjct:   67 LTVTGVAQVKIMTERELLAVASEQFLGKNVHEIKNVVLQTLEGHLRSILGTLTVEQIYQDRDQFAKLVREVAAPDVGRMGIEILSFTIKDVYDKVEYLSSLGKSQTAAVRRDADIGVAEAERDAGIREALCKRETLDVKYLADTKMADSKREFEMQKAGFSQEVNTKKAEAQLAYELQAAKEQQKIRQEEIEIEVVQRKKQIDIEEKEIVRMDKELIATVRRPAEAEAYRMQQIAEGEKVKQVLYAQAEAEKIRKIGDAEAATIEAIGKAEAEKMKLKAGAYQQYGEAAKMAMVLECLPQIAAKVSAPLAKVDEIVIL-SGENSKITGEMNRLLAEVPASVQALTGVDLT----KIP 418          

HSP 2 Score: 65.0846 bits (157), Expect = 1.108e-10
Identity = 26/43 (60.47%), Postives = 34/43 (79.07%), Query Frame = 1
Query:   16 IVGGWGWSWWLVCEVQMLSLEVMTLTPKCEQVETSEGVPITVT 144
            + GGW W+WW V + Q +SLE+MTL PKC+ VET+EGV +TVT
Sbjct:   28 VYGGWAWAWWCVSDTQRISLEIMTLQPKCDDVETAEGVALTVT 70          
BLAST of Flotillin-2 vs. Ensembl Xenopus
Match: flot2 (flotillin 2 [Source:NCBI gene;Acc:496443])

HSP 1 Score: 377.867 bits (969), Expect = 7.704e-127
Identity = 211/357 (59.10%), Postives = 287/357 (80.39%), Query Frame = 3
Query:  153 LKYKGVAQVKVMNEENLLRVACEQFLGKKREDIANTILQTLEGHLRAILGTLTVEAVYQDRDQFAQLVREVASPDVSKMGIEILSFTIKDVYDKVEYLNSLGRAQTANVKKDADIGVAEAERDAGIREAECEKLRMNIRYQANTEIADAERNFNMQKAIFETQVNQQKAESELAYELQAAKEKQRIRTEEIQXXXXXXXXXXXXXXXXXLRRENDLIASVKKPAESEAYKIERTAEGYKVQQIFXXXXXXXXXXXXXXXXXXVIGEIGKAEASRMKLRAEAFKKYGKTAILNQIIDSMPRIAAEVTSPLQRTKNITIMDSGTGGSLATEVAKLLGSLPPTIQAITGIDITNALSKIP 1223
            L   GVAQVK+M E  LL VA EQFLGK   +I N +LQTLEGHLR+ILGTLTVE +YQDRDQFA+LVREVA+PDV +MGIEILSFTIKDVYDKVEYL+SLG++QTA V++DADIGVAEAERDAGIREA C++  ++++Y A+T++AD++R F MQKA F  +VN +KAE++LAYELQAAKE+Q+IR EEI+IEVV++ KQI IEE E++R + +LIA+V++PAE+EAY++++ AEG KV+Q+  A+AEA+KI   G+AEA  I  IGKAEA +MKL+A A+++YG+ A +  +++ +P+IAA+V++PL +   I I+ SG    +  E+ +LL  +P ++QA+TG+D+T    KIP
Sbjct:   67 LYVTGVAQVKIMTERELLAVASEQFLGKNVHEIKNVVLQTLEGHLRSILGTLTVEQIYQDRDQFAKLVREVAAPDVGRMGIEILSFTIKDVYDKVEYLSSLGKSQTAAVRRDADIGVAEAERDAGIREALCKRETLDVKYLADTKMADSKREFEMQKAGFSQEVNTKKAEAQLAYELQAAKEQQKIRQEEIEIEVVQRKKQIDIEEKEIVRMDKELIATVRRPAEAEAYRMQQIAEGEKVKQVLYAQAEAEKIRKIGDAEAATIEAIGKAEAEKMKLKAGAYQQYGEAAKMAMVLECLPQIAAKVSAPLAKVDEIVIL-SGENSKITGEMNRLLAEVPASVQALTGVDLT----KIP 418          

HSP 2 Score: 62.003 bits (149), Expect = 1.134e-9
Identity = 26/43 (60.47%), Postives = 33/43 (76.74%), Query Frame = 1
Query:   16 IVGGWGWSWWLVCEVQMLSLEVMTLTPKCEQVETSEGVPITVT 144
            + GGW W+WW V + Q LSLEVMT+  +CE +ETSEGVP+ VT
Sbjct:   28 VYGGWAWAWWCVSDTQRLSLEVMTILCRCENIETSEGVPLYVT 70          
BLAST of Flotillin-2 vs. Ensembl Xenopus
Match: flot2 (flotillin 2 [Source:NCBI gene;Acc:496443])

HSP 1 Score: 378.637 bits (971), Expect = 9.770e-127
Identity = 211/357 (59.10%), Postives = 287/357 (80.39%), Query Frame = 3
Query:  153 LKYKGVAQVKVMNEENLLRVACEQFLGKKREDIANTILQTLEGHLRAILGTLTVEAVYQDRDQFAQLVREVASPDVSKMGIEILSFTIKDVYDKVEYLNSLGRAQTANVKKDADIGVAEAERDAGIREAECEKLRMNIRYQANTEIADAERNFNMQKAIFETQVNQQKAESELAYELQAAKEKQRIRTEEIQXXXXXXXXXXXXXXXXXLRRENDLIASVKKPAESEAYKIERTAEGYKVQQIFXXXXXXXXXXXXXXXXXXVIGEIGKAEASRMKLRAEAFKKYGKTAILNQIIDSMPRIAAEVTSPLQRTKNITIMDSGTGGSLATEVAKLLGSLPPTIQAITGIDITNALSKIP 1223
            L   GVAQVK+M E  LL VA EQFLGK   +I N +LQTLEGHLR+ILGTLTVE +YQDRDQFA+LVREVA+PDV +MGIEILSFTIKDVYDKVEYL+SLG++QTA V++DADIGVAEAERDAGIREA C++  ++++Y A+T++AD++R F MQKA F  +VN +KAE++LAYELQAAKE+Q+IR EEI+IEVV++ KQI IEE E++R + +LIA+V++PAE+EAY++++ AEG KV+Q+  A+AEA+KI   G+AEA  I  IGKAEA +MKL+A A+++YG+ A +  +++ +P+IAA+V++PL +   I I+ SG    +  E+ +LL  +P ++QA+TG+D+T    KIP
Sbjct:   92 LTVTGVAQVKIMTERELLAVASEQFLGKNVHEIKNVVLQTLEGHLRSILGTLTVEQIYQDRDQFAKLVREVAAPDVGRMGIEILSFTIKDVYDKVEYLSSLGKSQTAAVRRDADIGVAEAERDAGIREALCKRETLDVKYLADTKMADSKREFEMQKAGFSQEVNTKKAEAQLAYELQAAKEQQKIRQEEIEIEVVQRKKQIDIEEKEIVRMDKELIATVRRPAEAEAYRMQQIAEGEKVKQVLYAQAEAEKIRKIGDAEAATIEAIGKAEAEKMKLKAGAYQQYGEAAKMAMVLECLPQIAAKVSAPLAKVDEIVIL-SGENSKITGEMNRLLAEVPASVQALTGVDLT----KIP 443          

HSP 2 Score: 53.1434 bits (126), Expect = 6.461e-7
Identity = 27/68 (39.71%), Postives = 35/68 (51.47%), Query Frame = 1
Query:   16 IVGGWGWSWWLVCEVQ-------------------------MLSLEVMTLTPKCEQVETSEGVPITVT 144
            + GGW W+WW V + Q                         +LSLE+MTL PKC+ VET+EGV +TVT
Sbjct:   28 VYGGWAWAWWCVSDTQRTQPAASYFCAIIELLCVTHNSLYILLSLEIMTLQPKCDDVETAEGVALTVT 95          
BLAST of Flotillin-2 vs. Ensembl Xenopus
Match: flot2 (flotillin 2 [Source:NCBI gene;Acc:496443])

HSP 1 Score: 375.941 bits (964), Expect = 2.637e-126
Identity = 208/350 (59.43%), Postives = 284/350 (81.14%), Query Frame = 3
Query:  153 LKYKGVAQVKVMNEENLLRVACEQFLGKKREDIANTILQTLEGHLRAILGTLTVEAVYQDRDQFAQLVREVASPDVSKMGIEILSFTIKDVYDKVEYLNSLGRAQTANVKKDADIGVAEAERDAGIREAECEKLRMNIRYQANTEIADAERNFNMQKAIFETQVNQQKAESELAYELQAAKEKQRIRTEEIQXXXXXXXXXXXXXXXXXLRRENDLIASVKKPAESEAYKIERTAEGYKVQQIFXXXXXXXXXXXXXXXXXXVIGEIGKAEASRMKLRAEAFKKYGKTAILNQIIDSMPRIAAEVTSPLQRTKNITIMDSGTGGSLATEVAKLLGSLPPTIQAITGIDIT 1202
            L   GVAQVK+M E  LL VA EQFLGK   +I N +LQTLEGHLR+ILGTLTVE +YQDRDQFA+LVREVA+PDV +MGIEILSFTIKDVYDKVEYL+SLG++QTA V++DADIGVAEAERDAGIREA C++  ++++Y A+T++AD++R F MQKA F  +VN +KAE++LAYELQAAKE+Q+IR EEI+IEVV++ KQI IEE E++R + +LIA+V++PAE+EAY++++ AEG KV+Q+  A+AEA+KI   G+AEA  I  IGKAEA +MKL+A A+++YG+ A +  +++ +P+IAA+V++PL +   I I+ SG    +  E+ +LL  +P ++QA+TG+D+T
Sbjct:   39 LYVTGVAQVKIMTERELLAVASEQFLGKNVHEIKNVVLQTLEGHLRSILGTLTVEQIYQDRDQFAKLVREVAAPDVGRMGIEILSFTIKDVYDKVEYLSSLGKSQTAAVRRDADIGVAEAERDAGIREALCKRETLDVKYLADTKMADSKREFEMQKAGFSQEVNTKKAEAQLAYELQAAKEQQKIRQEEIEIEVVQRKKQIDIEEKEIVRMDKELIATVRRPAEAEAYRMQQIAEGEKVKQVLYAQAEAEKIRKIGDAEAATIEAIGKAEAEKMKLKAGAYQQYGEAAKMAMVLECLPQIAAKVSAPLAKVDEIVIL-SGENSKITGEMNRLLAEVPASVQALTGVDLT 387          
BLAST of Flotillin-2 vs. Ensembl Xenopus
Match: flot2 (flotillin 2 [Source:NCBI gene;Acc:496443])

HSP 1 Score: 378.252 bits (970), Expect = 2.943e-126
Identity = 211/357 (59.10%), Postives = 287/357 (80.39%), Query Frame = 3
Query:  153 LKYKGVAQVKVMNEENLLRVACEQFLGKKREDIANTILQTLEGHLRAILGTLTVEAVYQDRDQFAQLVREVASPDVSKMGIEILSFTIKDVYDKVEYLNSLGRAQTANVKKDADIGVAEAERDAGIREAECEKLRMNIRYQANTEIADAERNFNMQKAIFETQVNQQKAESELAYELQAAKEKQRIRTEEIQXXXXXXXXXXXXXXXXXLRRENDLIASVKKPAESEAYKIERTAEGYKVQQIFXXXXXXXXXXXXXXXXXXVIGEIGKAEASRMKLRAEAFKKYGKTAILNQIIDSMPRIAAEVTSPLQRTKNITIMDSGTGGSLATEVAKLLGSLPPTIQAITGIDITNALSKIP 1223
            L   GVAQVK+M E  LL VA EQFLGK   +I N +LQTLEGHLR+ILGTLTVE +YQDRDQFA+LVREVA+PDV +MGIEILSFTIKDVYDKVEYL+SLG++QTA V++DADIGVAEAERDAGIREA C++  ++++Y A+T++AD++R F MQKA F  +VN +KAE++LAYELQAAKE+Q+IR EEI+IEVV++ KQI IEE E++R + +LIA+V++PAE+EAY++++ AEG KV+Q+  A+AEA+KI   G+AEA  I  IGKAEA +MKL+A A+++YG+ A +  +++ +P+IAA+V++PL +   I I+ SG    +  E+ +LL  +P ++QA+TG+D+T    KIP
Sbjct:  118 LTVTGVAQVKIMTERELLAVASEQFLGKNVHEIKNVVLQTLEGHLRSILGTLTVEQIYQDRDQFAKLVREVAAPDVGRMGIEILSFTIKDVYDKVEYLSSLGKSQTAAVRRDADIGVAEAERDAGIREALCKRETLDVKYLADTKMADSKREFEMQKAGFSQEVNTKKAEAQLAYELQAAKEQQKIRQEEIEIEVVQRKKQIDIEEKEIVRMDKELIATVRRPAEAEAYRMQQIAEGEKVKQVLYAQAEAEKIRKIGDAEAATIEAIGKAEAEKMKLKAGAYQQYGEAAKMAMVLECLPQIAAKVSAPLAKVDEIVIL-SGENSKITGEMNRLLAEVPASVQALTGVDLT----KIP 469          

HSP 2 Score: 61.6178 bits (148), Expect = 1.485e-9
Identity = 26/43 (60.47%), Postives = 33/43 (76.74%), Query Frame = 1
Query:   16 IVGGWGWSWWLVCEVQMLSLEVMTLTPKCEQVETSEGVPITVT 144
            + GGW W+WW V + Q LSLEVMT+  +CE +ETSEGVP+ VT
Sbjct:   36 VYGGWAWAWWCVSDTQRLSLEVMTILCRCENIETSEGVPLYVT 78          
BLAST of Flotillin-2 vs. Ensembl Mouse
Match: Flot2 (flotillin 2 [Source:MGI Symbol;Acc:MGI:103309])

HSP 1 Score: 390.963 bits (1003), Expect = 9.051e-133
Identity = 213/357 (59.66%), Postives = 290/357 (81.23%), Query Frame = 3
Query:  153 LKYKGVAQVKVMNEENLLRVACEQFLGKKREDIANTILQTLEGHLRAILGTLTVEAVYQDRDQFAQLVREVASPDVSKMGIEILSFTIKDVYDKVEYLNSLGRAQTANVKKDADIGVAEAERDAGIREAECEKLRMNIRYQANTEIADAERNFNMQKAIFETQVNQQKAESELAYELQAAKEKQRIRTEEIQXXXXXXXXXXXXXXXXXLRRENDLIASVKKPAESEAYKIERTAEGYKVQQIFXXXXXXXXXXXXXXXXXXVIGEIGKAEASRMKLRAEAFKKYGKTAILNQIIDSMPRIAAEVTSPLQRTKNITIMDSGTGGSLATEVAKLLGSLPPTIQAITGIDITNALSKIP 1223
            L   GVAQVK+M E+ LL VACEQFLGK  +DI N +LQTLEGHLR+ILGTLTVE +YQDRDQFA+LVREVA+PDV +MGIEILSFTIKDVYDKV+YL+SLG+ QTA V++DADIGVAEAERDAGIREAEC+K  +++++ A+T+IAD++R F +QK+ F  +VN + AE++LAYELQ A+E+Q+IR EEI+IEVV++ KQI +E  E+LR + +LIA+V++PAE+EA++I++ AEG KV+Q+ LA+AEA+KI   GEAEA VI  +GKAEA RMKL+AEA++KYG  A +  +++++P+IAA++++PL +   I ++ SG    + +EV +LL  LP ++ A+TG+D    LSKIP
Sbjct:   18 LTVTGVAQVKIMTEKELLAVACEQFLGKNVQDIKNVVLQTLEGHLRSILGTLTVEQIYQDRDQFAKLVREVAAPDVGRMGIEILSFTIKDVYDKVDYLSSLGKTQTAVVQRDADIGVAEAERDAGIREAECKKEMLDVKFMADTKIADSKRAFELQKSAFSEEVNIKTAEAQLAYELQGAREQQKIRQEEIEIEVVQRKKQIAVEAQEILRTDKELIATVRRPAEAEAHRIQQIAEGEKVKQVLLAQAEAEKIRKIGEAEAAVIEAMGKAEAERMKLKAEAYQKYGDAAKMALVLEALPQIAAKISAPLTKVDEIVVL-SGDNSKVTSEVNRLLAELPASVHALTGVD----LSKIP 369          
BLAST of Flotillin-2 vs. Ensembl Mouse
Match: Flot2 (flotillin 2 [Source:MGI Symbol;Acc:MGI:103309])

