Bardet-Biedl syndrome 5 protein homolog

Overview
NameBardet-Biedl syndrome 5 protein homolog
Smed IDSMED30009735
Length (bp)1229
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Bardet-Biedl syndrome 5 protein homolog (SMED30009735) t-SNE clustered cells

Violin plots show distribution of expression levels for Bardet-Biedl syndrome 5 protein homolog (SMED30009735) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Bardet-Biedl syndrome 5 protein homolog (SMED30009735) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Bardet-Biedl syndrome 5 protein homolog (SMED30009735) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30009735

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30009735SMESG000052420.1 SmedASXL_012427SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30009735SMESG000052420.1 dd_Smed_v4_8523_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30009735SMESG000052420.1 dd_Smed_v4_8523_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30009735SMESG000052420.1 dd_Smed_v4_8523_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
epidermal cellSMED30009735SMESG000052420.1 dd_Smed_v4_8523_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30009735SMESG000052420.1 dd_Smed_v6_8523_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30009735SMESG000052420.1 dd_Smed_v4_8523_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30009735SMESG000052420.1 dd_Smed_v4_8523_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Bardet-Biedl syndrome 5 protein homolog vs. Ensembl Human
Match: BBS5 (Bardet-Biedl syndrome 5 [Source:HGNC Symbol;Acc:HGNC:970])

HSP 1 Score: 432.95 bits (1112), Expect = 2.736e-151
Identity = 200/343 (58.31%), Postives = 271/343 (79.01%), Query Frame = 2
Query:   95 ALYDVLWQDRDIQFDCILQDIRNRPGEKIIDSLDSVEDTKGNNGEKGRLIVTNLRLIWHSHNYPKINLSIGYNCVINITTKSVVSKLKGHTEALFVLTKSRTTRYEFIFTNLVTGSTRLFTSVIAVHRAYDTSRLYRDLKLRISLLDNKKVCLLPNEQIYSETPGVWNLSSDQGNLGTFVLTNVRLIWYAAINTNFNVSLPYIQIKYVKVQDSKFGKALVVQTSEQSGGYVLGFRTDPLEKLNSILQETSSLLKVYVKNPNFGVDYEIEDDIGAHNDGRAISVDQSNDDIEIDNGPEQSDVFAAYLADNVGQETSEPVFNEELGLVIGKLKEGFELSDLWNVL 1123
            ++ D LW+DRD++FD   Q ++ RPGE +ID LDS+EDTKGNNG++GRL+VTNLR++WHS    ++N+S+GYNC++NITT++  SKL+G TEAL++LTK  +TR+EFIFTNLV GS RLFTSV+AVHRAY+TS++YRD KLR +L+ NK++ LLP E +Y +  GVWNLSSDQGNLGTF +TNVR++W+A +N +FNVS+PY+QI+ +K++DSKFG ALV+++S+QSGGYVLGF+ DP+EKL   ++E +SL KVY  +P FGVDYE+E+         A++V+Q  DD+EID+    +D F AY AD   Q+  EPVF+EELGL I KLK+GF L  LW V+
Sbjct:    2 SVLDALWEDRDVRFDLSAQQMKTRPGEVLIDCLDSIEDTKGNNGDRGRLLVTNLRILWHSLALSRVNVSVGYNCILNITTRTANSKLRGQTEALYILTKCNSTRFEFIFTNLVPGSPRLFTSVMAVHRAYETSKMYRDFKLRSALIQNKQLRLLPQEHVYDKINGVWNLSSDQGNLGTFFITNVRIVWHANMNDSFNVSIPYLQIRSIKIRDSKFGLALVIESSQQSGGYVLGFKIDPVEKLQESVKEINSLHKVYSASPIFGVDYEMEE---KPQPLEALTVEQIQDDVEIDSDG-HTDAFVAYFADGNKQQDREPVFSEELGLAIEKLKDGFTLQGLWEVM 340          
BLAST of Bardet-Biedl syndrome 5 protein homolog vs. Ensembl Human
Match: BBS5 (Bardet-Biedl syndrome 5 [Source:HGNC Symbol;Acc:HGNC:970])

HSP 1 Score: 394.43 bits (1012), Expect = 1.971e-136
Identity = 189/343 (55.10%), Postives = 252/343 (73.47%), Query Frame = 2
Query:   95 ALYDVLWQDRDIQFDCILQDIRNRPGEKIIDSLDSVEDTKGNNGEKGRLIVTNLRLIWHSHNYPKINLSIGYNCVINITTKSVVSKLKGHTEALFVLTKSRTTRYEFIFTNLVTGSTRLFTSVIAVHRAYDTSRLYRDLKLRISLLDNKKVCLLPNEQIYSETPGVWNLSSDQGNLGTFVLTNVRLIWYAAINTNFNVSLPYIQIKYVKVQDSKFGKALVVQTSEQSGGYVLGFRTDPLEKLNSILQETSSLLKVYVKNPNFGVDYEIEDDIGAHNDGRAISVDQSNDDIEIDNGPEQSDVFAAYLADNVGQETSEPVFNEELGLVIGKLKEGFELSDLWNVL 1123
            ++ D LW+DRD++FD   Q ++ RPGE +ID LDS+EDTKGNNG++GRL+VTNLR++WHS    ++N+S+GYNC++NITT++  SKL+G TEAL++LTK  +TR+EFIFTNLV GS RLFTSV+AVHRAY+TS++YRD KLR +L+ NK++ LLP E +Y +  GVWNLSSDQGNLGTF +TNVR++W+A +N +FNVS+PY+QI                     SGGYVLGF+ DP+EKL   ++E +SL KVY  +P FGVDYE+E+         A++V+Q  DD+EID+    +D F AY AD   Q+  EPVF+EELGL I KLK+GF L  LW V+
Sbjct:    2 SVLDALWEDRDVRFDLSAQQMKTRPGEVLIDCLDSIEDTKGNNGDRGRLLVTNLRILWHSLALSRVNVSVGYNCILNITTRTANSKLRGQTEALYILTKCNSTRFEFIFTNLVPGSPRLFTSVMAVHRAYETSKMYRDFKLRSALIQNKQLRLLPQEHVYDKINGVWNLSSDQGNLGTFFITNVRIVWHANMNDSFNVSIPYLQI---------------------SGGYVLGFKIDPVEKLQESVKEINSLHKVYSASPIFGVDYEMEE---KPQPLEALTVEQIQDDVEIDSDG-HTDAFVAYFADGNKQQDREPVFSEELGLAIEKLKDGFTLQGLWEVM 319          
BLAST of Bardet-Biedl syndrome 5 protein homolog vs. Ensembl Human
Match: AC093899.2 (novel protein)