HSP 1 Score: 389.808 bits (1000), Expect = 1.539e-131
Identity = 213/357 (59.66%), Postives = 290/357 (81.23%), Query Frame = 3
Query:  153 LKYKGVAQVKVMNEENLLRVACEQFLGKKREDIANTILQTLEGHLRAILGTLTVEAVYQDRDQFAQLVREVASPDVSKMGIEILSFTIKDVYDKVEYLNSLGRAQTANVKKDADIGVAEAERDAGIREAECEKLRMNIRYQANTEIADAERNFNMQKAIFETQVNQQKAESELAYELQAAKEKQRIRTEEIQXXXXXXXXXXXXXXXXXLRRENDLIASVKKPAESEAYKIERTAEGYKVQQIFXXXXXXXXXXXXXXXXXXVIGEIGKAEASRMKLRAEAFKKYGKTAILNQIIDSMPRIAAEVTSPLQRTKNITIMDSGTGGSLATEVAKLLGSLPPTIQAITGIDITNALSKIP 1223
            L   GVAQVK+M E+ LL VACEQFLGK  +DI N +LQTLEGHLR+ILGTLTVE +YQDRDQFA+LVREVA+PDV +MGIEILSFTIKDVYDKV+YL+SLG+ QTA V++DADIGVAEAERDAGIREAEC+K  +++++ A+T+IAD++R F +QK+ F  +VN + AE++LAYELQ A+E+Q+IR EEI+IEVV++ KQI +E  E+LR + +LIA+V++PAE+EA++I++ AEG KV+Q+ LA+AEA+KI   GEAEA VI  +GKAEA RMKL+AEA++KYG  A +  +++++P+IAA++++PL +   I ++ SG    + +EV +LL  LP ++ A+TG+D    LSKIP
Sbjct:   67 LTVTGVAQVKIMTEKELLAVACEQFLGKNVQDIKNVVLQTLEGHLRSILGTLTVEQIYQDRDQFAKLVREVAAPDVGRMGIEILSFTIKDVYDKVDYLSSLGKTQTAVVQRDADIGVAEAERDAGIREAECKKEMLDVKFMADTKIADSKRAFELQKSAFSEEVNIKTAEAQLAYELQGAREQQKIRQEEIEIEVVQRKKQIAVEAQEILRTDKELIATVRRPAEAEAHRIQQIAEGEKVKQVLLAQAEAEKIRKIGEAEAAVIEAMGKAEAERMKLKAEAYQKYGDAAKMALVLEALPQIAAKISAPLTKVDEIVVL-SGDNSKVTSEVNRLLAELPASVHALTGVD----LSKIP 418          

HSP 2 Score: 65.4698 bits (158), Expect = 7.221e-11
Identity = 25/43 (58.14%), Postives = 34/43 (79.07%), Query Frame = 1
Query:   16 IVGGWGWSWWLVCEVQMLSLEVMTLTPKCEQVETSEGVPITVT 144
            + GGW W+WW + + Q +SLE+MTL P+CE VET+EGV +TVT
Sbjct:   28 VFGGWAWAWWCISDTQRISLEIMTLQPRCEDVETAEGVALTVT 70          
BLAST of Flotillin-2 vs. Ensembl Mouse
Match: Flot2 (flotillin 2 [Source:MGI Symbol;Acc:MGI:103309])

HSP 1 Score: 389.037 bits (998), Expect = 3.049e-131
Identity = 212/353 (60.06%), Postives = 289/353 (81.87%), Query Frame = 3
Query:  165 GVAQVKVMNEENLLRVACEQFLGKKREDIANTILQTLEGHLRAILGTLTVEAVYQDRDQFAQLVREVASPDVSKMGIEILSFTIKDVYDKVEYLNSLGRAQTANVKKDADIGVAEAERDAGIREAECEKLRMNIRYQANTEIADAERNFNMQKAIFETQVNQQKAESELAYELQAAKEKQRIRTEEIQXXXXXXXXXXXXXXXXXLRRENDLIASVKKPAESEAYKIERTAEGYKVQQIFXXXXXXXXXXXXXXXXXXVIGEIGKAEASRMKLRAEAFKKYGKTAILNQIIDSMPRIAAEVTSPLQRTKNITIMDSGTGGSLATEVAKLLGSLPPTIQAITGIDITNALSKIP 1223
            GVAQVK+M E+ LL VACEQFLGK  +DI N +LQTLEGHLR+ILGTLTVE +YQDRDQFA+LVREVA+PDV +MGIEILSFTIKDVYDKV+YL+SLG+ QTA V++DADIGVAEAERDAGIREAEC+K  +++++ A+T+IAD++R F +QK+ F  +VN + AE++LAYELQ A+E+Q+IR EEI+IEVV++ KQI +E  E+LR + +LIA+V++PAE+EA++I++ AEG KV+Q+ LA+AEA+KI   GEAEA VI  +GKAEA RMKL+AEA++KYG  A +  +++++P+IAA++++PL +   I ++ SG    + +EV +LL  LP ++ A+TG+D    LSKIP
Sbjct:   71 GVAQVKIMTEKELLAVACEQFLGKNVQDIKNVVLQTLEGHLRSILGTLTVEQIYQDRDQFAKLVREVAAPDVGRMGIEILSFTIKDVYDKVDYLSSLGKTQTAVVQRDADIGVAEAERDAGIREAECKKEMLDVKFMADTKIADSKRAFELQKSAFSEEVNIKTAEAQLAYELQGAREQQKIRQEEIEIEVVQRKKQIAVEAQEILRTDKELIATVRRPAEAEAHRIQQIAEGEKVKQVLLAQAEAEKIRKIGEAEAAVIEAMGKAEAERMKLKAEAYQKYGDAAKMALVLEALPQIAAKISAPLTKVDEIVVL-SGDNSKVTSEVNRLLAELPASVHALTGVD----LSKIP 418          

HSP 2 Score: 61.6178 bits (148), Expect = 1.033e-9
Identity = 25/43 (58.14%), Postives = 33/43 (76.74%), Query Frame = 1
Query:   16 IVGGWGWSWWLVCEVQMLSLEVMTLTPKCEQVETSEGVPITVT 144
            + GGW W+WW + + Q LSLEVMT+  +CE +ETSEGVP+ VT
Sbjct:   28 VFGGWAWAWWCISDTQRLSLEVMTILCRCENIETSEGVPLFVT 70          
BLAST of Flotillin-2 vs. Ensembl Mouse
Match: Flot1 (flotillin 1 [Source:MGI Symbol;Acc:MGI:1100500])

HSP 1 Score: 266.929 bits (681), Expect = 9.840e-84
Identity = 154/358 (43.02%), Postives = 253/358 (70.67%), Query Frame = 3
Query:  165 GVAQVKVMNE-ENLLRVACEQFLGKKREDIANTILQTLEGHLRAILGTLTVEAVYQDRDQFAQLVREVASPDVSKMGIEILSFTIKDVYDKVEYLNSLGRAQTANVKKDADIGVAEAERDAGIREAECEKLRMNIRYQANTEIADAERNFNMQKAIFETQVNQQKAESELAYELQAAKEKQRIRTEEIQXXXXXXXXXXXXXXXXXLRRENDLIASVKKPAESEAYKIERTAEGYKVQQIFXXXXXXXXXXXXXXXXXXVIGEIGKAEASRMKLRAEAFKKYGKTAILNQIIDSMPRIAAEVTSPLQRTKNITIMDSGTG----GSLATEVAKLLGSLPPTIQAITGIDITNALSKIP 1223
            G+AQVK+  + + +L  AC+ FLGK   +IA+  L+TLEGH RAI+  +TVE +Y+DR +F++ V +VAS D+  MGI ++S+T+KD++D  +YL+SLG+A+TA V+KDA IG AEA+RDAGIREA+ ++ +++ +  +  E+A A+R++ ++KA ++ +VN ++A+++LAY+LQ AK KQ+I  + +Q++VVE+ +Q+ ++E E+ RRE +L A V+KPAE+E Y++ER AE  K Q I  A+AEA+ + ++GEAEA  IG   +AEA +M  +AEAF+ Y + A L+ +++ +P++A E++ PL     IT++ SG+G      +  EV  +L  LP +++ +TG+ I+      P
Sbjct:   67 GIAQVKIQGQNKEMLAAACQMFLGKTEAEIAHIALETLEGHQRAIMAHMTVEEIYKDRQKFSEQVFKVASSDLVNMGISVVSYTLKDIHDDQDYLHSLGKARTAQVQKDARIGEAEAKRDAGIREAKAKQEKVSAQCLSEIEMAKAQRDYELKKATYDIEVNTRRAQADLAYQLQVAKTKQQIEEQRVQVQVVERAQQVAVQEQEIARREKELEARVRKPAEAERYRLERLAEAEKAQLIMQAEAEAESVRMRGEAEAFAIGARARAEAEQMAKKAEAFQMYQEAAQLDMLLEKLPQVAEEISGPLTSANKITLVSSGSGTMGAAKVTGEVLDILSRLPESVERLTGVSISQVNHNKP 424          
BLAST of Flotillin-2 vs. Ensembl Mouse
Match: Flot1 (flotillin 1 [Source:MGI Symbol;Acc:MGI:1100500])

HSP 1 Score: 215.698 bits (548), Expect = 8.814e-65
Identity = 128/305 (41.97%), Postives = 216/305 (70.82%), Query Frame = 3
Query:  321 VYQDRDQFAQLVREVASPDVSKMGIEILSFTIKDVYDKVEYLNSLGRAQTANVKKDADIGVAEAERDAGIREAECEKLRMNIRYQANTEIADAERNFNMQKAIFETQVNQQKAESELAYELQAAKEKQRIRTEEIQXXXXXXXXXXXXXXXXXLRRENDLIASVKKPAESEAYKIERTAEGYKVQQIFXXXXXXXXXXXXXXXXXXVIGEIGKAEASRMKLRAEAFKKYGKTAILNQIIDSMPRIAAEVTSPLQRTKNITIMDSGTG----GSLATEVAKLLGSLPPTIQAITGIDITNALSKIP 1223
            +Y+DR +F++ V +VAS D+  MGI ++S+T+KD++D  +YL+SLG+A+TA V+KDA IG AEA+RDAGIREA+ ++ +++ +  +  E+A A+R++ ++KA ++ +VN ++A+++LAY+LQ AK KQ+I  + +Q++VVE+ +Q+ ++E E+ RRE +L A V+KPAE+E Y++ER AE  K Q I  A+AEA+ + ++GEAEA  IG   +AEA +M  +AEAF+ Y + A L+ +++ +P++A E++ PL     IT++ SG+G      +  EV  +L  LP +++ +TG+ I+      P
Sbjct:   72 IYKDRQKFSEQVFKVASSDLVNMGISVVSYTLKDIHDDQDYLHSLGKARTAQVQKDARIGEAEAKRDAGIREAKAKQEKVSAQCLSEIEMAKAQRDYELKKATYDIEVNTRRAQADLAYQLQVAKTKQQIEEQRVQVQVVERAQQVAVQEQEIARREKELEARVRKPAEAERYRLERLAEAEKAQLIMQAEAEAESVRMRGEAEAFAIGARARAEAEQMAKKAEAFQMYQEAAQLDMLLEKLPQVAEEISGPLTSANKITLVSSGSGTMGAAKVTGEVLDILSRLPESVERLTGVSISQVNHNKP 376          
BLAST of Flotillin-2 vs. UniProt/SwissProt
Match: sp|A6QLR4|FLOT2_BOVIN (Flotillin-2 OS=Bos taurus OX=9913 GN=FLOT2 PE=2 SV=1)

HSP 1 Score: 389.808 bits (1000), Expect = 9.763e-131
Identity = 215/357 (60.22%), Postives = 287/357 (80.39%), Query Frame = 3
Query:  153 LKYKGVAQVKVMNEENLLRVACEQFLGKKREDIANTILQTLEGHLRAILGTLTVEAVYQDRDQFAQLVREVASPDVSKMGIEILSFTIKDVYDKVEYLNSLGRAQTANVKKDADIGVAEAERDAGIREAECEKLRMNIRYQANTEIADAERNFNMQKAIFETQVNQQKAESELAYELQAAKEKQRIRTEEIQXXXXXXXXXXXXXXXXXLRRENDLIASVKKPAESEAYKIERTAEGYKVQQIFXXXXXXXXXXXXXXXXXXVIGEIGKAEASRMKLRAEAFKKYGKTAILNQIIDSMPRIAAEVTSPLQRTKNITIMDSGTGGSLATEVAKLLGSLPPTIQAITGIDITNALSKIP 1223
            L   GVAQVK+M E+ LL VACEQFLGK  +DI N +LQTLEGHLR+ILGTLTVE +YQDRDQFA+LVREVA+PDV +MGIEILSFTIKDVYDKV+YL+SLG+ QTA V++DADIGVAEAERDAGIREAEC+K  +++++ A+T+IAD++R F +QK+ F  +VN + AE++LAYELQ A+E+Q+IR EEI+IEVV++ KQI +E  E+LR + +LIA+V+ PAE+EA++I++ AEG KV+Q+ LA+AEA+KI   GEAEA VI   GKAEA RMKL+AEA++KYG  A +  ++D++PRIAA++ +PL +   I ++ SG    + +EV +LL  LP ++ A+TG+D    LSKIP
Sbjct:   67 LTVTGVAQVKIMTEKELLAVACEQFLGKSVQDIKNVVLQTLEGHLRSILGTLTVEQIYQDRDQFAKLVREVAAPDVGRMGIEILSFTIKDVYDKVDYLSSLGKTQTAVVQRDADIGVAEAERDAGIREAECKKEMLDVKFMADTKIADSKRAFELQKSAFSEEVNIKTAEAQLAYELQGAREQQKIRQEEIEIEVVQRKKQIAVEAQEILRTDKELIATVRCPAEAEAHRIQQIAEGEKVKQVLLAQAEAEKIRKIGEAEAAVIEARGKAEAERMKLKAEAYQKYGDAAKMALVLDALPRIAAKIAAPLTKVDEIVVL-SGDNSKVTSEVNRLLAELPASVHALTGVD----LSKIP 418          

HSP 2 Score: 65.4698 bits (158), Expect = 5.051e-10
Identity = 25/43 (58.14%), Postives = 34/43 (79.07%), Query Frame = 1
Query:   16 IVGGWGWSWWLVCEVQMLSLEVMTLTPKCEQVETSEGVPITVT 144
            + GGW W+WW + + Q +SLE+MTL P+CE VET+EGV +TVT
Sbjct:   28 VFGGWAWAWWCISDTQRISLEIMTLQPRCEDVETAEGVALTVT 70          
BLAST of Flotillin-2 vs. UniProt/SwissProt
Match: sp|Q9Z2S9|FLOT2_RAT (Flotillin-2 OS=Rattus norvegicus OX=10116 GN=Flot2 PE=1 SV=1)

HSP 1 Score: 389.808 bits (1000), Expect = 1.076e-130
Identity = 213/357 (59.66%), Postives = 290/357 (81.23%), Query Frame = 3
Query:  153 LKYKGVAQVKVMNEENLLRVACEQFLGKKREDIANTILQTLEGHLRAILGTLTVEAVYQDRDQFAQLVREVASPDVSKMGIEILSFTIKDVYDKVEYLNSLGRAQTANVKKDADIGVAEAERDAGIREAECEKLRMNIRYQANTEIADAERNFNMQKAIFETQVNQQKAESELAYELQAAKEKQRIRTEEIQXXXXXXXXXXXXXXXXXLRRENDLIASVKKPAESEAYKIERTAEGYKVQQIFXXXXXXXXXXXXXXXXXXVIGEIGKAEASRMKLRAEAFKKYGKTAILNQIIDSMPRIAAEVTSPLQRTKNITIMDSGTGGSLATEVAKLLGSLPPTIQAITGIDITNALSKIP 1223
            L   GVAQVK+M E+ LL VACEQFLGK  +DI N +LQTLEGHLR+ILGTLTVE +YQDRDQFA+LVREVA+PDV +MGIEILSFTIKDVYDKV+YL+SLG+ QTA V++DADIGVAEAERDAGIREAEC+K  +++++ A+T+IAD++R F +QK+ F  +VN + AE++LAYELQ A+E+Q+IR EEI+IEVV++ KQI +E  E+LR + +LIA+V++PAE+EA++I++ AEG KV+Q+ LA+AEA+KI   GEAEA VI  +GKAEA RMKL+AEA++KYG  A +  +++++P+IAA++++PL +   I ++ SG    + +EV +LL  LP ++ A+TG+D    LSKIP
Sbjct:   67 LTVTGVAQVKIMTEKELLAVACEQFLGKNVQDIKNVVLQTLEGHLRSILGTLTVEQIYQDRDQFAKLVREVAAPDVGRMGIEILSFTIKDVYDKVDYLSSLGKTQTAVVQRDADIGVAEAERDAGIREAECKKEMLDVKFMADTKIADSKRAFELQKSAFSEEVNIKTAEAQLAYELQGAREQQKIRQEEIEIEVVQRKKQIAVEAQEILRTDKELIATVRRPAEAEAHRIQQIAEGEKVKQVLLAQAEAEKIRKIGEAEAAVIEAMGKAEAERMKLKAEAYQKYGDAAKMALVLEALPQIAAKISAPLTKVDEIVVL-SGDNSKVTSEVNRLLAELPASVHALTGVD----LSKIP 418          

HSP 2 Score: 65.4698 bits (158), Expect = 5.051e-10
Identity = 25/43 (58.14%), Postives = 34/43 (79.07%), Query Frame = 1
Query:   16 IVGGWGWSWWLVCEVQMLSLEVMTLTPKCEQVETSEGVPITVT 144
            + GGW W+WW + + Q +SLE+MTL P+CE VET+EGV +TVT
Sbjct:   28 VFGGWAWAWWCISDTQRISLEIMTLQPRCEDVETAEGVALTVT 70          
BLAST of Flotillin-2 vs. UniProt/SwissProt
Match: sp|Q60634|FLOT2_MOUSE (Flotillin-2 OS=Mus musculus OX=10090 GN=Flot2 PE=1 SV=2)

HSP 1 Score: 389.808 bits (1000), Expect = 1.076e-130
Identity = 213/357 (59.66%), Postives = 290/357 (81.23%), Query Frame = 3
Query:  153 LKYKGVAQVKVMNEENLLRVACEQFLGKKREDIANTILQTLEGHLRAILGTLTVEAVYQDRDQFAQLVREVASPDVSKMGIEILSFTIKDVYDKVEYLNSLGRAQTANVKKDADIGVAEAERDAGIREAECEKLRMNIRYQANTEIADAERNFNMQKAIFETQVNQQKAESELAYELQAAKEKQRIRTEEIQXXXXXXXXXXXXXXXXXLRRENDLIASVKKPAESEAYKIERTAEGYKVQQIFXXXXXXXXXXXXXXXXXXVIGEIGKAEASRMKLRAEAFKKYGKTAILNQIIDSMPRIAAEVTSPLQRTKNITIMDSGTGGSLATEVAKLLGSLPPTIQAITGIDITNALSKIP 1223
            L   GVAQVK+M E+ LL VACEQFLGK  +DI N +LQTLEGHLR+ILGTLTVE +YQDRDQFA+LVREVA+PDV +MGIEILSFTIKDVYDKV+YL+SLG+ QTA V++DADIGVAEAERDAGIREAEC+K  +++++ A+T+IAD++R F +QK+ F  +VN + AE++LAYELQ A+E+Q+IR EEI+IEVV++ KQI +E  E+LR + +LIA+V++PAE+EA++I++ AEG KV+Q+ LA+AEA+KI   GEAEA VI  +GKAEA RMKL+AEA++KYG  A +  +++++P+IAA++++PL +   I ++ SG    + +EV +LL  LP ++ A+TG+D    LSKIP
Sbjct:   67 LTVTGVAQVKIMTEKELLAVACEQFLGKNVQDIKNVVLQTLEGHLRSILGTLTVEQIYQDRDQFAKLVREVAAPDVGRMGIEILSFTIKDVYDKVDYLSSLGKTQTAVVQRDADIGVAEAERDAGIREAECKKEMLDVKFMADTKIADSKRAFELQKSAFSEEVNIKTAEAQLAYELQGAREQQKIRQEEIEIEVVQRKKQIAVEAQEILRTDKELIATVRRPAEAEAHRIQQIAEGEKVKQVLLAQAEAEKIRKIGEAEAAVIEAMGKAEAERMKLKAEAYQKYGDAAKMALVLEALPQIAAKISAPLTKVDEIVVL-SGDNSKVTSEVNRLLAELPASVHALTGVD----LSKIP 418          

HSP 2 Score: 65.4698 bits (158), Expect = 5.051e-10
Identity = 25/43 (58.14%), Postives = 34/43 (79.07%), Query Frame = 1
Query:   16 IVGGWGWSWWLVCEVQMLSLEVMTLTPKCEQVETSEGVPITVT 144
            + GGW W+WW + + Q +SLE+MTL P+CE VET+EGV +TVT
Sbjct:   28 VFGGWAWAWWCISDTQRISLEIMTLQPRCEDVETAEGVALTVT 70          
BLAST of Flotillin-2 vs. UniProt/SwissProt
Match: sp|Q14254|FLOT2_HUMAN (Flotillin-2 OS=Homo sapiens OX=9606 GN=FLOT2 PE=1 SV=2)

HSP 1 Score: 389.037 bits (998), Expect = 1.812e-130
Identity = 213/357 (59.66%), Postives = 289/357 (80.95%), Query Frame = 3
Query:  153 LKYKGVAQVKVMNEENLLRVACEQFLGKKREDIANTILQTLEGHLRAILGTLTVEAVYQDRDQFAQLVREVASPDVSKMGIEILSFTIKDVYDKVEYLNSLGRAQTANVKKDADIGVAEAERDAGIREAECEKLRMNIRYQANTEIADAERNFNMQKAIFETQVNQQKAESELAYELQAAKEKQRIRTEEIQXXXXXXXXXXXXXXXXXLRRENDLIASVKKPAESEAYKIERTAEGYKVQQIFXXXXXXXXXXXXXXXXXXVIGEIGKAEASRMKLRAEAFKKYGKTAILNQIIDSMPRIAAEVTSPLQRTKNITIMDSGTGGSLATEVAKLLGSLPPTIQAITGIDITNALSKIP 1223
            L   GVAQVK+M E+ LL VACEQFLGK  +DI N +LQTLEGHLR+ILGTLTVE +YQDRDQFA+LVREVA+PDV +MGIEILSFTIKDVYDKV+YL+SLG+ QTA V++DADIGVAEAERDAGIREAEC+K  +++++ A+T+IAD++R F +QK+ F  +VN + AE++LAYELQ A+E+Q+IR EEI+IEVV++ KQI +E  E+LR + +LIA+V++PAE+EA++I++ AEG KV+Q+ LA+AEA+KI   GEAEA VI  +GKAEA RMKL+AEA++KYG  A +  +++++P+IAA++ +PL +   I ++ SG    + +EV +LL  LP ++ A+TG+D    LSKIP
Sbjct:   67 LTVTGVAQVKIMTEKELLAVACEQFLGKNVQDIKNVVLQTLEGHLRSILGTLTVEQIYQDRDQFAKLVREVAAPDVGRMGIEILSFTIKDVYDKVDYLSSLGKTQTAVVQRDADIGVAEAERDAGIREAECKKEMLDVKFMADTKIADSKRAFELQKSAFSEEVNIKTAEAQLAYELQGAREQQKIRQEEIEIEVVQRKKQIAVEAQEILRTDKELIATVRRPAEAEAHRIQQIAEGEKVKQVLLAQAEAEKIRKIGEAEAAVIEAMGKAEAERMKLKAEAYQKYGDAAKMALVLEALPQIAAKIAAPLTKVDEIVVL-SGDNSKVTSEVNRLLAELPASVHALTGVD----LSKIP 418          

HSP 2 Score: 65.4698 bits (158), Expect = 5.006e-10
Identity = 25/43 (58.14%), Postives = 34/43 (79.07%), Query Frame = 1
Query:   16 IVGGWGWSWWLVCEVQMLSLEVMTLTPKCEQVETSEGVPITVT 144
            + GGW W+WW + + Q +SLE+MTL P+CE VET+EGV +TVT
Sbjct:   28 VFGGWAWAWWCISDTQRISLEIMTLQPRCEDVETAEGVALTVT 70          
BLAST of Flotillin-2 vs. UniProt/SwissProt
Match: sp|Q98TZ8|FLOT2_DANRE (Flotillin-2a OS=Danio rerio OX=7955 GN=flot2a PE=2 SV=2)

HSP 1 Score: 385.571 bits (989), Expect = 4.852e-129
Identity = 216/353 (61.19%), Postives = 288/353 (81.59%), Query Frame = 3
Query:  165 GVAQVKVMNEENLLRVACEQFLGKKREDIANTILQTLEGHLRAILGTLTVEAVYQDRDQFAQLVREVASPDVSKMGIEILSFTIKDVYDKVEYLNSLGRAQTANVKKDADIGVAEAERDAGIREAECEKLRMNIRYQANTEIADAERNFNMQKAIFETQVNQQKAESELAYELQAAKEKQRIRTEEIQXXXXXXXXXXXXXXXXXLRRENDLIASVKKPAESEAYKIERTAEGYKVQQIFXXXXXXXXXXXXXXXXXXVIGEIGKAEASRMKLRAEAFKKYGKTAILNQIIDSMPRIAAEVTSPLQRTKNITIMDSGTGGSLATEVAKLLGSLPPTIQAITGIDITNALSKIP 1223
            GVAQVKVM +  LL  ACEQFLGK   +I + ILQTLEGHLR+ILGTLTVE +YQDRDQFA+LVREVA+PDV +MGIEILSFTIKDVYDKV+YL+SLG++QTA V++DADIGVAEAERDAGIREAEC+K  M+I++QA+T++AD++R   MQKA F  +VN +KAE++LAYELQAAKE+Q+IR EEI+IEVV++ KQI IEE E+LR + +LIA+V++PAE+EA+K+E+ AE  K++++  A+AEA+KI+  GEAEA  I  +GKAEA +M+L+AEA+++YG+ A    +++++P+IA +V +PL RT  I I+ SG GG +  EV +LL  LP ++ A+TG+D    LSKIP
Sbjct:   71 GVAQVKVMTDNELLGYACEQFLGKTVTEIKSVILQTLEGHLRSILGTLTVEQIYQDRDQFAKLVREVAAPDVGRMGIEILSFTIKDVYDKVDYLSSLGKSQTAAVQRDADIGVAEAERDAGIREAECKKEMMDIKFQADTKMADSKRELEMQKAAFNQEVNTKKAEAQLAYELQAAKEQQKIRLEEIEIEVVQRKKQISIEEKEILRTDKELIATVRRPAEAEAFKMEQLAEAKKIKKVLTAQAEAEKIKRIGEAEAGSIEAVGKAEAEKMRLKAEAYQQYGEAAKTALVLEALPKIAGKVAAPLGRTNEIVIL-SGDGGRVTGEVNRLLAELPVSVNALTGVD----LSKIP 418          

HSP 2 Score: 69.707 bits (169), Expect = 1.878e-11
Identity = 28/42 (66.67%), Postives = 36/42 (85.71%), Query Frame = 1
Query:   19 VGGWGWSWWLVCEVQMLSLEVMTLTPKCEQVETSEGVPITVT 144
            VGGW W+WWL+ ++Q ++LE+MTL PKCE VET+EGV ITVT
Sbjct:   29 VGGWAWAWWLITDIQKITLEIMTLQPKCEDVETAEGVAITVT 70          
BLAST of Flotillin-2 vs. TrEMBL
Match: A0A068CL83 (Flotillin-2 OS=Dugesia japonica OX=6161 PE=2 SV=1)

HSP 1 Score: 429.098 bits (1102), Expect = 1.058e-143
Identity = 235/365 (64.38%), Postives = 296/365 (81.10%), Query Frame = 3
Query:  153 LKYKGVAQVKVMNEENLLRVACEQFLGKKREDIANTILQTLEGHLRAILGTLTVEAVYQDRDQFAQLVREVASPDVSKMGIEILSFTIKDVYDKVEYLNSLGRAQTANVKKDADIGVAEAERDAGIREAECEKLRMNIRYQANTEIADAERNFNMQKAIFETQVNQQKAESELAYELQAAKEKQRIRTEEIQXXXXXXXXXXXXXXXXXLRRENDLIASVKKPAESEAYKIERTAEGYKVQQIFXXXXXXXXXXXXXXXXXXVIGEIGKAEASRMKLRAEAFKKYGKTAILNQIIDSMPRIAAEVTSPLQRTKNITIMDSGTG--GSLATEVAKLLGSLPPTIQAITGIDITNALSKIPGAEIVA 1241
            L   GVAQVKVM E +LL  ACEQFLG++R +I  TILQTL+GHLRAILGTLTVEA+YQDRDQFA  VREVA+PDV+KMGIEILSFTIKDVYDKVEYLNSLGRAQTA VK+DADIGVAEAERDAGIREAECEK RM++RY+A+TEIA+A R F +QKA F+ +V + +AE+ELA+ELQAAKEKQ+IR+EEIQIEVVE+ K I IEE E+LR E +L  +VKKPAE+EA+K E  A+  + +Q+ LA+ EA+ I LKG AEA  +  IGKAEA RM+L+A A+ KYG  AIL+ ++D++P++AAEV +PL +T  I I+ SG+        E+ KLLG+LPP +QA+TG+DI+ A+ +IPGA +++
Sbjct:   67 LTVTGVAQVKVMTEPSLLATACEQFLGRRRSEIEETILQTLDGHLRAILGTLTVEAIYQDRDQFAHQVREVAAPDVAKMGIEILSFTIKDVYDKVEYLNSLGRAQTAIVKRDADIGVAEAERDAGIREAECEKARMDVRYEADTEIANATRGFQLQKASFDAEVFKVRAEAELAFELQAAKEKQKIRSEEIQIEVVERKKLIEIEEKEILRNEKELDGTVKKPAEAEAFKTEILADARRTKQVLLAQGEAEAIRLKGHAEASSLSAIGKAEAERMRLKAAAYNKYGDAAILSLVLDALPKVAAEVAAPLAKTNEIVILGSGSDSKSDFTGEITKLLGNLPPAVQAMTGVDISQAVRQIPGARVIS 431          

HSP 2 Score: 79.7221 bits (195), Expect = 3.387e-12
Identity = 34/46 (73.91%), Postives = 40/46 (86.96%), Query Frame = 1
Query:    7 VKTIVGGWGWSWWLVCEVQMLSLEVMTLTPKCEQVETSEGVPITVT 144
            +KTI+GGWGW+WWLV +VQ +SLEVMTL P CE VET EGVP+TVT
Sbjct:   25 MKTIIGGWGWAWWLVSQVQKISLEVMTLNPTCEHVETKEGVPLTVT 70          
BLAST of Flotillin-2 vs. TrEMBL
Match: V9XMS7 (Flotillin-2 OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 429.098 bits (1102), Expect = 1.287e-143
Identity = 234/365 (64.11%), Postives = 298/365 (81.64%), Query Frame = 3
Query:  153 LKYKGVAQVKVMNEENLLRVACEQFLGKKREDIANTILQTLEGHLRAILGTLTVEAVYQDRDQFAQLVREVASPDVSKMGIEILSFTIKDVYDKVEYLNSLGRAQTANVKKDADIGVAEAERDAGIREAECEKLRMNIRYQANTEIADAERNFNMQKAIFETQVNQQKAESELAYELQAAKEKQRIRTEEIQXXXXXXXXXXXXXXXXXLRRENDLIASVKKPAESEAYKIERTAEGYKVQQIFXXXXXXXXXXXXXXXXXXVIGEIGKAEASRMKLRAEAFKKYGKTAILNQIIDSMPRIAAEVTSPLQRTKNITIMDSGTG--GSLATEVAKLLGSLPPTIQAITGIDITNALSKIPGAEIVA 1241
            L   GVAQVKVM E +LL  ACEQFLG++R +I  TILQTL+GHLRAILGTLTVEA+YQDRDQFA  VREVA+PDV+KMGIEILSFTIKDVYDKVEYLNSLGRAQTA VK+DADIGVAEAERDAGIREAECEK RM+IRY+A+TEIA+A + + +QKA F+ +V + +AE+ELA+ELQAAKEKQ+IR+EEIQIEVVE+ K I IEE E+LR E +L  +VKKPAE+EA+K E  A+  + +Q+ LA+ EA+ I LKG AEA  +  IGKAEA RM+L+A A+ KYG  AIL+ ++D++P++AAE+T+PL +T  I I+ SG+     L  E+ +LLG+LPP +QA+TG+DI+ A+ +IPGA +++
Sbjct:   67 LTVTGVAQVKVMTEPSLLATACEQFLGRRRSEIEETILQTLDGHLRAILGTLTVEAIYQDRDQFAHQVREVAAPDVAKMGIEILSFTIKDVYDKVEYLNSLGRAQTAIVKRDADIGVAEAERDAGIREAECEKARMDIRYEADTEIANATKGYQLQKASFDAEVFKVRAEAELAFELQAAKEKQKIRSEEIQIEVVERKKLIEIEEKEILRNEKELEGTVKKPAEAEAFKTEVLADARRTKQVLLAQGEAESIRLKGHAEASSLSAIGKAEAERMRLKAAAYNKYGDAAILSLVLDALPKVAAEITAPLAKTNEIVILGSGSDSKSDLTGEITRLLGNLPPAVQAMTGVDISQAVRQIPGARVIS 431          