HSP 1 Score: 394.045 bits (1011), Expect = 5.676e-133
Identity = 180/308 (58.44%), Postives = 247/308 (80.19%), Query Frame = 2
Query:   95 ALYDVLWQDRDIQFDCILQDIRNRPGEKIIDSLDSVEDTKGNNGEKGRLIVTNLRLIWHSHNYPKINLSIGYNCVINITTKSVVSKLKGHTEALFVLTKSRTTRYEFIFTNLVTGSTRLFTSVIAVHRAYDTSRLYRDLKLRISLLDNKKVCLLPNEQIYSETPGVWNLSSDQGNLGTFVLTNVRLIWYAAINTNFNVSLPYIQIKYVKVQDSKFGKALVVQTSEQSGGYVLGFRTDPLEKLNSILQETSSLLKVYVKNPNFGVDYEIEDDIGAHNDGRAISVDQSNDDIEIDNGPEQSDVFAAYLAD 1018
            ++ D LW+DRD++FD   Q ++ RPGE +ID LDS+EDTKGNNG++GRL+VTNLR++WHS    ++N+S+GYNC++NITT++  SKL+G TEAL++LTK  +TR+EFIFTNLV GS RLFTSV+AVHRAY+TS++YRD KLR +L+ NK++ LLP E +Y +  GVWNLSSDQGNLGTF +TNVR++W+A +N +FNVS+PY+QI+ +K++DSKFG ALV+++S+QSGGYVLGF+ DP+EKL   ++E +SL KVY  +P FGVDYE+E+         A++V+Q  DD+EID+    +D F AY AD
Sbjct:    2 SVLDALWEDRDVRFDLSAQQMKTRPGEVLIDCLDSIEDTKGNNGDRGRLLVTNLRILWHSLALSRVNVSVGYNCILNITTRTANSKLRGQTEALYILTKCNSTRFEFIFTNLVPGSPRLFTSVMAVHRAYETSKMYRDFKLRSALIQNKQLRLLPQEHVYDKINGVWNLSSDQGNLGTFFITNVRIVWHANMNDSFNVSIPYLQIRSIKIRDSKFGLALVIESSQQSGGYVLGFKIDPVEKLQESVKEINSLHKVYSASPIFGVDYEMEE---KPQPLEALTVEQIQDDVEIDSD-GHTDAFVAYFAD 305          
BLAST of Bardet-Biedl syndrome 5 protein homolog vs. Ensembl Human
Match: BBS5 (Bardet-Biedl syndrome 5 [Source:HGNC Symbol;Acc:HGNC:970])

HSP 1 Score: 66.2402 bits (160), Expect = 1.373e-13
Identity = 26/46 (56.52%), Postives = 37/46 (80.43%), Query Frame = 2
Query:   95 ALYDVLWQDRDIQFDCILQDIRNRPGEKIIDSLDSVEDTKGNNGEK 232
            ++ D LW+DRD++FD   Q ++ RPGE +ID LDS+EDTKGNNG++
Sbjct:    2 SVLDALWEDRDVRFDLSAQQMKTRPGEVLIDCLDSIEDTKGNNGDR 47          
BLAST of Bardet-Biedl syndrome 5 protein homolog vs. Ensembl Celegans
Match: bbs-5 (Bardet-Biedl syndrome 5 protein homolog [Source:UniProtKB/Swiss-Prot;Acc:Q21626])

HSP 1 Score: 278.485 bits (711), Expect = 8.763e-91
Identity = 151/350 (43.14%), Postives = 233/350 (66.57%), Query Frame = 2
Query:  110 LWQDRDIQFDCILQDIRNRPGEKIIDSLDSVEDTKGNNGEKGRLIVTNLRLIWHSHNYPKINLSIGYNCVINITTK---SVVSKLKG-HTEALFVLTK--SRTTRYEFIFTNLVTGS-TRLFTSVIAVHRAYDTSRLYRDLKLR-ISLLDNKKVCLLPNEQIYSETPGVWNLSSDQGNLGTFVLTNVRLIWYAAINTNFNVSLPYIQIKYVKVQDSKFGKALVVQTSEQSGGYVLGFRTDPLEKLNSILQETSSLLKVYVKNPNFGVDY--EIEDDIGAHN-DGRAISVDQSNDDIEIDNGPEQSDVFAAYL--ADNVGQETSEPVFNEELGLVIGKLKEGFELSDLWNV 1120
            +WQDR+I+FD   + +R   GE  +  ++ VEDTKGNNG++G + VTNLRLIWH+ + P+IN++IG+N +  + +K   S+V++ +G   EA++VL K  + TT++EFIFT     S ++LF ++ ++ RAY+T+++YR+LK+R + + ++  + +LP E I  +  GVWNLS++ G+LG FV+TN+R++WYA +N  +NVS+PYI +  V+V++SKFG ALV++T+  SG YVLGFR DP E+L ++L+   SL K ++  P FGV Y  EI + +     D     +D + DD+EID+   + D FA+Y         E   PV N ELGL I  ++ GF L DLWN+
Sbjct:    9 IWQDREIRFDVDHKLLRLINGEIQVAKIEHVEDTKGNNGDRGTMRVTNLRLIWHAASMPRINITIGWNAITGVQSKQTTSLVTRNRGISNEAIYVLAKVSATTTKFEFIFTTTNPASHSKLFNTISSISRAYETTKMYRELKMRGVFIREDGTLKILPQETIIEKVNGVWNLSTETGSLGVFVITNIRVVWYAEMNIGYNVSVPYITLYSVRVRESKFGMALVLETTTSSGEYVLGFRVDPAERLQNLLKTVQSLHKAHLLKPIFGVSYVKEIAEKVEPRKDDDEIDIIDNNEDDVEIDDKI-RPDAFASYFDGEHTATDEKQLPVLNPELGLAIEPIRNGFTLHDLWNI 357          
BLAST of Bardet-Biedl syndrome 5 protein homolog vs. Ensembl Fly
Match: BBS5 (gene:FBgn0037280 transcript:FBtr0078872)