HSP 2 Score: 79.7221 bits (195), Expect = 3.705e-12
Identity = 34/46 (73.91%), Postives = 40/46 (86.96%), Query Frame = 1
Query:    7 VKTIVGGWGWSWWLVCEVQMLSLEVMTLTPKCEQVETSEGVPITVT 144
            +KTI+GGWGW+WWLV +VQ +SLEVMTL P CE VET EGVP+TVT
Sbjct:   25 MKTIIGGWGWAWWLVSQVQKISLEVMTLNPTCEHVETKEGVPLTVT 70          
BLAST of Flotillin-2 vs. TrEMBL
Match: G4V9T2 (Putative flotillin-2 OS=Schistosoma mansoni OX=6183 GN=Smp_033970 PE=3 SV=1)

HSP 1 Score: 421.009 bits (1081), Expect = 3.296e-140
Identity = 226/370 (61.08%), Postives = 297/370 (80.27%), Query Frame = 3
Query:  153 LKYKGVAQVKVMNEENLLRVACEQFLGKKREDIANTILQTLEGHLRAILGTLTVEAVYQDRDQFAQLVREVASPDVSKMGIEILSFTIKDVYDKVEYLNSLGRAQTANVKKDADIGVAEAERDAGIREAECEKLRMNIRYQANTEIADAERNFNMQKAIFETQVNQQKAESELAYELQAAKEKQRIRTEEIQXXXXXXXXXXXXXXXXXLRRENDLIASVKKPAESEAYKIERTAEGYKVQQIFXXXXXXXXXXXXXXXXXXVIGEIGKAEASRMKLRAEAFKKYGKTAILNQIIDSMPRIAAEVTSPLQRTKNITIMDSGTG--------GSLATEVAKLLGSLPPTIQAITGIDITNALSKIPGAEIV 1238
            L   GVAQVKVM ++ LL  AC+QFLGKK+ DI NTILQT+EGHLRAILGTLTVEA+Y+DRDQFA LVREVA+PDV +MGIEILSFTIKDVYD+VEYLNSLGRAQTANVK+DADIGVAEAERDAGI+EAEC++ R+++RY A+T IA++ R F ++KA F+ +VN  +AESELAY+LQAAKE+Q+IRTEE+ I +VE+ KQI IEE  +L  E ++ A+V++PAE+EAY++++ AEGY+ Q+I LA+AEA  I LKG A+A  +  +G+AEA RM+LRAEA+ KYG  AILN I+D++P+IAAEV +PL +TK I IM+   G         +L  +   L+G++P  I+A+T +D++  +SKIPGA++V
Sbjct:   80 LTVTGVAQVKVMRDDKLLEAACQQFLGKKQRDIQNTILQTMEGHLRAILGTLTVEAIYRDRDQFAALVREVAAPDVGRMGIEILSFTIKDVYDRVEYLNSLGRAQTANVKRDADIGVAEAERDAGIKEAECDRSRLDVRYSADTHIANSSREFQLRKASFDQEVNTARAESELAYKLQAAKERQKIRTEEVNINIVERRKQIEIEEKGILCTEKNMDATVRRPAEAEAYRLQQIAEGYRSQKILLAQAEADGIRLKGIAKAEAMEAVGRAEAERMRLRAEAYSKYGDAAILNLILDTLPQIAAEVAAPLSKTKEIVIMNGSNGEPATLQSLTNLGKDFTTLVGTVPHAIRALTNVDLSQTISKIPGAKVV 449          

HSP 2 Score: 80.8777 bits (198), Expect = 1.595e-12
Identity = 36/47 (76.60%), Postives = 41/47 (87.23%), Query Frame = 1
Query:    4 KVKTIVGGWGWSWWLVCEVQMLSLEVMTLTPKCEQVETSEGVPITVT 144
            KV+TI+GGWGW+WWLV EVQ +SL VMTL P CE VETSEGVP+TVT
Sbjct:   37 KVRTIIGGWGWAWWLVTEVQKISLGVMTLNPVCENVETSEGVPLTVT 83          
BLAST of Flotillin-2 vs. TrEMBL
Match: A0A3Q0KEA0 (Putative flotillin-2 OS=Schistosoma mansoni OX=6183 PE=3 SV=1)

HSP 1 Score: 420.624 bits (1080), Expect = 3.638e-140
Identity = 226/370 (61.08%), Postives = 297/370 (80.27%), Query Frame = 3
Query:  153 LKYKGVAQVKVMNEENLLRVACEQFLGKKREDIANTILQTLEGHLRAILGTLTVEAVYQDRDQFAQLVREVASPDVSKMGIEILSFTIKDVYDKVEYLNSLGRAQTANVKKDADIGVAEAERDAGIREAECEKLRMNIRYQANTEIADAERNFNMQKAIFETQVNQQKAESELAYELQAAKEKQRIRTEEIQXXXXXXXXXXXXXXXXXLRRENDLIASVKKPAESEAYKIERTAEGYKVQQIFXXXXXXXXXXXXXXXXXXVIGEIGKAEASRMKLRAEAFKKYGKTAILNQIIDSMPRIAAEVTSPLQRTKNITIMDSGTG--------GSLATEVAKLLGSLPPTIQAITGIDITNALSKIPGAEIV 1238
            L   GVAQVKVM ++ LL  AC+QFLGKK+ DI NTILQT+EGHLRAILGTLTVEA+Y+DRDQFA LVREVA+PDV +MGIEILSFTIKDVYD+VEYLNSLGRAQTANVK+DADIGVAEAERDAGI+EAEC++ R+++RY A+T IA++ R F ++KA F+ +VN  +AESELAY+LQAAKE+Q+IRTEE+ I +VE+ KQI IEE  +L  E ++ A+V++PAE+EAY++++ AEGY+ Q+I LA+AEA  I LKG A+A  +  +G+AEA RM+LRAEA+ KYG  AILN I+D++P+IAAEV +PL +TK I IM+   G         +L  +   L+G++P  I+A+T +D++  +SKIPGA++V
Sbjct:   67 LTVTGVAQVKVMRDDKLLEAACQQFLGKKQRDIQNTILQTMEGHLRAILGTLTVEAIYRDRDQFAALVREVAAPDVGRMGIEILSFTIKDVYDRVEYLNSLGRAQTANVKRDADIGVAEAERDAGIKEAECDRSRLDVRYSADTHIANSSREFQLRKASFDQEVNTARAESELAYKLQAAKERQKIRTEEVNINIVERRKQIEIEEKGILCTEKNMDATVRRPAEAEAYRLQQIAEGYRSQKILLAQAEADGIRLKGIAKAEAMEAVGRAEAERMRLRAEAYSKYGDAAILNLILDTLPQIAAEVAAPLSKTKEIVIMNGSNGEPATLQSLTNLGKDFTTLVGTVPHAIRALTNVDLSQTISKIPGAKVV 436          

HSP 2 Score: 80.8777 bits (198), Expect = 1.516e-12
Identity = 36/47 (76.60%), Postives = 41/47 (87.23%), Query Frame = 1
Query:    4 KVKTIVGGWGWSWWLVCEVQMLSLEVMTLTPKCEQVETSEGVPITVT 144
            KV+TI+GGWGW+WWLV EVQ +SL VMTL P CE VETSEGVP+TVT
Sbjct:   24 KVRTIIGGWGWAWWLVTEVQKISLGVMTLNPVCENVETSEGVPLTVT 70          
BLAST of Flotillin-2 vs. TrEMBL
Match: C1LGS2 (Flotillin 2 OS=Schistosoma japonicum OX=6182 GN=Flo-2 PE=2 SV=1)

HSP 1 Score: 416.387 bits (1069), Expect = 1.282e-138
Identity = 226/370 (61.08%), Postives = 298/370 (80.54%), Query Frame = 3
Query:  153 LKYKGVAQVKVMNEENLLRVACEQFLGKKREDIANTILQTLEGHLRAILGTLTVEAVYQDRDQFAQLVREVASPDVSKMGIEILSFTIKDVYDKVEYLNSLGRAQTANVKKDADIGVAEAERDAGIREAECEKLRMNIRYQANTEIADAERNFNMQKAIFETQVNQQKAESELAYELQAAKEKQRIRTEEIQXXXXXXXXXXXXXXXXXLRRENDLIASVKKPAESEAYKIERTAEGYKVQQIFXXXXXXXXXXXXXXXXXXVIGEIGKAEASRMKLRAEAFKKYGKTAILNQIIDSMPRIAAEVTSPLQRTKNITIMDSGTGGS--------LATEVAKLLGSLPPTIQAITGIDITNALSKIPGAEIV 1238
            L   GVAQVKVM ++ LL  AC+QFLGKK+ DI NTILQT+EGHLRAILGTLTVEA+Y+DRDQFA LVREVA+PDV +MGIEILSFTIKDVYD+VEYLNSLGRAQTANVK+DADIGVAEAERDAGI+EAEC++ R+++RY A+T IA++ R F ++KA F+ +VN  +AESELAY+LQAAKE+Q+IRTEE+ I +VE+ KQI IEE  VL  E ++ A+V++PAE+EAY++++ AEG + Q+I LAKAEA  I LKG A+A  +  +G+AEA RM+LRAEA+ KYG  AIL+ I++++P+IAAEV++PL +TK I IM+   G S        L  +   L+G++P  I+A+T +D++ ++S+IPGA+IV
Sbjct:   67 LTVTGVAQVKVMRDDKLLEAACQQFLGKKQRDIQNTILQTMEGHLRAILGTLTVEAIYRDRDQFAALVREVAAPDVGRMGIEILSFTIKDVYDRVEYLNSLGRAQTANVKRDADIGVAEAERDAGIKEAECDRSRLDVRYSADTHIANSSREFQLRKASFDQEVNTARAESELAYKLQAAKERQKIRTEEVNINIVERRKQIEIEEKGVLCTEKNMDATVRRPAEAEAYRLQQIAEGQRSQKILLAKAEADGIRLKGIAKAEAMEAVGRAEAERMRLRAEAYSKYGDAAILHLILNTLPQIAAEVSAPLSKTKEIVIMNGSNGESASLQSLSNLGKDFTTLVGTVPHAIRALTSVDLSQSISRIPGAKIV 436          

HSP 2 Score: 79.7221 bits (195), Expect = 3.601e-12
Identity = 35/47 (74.47%), Postives = 41/47 (87.23%), Query Frame = 1
Query:    4 KVKTIVGGWGWSWWLVCEVQMLSLEVMTLTPKCEQVETSEGVPITVT 144
            KV+TI+GGWGW+WWLV +VQ +SL VMTL P CE VETSEGVP+TVT
Sbjct:   24 KVRTIIGGWGWAWWLVTQVQKISLGVMTLNPVCENVETSEGVPLTVT 70          
BLAST of Flotillin-2 vs. Ensembl Cavefish
Match: flot2a (flotillin 2 [Source:NCBI gene;Acc:103045282])

HSP 1 Score: 380.563 bits (976), Expect = 4.550e-128
Identity = 213/357 (59.66%), Postives = 286/357 (80.11%), Query Frame = 3
Query:  153 LKYKGVAQVKVMNEENLLRVACEQFLGKKREDIANTILQTLEGHLRAILGTLTVEAVYQDRDQFAQLVREVASPDVSKMGIEILSFTIKDVYDKVEYLNSLGRAQTANVKKDADIGVAEAERDAGIREAECEKLRMNIRYQANTEIADAERNFNMQKAIFETQVNQQKAESELAYELQAAKEKQRIRTEEIQXXXXXXXXXXXXXXXXXLRRENDLIASVKKPAESEAYKIERTAEGYKVQQIFXXXXXXXXXXXXXXXXXXVIGEIGKAEASRMKLRAEAFKKYGKTAILNQIIDSMPRIAAEVTSPLQRTKNITIMDSGTGGSLATEVAKLLGSLPPTIQAITGIDITNALSKIP 1223
            L   GVAQVKVM ++ LL +ACEQFLGK   +I   +LQTLEGHLR+ILGTLTVE +YQDRDQFA LVREVA+PDV +MGIEILSFTIKDVYDKV+YL+SLG+ QTA V++DADIGVAEAERDAGIREAEC+K  M++++ A+T++AD++R   MQKA F  +VN +KAE++LAYELQAAKE+Q+IR EEI+IEVV++ KQI IEE E++R + +LIA+VK+PAE+EAYK+++ AEG KV+++  A+AEA+KI+  GEAEA  I  +GKAEA +M+++AEA+ +YG+ A    +++++P+IA +V +PL RT  I I+ SG G  +  EV +LL  LP ++ A+TG+D+T    KIP
Sbjct:   67 LTVTGVAQVKVMTDKELLSLACEQFLGKSVIEIKGVVLQTLEGHLRSILGTLTVEQIYQDRDQFASLVREVAAPDVGRMGIEILSFTIKDVYDKVDYLSSLGKTQTAAVQRDADIGVAEAERDAGIREAECKKEMMDVKFLADTKMADSKRELEMQKASFNQEVNAKKAEAQLAYELQAAKEQQKIRLEEIEIEVVQRKKQITIEEKEIVRTDKELIATVKRPAEAEAYKMQQLAEGQKVKKVLTAQAEAEKIKRIGEAEAASIEAVGKAEAEKMRMKAEAYMQYGEAAKTALVLEALPKIAGKVAAPLARTNEIVIL-SGEGSRVTGEVNRLLAELPVSVNALTGVDLT----KIP 418          

HSP 2 Score: 63.929 bits (154), Expect = 1.745e-10
Identity = 26/42 (61.90%), Postives = 35/42 (83.33%), Query Frame = 1
Query:   19 VGGWGWSWWLVCEVQMLSLEVMTLTPKCEQVETSEGVPITVT 144
            VGGW W+W L+ ++Q ++LE+MTL PKCE VET+EGV +TVT
Sbjct:   29 VGGWAWAWCLLTDIQKITLEIMTLQPKCEDVETAEGVALTVT 70          
BLAST of Flotillin-2 vs. Ensembl Cavefish
Match: flot2a (flotillin 2 [Source:NCBI gene;Acc:103045282])

HSP 1 Score: 380.178 bits (975), Expect = 5.839e-128
Identity = 213/357 (59.66%), Postives = 286/357 (80.11%), Query Frame = 3
Query:  153 LKYKGVAQVKVMNEENLLRVACEQFLGKKREDIANTILQTLEGHLRAILGTLTVEAVYQDRDQFAQLVREVASPDVSKMGIEILSFTIKDVYDKVEYLNSLGRAQTANVKKDADIGVAEAERDAGIREAECEKLRMNIRYQANTEIADAERNFNMQKAIFETQVNQQKAESELAYELQAAKEKQRIRTEEIQXXXXXXXXXXXXXXXXXLRRENDLIASVKKPAESEAYKIERTAEGYKVQQIFXXXXXXXXXXXXXXXXXXVIGEIGKAEASRMKLRAEAFKKYGKTAILNQIIDSMPRIAAEVTSPLQRTKNITIMDSGTGGSLATEVAKLLGSLPPTIQAITGIDITNALSKIP 1223
            L   GVAQVKVM ++ LL +ACEQFLGK   +I   +LQTLEGHLR+ILGTLTVE +YQDRDQFA LVREVA+PDV +MGIEILSFTIKDVYDKV+YL+SLG+ QTA V++DADIGVAEAERDAGIREAEC+K  M++++ A+T++AD++R   MQKA F  +VN +KAE++LAYELQAAKE+Q+IR EEI+IEVV++ KQI IEE E++R + +LIA+VK+PAE+EAYK+++ AEG KV+++  A+AEA+KI+  GEAEA  I  +GKAEA +M+++AEA+ +YG+ A    +++++P+IA +V +PL RT  I I+ SG G  +  EV +LL  LP ++ A+TG+D+T    KIP
Sbjct:   67 LDVTGVAQVKVMTDKELLSLACEQFLGKSVIEIKGVVLQTLEGHLRSILGTLTVEQIYQDRDQFASLVREVAAPDVGRMGIEILSFTIKDVYDKVDYLSSLGKTQTAAVQRDADIGVAEAERDAGIREAECKKEMMDVKFLADTKMADSKRELEMQKASFNQEVNAKKAEAQLAYELQAAKEQQKIRLEEIEIEVVQRKKQITIEEKEIVRTDKELIATVKRPAEAEAYKMQQLAEGQKVKKVLTAQAEAEKIKRIGEAEAASIEAVGKAEAEKMRMKAEAYMQYGEAAKTALVLEALPKIAGKVAAPLARTNEIVIL-SGEGSRVTGEVNRLLAELPVSVNALTGVDLT----KIP 418          