HSP 1 Score: 297.745 bits (761), Expect = 6.498e-98
Identity = 154/364 (42.31%), Postives = 232/364 (63.74%), Query Frame = 2
Query:   92 KALYDVLWQDRDIQFDCILQDIRNRPGEKIIDSLDSVEDTKGNNGEKGRLIVTNLRLIWHSHNYPKINLSIGYNCVINITTKSVV--SKLKGHTEALFVLTKSRTTRYEFIFTNLVTGSTR----LFTSVIAVHRAYDTSRLYRDLKLRISLLDNKKVCLLPNEQIYSETPGVWNLSSDQGNLGTFVLTNVRLIWYAAINTNFNVSLPYIQIKYVKVQDSKFGKALVVQTSEQSGGYVLGFRTDPLEKLNSILQETSSLLKVYVKNPNFGVDYEIEDDIGAHNDGRAISVDQSNDDIEIDNGPEQSD--------VFAAYLADNV-----GQETSEPVFNEELGLVIGKLKEGFELSDLWNVLP 1126
            + +  +LW+D++++FD        R GE+++D +  +ED+KGN G+ GRL+VTNLR+IWHS  + K NLSIGY  + N  T+ V   SK +  ++AL++L  S  TR+EF+FT++   ++R    +F SV  V+  Y  + LYRDLKLR +++   ++ +LP+E+++S   GVWNLSSDQGNLG+FV+TN+RL+W+A  N  FN+SLPY+QI+ ++V++SK+G ALV+QT+E  GGYVLGFR DP E+LN + +E SSL  VY ++PNFG+ Y   D         A         I++DN  E  +           +YLA+        Q    PV+ +ELG  +  + +G++L DLWNV+P
Sbjct:   13 QPVLQLLWEDKEVKFDVPQLHKNLRSGERVLDYIYHIEDSKGNPGDTGRLMVTNLRIIWHSLVHKKYNLSIGYARIGNTNTRVVHMHSKARIASQALYILAVSNETRFEFLFTDVSGETSRRDQPIFASVFDVYHLYQRTYLYRDLKLRGAIVQAGQLVILPDEEVFSHVQGVWNLSSDQGNLGSFVVTNIRLVWFADANETFNISLPYLQIESLRVRESKYGPALVIQTAETGGGYVLGFRVDPAERLNELFKELSSLHTVYGEHPNFGIQYNAND--ARRRLEAASEEAAQASQIKVDNFEELDERQEREINTKLNSYLAEGCLGKVPSQGERAPVYCKELGFAMEPIGDGYKLQDLWNVMP 374          
BLAST of Bardet-Biedl syndrome 5 protein homolog vs. Ensembl Zebrafish
Match: bbs5 (Bardet-Biedl syndrome 5 [Source:NCBI gene;Acc:393269])

HSP 1 Score: 441.039 bits (1133), Expect = 1.378e-154
Identity = 203/343 (59.18%), Postives = 273/343 (79.59%), Query Frame = 2
Query:   95 ALYDVLWQDRDIQFDCILQDIRNRPGEKIIDSLDSVEDTKGNNGEKGRLIVTNLRLIWHSHNYPKINLSIGYNCVINITTKSVVSKLKGHTEALFVLTKSRTTRYEFIFTNLVTGSTRLFTSVIAVHRAYDTSRLYRDLKLRISLLDNKKVCLLPNEQIYSETPGVWNLSSDQGNLGTFVLTNVRLIWYAAINTNFNVSLPYIQIKYVKVQDSKFGKALVVQTSEQSGGYVLGFRTDPLEKLNSILQETSSLLKVYVKNPNFGVDYEIEDDIGAHNDGRAISVDQSNDDIEIDNGPEQSDVFAAYLADNVGQETSEPVFNEELGLVIGKLKEGFELSDLWNVL 1123
            ++ D LW+DRD++FD   Q ++ RPGE +ID LDS+EDTKGNNG++GRL+VTNLR+IWHS   P++NLS+GYNC+INITT++  SKL+G TEAL++LTKS  TR+EFIFTN+V GS RLFTSVIAVHRAY+TS++YRDLKLR +L+ NK++ LLP EQ+Y +  GVWNLSSDQGNLGTF +TNVR++W+A +N +FNVS+PY+QI+ ++++DSKFG ALV+++S+Q+GGYVLGF+ DP++KL   ++E +SL KVY  NP FGV+YE+E+      +   ++V+Q  DD+EI+   E +D F AY AD   Q   EPVF+EELGL I KLK+GF L  LW V+
Sbjct:    3 SVLDALWEDRDVRFDITAQQMKTRPGEALIDCLDSIEDTKGNNGDRGRLLVTNLRIIWHSLALPRVNLSVGYNCIINITTRTANSKLRGQTEALYILTKSNNTRFEFIFTNVVPGSPRLFTSVIAVHRAYETSKMYRDLKLRGALIQNKQLRLLPQEQVYDKINGVWNLSSDQGNLGTFFITNVRIVWHANMNESFNVSIPYLQIRSIRIRDSKFGLALVIESSQQTGGYVLGFKIDPMDKLQDAVKEINSLHKVYSANPIFGVEYEMEEKPQPLEE---LTVEQPPDDVEIEPD-EHTDAFTAYFADGNKQHDREPVFSEELGLAIEKLKDGFTLQGLWEVM 341          
BLAST of Bardet-Biedl syndrome 5 protein homolog vs. Ensembl Xenopus
Match: bbs5 (Bardet-Biedl syndrome 5 [Source:NCBI gene;Acc:548992])

HSP 1 Score: 437.187 bits (1123), Expect = 5.556e-153
Identity = 202/343 (58.89%), Postives = 275/343 (80.17%), Query Frame = 2
Query:   95 ALYDVLWQDRDIQFDCILQDIRNRPGEKIIDSLDSVEDTKGNNGEKGRLIVTNLRLIWHSHNYPKINLSIGYNCVINITTKSVVSKLKGHTEALFVLTKSRTTRYEFIFTNLVTGSTRLFTSVIAVHRAYDTSRLYRDLKLRISLLDNKKVCLLPNEQIYSETPGVWNLSSDQGNLGTFVLTNVRLIWYAAINTNFNVSLPYIQIKYVKVQDSKFGKALVVQTSEQSGGYVLGFRTDPLEKLNSILQETSSLLKVYVKNPNFGVDYEIEDDIGAHNDGRAISVDQSNDDIEIDNGPEQSDVFAAYLADNVGQETSEPVFNEELGLVIGKLKEGFELSDLWNVL 1123
            ++ D LW+DRD++FD   Q ++ RPGE +ID LDS+EDTKGNNG++GRL+VTNLR+IWHS   P++NL++GYNC+INITT++  SKL+G TEAL++LTK   TR+EFIFTNLV GS RLFTSVIAVHRAY+TS++YRDLKLR +L+ NK++ LLP EQ+Y +  GVWNLSSDQGNLGTF +TNVR++W+A +N +FNVS+PY+QI+ +K++DSKFG ALV+++S+QSGGYVLGF+ DP+EKL   ++E +SL +VY  +P FGV+YE+E+   A  +   ++++Q  DD+EI+   E +D F AY AD   Q+  EPV++EELGL I KLK+GF L  LW+V+
Sbjct:    3 SVLDALWEDRDVRFDISPQQMKMRPGEVLIDCLDSIEDTKGNNGDRGRLLVTNLRVIWHSLALPRVNLAVGYNCIINITTRTANSKLRGQTEALYILTKCNNTRFEFIFTNLVPGSPRLFTSVIAVHRAYETSKMYRDLKLRGALIQNKQLRLLPREQVYDKINGVWNLSSDQGNLGTFFITNVRIVWHANMNDSFNVSIPYLQIRSIKIRDSKFGLALVIESSQQSGGYVLGFKIDPVEKLQDSVKEINSLHRVYSASPIFGVEYEMEEKPQALEE---LTIEQVQDDVEIE-ADEHTDAFVAYFADGNKQQDREPVYSEELGLAIEKLKDGFTLQGLWDVM 341          
BLAST of Bardet-Biedl syndrome 5 protein homolog vs. Ensembl Xenopus
Match: bbs5 (Bardet-Biedl syndrome 5 [Source:NCBI gene;Acc:548992])