HSP 2 Score: 61.6178 bits (148), Expect = 8.333e-10
Identity = 26/42 (61.90%), Postives = 34/42 (80.95%), Query Frame = 1
Query:   19 VGGWGWSWWLVCEVQMLSLEVMTLTPKCEQVETSEGVPITVT 144
            VGGW W+W L+ ++Q LSLEVMT+  +CE +ETSEGVP+ VT
Sbjct:   29 VGGWAWAWCLLTDIQKLSLEVMTILCRCENIETSEGVPLDVT 70          
BLAST of Flotillin-2 vs. Ensembl Cavefish
Match: flot2b (flotillin-2-like [Source:NCBI gene;Acc:103034256])

HSP 1 Score: 372.859 bits (956), Expect = 4.692e-125
Identity = 208/353 (58.92%), Postives = 286/353 (81.02%), Query Frame = 3
Query:  165 GVAQVKVMNEENLLRVACEQFLGKKREDIANTILQTLEGHLRAILGTLTVEAVYQDRDQFAQLVREVASPDVSKMGIEILSFTIKDVYDKVEYLNSLGRAQTANVKKDADIGVAEAERDAGIREAECEKLRMNIRYQANTEIADAERNFNMQKAIFETQVNQQKAESELAYELQAAKEKQRIRTEEIQXXXXXXXXXXXXXXXXXLRRENDLIASVKKPAESEAYKIERTAEGYKVQQIFXXXXXXXXXXXXXXXXXXVIGEIGKAEASRMKLRAEAFKKYGKTAILNQIIDSMPRIAAEVTSPLQRTKNITIMDSGTGGSLATEVAKLLGSLPPTIQAITGIDITNALSKIP 1223
            GVAQVKVM +++LL +ACEQFLGK   +I   +LQTLEGHLR+ILGTLTVE +YQDRD+FAQLVREVA+PDV +MGIEILSFTIKDVYDK++YL+SLG+ QTA V++DADIGVAEAERDAGI+EAEC+K  M++ + A+T++A+++R  ++QKA F  +VN +KAE++LAYELQAAKE Q+IR EEI+IEVV++ KQI+IE+ E+ R E +LIA VK+PAE+EAYK+ + AEG K++++  A+AEA+KI   GEAEA  I  +GKAEA +M+L+A+A+++YG+ A    +++++P+IAA+V++PL RT  I I+ SG G  +  EV +LL  LP ++ A+TG+D+T    KIP
Sbjct:   71 GVAQVKVMTDKDLLAIACEQFLGKSVMEIKGVVLQTLEGHLRSILGTLTVEQIYQDRDKFAQLVREVAAPDVGRMGIEILSFTIKDVYDKLDYLSSLGKTQTAAVQRDADIGVAEAERDAGIKEAECKKEMMDVTFLADTKMANSKRELDLQKAAFNQEVNSKKAEAQLAYELQAAKELQKIRLEEIEIEVVQRKKQIVIEDKEINRTEKELIAIVKRPAEAEAYKMLQLAEGQKIKKVLTAQAEAEKIRKIGEAEAKSIEAVGKAEAEKMRLKADAYQQYGEAAKTALVLEALPKIAAKVSAPLARTNEIVIL-SGEGSRVTGEVNRLLAELPVSVNALTGVDLT----KIP 418          

HSP 2 Score: 65.855 bits (159), Expect = 3.773e-11
Identity = 27/43 (62.79%), Postives = 35/43 (81.40%), Query Frame = 1
Query:   16 IVGGWGWSWWLVCEVQMLSLEVMTLTPKCEQVETSEGVPITVT 144
            +VGGW W+WW + + Q ++LE+MTL PKCE VET+EGV ITVT
Sbjct:   28 VVGGWAWAWWCLTDTQRITLEIMTLQPKCESVETAEGVAITVT 70          
BLAST of Flotillin-2 vs. Ensembl Cavefish
Match: flot2b (flotillin-2-like [Source:NCBI gene;Acc:103034256])

HSP 1 Score: 370.163 bits (949), Expect = 6.181e-124
Identity = 205/346 (59.25%), Postives = 283/346 (81.79%), Query Frame = 3
Query:  165 GVAQVKVMNEENLLRVACEQFLGKKREDIANTILQTLEGHLRAILGTLTVEAVYQDRDQFAQLVREVASPDVSKMGIEILSFTIKDVYDKVEYLNSLGRAQTANVKKDADIGVAEAERDAGIREAECEKLRMNIRYQANTEIADAERNFNMQKAIFETQVNQQKAESELAYELQAAKEKQRIRTEEIQXXXXXXXXXXXXXXXXXLRRENDLIASVKKPAESEAYKIERTAEGYKVQQIFXXXXXXXXXXXXXXXXXXVIGEIGKAEASRMKLRAEAFKKYGKTAILNQIIDSMPRIAAEVTSPLQRTKNITIMDSGTGGSLATEVAKLLGSLPPTIQAITGIDIT 1202
            GVAQVKVM +++LL +ACEQFLGK   +I   +LQTLEGHLR+ILGTLTVE +YQDRD+FAQLVREVA+PDV +MGIEILSFTIKDVYDK++YL+SLG+ QTA V++DADIGVAEAERDAGI+EAEC+K  M++ + A+T++A+++R  ++QKA F  +VN +KAE++LAYELQAAKE Q+IR EEI+IEVV++ KQI+IE+ E+ R E +LIA VK+PAE+EAYK+ + AEG K++++  A+AEA+KI   GEAEA  I  +GKAEA +M+L+A+A+++YG+ A    +++++P+IAA+V++PL RT  I I+ SG G  +  EV +LL  LP ++ A+TG+D+T
Sbjct:   71 GVAQVKVMTDKDLLAIACEQFLGKSVMEIKGVVLQTLEGHLRSILGTLTVEQIYQDRDKFAQLVREVAAPDVGRMGIEILSFTIKDVYDKLDYLSSLGKTQTAAVQRDADIGVAEAERDAGIKEAECKKEMMDVTFLADTKMANSKRELDLQKAAFNQEVNSKKAEAQLAYELQAAKELQKIRLEEIEIEVVQRKKQIVIEDKEINRTEKELIAIVKRPAEAEAYKMLQLAEGQKIKKVLTAQAEAEKIRKIGEAEAKSIEAVGKAEAEKMRLKADAYQQYGEAAKTALVLEALPKIAAKVSAPLARTNEIVIL-SGEGSRVTGEVNRLLAELPVSVNALTGVDLT 415          

HSP 2 Score: 65.4698 bits (158), Expect = 4.687e-11
Identity = 27/43 (62.79%), Postives = 35/43 (81.40%), Query Frame = 1
Query:   16 IVGGWGWSWWLVCEVQMLSLEVMTLTPKCEQVETSEGVPITVT 144
            +VGGW W+WW + + Q ++LE+MTL PKCE VET+EGV ITVT
Sbjct:   28 VVGGWAWAWWCLTDTQRITLEIMTLQPKCESVETAEGVAITVT 70          
BLAST of Flotillin-2 vs. Ensembl Cavefish
Match: flot1b (flotillin-1-like [Source:NCBI gene;Acc:103034507])

HSP 1 Score: 260.381 bits (664), Expect = 2.130e-81
Identity = 157/355 (44.23%), Postives = 249/355 (70.14%), Query Frame = 3
Query:  165 GVAQVKVMNE-ENLLRVACEQFLGKKREDIANTILQTLEGHLRAILGTLTVEAVYQDRDQFAQLVREVASPDVSKMGIEILSFTIKDVYDKVEYLNSLGRAQTANVKKDADIGVAEAERDAGIREAECEKLRMNIRYQANTEIADAERNFNMQKAIFETQVNQQKAESELAYELQAAKEKQRIRTEEIQXXXXXXXXXXXXXXXXXLRRENDLIASVKKPAESEAYKIERTAEGYKVQQIFXXXXXXXXXXXXXXXXXXVIGEIGKAEASRMKLRAEAFKKYGKTAILNQIIDSMPRIAAEVTSPLQRTKNITIMDSG----TGGSLATEVAKLLGSLPPTIQAITGIDITNALS 1214
            G+AQVK+  + + +L  AC+ FLGK   +I+   L+TLEGH RAI+  LTVE +YQDR +F++ V +VAS D+  MGI ++S+T+KDV+D  +YL SLG+A+TA V++DA IG A+ +RD+ IREA   + +++ +Y    E+A A+R++ ++KA ++ ++N +KAESE+AY+LQ AK KQRI  E++Q+ VVE+ +QI ++E E+ R+E +L A VKKPAE+E Y++E+ AE  ++Q I  A+AEA+ I +KGEAEA  +   G+AEA +M  +AEAFK+Y + A+++ +++ +P +A E++ PL   + +T++ SG        L  EV  ++  LP TI+ +TGI+I+   S
Sbjct:   67 GIAQVKIQGQNKEMLATACQMFLGKTETEISQIALETLEGHQRAIIAHLTVEEIYQDRKKFSEQVFKVASSDLVNMGIGVVSYTLKDVHDDQDYLQSLGKARTAQVQRDARIGEAQYKRDSVIREAHAMQEKVSAQYVNEIEMAKAQRDYELKKAAYDIEINTKKAESEMAYQLQVAKTKQRIEEEKMQVMVVERTQQITLQEQEISRKEKELEAKVKKPAEAEKYRLEKLAEAERLQLIMEAEAEAESIRMKGEAEAFALEAKGRAEAEQMAKKAEAFKQYKEGAMVDMLLEKLPLMAEEISKPLSAAQKVTMVSSGGSEVGAAKLTGEVLDIMTRLPATIEKLTGINISQVSS 421          
BLAST of Flotillin-2 vs. Ensembl Sea Lamprey
Match: flot2a (flotillin 2a [Source:NCBI gene;Acc:245698])

HSP 1 Score: 387.111 bits (993), Expect = 2.582e-131
Identity = 215/357 (60.22%), Postives = 289/357 (80.95%), Query Frame = 3
Query:  153 LKYKGVAQVKVMNEENLLRVACEQFLGKKREDIANTILQTLEGHLRAILGTLTVEAVYQDRDQFAQLVREVASPDVSKMGIEILSFTIKDVYDKVEYLNSLGRAQTANVKKDADIGVAEAERDAGIREAECEKLRMNIRYQANTEIADAERNFNMQKAIFETQVNQQKAESELAYELQAAKEKQRIRTEEIQXXXXXXXXXXXXXXXXXLRRENDLIASVKKPAESEAYKIERTAEGYKVQQIFXXXXXXXXXXXXXXXXXXVIGEIGKAEASRMKLRAEAFKKYGKTAILNQIIDSMPRIAAEVTSPLQRTKNITIMDSGTGGSLATEVAKLLGSLPPTIQAITGIDITNALSKIP 1223
            L   GVAQVKVM +++LL VACEQFLG+  ++I + +LQTLEGHLR+ILGTLTVEAVYQDRDQFAQLVREVASPDV +MGIEILSFTIKDVYDKVEYL SLG+ Q A VK+DA+IGVA+AERDAGIREAEC+K  M++++ A+T+IA+++R + MQKA F  +   +KAE++LAYELQAAKE+Q+IR EE QIEVV++ KQI +EE E+ R E +LIA+V+ PA++EA+++++ AEG K++++  A+A+A++I+  G+AEA  I  IG+AEA  M+L+AEA+K+YGK AI++ ++D++P+IAAEV +PLQ+   I I+ SG G    TEV +LL  LP T+QA+TG+D    LSK P
Sbjct:   67 LTVTGVAQVKVMTDKDLLAVACEQFLGRTVDEIKSVVLQTLEGHLRSILGTLTVEAVYQDRDQFAQLVREVASPDVGRMGIEILSFTIKDVYDKVEYLASLGKTQAALVKRDAEIGVAQAERDAGIREAECKKNMMDVKFNADTKIANSKREYEMQKAFFNQESQTKKAEAQLAYELQAAKEQQKIRQEECQIEVVQRRKQIDVEEREIQRTERELIATVRCPAQAEAFRVQQIAEGDKIKRVLAAQADAERIKKIGDAEAAAIEAIGRAEAEEMRLKAEAYKQYGKAAIISMVLDALPKIAAEVAAPLQKIDEIVIL-SGEGNRTTTEVTRLLAELPTTVQALTGVD----LSKSP 418          

HSP 2 Score: 65.0846 bits (157), Expect = 1.291e-11
Identity = 28/45 (62.22%), Postives = 34/45 (75.56%), Query Frame = 1
Query:   10 KTIVGGWGWSWWLVCEVQMLSLEVMTLTPKCEQVETSEGVPITVT 144
            K + GGW W W LV + Q +SLE+MTL P+CE VETSEGV +TVT
Sbjct:   26 KYVTGGWSWVWCLVSQAQRISLEIMTLNPRCEDVETSEGVALTVT 70          
BLAST of Flotillin-2 vs. Ensembl Sea Lamprey
Match: flot1b (flotillin 1b [Source:ZFIN;Acc:ZDB-GENE-020430-2])

HSP 1 Score: 253.832 bits (647), Expect = 1.053e-79
Identity = 160/355 (45.07%), Postives = 251/355 (70.70%), Query Frame = 3
Query:  165 GVAQVKVMNE-ENLLRVACEQFLGKKREDIANTILQTLEGHLRAILGTLTVEAVYQDRDQFAQLVREVASPDVSKMGIEILSFTIKDVYDKVEYLNSLGRAQTANVKKDADIGVAEAERDAGIREAECEKLRMNIRYQANTEIADAERNFNMQKAIFETQVNQQKAESELAYELQAAKEKQRIRTEEIQXXXXXXXXXXXXXXXXXLRRENDLIASVKKPAESEAYKIERTAEGYKVQQIFXXXXXXXXXXXXXXXXXXVIGEIGKAEASRMKLRAEAFKKYGKTAILNQIIDSMPRIAAEVTSPLQRTKNITIMDSGTG----GSLATEVAKLLGSLPPTIQAITGIDITNALS 1214
            G+AQVK+  + +++L  AC+ FLGK  E+I+   L+TLEGH RAI+G +TVE +Y+DR +F+Q V  VAS D+  MGI ++S+T+KDV D  +YL SLG+A+TA V++DA IG AE +RDAGI+EA   + ++  +Y    EIA A+  F ++ A ++ +VN QKA+++LAY+LQ AK KQ+I  E++QI VVE+ +QI+++E E+LRRE +L A +KKPAE+E Y++E+ AE  + + I  A+AEA+ I++KGEAEA  I    KAEA +M  +A+AFK Y + A+++ +++++P+IA EV+ PL + + +T++ SG G      L +EV  ++  LP +++ +TG+ I+   S
Sbjct:   58 GIAQVKIQGQNKDMLAAACQMFLGKGDEEISQIALETLEGHQRAIMGNMTVEEIYKDRKKFSQEVFRVASSDLLNMGISVVSYTLKDVRDDEDYLKSLGKARTAQVQRDARIGEAEMKRDAGIKEAMAVEQKVAAQYLNEIEIAKAQLEFELKTAAYDMEVNTQKAQADLAYQLQVAKTKQKIEEEKMQILVVERTQQILVQEQEILRREKELDAKIKKPAEAEKYRLEKLAEAGRARVIMEAEAEAESIKIKGEAEAYAIEAKAKAEAEQMLQKAQAFKDYEEAAMVDLLLETLPKIATEVSQPLSKARKVTMISSGGGEVGASKLTSEVLDIMSKLPESVERLTGVKISQVRS 412          
BLAST of Flotillin-2 vs. Ensembl Nematostella
Match: EDO37688 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SF43])