HSP 1 Score: 409.068 bits (1050), Expect = 6.605e-142
Identity = 197/345 (57.10%), Postives = 268/345 (77.68%), Query Frame = 2
Query:   95 ALYDVLWQDRDIQFDCILQDIRNRPGEKIIDSLDSVEDTKGNNGEKGRLIVTNLRLIWHSHNYPKINLSIGY--NCVINITTKSVVSKLKGHTEALFVLTKSRTTRYEFIFTNLVTGSTRLFTSVIAVHRAYDTSRLYRDLKLRISLLDNKKVCLLPNEQIYSETPGVWNLSSDQGNLGTFVLTNVRLIWYAAINTNFNVSLPYIQIKYVKVQDSKFGKALVVQTSEQSGGYVLGFRTDPLEKLNSILQETSSLLKVYVKNPNFGVDYEIEDDIGAHNDGRAISVDQSNDDIEIDNGPEQSDVFAAYLADNVGQETSEPVFNEELGLVIGKLKEGFELSDLWNVL 1123
            ++ D LW+DRD++FD   Q ++ RPGE +ID LDS+EDTKGNNG++GRL+VTNLR+IWHS   P++N S+GY  N  IN  ++    KL+G TEAL++LTK   TR+EFIFTNLV GS RLFTSVIAVHRAY+TS++YRDLKLR +L+ NK++ LLP EQ+Y +  GVWNLSSDQGNLGTF +TNVR++W+A +N +FNVS+PY+QI+ +K++DSKFG ALV+++S+QSGGYVLGF+ DP+EKL   ++E +SL +VY  +P FGV+YE+E+   A  +   ++++Q  DD+EI+   E +D F AY AD   Q+  EPV++EELGL I KLK+GF L  LW+V+
Sbjct:    3 SVLDALWEDRDVRFDISPQQMKMRPGEVLIDCLDSIEDTKGNNGDRGRLLVTNLRVIWHSLALPRVN-SLGYCINVPINCMSRQ---KLRGQTEALYILTKCNNTRFEFIFTNLVPGSPRLFTSVIAVHRAYETSKMYRDLKLRGALIQNKQLRLLPREQVYDKINGVWNLSSDQGNLGTFFITNVRIVWHANMNDSFNVSIPYLQIRSIKIRDSKFGLALVIESSQQSGGYVLGFKIDPVEKLQDSVKEINSLHRVYSASPIFGVEYEMEEKPQALEE---LTIEQVQDDVEIE-ADEHTDAFVAYFADGNKQQDREPVYSEELGLAIEKLKDGFTLQGLWDVM 339          
BLAST of Bardet-Biedl syndrome 5 protein homolog vs. Ensembl Xenopus
Match: bbs5 (Bardet-Biedl syndrome 5 [Source:NCBI gene;Acc:548992])

HSP 1 Score: 390.193 bits (1001), Expect = 9.858e-135
Identity = 189/330 (57.27%), Postives = 255/330 (77.27%), Query Frame = 2
Query:  140 CILQDIRNRPGEKIIDSLDSVEDTKGNNGEKGRLIVTNLRLIWHSHNYPKINLSIGY--NCVINITTKSVVSKLKGHTEALFVLTKSRTTRYEFIFTNLVTGSTRLFTSVIAVHRAYDTSRLYRDLKLRISLLDNKKVCLLPNEQIYSETPGVWNLSSDQGNLGTFVLTNVRLIWYAAINTNFNVSLPYIQIKYVKVQDSKFGKALVVQTSEQSGGYVLGFRTDPLEKLNSILQETSSLLKVYVKNPNFGVDYEIEDDIGAHNDGRAISVDQSNDDIEIDNGPEQSDVFAAYLADNVGQETSEPVFNEELGLVIGKLKEGFELSDLWNVL 1123
            C    ++ RPGE +ID LDS+EDTKGNNG++GRL+VTNLR+IWHS   P++N S+GY  N  IN  ++    KL+G TEAL++LTK   TR+EFIFTNLV GS RLFTSVIAVHRAY+TS++YRDLKLR +L+ NK++ LLP EQ+Y +  GVWNLSSDQGNLGTF +TNVR++W+A +N +FNVS+PY+QI+ +K++DSKFG ALV+++S+QSGGYVLGF+ DP+EKL   ++E +SL +VY  +P FGV+YE+E+   A  +   ++++Q  DD+EI+   E +D F AY AD   Q+  EPV++EELGL I KLK+GF L  LW+V+
Sbjct:    1 CFSMQMKMRPGEVLIDCLDSIEDTKGNNGDRGRLLVTNLRVIWHSLALPRVN-SLGYCINVPINCMSRQ---KLRGQTEALYILTKCNNTRFEFIFTNLVPGSPRLFTSVIAVHRAYETSKMYRDLKLRGALIQNKQLRLLPREQVYDKINGVWNLSSDQGNLGTFFITNVRIVWHANMNDSFNVSIPYLQIRSIKIRDSKFGLALVIESSQQSGGYVLGFKIDPVEKLQDSVKEINSLHRVYSASPIFGVEYEMEEKPQALEE---LTIEQVQDDVEIE-ADEHTDAFVAYFADGNKQQDREPVYSEELGLAIEKLKDGFTLQGLWDVM 322          
BLAST of Bardet-Biedl syndrome 5 protein homolog vs. Ensembl Xenopus
Match: bbs5 (Bardet-Biedl syndrome 5 [Source:NCBI gene;Acc:548992])

HSP 1 Score: 389.423 bits (999), Expect = 2.681e-134
Identity = 189/328 (57.62%), Postives = 256/328 (78.05%), Query Frame = 2
Query:  146 LQDIRNRPGEKIIDSLDSVEDTKGNNGEKGRLIVTNLRLIWHSHNYPKINLSIGY--NCVINITTKSVVSKLKGHTEALFVLTKSRTTRYEFIFTNLVTGSTRLFTSVIAVHRAYDTSRLYRDLKLRISLLDNKKVCLLPNEQIYSETPGVWNLSSDQGNLGTFVLTNVRLIWYAAINTNFNVSLPYIQIKYVKVQDSKFGKALVVQTSEQSGGYVLGFRTDPLEKLNSILQETSSLLKVYVKNPNFGVDYEIEDDIGAHNDGRAISVDQSNDDIEIDNGPEQSDVFAAYLADNVGQETSEPVFNEELGLVIGKLKEGFELSDLWNVL 1123
            L+ ++ RPGE +ID LDS+EDTKGNNG++GRL+VTNLR+IWHS   P++N S+GY  N  IN  ++    KL+G TEAL++LTK   TR+EFIFTNLV GS RLFTSVIAVHRAY+TS++YRDLKLR +L+ NK++ LLP EQ+Y +  GVWNLSSDQGNLGTF +TNVR++W+A +N +FNVS+PY+QI+ +K++DSKFG ALV+++S+QSGGYVLGF+ DP+EKL   ++E +SL +VY  +P FGV+YE+E+   A  +   ++++Q  DD+EI+   E +D F AY AD   Q+  EPV++EELGL I KLK+GF L  LW+V+
Sbjct:    7 LRQMKMRPGEVLIDCLDSIEDTKGNNGDRGRLLVTNLRVIWHSLALPRVN-SLGYCINVPINCMSRQ---KLRGQTEALYILTKCNNTRFEFIFTNLVPGSPRLFTSVIAVHRAYETSKMYRDLKLRGALIQNKQLRLLPREQVYDKINGVWNLSSDQGNLGTFFITNVRIVWHANMNDSFNVSIPYLQIRSIKIRDSKFGLALVIESSQQSGGYVLGFKIDPVEKLQDSVKEINSLHRVYSASPIFGVEYEMEEKPQALEE---LTIEQVQDDVEIE-ADEHTDAFVAYFADGNKQQDREPVYSEELGLAIEKLKDGFTLQGLWDVM 326          
BLAST of Bardet-Biedl syndrome 5 protein homolog vs. Ensembl Xenopus
Match: bbs5 (Bardet-Biedl syndrome 5 [Source:NCBI gene;Acc:548992])

HSP 1 Score: 366.311 bits (939), Expect = 8.487e-125
Identity = 172/302 (56.95%), Postives = 236/302 (78.15%), Query Frame = 2
Query:   95 ALYDVLWQDRDIQFDCILQDIRNRPGEKIIDSLDSVEDTKGNNGEKGRLIVTNLRLIWHSHNYPKINLSIGYNCVINITTKSVVSKLKGHTEALFVLTKSRTTRYEFIFTNLVTGSTRLFTSVIAVHRAYDTSRLYRDLKLRISLLDNKKVCLLPNEQIYSETPGVWNLSSDQGNLGTFVLTNVRLIWYAAINTNFNVSLPYIQIKYVKVQDSKFGKALVVQTSEQSGGYVLGFRTDPLEKLNSILQETSSLLKVYVKNPNFGVDYEIEDDIGAHNDGRAISVDQSNDDIEIDNGPEQSDVF 1000
            ++ D LW+DRD++FD   Q ++ RPGE +ID LDS+EDTKGNNG++GRL+VTNLR+IWHS   P++NL    N  IN  ++    KL+G TEAL++LTK   TR+EFIFTNLV GS RLFTSVIAVHRAY+TS++YRDLKLR +L+ NK++ LLP EQ+Y +  GVWNLSSDQGNLGTF +TNVR++W+A +N +FNVS+PY+QI+ +K++DSKFG ALV+++S+QSGGYVLGF+ DP+EKL   ++E +SL +VY  +P FGV+YE+E+   A  +   ++++Q  DD+EI+   E +D F
Sbjct:    3 SVLDALWEDRDVRFDISPQQMKMRPGEVLIDCLDSIEDTKGNNGDRGRLLVTNLRVIWHSLALPRVNLGYCINVPINCMSRQ---KLRGQTEALYILTKCNNTRFEFIFTNLVPGSPRLFTSVIAVHRAYETSKMYRDLKLRGALIQNKQLRLLPREQVYDKINGVWNLSSDQGNLGTFFITNVRIVWHANMNDSFNVSIPYLQIRSIKIRDSKFGLALVIESSQQSGGYVLGFKIDPVEKLQDSVKEINSLHRVYSASPIFGVEYEMEEKPQALEE---LTIEQVQDDVEIE-ADEHTDAF 297          
BLAST of Bardet-Biedl syndrome 5 protein homolog vs. Ensembl Mouse
Match: Bbs5 (Bardet-Biedl syndrome 5 (human) [Source:MGI Symbol;Acc:MGI:1919819])

HSP 1 Score: 440.269 bits (1131), Expect = 2.735e-154
Identity = 205/343 (59.77%), Postives = 274/343 (79.88%), Query Frame = 2
Query:   95 ALYDVLWQDRDIQFDCILQDIRNRPGEKIIDSLDSVEDTKGNNGEKGRLIVTNLRLIWHSHNYPKINLSIGYNCVINITTKSVVSKLKGHTEALFVLTKSRTTRYEFIFTNLVTGSTRLFTSVIAVHRAYDTSRLYRDLKLRISLLDNKKVCLLPNEQIYSETPGVWNLSSDQGNLGTFVLTNVRLIWYAAINTNFNVSLPYIQIKYVKVQDSKFGKALVVQTSEQSGGYVLGFRTDPLEKLNSILQETSSLLKVYVKNPNFGVDYEIEDDIGAHNDGRAISVDQSNDDIEIDNGPEQSDVFAAYLADNVGQETSEPVFNEELGLVIGKLKEGFELSDLWNVL 1123
            ++ DVLW+DRD++FD   Q ++ RPGE +ID LDS+EDTKGNNG++GRL+VTNLR+IWHS   P++NLSIGYNC++NITT++  SKL+G TEAL++LTK  TTR+EFIFTNLV GS RLFTSVIAVHRAY+TS++YRD KLR +++ NK++ LLP E +Y +  GVWNLSSDQGNLGTF +TNVR++W+A +N +FNVS+PY+QI+ +K++DSKFG ALV+++S+QSGGYVLGF+ DP+EKL   ++E +SL KVY  +P FGV+YE+E+         A++V+Q  DD+EID+  + +D F AY AD   Q+  EPVF+EELGL I KLK+GF L  LW V+
Sbjct:    2 SVLDVLWEDRDVRFDVSSQQMKTRPGEVLIDCLDSIEDTKGNNGDRGRLLVTNLRIIWHSLALPRVNLSIGYNCILNITTRTANSKLRGQTEALYILTKCNTTRFEFIFTNLVPGSPRLFTSVIAVHRAYETSKMYRDFKLRSAVIQNKQLRLLPQEHVYDKINGVWNLSSDQGNLGTFFITNVRIVWHANMNDSFNVSIPYLQIRSIKIRDSKFGLALVIESSQQSGGYVLGFKIDPVEKLQESVKEINSLHKVYSASPIFGVNYEMEE---KPQPLEALTVEQIQDDVEIDSD-DHTDAFVAYFADGNKQQDREPVFSEELGLAIEKLKDGFTLQGLWEVM 340          
BLAST of Bardet-Biedl syndrome 5 protein homolog vs. Ensembl Mouse
Match: Bbs5 (Bardet-Biedl syndrome 5 (human) [Source:MGI Symbol;Acc:MGI:1919819])