HSP 1 Score: 394.43 bits (1012), Expect = 5.805e-134
Identity = 215/355 (60.56%), Postives = 283/355 (79.72%), Query Frame = 3
Query:  165 GVAQVKVMNEENLLRVACEQFLGKKREDIANTILQTLEGHLRAILGTLTVEAVYQDRDQFAQLVREVASPDVSKMGIEILSFTIKDVYDKVEYLNSLGRAQTANVKKDADIGVAEAERDAGIREAECEKLRMNIRYQANTEIADAERNFNMQKAIFETQVNQQKAESELAYELQAAKEKQRIRTEEIQXXXXXXXXXXXXXXXXXLRRENDLIASVKKPAESEAYKIERTAEGYKVQQIFXXXXXXXXXXXXXXXXXXVIGEIGKAEASRMKLRAEAFKKYGKTAILNQIIDSMPRIAAEVTSPLQRTKNITIMDSGTGGSLATEVAKLLGSLPPTIQAITGIDITNALSKIPGA 1229
            GVAQVKVM E  LL+ ACEQFLGK    I + +LQTLEGHLRAILGTL+VE +Y+DR+ FA LVREVASPDV +MGIEILSFTIKD+ D V+YLNSLG+ QTA VK+DADIGVAEA+RDAGIREAECEK +M++ Y+  T IAD+ R + MQKA ++ +VN +KAE+EL+YELQ  KEKQ+IR+EEIQIEVVE+ KQI ++E E+ R+E +LIA VK+PAE+E+YK+E  A+G + Q +FLA+A+A++I+L G +EA  I  IGKAEA RM+ +A A+K YG  A+   I++++P++AAEV +PL +T  I I++   G S++ E++KLLG LPP IQA+TG D++  L+KIPGA
Sbjct:   71 GVAQVKVMTEPRLLKTACEQFLGKTTRQIESVVLQTLEGHLRAILGTLSVEEIYKDREAFAALVREVASPDVGRMGIEILSFTIKDIEDHVDYLNSLGKTQTAKVKRDADIGVAEAKRDAGIREAECEKQKMDVVYETQTNIADSSREYQMQKAAYDQEVNTRKAEAELSYELQGNKEKQKIRSEEIQIEVVERRKQIEVQEKEIQRKEKELIAEVKRPAEAESYKVETLAQGKRTQTVFLAQADAERIKLIGSSEASAIEAIGKAEAERMRQKAAAYKMYGDAAMTALILEALPKVAAEVAAPLAKTGEIVIIND-DGNSVSGELSKLLGQLPPAIQALTGTDLSGVLNKIPGA 424          

HSP 2 Score: 63.929 bits (154), Expect = 6.407e-11
Identity = 27/45 (60.00%), Postives = 36/45 (80.00%), Query Frame = 1
Query:   10 KTIVGGWGWSWWLVCEVQMLSLEVMTLTPKCEQVETSEGVPITVT 144
            KT++GGW ++W  V +VQ +SLEVMTL P CE VET++GV +TVT
Sbjct:   26 KTVIGGWAFAWACVTDVQSISLEVMTLNPTCEAVETAQGVAVTVT 70          
BLAST of Flotillin-2 vs. Ensembl Nematostella
Match: EDO47182 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RMZ4])

HSP 1 Score: 266.544 bits (680), Expect = 2.976e-84
Identity = 161/355 (45.35%), Postives = 259/355 (72.96%), Query Frame = 3
Query:  165 GVAQVKVMNE-ENLLRVACEQFLGKKREDIANTILQTLEGHLRAILGTLTVEAVYQDRDQFAQLVREVASPDVSKMGIEILSFTIKDVYDKVEYLNSLGRAQTANVKKDADIGVAEAERDAGIREAECEKLRMNIRYQANTEIADAERNFNMQKAIFETQVNQQKAESELAYELQAAKEKQRIRTEEIQXXXXXXXXXXXXXXXXXLRRENDLIASVKKPAESEAYKIERTAEGYKVQQIFXXXXXXXXXXXXXXXXXXVIGEIGKAEASRMKLRAEAFKKYGKTAILNQIIDSMPRIAAEVTSPLQRTKNITIMDSGTG----GSLATEVAKLLGSLPPTIQAITGIDITNALS 1214
            G+AQVK+  + + +L  AC+QFLGK  E   +  L+TLEGH RAI+GT+TVE +Y+DR +F++ V EVAS D+  MGI I+S+TIKD+ D+  YL++LG ++TA VK+DA IG AEA+RD+GI+EA  E+ R+  +Y+ +T+IA A+R+F ++KA ++ +V  + A S++AY LQAA  KQ+I+ EE+QI+VVE+ +QI ++E E+ RRE +L A+V++PAE+E Y++E+ AE  + + I  A+A+++ I++KG+AEA  I    KAEA +M  +A+A+K+Y + AI++ ++++MP+IAAE+ +PL +   IT++ +G G      +  E+  ++  LP  ++A+TGIDI+ A+S
Sbjct:   69 GIAQVKIQGQNQEMLHAACQQFLGKSAEQTRHIALETLEGHQRAIMGTMTVEEIYRDRKKFSKSVFEVASSDLVNMGISIVSYTIKDIRDEEGYLHALGMSRTAQVKRDARIGEAEAKRDSGIKEAIAEEARLKAKYENDTQIAKAKRDFELKKAGYDIEVQTKNATSQMAYNLQAAVTKQKIKEEEMQIKVVERGQQIKVQEQEIARRERELEATVRQPAEAEKYRLEKLAEANRNRVILEAEAQSEAIKVKGDAEAFAIEAKAKAEAEQMAKKADAWKEYREAAIVDMVLETMPKIAAEIAAPLSQVNKITMVSNGKGEVGASKVTGEILDIVAKLPKAVEALTGIDISKAMS 423          
BLAST of Flotillin-2 vs. Ensembl Nematostella
Match: EDO25979 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TD74])

HSP 1 Score: 113.62 bits (283), Expect = 6.910e-31
Identity = 54/68 (79.41%), Postives = 61/68 (89.71%), Query Frame = 3
Query:  330 DRDQFAQLVREVASPDVSKMGIEILSFTIKDVYDKVEYLNSLGRAQTANVKKDADIGVAEAERDAGIR 533
            DR+ FA LVREVASPDV +MGIEILSFTIKD+ D V+YLNSLG+ QTA VK+DADIGVAEA+RDAGIR
Sbjct:    1 DREAFAALVREVASPDVGRMGIEILSFTIKDIEDHVDYLNSLGKTQTAKVKRDADIGVAEAKRDAGIR 68          
BLAST of Flotillin-2 vs. Ensembl Nematostella
Match: EDO37689 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SF44])

HSP 1 Score: 53.1434 bits (126), Expect = 1.471e-7
Identity = 25/57 (43.86%), Postives = 38/57 (66.67%), Query Frame = 3
Query: 1053 IAAEVTSPLQRTKNITIMDSGTGGSLATEVAKLLGSLPPTIQAITGIDITNALSKIP 1223
            +AAEV +PL +T  I I++   G S++ E++KLLG LPP +QA+TG D++      P
Sbjct:  385 VAAEVAAPLAKTGEIVIIND-DGNSVSGELSKLLGQLPPAVQALTGTDLSGGSFLYP 440          
BLAST of Flotillin-2 vs. Ensembl Medaka
Match: flot2a (flotillin 2 [Source:NCBI gene;Acc:101169802])

HSP 1 Score: 378.637 bits (971), Expect = 2.859e-127
Identity = 215/353 (60.91%), Postives = 282/353 (79.89%), Query Frame = 3
Query:  165 GVAQVKVMNEENLLRVACEQFLGKKREDIANTILQTLEGHLRAILGTLTVEAVYQDRDQFAQLVREVASPDVSKMGIEILSFTIKDVYDKVEYLNSLGRAQTANVKKDADIGVAEAERDAGIREAECEKLRMNIRYQANTEIADAERNFNMQKAIFETQVNQQKAESELAYELQAAKEKQRIRTEEIQXXXXXXXXXXXXXXXXXLRRENDLIASVKKPAESEAYKIERTAEGYKVQQIFXXXXXXXXXXXXXXXXXXVIGEIGKAEASRMKLRAEAFKKYGKTAILNQIIDSMPRIAAEVTSPLQRTKNITIMDSGTGGSLATEVAKLLGSLPPTIQAITGIDITNALSKIP 1223
            GVAQVKVM E  LL  ACEQFLGK   +I + ILQTLEGHLRAILGTLTVE +YQDRD+FA LVREVA+PDV +MGIEILSFTIKDVYDKVEYL+SLG+ QTA V++DADIGVAEAERDAGIREAEC+K  M++++ A+T++AD++R   MQKA F  +VN +KAE++LAYELQAAKE+Q+IR EEI+IEVV++ KQI IEE E+ R E +LIA+VK+PAE+EAYK+++ AEG K++++  A+AEA+KI   GEAEA  I  +GKAEA +M+L+AEA+++YG+ A    +++++P+IA +V +PL +T  I I+ SG G  +  EV +LL  LP ++ A+TG+D    L KIP
Sbjct:   71 GVAQVKVMTERELLGYACEQFLGKSVVEIKSVILQTLEGHLRAILGTLTVEQIYQDRDKFASLVREVAAPDVGRMGIEILSFTIKDVYDKVEYLSSLGKTQTAAVQRDADIGVAEAERDAGIREAECKKEMMDVKFVADTKMADSKRELEMQKASFNQEVNTKKAEAQLAYELQAAKEQQKIRLEEIEIEVVQRKKQITIEEKEIDRTEKELIATVKRPAEAEAYKMQQLAEGQKMKKVLTAQAEAEKIRCIGEAEATSIEAVGKAEAEKMRLKAEAYQQYGEAAKTALVLEALPKIAGKVAAPLSKTNEIVIL-SGDGSRVTGEVNRLLAELPVSVNALTGVD----LMKIP 418          

HSP 2 Score: 70.8626 bits (172), Expect = 8.893e-13
Identity = 28/43 (65.12%), Postives = 37/43 (86.05%), Query Frame = 1
Query:   16 IVGGWGWSWWLVCEVQMLSLEVMTLTPKCEQVETSEGVPITVT 144
            +VGGW W+WWL+ ++Q ++LE+MTL PKCE VET+EGV ITVT
Sbjct:   28 VVGGWAWAWWLISDIQRITLEIMTLQPKCEDVETAEGVAITVT 70          
BLAST of Flotillin-2 vs. Ensembl Medaka
Match: flot2a (flotillin 2 [Source:NCBI gene;Acc:101169802])

HSP 1 Score: 377.481 bits (968), Expect = 7.577e-127
Identity = 212/349 (60.74%), Postives = 280/349 (80.23%), Query Frame = 3
Query:  153 LKYKGVAQVKVMNEENLLRVACEQFLGKKREDIANTILQTLEGHLRAILGTLTVEAVYQDRDQFAQLVREVASPDVSKMGIEILSFTIKDVYDKVEYLNSLGRAQTANVKKDADIGVAEAERDAGIREAECEKLRMNIRYQANTEIADAERNFNMQKAIFETQVNQQKAESELAYELQAAKEKQRIRTEEIQXXXXXXXXXXXXXXXXXLRRENDLIASVKKPAESEAYKIERTAEGYKVQQIFXXXXXXXXXXXXXXXXXXVIGEIGKAEASRMKLRAEAFKKYGKTAILNQIIDSMPRIAAEVTSPLQRTKNITIMDSGTGGSLATEVAKLLGSLPPTIQAITGIDI 1199
            L   GVAQVKVM E  LL  ACEQFLGK   +I + ILQTLEGHLRAILGTLTVE +YQDRD+FA LVREVA+PDV +MGIEILSFTIKDVYDKVEYL+SLG+ QTA V++DADIGVAEAERDAGIREAEC+K  M++++ A+T++AD++R   MQKA F  +VN +KAE++LAYELQAAKE+Q+IR EEI+IEVV++ KQI IEE E+ R E +LIA+VK+PAE+EAYK+++ AEG K++++  A+AEA+KI   GEAEA  I  +GKAEA +M+L+AEA+++YG+ A    +++++P+IA +V +PL +T  I I+ SG G  +  EV +LL  LP ++ A+TG+D+
Sbjct:   67 LAVTGVAQVKVMTERELLGYACEQFLGKSVVEIKSVILQTLEGHLRAILGTLTVEQIYQDRDKFASLVREVAAPDVGRMGIEILSFTIKDVYDKVEYLSSLGKTQTAAVQRDADIGVAEAERDAGIREAECKKEMMDVKFVADTKMADSKRELEMQKASFNQEVNTKKAEAQLAYELQAAKEQQKIRLEEIEIEVVQRKKQITIEEKEIDRTEKELIATVKRPAEAEAYKMQQLAEGQKMKKVLTAQAEAEKIRCIGEAEATSIEAVGKAEAEKMRLKAEAYQQYGEAAKTALVLEALPKIAGKVAAPLSKTNEIVIL-SGDGSRVTGEVNRLLAELPVSVNALTGVDL 414          

HSP 2 Score: 67.0106 bits (162), Expect = 1.367e-11
Identity = 26/43 (60.47%), Postives = 36/43 (83.72%), Query Frame = 1
Query:   16 IVGGWGWSWWLVCEVQMLSLEVMTLTPKCEQVETSEGVPITVT 144
            +VGGW W+WWL+ ++Q +SLEVMT+  +CE +ETSEGVP+ VT
Sbjct:   28 VVGGWAWAWWLISDIQRMSLEVMTILCRCENIETSEGVPLAVT 70          
BLAST of Flotillin-2 vs. Ensembl Medaka
Match: ENSORLT00000002428.2 (flotillin-2 [Source:NCBI gene;Acc:101164911])

HSP 1 Score: 356.681 bits (914), Expect = 9.577e-119
Identity = 200/353 (56.66%), Postives = 277/353 (78.47%), Query Frame = 3
Query:  165 GVAQVKVMNEENLLRVACEQFLGKKREDIANTILQTLEGHLRAILGTLTVEAVYQDRDQFAQLVREVASPDVSKMGIEILSFTIKDVYDKVEYLNSLGRAQTANVKKDADIGVAEAERDAGIREAECEKLRMNIRYQANTEIADAERNFNMQKAIFETQVNQQKAESELAYELQAAKEKQRIRTEEIQXXXXXXXXXXXXXXXXXLRRENDLIASVKKPAESEAYKIERTAEGYKVQQIFXXXXXXXXXXXXXXXXXXVIGEIGKAEASRMKLRAEAFKKYGKTAILNQIIDSMPRIAAEVTSPLQRTKNITIMDSGTGGSLATEVAKLLGSLPPTIQAITGIDITNALSKIP 1223
            GVAQV+V+ E +LL VACEQFLGK  ++I   +LQTLEGHLR+ILGTLTVE ++QDRDQFA+LVR+VA+PDV +MGIEILSFTIKDV+D+V YL+SLG+ QTA V++DADIGVAEAERDAGIREAEC+K  M++++ A+  +AD++R   +QK  F  ++N +KAE++LAYELQAAKE Q+IR EEI+IEVV++ KQI IEE E+ R E +L+A VK+PAE+EAYK+ + AEG K+++I +A+AEA++I   GEA+A     +G+AEA +MKL+AEA+++YG  A    +++++P+IA+ V +PL +T  I I+ SG    +  EV +LL  LP ++ A+TG+D+T    KIP
Sbjct:   71 GVAQVRVITEHDLLAVACEQFLGKTVDEIKLVLLQTLEGHLRSILGTLTVEQIFQDRDQFAKLVRDVAAPDVGRMGIEILSFTIKDVFDRVNYLSSLGKTQTAAVRRDADIGVAEAERDAGIREAECKKEMMDVKFVADIRMADSKRELELQKFAFNQEINTKKAEAQLAYELQAAKESQKIRLEEIEIEVVQRKKQITIEEKEIDRTEKELVAIVKRPAEAEAYKLRQLAEGQKLKKILIAQAEAERIRKIGEAQAATTEAVGRAEAEKMKLKAEAYQQYGDAAKTALVLNALPKIASVVAAPLAKTNEIVIL-SGDRSGVTGEVNRLLAELPVSVNALTGVDLT----KIP 418          

HSP 2 Score: 58.9214 bits (141), Expect = 6.810e-9
Identity = 27/43 (62.79%), Postives = 33/43 (76.74%), Query Frame = 1
Query:   16 IVGGWGWSWWLVCEVQMLSLEVMTLTPKCEQVETSEGVPITVT 144
            I+GG+ W+   V +VQ +SLEVMTL P CE VET+EGV ITVT
Sbjct:   28 IIGGFAWACCCVTDVQRISLEVMTLNPLCESVETAEGVAITVT 70          
BLAST of Flotillin-2 vs. Ensembl Medaka
Match: flot1a (flotillin-1 [Source:NCBI gene;Acc:101155616])