HSP 1 Score: 401.749 bits (1031), Expect = 2.003e-139
Identity = 194/343 (56.56%), Postives = 255/343 (74.34%), Query Frame = 2
Query:   95 ALYDVLWQDRDIQFDCILQDIRNRPGEKIIDSLDSVEDTKGNNGEKGRLIVTNLRLIWHSHNYPKINLSIGYNCVINITTKSVVSKLKGHTEALFVLTKSRTTRYEFIFTNLVTGSTRLFTSVIAVHRAYDTSRLYRDLKLRISLLDNKKVCLLPNEQIYSETPGVWNLSSDQGNLGTFVLTNVRLIWYAAINTNFNVSLPYIQIKYVKVQDSKFGKALVVQTSEQSGGYVLGFRTDPLEKLNSILQETSSLLKVYVKNPNFGVDYEIEDDIGAHNDGRAISVDQSNDDIEIDNGPEQSDVFAAYLADNVGQETSEPVFNEELGLVIGKLKEGFELSDLWNVL 1123
            ++ DVLW+DRD++FD   Q ++ RPGE +ID LDS+EDTKGNNG++GRL+VTNLR+IWHS   P++NLSIGYNC++NITT++  SKL+G TEAL++LTK  TTR+EFIFTNLV GS RLFTSVIAVHRAY+TS++YRD KLR +++ NK++ LLP E +Y +  GVWNLSSDQGNLGTF +TNVR++W+A +N +FNVS+PY+QI                     SGGYVLGF+ DP+EKL   ++E +SL KVY  +P FGV+YE+E+         A++V+Q  DD+EID+  + +D F AY AD   Q+  EPVF+EELGL I KLK+GF L  LW V+
Sbjct:    2 SVLDVLWEDRDVRFDVSSQQMKTRPGEVLIDCLDSIEDTKGNNGDRGRLLVTNLRIIWHSLALPRVNLSIGYNCILNITTRTANSKLRGQTEALYILTKCNTTRFEFIFTNLVPGSPRLFTSVIAVHRAYETSKMYRDFKLRSAVIQNKQLRLLPQEHVYDKINGVWNLSSDQGNLGTFFITNVRIVWHANMNDSFNVSIPYLQI---------------------SGGYVLGFKIDPVEKLQESVKEINSLHKVYSASPIFGVNYEMEE---KPQPLEALTVEQIQDDVEIDSD-DHTDAFVAYFADGNKQQDREPVFSEELGLAIEKLKDGFTLQGLWEVM 319          
BLAST of Bardet-Biedl syndrome 5 protein homolog vs. Ensembl Mouse
Match: Bbs5 (Bardet-Biedl syndrome 5 (human) [Source:MGI Symbol;Acc:MGI:1919819])

HSP 1 Score: 125.561 bits (314), Expect = 4.395e-35
Identity = 53/87 (60.92%), Postives = 73/87 (83.91%), Query Frame = 2
Query:   95 ALYDVLWQDRDIQFDCILQDIRNRPGEKIIDSLDSVEDTKGNNGEKGRLIVTNLRLIWHSHNYPKINLSIGYNCVINITTKSVVSKL 355
            ++ DVLW+DRD++FD   Q ++ RPGE +ID LDS+EDTKGNNG++GRL+VTNLR+IWHS   P++NLSIGYNC++NITT++  S +
Sbjct:    2 SVLDVLWEDRDVRFDVSSQQMKTRPGEVLIDCLDSIEDTKGNNGDRGRLLVTNLRIIWHSLALPRVNLSIGYNCILNITTRTANSSI 88          
BLAST of Bardet-Biedl syndrome 5 protein homolog vs. Ensembl Mouse
Match: Bbs5 (Bardet-Biedl syndrome 5 (human) [Source:MGI Symbol;Acc:MGI:1919819])

HSP 1 Score: 77.411 bits (189), Expect = 3.131e-17
Identity = 49/139 (35.25%), Postives = 68/139 (48.92%), Query Frame = 2
Query:  707 IKYVKVQDSKFGKALVVQTSEQSGGYVLGFRTDPLEKLNSILQETSSLLKVYVKNPNFGVDYEIEDDIGAHNDGRAISVDQSNDDIEIDNGPEQSDVFAAYLADNVGQETSEPVFNEELGLVIGKLKEGFELSDLWNVL 1123
            I+ +K++DSKFG ALV+++S+Q           PLE                                       A++V+Q  DD+EID+  + +D F AY AD   Q+  EPVF+EELGL I KLK+GF L  LW V+
Sbjct:    2 IRSIKIRDSKFGLALVIESSQQP---------QPLE---------------------------------------ALTVEQIQDDVEIDSD-DHTDAFVAYFADGNKQQDREPVFSEELGLAIEKLKDGFTLQGLWEVM 91          
BLAST of Bardet-Biedl syndrome 5 protein homolog vs. UniProt/SwissProt
Match: sp|Q7ZWB7|BBS5_DANRE (Bardet-Biedl syndrome 5 protein homolog OS=Danio rerio OX=7955 GN=bbs5 PE=2 SV=1)

HSP 1 Score: 441.039 bits (1133), Expect = 1.040e-153
Identity = 203/343 (59.18%), Postives = 273/343 (79.59%), Query Frame = 2
Query:   95 ALYDVLWQDRDIQFDCILQDIRNRPGEKIIDSLDSVEDTKGNNGEKGRLIVTNLRLIWHSHNYPKINLSIGYNCVINITTKSVVSKLKGHTEALFVLTKSRTTRYEFIFTNLVTGSTRLFTSVIAVHRAYDTSRLYRDLKLRISLLDNKKVCLLPNEQIYSETPGVWNLSSDQGNLGTFVLTNVRLIWYAAINTNFNVSLPYIQIKYVKVQDSKFGKALVVQTSEQSGGYVLGFRTDPLEKLNSILQETSSLLKVYVKNPNFGVDYEIEDDIGAHNDGRAISVDQSNDDIEIDNGPEQSDVFAAYLADNVGQETSEPVFNEELGLVIGKLKEGFELSDLWNVL 1123
            ++ D LW+DRD++FD   Q ++ RPGE +ID LDS+EDTKGNNG++GRL+VTNLR+IWHS   P++NLS+GYNC+INITT++  SKL+G TEAL++LTKS  TR+EFIFTN+V GS RLFTSVIAVHRAY+TS++YRDLKLR +L+ NK++ LLP EQ+Y +  GVWNLSSDQGNLGTF +TNVR++W+A +N +FNVS+PY+QI+ ++++DSKFG ALV+++S+Q+GGYVLGF+ DP++KL   ++E +SL KVY  NP FGV+YE+E+      +   ++V+Q  DD+EI+   E +D F AY AD   Q   EPVF+EELGL I KLK+GF L  LW V+
Sbjct:    3 SVLDALWEDRDVRFDITAQQMKTRPGEALIDCLDSIEDTKGNNGDRGRLLVTNLRIIWHSLALPRVNLSVGYNCIINITTRTANSKLRGQTEALYILTKSNNTRFEFIFTNVVPGSPRLFTSVIAVHRAYETSKMYRDLKLRGALIQNKQLRLLPQEQVYDKINGVWNLSSDQGNLGTFFITNVRIVWHANMNESFNVSIPYLQIRSIRIRDSKFGLALVIESSQQTGGYVLGFKIDPMDKLQDAVKEINSLHKVYSANPIFGVEYEMEEKPQPLEE---LTVEQPPDDVEIEPD-EHTDAFTAYFADGNKQHDREPVFSEELGLAIEKLKDGFTLQGLWEVM 341          
BLAST of Bardet-Biedl syndrome 5 protein homolog vs. UniProt/SwissProt
Match: sp|Q9CZQ9|BBS5_MOUSE (Bardet-Biedl syndrome 5 protein homolog OS=Mus musculus OX=10090 GN=Bbs5 PE=1 SV=1)