HSP 1 Score: 262.692 bits (670), Expect = 1.387e-82
Identity = 155/356 (43.54%), Postives = 253/356 (71.07%), Query Frame = 3
Query:  165 GVAQVKVMNE-ENLLRVACEQFLGKKREDIANTILQTLEGHLRAILGTLTVEAVYQDRDQFAQLVREVASPDVSKMGIEILSFTIKDVYDKVEYLNSLGRAQTANVKKDADIGVAEAERDAGIREAECEKLRMNIRYQANTEIADAERNFNMQKAIFETQVNQQKAESELAYELQAAKEKQRIRTEEIQXXXXXXXXXXXXXXXXXLRRENDLIASVKKPAESEAYKIERTAEGYKVQQIFXXXXXXXXXXXXXXXXXXVIGEIGKAEASRMKLRAEAFKKYGKTAILNQIIDSMPRIAAEVTSPLQRTKNITIMDSGTG----GSLATEVAKLLGSLPPTIQAITGIDITNALSK 1217
            G+AQ+K+  + + +L  AC+ F+GK   +IA   L+TLEGH RAI+  LTVE +Y+DR +F++ V +VAS D+  MGI ++S+T+KDV+D  +YL+SLG+A+TA V+KDA IG A  +RDA IREA   + +++ +Y+ + E+A A+R++ ++KA ++ +VN +KAESE+AY+LQ AK KQRI  E +Q++VVE+++QI +++ E+ R+E +L A VKKPAE+E Y+ E+ AE  +++ I  A+AEA+ I +KGEAEA  I  +G+AEA +M  +AEAF++Y   A+++ +++ +P +A E++ PL +   IT++ SG G      L+ EV  ++  LP  ++ +TG++I+   S+
Sbjct:   45 GIAQMKIQGQNKQMLAAACQMFMGKSEHEIAQIALETLEGHQRAIIAHLTVEEIYKDRKKFSEQVFKVASSDLVNMGISVVSYTLKDVHDDQDYLHSLGKARTAQVQKDARIGEALNKRDAVIREAHAMQEKISAQYKNDIEMAKAQRDYELKKAAYDIEVNTKKAESEMAYQLQVAKTKQRIEEERMQVQVVERSQQIFLQDQEITRKEKELEAKVKKPAEAERYRQEKLAEAQRLKMIMEAEAEAESIRIKGEAEAYAIEAMGRAEAEQMAKKAEAFQQYKDGAMVDMLMEKLPLMAEEISKPLSQAHKITMVSSGAGEIGAAKLSGEVLDIMTRLPEAVEKLTGVNISLVTSR 400          
BLAST of Flotillin-2 vs. Ensembl Medaka
Match: flot1a (flotillin-1 [Source:NCBI gene;Acc:101155616])

HSP 1 Score: 261.922 bits (668), Expect = 5.188e-82
Identity = 155/356 (43.54%), Postives = 253/356 (71.07%), Query Frame = 3
Query:  165 GVAQVKVMNE-ENLLRVACEQFLGKKREDIANTILQTLEGHLRAILGTLTVEAVYQDRDQFAQLVREVASPDVSKMGIEILSFTIKDVYDKVEYLNSLGRAQTANVKKDADIGVAEAERDAGIREAECEKLRMNIRYQANTEIADAERNFNMQKAIFETQVNQQKAESELAYELQAAKEKQRIRTEEIQXXXXXXXXXXXXXXXXXLRRENDLIASVKKPAESEAYKIERTAEGYKVQQIFXXXXXXXXXXXXXXXXXXVIGEIGKAEASRMKLRAEAFKKYGKTAILNQIIDSMPRIAAEVTSPLQRTKNITIMDSGTG----GSLATEVAKLLGSLPPTIQAITGIDITNALSK 1217
            G+AQ+K+  + + +L  AC+ F+GK   +IA   L+TLEGH RAI+  LTVE +Y+DR +F++ V +VAS D+  MGI ++S+T+KDV+D  +YL+SLG+A+TA V+KDA IG A  +RDA IREA   + +++ +Y+ + E+A A+R++ ++KA ++ +VN +KAESE+AY+LQ AK KQRI  E +Q++VVE+++QI +++ E+ R+E +L A VKKPAE+E Y+ E+ AE  +++ I  A+AEA+ I +KGEAEA  I  +G+AEA +M  +AEAF++Y   A+++ +++ +P +A E++ PL +   IT++ SG G      L+ EV  ++  LP  ++ +TG++I+   S+
Sbjct:   67 GIAQMKIQGQNKQMLAAACQMFMGKSEHEIAQIALETLEGHQRAIIAHLTVEEIYKDRKKFSEQVFKVASSDLVNMGISVVSYTLKDVHDDQDYLHSLGKARTAQVQKDARIGEALNKRDAVIREAHAMQEKISAQYKNDIEMAKAQRDYELKKAAYDIEVNTKKAESEMAYQLQVAKTKQRIEEERMQVQVVERSQQIFLQDQEITRKEKELEAKVKKPAEAERYRQEKLAEAQRLKMIMEAEAEAESIRIKGEAEAYAIEAMGRAEAEQMAKKAEAFQQYKDGAMVDMLMEKLPLMAEEISKPLSQAHKITMVSSGAGEIGAAKLSGEVLDIMTRLPEAVEKLTGVNISLVTSR 422          
BLAST of Flotillin-2 vs. Planmine SMEST
Match: SMESG000017953.1 (SMESG000017953.1)

HSP 1 Score: 639.802 bits (1649), Expect = 0.000e+0
Identity = 359/359 (100.00%), Postives = 359/359 (100.00%), Query Frame = 3
Query:  165 GVAQVKVMNEENLLRVACEQFLGKKREDIANTILQTLEGHLRAILGTLTVEAVYQDRDQFAQLVREVASPDVSKMGIEILSFTIKDVYDKVEYLNSLGRAQTANVKKDADIGVAEAERDAGIREAECEKLRMNIRYQANTEIADAERNFNMQKAIFETQVNQQKAESELAYELQAAKEKQRIRTEEIQXXXXXXXXXXXXXXXXXLRRENDLIASVKKPAESEAYKIERTAEGYKVQQIFXXXXXXXXXXXXXXXXXXVIGEIGKAEASRMKLRAEAFKKYGKTAILNQIIDSMPRIAAEVTSPLQRTKNITIMDSGTGGSLATEVAKLLGSLPPTIQAITGIDITNALSKIPGAEIVA 1241
            GVAQVKVMNEENLLRVACEQFLGKKREDIANTILQTLEGHLRAILGTLTVEAVYQDRDQFAQLVREVASPDVSKMGIEILSFTIKDVYDKVEYLNSLGRAQTANVKKDADIGVAEAERDAGIREAECEKLRMNIRYQANTEIADAERNFNMQKAIFETQVNQQKAESELAYELQAAKEKQRIRTEEIQIEVVEKNKQIIIEENEVLRRENDLIASVKKPAESEAYKIERTAEGYKVQQIFLAKAEAKKIELKGEAEALVIGEIGKAEASRMKLRAEAFKKYGKTAILNQIIDSMPRIAAEVTSPLQRTKNITIMDSGTGGSLATEVAKLLGSLPPTIQAITGIDITNALSKIPGAEIVA
Sbjct:   71 GVAQVKVMNEENLLRVACEQFLGKKREDIANTILQTLEGHLRAILGTLTVEAVYQDRDQFAQLVREVASPDVSKMGIEILSFTIKDVYDKVEYLNSLGRAQTANVKKDADIGVAEAERDAGIREAECEKLRMNIRYQANTEIADAERNFNMQKAIFETQVNQQKAESELAYELQAAKEKQRIRTEEIQIEVVEKNKQIIIEENEVLRRENDLIASVKKPAESEAYKIERTAEGYKVQQIFLAKAEAKKIELKGEAEALVIGEIGKAEASRMKLRAEAFKKYGKTAILNQIIDSMPRIAAEVTSPLQRTKNITIMDSGTGGSLATEVAKLLGSLPPTIQAITGIDITNALSKIPGAEIVA 429          

HSP 2 Score: 103.219 bits (256), Expect = 1.766e-23
Identity = 48/48 (100.00%), Postives = 48/48 (100.00%), Query Frame = 1
Query:    1 KKVKTIVGGWGWSWWLVCEVQMLSLEVMTLTPKCEQVETSEGVPITVT 144
            KKVKTIVGGWGWSWWLVCEVQMLSLEVMTLTPKCEQVETSEGVPITVT
Sbjct:   23 KKVKTIVGGWGWSWWLVCEVQMLSLEVMTLTPKCEQVETSEGVPITVT 70          
BLAST of Flotillin-2 vs. Planmine SMEST
Match: SMESG000024114.1 (SMESG000024114.1)

HSP 1 Score: 430.254 bits (1105), Expect = 1.082e-147
Identity = 235/365 (64.38%), Postives = 298/365 (81.64%), Query Frame = 3
Query:  153 LKYKGVAQVKVMNEENLLRVACEQFLGKKREDIANTILQTLEGHLRAILGTLTVEAVYQDRDQFAQLVREVASPDVSKMGIEILSFTIKDVYDKVEYLNSLGRAQTANVKKDADIGVAEAERDAGIREAECEKLRMNIRYQANTEIADAERNFNMQKAIFETQVNQQKAESELAYELQAAKEKQRIRTEEIQXXXXXXXXXXXXXXXXXLRRENDLIASVKKPAESEAYKIERTAEGYKVQQIFXXXXXXXXXXXXXXXXXXVIGEIGKAEASRMKLRAEAFKKYGKTAILNQIIDSMPRIAAEVTSPLQRTKNITIMDSGTG--GSLATEVAKLLGSLPPTIQAITGIDITNALSKIPGAEIVA 1241
            L   GVAQVKVM E +LL  ACEQFLG++R +I  TILQTL+GHLRAILGTLTVEA+YQDRDQFA  VREVA+PDV+KMGIEILSFTIKDVYDKVEYLNSLGRAQTA VK+DADIGVAEAERDAGIREAECEK RM+IRY+A+TEIA+A R + +QKA F+ +V + +AE+ELA+ELQAAKEKQ+IR+EEIQIEVVE+ K I IEE E+LR E +L  +VKKPAE+EA+K E  A+  + +Q+ LA+ EA+ I LKG AEA  +  IGKAEA RM+L+A A+ KYG  AIL+ ++D++P++AAE+T+PL +T  I I+ SG+     L  E+ +LLG+LPP +QA+TG+DI+ A+ +IPGA +++
Sbjct:   67 LTVTGVAQVKVMTEPSLLATACEQFLGRRRSEIEETILQTLDGHLRAILGTLTVEAIYQDRDQFAHQVREVAAPDVAKMGIEILSFTIKDVYDKVEYLNSLGRAQTAIVKRDADIGVAEAERDAGIREAECEKARMDIRYEADTEIANATRGYQLQKASFDAEVFKVRAEAELAFELQAAKEKQKIRSEEIQIEVVERKKLIEIEEKEILRNEKELEGTVKKPAEAEAFKTEVLADARRTKQVLLAQGEAESIRLKGHAEASSLSAIGKAEAERMRLKAAAYNKYGDAAILSLVLDALPKVAAEITAPLAKTNEIVILGSGSDSKSDLTGEITRLLGNLPPAVQAMTGVDISQAVRQIPGARVIS 431          

HSP 2 Score: 79.7221 bits (195), Expect = 1.021e-15
Identity = 34/46 (73.91%), Postives = 40/46 (86.96%), Query Frame = 1
Query:    7 VKTIVGGWGWSWWLVCEVQMLSLEVMTLTPKCEQVETSEGVPITVT 144
            +KTI+GGWGW+WWLV +VQ +SLEVMTL P CE VET EGVP+TVT
Sbjct:   25 MKTIIGGWGWAWWLVSQVQKISLEVMTLNPTCEHVETKEGVPLTVT 70          
BLAST of Flotillin-2 vs. Planmine SMEST
Match: SMESG000004975.1 (SMESG000004975.1)

HSP 1 Score: 259.996 bits (663), Expect = 2.176e-81
Identity = 155/355 (43.66%), Postives = 245/355 (69.01%), Query Frame = 3
Query:  165 GVAQVKVMNE-ENLLRVACEQFLGKKREDIANTILQTLEGHLRAILGTLTVEAVYQDRDQFAQLVREVASPDVSKMGIEILSFTIKDVYDKVEYLNSLGRAQTANVKKDADIGVAEAERDAGIREAECEKLRMNIRYQANTEIADAERNFNMQKAIFETQVNQQKAESELAYELQAAKEKQRIRTEEIQXXXXXXXXXXXXXXXXXLRRENDLIASVKKPAESEAYKIERTAEGYKVQQIFXXXXXXXXXXXXXXXXXXVIGEIGKAEASRMKLRAEAFKKYGKTAILNQIIDSMPRIAAEVTSPLQRTKNITIMDSGTG----GSLATEVAKLLGSLPPTIQAITGIDITNALS 1214
            GVAQVK+ +  + +L  ACEQFLG+    I +   +TLEGH RAI+G +TVE +Y DR +F++ V EVAS D+  MGI ++S+T+KD++D   YL SLG A+TA VK+D  IG AEA+RDAGI++A+ E+ ++  +    T+IA A+R+F ++KA ++ ++  +KA+S+L+Y LQ A  KQ+I+ EE+QI+VVE+ +Q+ ++E E+ R++ +L A V+KPAE+EAY++++ AE  K++ I  A+ E++ I L GEA A  I  + KAEA +++ +AEA+K YG  A L   ++++P++AAEV SPL     IT++ SGTG      +  EV  ++ +LP  ++ +TG DI   ++
Sbjct:   70 GVAQVKIQSSNKEMLATACEQFLGRSVHQIMDVAKETLEGHQRAIMGNMTVEEIYMDRKKFSKHVFEVASSDLVNMGISVVSYTLKDIHDDEGYLKSLGLARTAQVKRDGRIGEAEAQRDAGIKQAKAEEAQVASKLANETKIAQAQRDFQLKKAEYDKEIETKKAQSQLSYNLQVAVTKQQIKEEEMQIKVVERIQQVKLQELEIQRKDKELEARVRKPAEAEAYRLQKVAEAEKLRIIKEAEGESETIRLNGEARAFAIEALAKAEAEQLEKKAEAWKDYGSAAKLEMFLNTLPKLAAEVASPLSSCHKITMVSSGTGDLGANKITGEVISIMETLPNLVKGMTGFDIAKNMT 424          
BLAST of Flotillin-2 vs. Planmine SMEST
Match: SMESG000064151.1 (SMESG000064151.1)

HSP 1 Score: 243.817 bits (621), Expect = 3.541e-75
Identity = 156/354 (44.07%), Postives = 245/354 (69.21%), Query Frame = 3
Query:  165 GVAQVKVM-NEENLLRVACEQFLGKKREDIANTILQTLEGHLRAILGTLTVEAVYQDRDQFAQLVREVASPDVSKMGIEILSFTIKDVYDKVEYLNSLGRAQTANVKKDADIGVAEAERDAGIREAECEKLRMNIRYQANTEIADAERNFNMQKAIFETQVNQQKAESELAYELQAAKEKQRIRTEEIQXXXXXXXXXXXXXXXXXLRRENDLIASVKKPAESEAYKIERTAEGYKVQQIFXXXXXXXXXXXXXXXXXXVIGEIGKAEASRMKLRAEAFKKYGKTAILNQIIDSMPRIAAEVTSPLQRTKNITIM--DSGTGG--SLATEVAKLLGSLPPTIQAITGIDITNAL 1211
            GVAQVK++ N E  L+ AC  +L  K E IA+   +TLEGH RAI+G +TVE +YQDR +FA  V EVAS D+ +MG++++S+TIK++ D+  YLNSLG ++T+ VK+DA IG AEA RDA +++A  EKL    + +  T+IA AER+F+++KA +E ++  ++AE+ELAY LQAAK +Q+I  EE+QI+VVE+ + I +++ E+ RRE +L ++V+K  E+E YK+E+ A   K++ +  A+A A+  +L+GEAEA  I E  KAEA +M  +AE++K+Y + A L   + ++P+IAAEV +PL     IT++  D+   G   ++ E+  ++  +P  +Q +TG+D+  A+
Sbjct:   68 GVAQVKIISNIEEKLKTACTLYLEMKPEKIADIAKETLEGHQRAIMGLMTVEEIYQDRKKFANAVFEVASRDLFQMGLQVVSYTIKELSDEEGYLNSLGMSRTSQVKRDARIGEAEARRDASVKQAAAEKLETISQLENKTKIAQAERDFSIKKAEYEKEIKTRQAETELAYRLQAAKTRQQIMLEEMQIKVVEREQMITVQDLEIQRRERELDSTVRKQVEAEKYKMEKIAYAEKIRAVREAEASAETTKLRGEAEAFAILEKAKAEAEQMAKKAESWKEYTEAAKLELFLSTLPKIAAEVANPLTSVSKITMVSNDNSPIGITKISDEILSVMDRIPKLVQNMTGLDLLQAV 421          
BLAST of Flotillin-2 vs. Planmine SMEST
Match: SMESG000062944.1 (SMESG000062944.1)

HSP 1 Score: 237.654 bits (605), Expect = 7.692e-73
Identity = 150/354 (42.37%), Postives = 245/354 (69.21%), Query Frame = 3
Query:  165 GVAQVKVM-NEENLLRVACEQFLGKKREDIANTILQTLEGHLRAILGTLTVEAVYQDRDQFAQLVREVASPDVSKMGIEILSFTIKDVYDKVEYLNSLGRAQTANVKKDADIGVAEAERDAGIREAECEKLRMNIRYQANTEIADAERNFNMQKAIFETQVNQQKAESELAYELQAAKEKQRIRTEEIQXXXXXXXXXXXXXXXXXLRRENDLIASVKKPAESEAYKIERTAEGYKVQQIFXXXXXXXXXXXXXXXXXXVIGEIGKAEASRMKLRAEAFKKYGKTAILNQIIDSMPRIAAEVTSPLQRTKNITIMDSGTG----GSLATEVAKLLGSLPPTIQAITGIDITNAL 1211
            GVAQ+K+  +++ +L  ACEQFLGK  ++I +   +TLE H RAI+G +TVE +Y+DR +F+  V EVAS D+  MGI ++S+T+KD+ D   YL +LG A+TA VK+DA IG AEA++D+GI+EA  E+L+   +   + EIA + R++ ++KA FE +V  ++AES+ +Y++QAAK +Q I+ E +QI+V+E+ ++I +E  E+LR++  L A+V+K A++E Y++E+  E    +    A+AEA+KI+LKG AEA  I    +A+A +M L+AEA+++Y + A LN  +D +P++AAEV +P+     I+++ +G+G      L TE+ +++  LP  IQ+ITG +I  ++
Sbjct:   70 GVAQIKINGSDKGMLATACEQFLGKTEDEIRDIAKETLEAHQRAIMGNMTVEEIYKDRKKFSSSVFEVASSDMINMGISVVSYTLKDIQDDEGYLKALGEARTAQVKRDARIGEAEAKKDSGIKEALAEQLKRAAQCSNDVEIAKSSRDYELKKANFEKEVQTKRAESDFSYDIQAAKTQQAIKEEAMQIKVIERMRKIEVERLEILRQDKYLEATVRKTADAEKYRLEKLGEAEMNRICREAEAEAEKIKLKGGAEARAILLRAEADAMQMNLKAEAWQEYQEAARLNMFLDMLPQLAAEVAAPMSNCDKISMICTGSGEIGASKLTTEILEIMEKLPGVIQSITGFNIKESM 423          
The following BLAST results are available for this feature:
BLAST of Flotillin-2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
FLOT23.773e-13159.66flotillin 2 [Source:HGNC Symbol;Acc:HGNC:3758][more]
FLOT21.081e-13060.06flotillin 2 [Source:HGNC Symbol;Acc:HGNC:3758][more]
FLOT23.326e-13059.66flotillin 2 [Source:HGNC Symbol;Acc:HGNC:3758][more]
FLOT25.840e-8559.17flotillin 2 [Source:HGNC Symbol;Acc:HGNC:3758][more]
FLOT11.025e-8444.03flotillin 1 [Source:HGNC Symbol;Acc:HGNC:3757][more]
back to top
BLAST of Flotillin-2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Flotillin-2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Flo21.547e-12458.33gene:FBgn0264078 transcript:FBtr0073952[more]
Flo21.547e-12458.33gene:FBgn0264078 transcript:FBtr0073950[more]
Flo21.818e-12458.33gene:FBgn0264078 transcript:FBtr0330217[more]
Flo21.236e-12157.03gene:FBgn0264078 transcript:FBtr0330214[more]
Flo23.490e-12156.84gene:FBgn0264078 transcript:FBtr0330216[more]
back to top
BLAST of Flotillin-2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
flot2b6.803e-13160.61flotillin 2b [Source:ZFIN;Acc:ZDB-GENE-040426-1368... [more]
flot2a6.427e-13061.19flotillin 2a [Source:NCBI gene;Acc:245698][more]
flot1b1.123e-8244.76flotillin 1b [Source:ZFIN;Acc:ZDB-GENE-020430-2][more]
flot1a7.638e-8244.07flotillin 1a [Source:ZFIN;Acc:ZDB-GENE-020430-1][more]
flot1a1.149e-8144.44flotillin 1a [Source:ZFIN;Acc:ZDB-GENE-020430-1][more]
back to top
BLAST of Flotillin-2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
flot23.201e-12759.10flotillin 2 [Source:NCBI gene;Acc:496443][more]
flot27.704e-12759.10flotillin 2 [Source:NCBI gene;Acc:496443][more]
flot29.770e-12759.10flotillin 2 [Source:NCBI gene;Acc:496443][more]
flot22.637e-12659.43flotillin 2 [Source:NCBI gene;Acc:496443][more]
flot22.943e-12659.10flotillin 2 [Source:NCBI gene;Acc:496443][more]
back to top
BLAST of Flotillin-2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Flot29.051e-13359.66flotillin 2 [Source:MGI Symbol;Acc:MGI:103309][more]
Flot21.539e-13159.66flotillin 2 [Source:MGI Symbol;Acc:MGI:103309][more]
Flot23.049e-13160.06flotillin 2 [Source:MGI Symbol;Acc:MGI:103309][more]
Flot19.840e-8443.02flotillin 1 [Source:MGI Symbol;Acc:MGI:1100500][more]
Flot18.814e-6541.97flotillin 1 [Source:MGI Symbol;Acc:MGI:1100500][more]
back to top
BLAST of Flotillin-2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|A6QLR4|FLOT2_BOVIN9.763e-13160.22Flotillin-2 OS=Bos taurus OX=9913 GN=FLOT2 PE=2 SV... [more]
sp|Q9Z2S9|FLOT2_RAT1.076e-13059.66Flotillin-2 OS=Rattus norvegicus OX=10116 GN=Flot2... [more]
sp|Q60634|FLOT2_MOUSE1.076e-13059.66Flotillin-2 OS=Mus musculus OX=10090 GN=Flot2 PE=1... [more]
sp|Q14254|FLOT2_HUMAN1.812e-13059.66Flotillin-2 OS=Homo sapiens OX=9606 GN=FLOT2 PE=1 ... [more]
sp|Q98TZ8|FLOT2_DANRE4.852e-12961.19Flotillin-2a OS=Danio rerio OX=7955 GN=flot2a PE=2... [more]
back to top
BLAST of Flotillin-2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A068CL831.058e-14364.38Flotillin-2 OS=Dugesia japonica OX=6161 PE=2 SV=1[more]
V9XMS71.287e-14364.11Flotillin-2 OS=Schmidtea mediterranea OX=79327 PE=... [more]
G4V9T23.296e-14061.08Putative flotillin-2 OS=Schistosoma mansoni OX=618... [more]
A0A3Q0KEA03.638e-14061.08Putative flotillin-2 OS=Schistosoma mansoni OX=618... [more]
C1LGS21.282e-13861.08Flotillin 2 OS=Schistosoma japonicum OX=6182 GN=Fl... [more]
back to top
BLAST of Flotillin-2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
flot2a4.550e-12859.66flotillin 2 [Source:NCBI gene;Acc:103045282][more]
flot2a5.839e-12859.66flotillin 2 [Source:NCBI gene;Acc:103045282][more]
flot2b4.692e-12558.92flotillin-2-like [Source:NCBI gene;Acc:103034256][more]
flot2b6.181e-12459.25flotillin-2-like [Source:NCBI gene;Acc:103034256][more]
flot1b2.130e-8144.23flotillin-1-like [Source:NCBI gene;Acc:103034507][more]
back to top
BLAST of Flotillin-2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
flot2a2.582e-13160.22flotillin 2a [Source:NCBI gene;Acc:245698][more]
flot1b1.053e-7945.07flotillin 1b [Source:ZFIN;Acc:ZDB-GENE-020430-2][more]
back to top
BLAST of Flotillin-2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Flotillin-2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO376885.805e-13460.56Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO471822.976e-8445.35Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO259796.910e-3179.41Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO376891.471e-743.86Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Flotillin-2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
flot2a2.859e-12760.91flotillin 2 [Source:NCBI gene;Acc:101169802][more]
flot2a7.577e-12760.74flotillin 2 [Source:NCBI gene;Acc:101169802][more]
ENSORLT00000002428.29.577e-11956.66flotillin-2 [Source:NCBI gene;Acc:101164911][more]
flot1a1.387e-8243.54flotillin-1 [Source:NCBI gene;Acc:101155616][more]
flot1a5.188e-8243.54flotillin-1 [Source:NCBI gene;Acc:101155616][more]
back to top
BLAST of Flotillin-2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000017953.11.766e-23100.00SMESG000017953.1[more]
SMESG000024114.11.082e-14764.38SMESG000024114.1[more]
SMESG000004975.12.176e-8143.66SMESG000004975.1[more]
SMESG000064151.13.541e-7544.07SMESG000064151.1[more]
SMESG000062944.17.692e-7342.37SMESG000062944.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30009745 ID=SMED30009745|Name=Flotillin-2|organism=Schmidtea mediterranea sexual|type=transcript|length=1533bp
AAAAAAGTTAAAACTATTGTTGGAGGTTGGGGTTGGTCTTGGTGGTTAGT
ATGTGAAGTTCAAATGTTGTCACTTGAAGTTATGACATTAACACCAAAAT
GTGAGCAAGTGGAAACTTCTGAAGGAGTGCCAATTACTGTTACTGTTCTA
GGCTTAAATACAAAGGGGTTGCTCAAGTAAAGGTTATGAATGAAGAGAAT
CTCTTAAGAGTAGCTTGTGAGCAGTTTCTAGGAAAAAAACGCGAAGATAT
AGCTAACACTATTTTGCAGACTCTTGAAGGTCACTTGCGTGCTATTCTAG
GAACTTTAACAGTGGAAGCAGTTTATCAAGATAGAGATCAATTTGCTCAG
CTTGTTCGAGAGGTGGCATCTCCTGATGTTAGTAAAATGGGAATTGAAAT
CTTGAGTTTTACTATCAAAGATGTTTATGACAAAGTGGAATATTTGAATT
CGTTAGGTAGAGCTCAAACTGCTAATGTCAAGAAAGATGCAGATATCGGT
GTTGCAGAAGCAGAAAGAGATGCTGGAATAAGAGAAGCTGAGTGTGAAAA
ATTACGAATGAATATTCGTTATCAAGCCAATACGGAAATTGCAGACGCAG
AAAGAAATTTTAATATGCAAAAAGCGATCTTTGAGACTCAGGTTAATCAG
CAAAAAGCTGAATCTGAATTGGCATATGAACTGCAGGCTGCTAAAGAAAA
ACAACGAATTCGTACGGAAGAAATACAAATTGAAGTTGTCGAGAAAAATA
AACAAATAATAATTGAGGAAAATGAAGTTTTACGTCGAGAAAATGATTTG
ATAGCATCCGTAAAAAAACCTGCTGAATCAGAAGCCTATAAAATCGAAAG
AACAGCTGAAGGCTATAAAGTACAACAGATTTTTTTGGCCAAAGCAGAAG
CAAAGAAAATTGAATTGAAAGGTGAAGCTGAGGCATTGGTAATTGGTGAA
ATAGGTAAAGCTGAAGCATCAAGAATGAAGTTAAGAGCAGAAGCTTTTAA
AAAATACGGAAAAACAGCGATTCTTAATCAAATCATCGACAGCATGCCAC
GAATCGCGGCAGAAGTAACAAGTCCATTACAGCGCACAAAGAATATCACA
ATCATGGATAGCGGCACAGGCGGCAGTCTAGCTACAGAAGTGGCAAAACT
TTTAGGATCTCTTCCTCCAACAATTCAAGCAATTACTGGAATTGATATTA
CAAATGCATTATCTAAGATCCCTGGAGCTGAAATTGTAGCTTAATATTTG
AATCAAATTCATTTATTATGCTTATTGAAAAACGAAAAAAATAAATATTT
ACTTGTTTTTTGTTTTTGAAATCAATAAAATAAAAAAAAATTCGCAAATT
AAAAACAATAAAAGCGACATCAAGCTTCATGTGAGCTTTTGCTGTAACAT
ATAAAATCAGAATTTTCAATGAGCCAATCATTCACTCTTCTATGACTTTC
TGAATCCGACAATAAATCCCAAACAACCTCTGTAGAAGTTTCCAGCTCCT
CATTTTCATTTCTATTTCTTGTTTGAGTCGAGG
back to top

protein sequence of SMED30009745-orf-1

>SMED30009745-orf-1 ID=SMED30009745-orf-1|Name=SMED30009745-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=353bp
MNEENLLRVACEQFLGKKREDIANTILQTLEGHLRAILGTLTVEAVYQDR
DQFAQLVREVASPDVSKMGIEILSFTIKDVYDKVEYLNSLGRAQTANVKK
DADIGVAEAERDAGIREAECEKLRMNIRYQANTEIADAERNFNMQKAIFE
TQVNQQKAESELAYELQAAKEKQRIRTEEIQIEVVEKNKQIIIEENEVLR
RENDLIASVKKPAESEAYKIERTAEGYKVQQIFLAKAEAKKIELKGEAEA
LVIGEIGKAEASRMKLRAEAFKKYGKTAILNQIIDSMPRIAAEVTSPLQR
TKNITIMDSGTGGSLATEVAKLLGSLPPTIQAITGIDITNALSKIPGAEI
VA*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000028Category 2 cell
PLANA:0000418head
PLANA:0002075pigment cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR027705Flotillin_fam
IPR036013Band_7/SPFH_dom_sf
IPR001107Band_7
IPR031905Flotillin_C
Vocabulary: biological process
TermDefinition
GO:0001765membrane raft assembly
GO:0007155cell adhesion
GO:0010629negative regulation of gene expression
GO:0044860protein localization to plasma membrane raft
GO:0045661regulation of myoblast differentiation
GO:0050821protein stabilization
GO:0090002establishment of protein localization to plasma membrane
GO:1902992negative regulation of amyloid precursor protein catabolic process
GO:1903905positive regulation of establishment of T cell polarity
Vocabulary: cellular component
TermDefinition
GO:0001931uropod
GO:0002080acrosomal membrane
GO:0005768endosome
GO:0005886plasma membrane
GO:0005901caveola
GO:0005913cell-cell adherens junction
GO:0005925focal adhesion
GO:0016020membrane
GO:0016323basolateral plasma membrane
GO:0016600flotillin complex
GO:0030027lamellipodium
GO:0030139endocytic vesicle
GO:0030864cortical actin cytoskeleton
GO:0031410cytoplasmic vesicle
GO:0031982vesicle
GO:0044291cell-cell contact zone
GO:0045121membrane raft
GO:0048471perinuclear region of cytoplasm
GO:0070062extracellular exosome
Vocabulary: molecular function
TermDefinition
GO:0002020protease binding
GO:0005515protein binding
GO:0035255ionotropic glutamate receptor binding
GO:0046982protein heterodimerization activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 168..202
NoneNo IPR availableGENE3DG3DSA:3.30.479.30coord: 1..84
e-value: 6.4E-28
score: 99.2
NoneNo IPR availablePANTHERPTHR13806:SF39FLOTILLIN 2Bcoord: 1..340
NoneNo IPR availableCDDcd03399SPFH_flotillincoord: 1..101
e-value: 4.08769E-44
score: 146.88
IPR001107Band 7 domainSMARTSM00244PHB_4coord: 10..192
e-value: 7.1E-4
score: 26.7
IPR001107Band 7 domainPFAMPF01145Band_7coord: 16..111
e-value: 1.4E-14
score: 54.5
IPR031905Flotillin, C-terminal domainPFAMPF15975Flotcoord: 237..313
e-value: 6.0E-10
score: 39.4
IPR027705Flotillin familyPANTHERPTHR13806FLOTILLIN-RELATEDcoord: 1..340
IPR036013Band 7/SPFH domain superfamilySUPERFAMILYSSF117892Band 7/SPFH domaincoord: 4..101