HSP 1 Score: 440.269 bits (1131), Expect = 1.913e-153
Identity = 205/343 (59.77%), Postives = 274/343 (79.88%), Query Frame = 2
Query:   95 ALYDVLWQDRDIQFDCILQDIRNRPGEKIIDSLDSVEDTKGNNGEKGRLIVTNLRLIWHSHNYPKINLSIGYNCVINITTKSVVSKLKGHTEALFVLTKSRTTRYEFIFTNLVTGSTRLFTSVIAVHRAYDTSRLYRDLKLRISLLDNKKVCLLPNEQIYSETPGVWNLSSDQGNLGTFVLTNVRLIWYAAINTNFNVSLPYIQIKYVKVQDSKFGKALVVQTSEQSGGYVLGFRTDPLEKLNSILQETSSLLKVYVKNPNFGVDYEIEDDIGAHNDGRAISVDQSNDDIEIDNGPEQSDVFAAYLADNVGQETSEPVFNEELGLVIGKLKEGFELSDLWNVL 1123
            ++ DVLW+DRD++FD   Q ++ RPGE +ID LDS+EDTKGNNG++GRL+VTNLR+IWHS   P++NLSIGYNC++NITT++  SKL+G TEAL++LTK  TTR+EFIFTNLV GS RLFTSVIAVHRAY+TS++YRD KLR +++ NK++ LLP E +Y +  GVWNLSSDQGNLGTF +TNVR++W+A +N +FNVS+PY+QI+ +K++DSKFG ALV+++S+QSGGYVLGF+ DP+EKL   ++E +SL KVY  +P FGV+YE+E+         A++V+Q  DD+EID+  + +D F AY AD   Q+  EPVF+EELGL I KLK+GF L  LW V+
Sbjct:    2 SVLDVLWEDRDVRFDVSSQQMKTRPGEVLIDCLDSIEDTKGNNGDRGRLLVTNLRIIWHSLALPRVNLSIGYNCILNITTRTANSKLRGQTEALYILTKCNTTRFEFIFTNLVPGSPRLFTSVIAVHRAYETSKMYRDFKLRSAVIQNKQLRLLPQEHVYDKINGVWNLSSDQGNLGTFFITNVRIVWHANMNDSFNVSIPYLQIRSIKIRDSKFGLALVIESSQQSGGYVLGFKIDPVEKLQESVKEINSLHKVYSASPIFGVNYEMEE---KPQPLEALTVEQIQDDVEIDSD-DHTDAFVAYFADGNKQQDREPVFSEELGLAIEKLKDGFTLQGLWEVM 340          
BLAST of Bardet-Biedl syndrome 5 protein homolog vs. UniProt/SwissProt
Match: sp|Q4R649|BBS5_MACFA (Bardet-Biedl syndrome 5 protein homolog OS=Macaca fascicularis OX=9541 GN=BBS5 PE=2 SV=2)

HSP 1 Score: 433.721 bits (1114), Expect = 7.206e-151
Identity = 200/343 (58.31%), Postives = 272/343 (79.30%), Query Frame = 2
Query:   95 ALYDVLWQDRDIQFDCILQDIRNRPGEKIIDSLDSVEDTKGNNGEKGRLIVTNLRLIWHSHNYPKINLSIGYNCVINITTKSVVSKLKGHTEALFVLTKSRTTRYEFIFTNLVTGSTRLFTSVIAVHRAYDTSRLYRDLKLRISLLDNKKVCLLPNEQIYSETPGVWNLSSDQGNLGTFVLTNVRLIWYAAINTNFNVSLPYIQIKYVKVQDSKFGKALVVQTSEQSGGYVLGFRTDPLEKLNSILQETSSLLKVYVKNPNFGVDYEIEDDIGAHNDGRAISVDQSNDDIEIDNGPEQSDVFAAYLADNVGQETSEPVFNEELGLVIGKLKEGFELSDLWNVL 1123
            ++ D LW+DRD++FD   Q ++ RPGE +ID LDS+EDTKGNNG++GRL+VTNLR++WHS    ++N+S+GYNC++NITT++  SKL+G TEAL++LTK  +TR+EFIFTNLV GS RLFTSV+AVHRAY+TS++YRD KLR +L+ NK++ LLP E +Y +  GVWNLSSDQGNLGTF +TNVR++W+A +N +FNVS+PY+QI+ +K++DSKFG ALV+++S+QSGGYVLGF+ DP+EKL   ++E +SL KVY  +P FGVDYE+E+         A++V+Q  DD+EID+  + +D F AY AD   Q+  EPVF+EELGL I KLK+GF L  LW V+
Sbjct:    2 SVLDALWEDRDVRFDLSSQQMKTRPGEVLIDCLDSIEDTKGNNGDRGRLLVTNLRILWHSLALSRVNVSVGYNCILNITTRTANSKLRGQTEALYILTKCNSTRFEFIFTNLVPGSPRLFTSVMAVHRAYETSKMYRDFKLRSALIQNKQLRLLPQEHVYDKINGVWNLSSDQGNLGTFFITNVRIVWHANMNDSFNVSIPYLQIRSIKIRDSKFGLALVIESSQQSGGYVLGFKIDPVEKLQESVKEINSLHKVYSASPIFGVDYEMEE---KPQPLEALTVEQIQDDVEIDSD-DHTDAFVAYFADGNKQQDREPVFSEELGLAIEKLKDGFTLQGLWEVM 340          
BLAST of Bardet-Biedl syndrome 5 protein homolog vs. UniProt/SwissProt
Match: sp|Q8N3I7|BBS5_HUMAN (Bardet-Biedl syndrome 5 protein OS=Homo sapiens OX=9606 GN=BBS5 PE=1 SV=1)

HSP 1 Score: 432.95 bits (1112), Expect = 1.314e-150
Identity = 200/343 (58.31%), Postives = 271/343 (79.01%), Query Frame = 2
Query:   95 ALYDVLWQDRDIQFDCILQDIRNRPGEKIIDSLDSVEDTKGNNGEKGRLIVTNLRLIWHSHNYPKINLSIGYNCVINITTKSVVSKLKGHTEALFVLTKSRTTRYEFIFTNLVTGSTRLFTSVIAVHRAYDTSRLYRDLKLRISLLDNKKVCLLPNEQIYSETPGVWNLSSDQGNLGTFVLTNVRLIWYAAINTNFNVSLPYIQIKYVKVQDSKFGKALVVQTSEQSGGYVLGFRTDPLEKLNSILQETSSLLKVYVKNPNFGVDYEIEDDIGAHNDGRAISVDQSNDDIEIDNGPEQSDVFAAYLADNVGQETSEPVFNEELGLVIGKLKEGFELSDLWNVL 1123
            ++ D LW+DRD++FD   Q ++ RPGE +ID LDS+EDTKGNNG++GRL+VTNLR++WHS    ++N+S+GYNC++NITT++  SKL+G TEAL++LTK  +TR+EFIFTNLV GS RLFTSV+AVHRAY+TS++YRD KLR +L+ NK++ LLP E +Y +  GVWNLSSDQGNLGTF +TNVR++W+A +N +FNVS+PY+QI+ +K++DSKFG ALV+++S+QSGGYVLGF+ DP+EKL   ++E +SL KVY  +P FGVDYE+E+         A++V+Q  DD+EID+    +D F AY AD   Q+  EPVF+EELGL I KLK+GF L  LW V+
Sbjct:    2 SVLDALWEDRDVRFDLSAQQMKTRPGEVLIDCLDSIEDTKGNNGDRGRLLVTNLRILWHSLALSRVNVSVGYNCILNITTRTANSKLRGQTEALYILTKCNSTRFEFIFTNLVPGSPRLFTSVMAVHRAYETSKMYRDFKLRSALIQNKQLRLLPQEHVYDKINGVWNLSSDQGNLGTFFITNVRIVWHANMNDSFNVSIPYLQIRSIKIRDSKFGLALVIESSQQSGGYVLGFKIDPVEKLQESVKEINSLHKVYSASPIFGVDYEMEE---KPQPLEALTVEQIQDDVEIDSDG-HTDAFVAYFADGNKQQDREPVFSEELGLAIEKLKDGFTLQGLWEVM 340          
BLAST of Bardet-Biedl syndrome 5 protein homolog vs. UniProt/SwissProt
Match: sp|Q66IS6|BBS5_XENLA (Bardet-Biedl syndrome 5 protein homolog OS=Xenopus laevis OX=8355 GN=bbs5 PE=2 SV=1)

HSP 1 Score: 391.349 bits (1004), Expect = 7.533e-134
Identity = 180/319 (56.43%), Postives = 251/319 (78.68%), Query Frame = 2
Query:   95 ALYDVLWQDRDIQFDCILQDIRNRPGEKIIDSLDSVEDTKGNNGEKGRLIVTNLRLIWHSHNYPKINLSIGYNCVINITTKSVVSKLKGHTEALFVLTKSRTTRYEFIFTNLVTGSTRLFTSVIAVHRAYDTSRLYRDLKLRISLLDNKKVCLLPNEQIYSETPGVWNLSSDQGNLGTFVLTNVRLIWYAAINTNFNVSLPYIQIKYVKVQDSKFGKALVVQTSEQSGGYVLGFRTDPLEKLNSILQETSSLLKVYVKNPNFGVDYEIEDDIGAHNDGRAISVDQSNDDIEIDNGPEQSDVFAAYLADNVGQETSEPVF 1051
            ++ D LW+DRD++FD   Q ++ RPGE +ID LDS+EDTKGNNG++GRL+VTNLR+IWHS   P++NL++GYNC+INITT++  SKL+G TEAL++LTK   TR+EFIFTNLV GS RLFTSVIAVHRAY+TS++YRDLKLR +L+ NK++ LLP EQ+Y +  GVWNLSSDQGNLGTF +TNVR++W+A +N +FNVS+PY+QI+ +K++DSKFG ALV+++S+QSGGYVLGF+ DP+EKL   ++E +SL +VY  +P FGV+YE+E+   A  +   ++++Q  DD+EI+   E +D F       +   T + ++
Sbjct:    3 SVLDALWEDRDVRFDISPQQMKMRPGEVLIDCLDSIEDTKGNNGDRGRLLVTNLRVIWHSLALPRVNLAVGYNCIINITTRTANSKLRGQTEALYILTKCNNTRFEFIFTNLVPGSPRLFTSVIAVHRAYETSKMYRDLKLRGALIQNKQLKLLPREQVYDKINGVWNLSSDQGNLGTFFITNVRIVWHANMNDSFNVSIPYLQIRSIKIRDSKFGLALVIESSQQSGGYVLGFKIDPVEKLQDSVKEINSLHRVYSASPIFGVEYEMEEKPQALEE---LTIEQVQDDVEIE-ADEHTDAFVVSRLSRISYFTRQIIY 317          
BLAST of Bardet-Biedl syndrome 5 protein homolog vs. TrEMBL
Match: R7V9C2 (Uncharacterized protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_176376 PE=4 SV=1)

HSP 1 Score: 454.907 bits (1169), Expect = 1.121e-156
Identity = 211/344 (61.34%), Postives = 274/344 (79.65%), Query Frame = 2
Query:   98 LYDVLWQDRDIQFDCILQDIRNRPGEKIIDSLDSVEDTKGNNGEKGRLIVTNLRLIWHSHNYPKINLSIGYNCVINITTKSVVSKLKGHTEALFVLTKSRTTRYEFIFTNLVTGSTRLFTSVIAVHRAYDTSRLYRDLKLRISLLDNKKVCLLPNEQIYSETPGVWNLSSDQGNLGTFVLTNVRLIWYAAINTNFNVSLPYIQIKYVKVQDSKFGKALVVQTSEQSGGYVLGFRTDPLEKLNSILQETSSLLKVYVKNPNFGVDYEIEDDIGAHNDGRAISVDQSNDDIEIDNGPEQSDVFAAYLADNVGQETSEPVFNEELGLVIGKLKEGFELSDLWNVLPK 1129
            + D LW+DRD++FD  +Q ++ RPGEK++D LDS+EDTKGNNGE+GRLIVTNLRLIWHS   P++NLSIGYNCV+NI+TK+  SKL+G+ EALFVLTK  +TR+EFIFTNLV GS RLFTSVIAVHRAY+T+++YR+L+LR +L+ NK + LLP EQ+Y +  GVWNLSSDQGNLGTF +TNVRL+W+A +N  FNVS+PY+Q+K VKV+DSKFG ALV+++S  SGGYVLGFR DP+EKL+  ++E  SL +VY   P FG++YE ED + +  +   ++V+   DD+EIDN  +QSD FAAY AD   Q   EPVF+E+LGL I KLK+GF L+ LW V+ +
Sbjct:    1 MADSLWEDRDVRFDISIQQMQMRPGEKLVDRLDSIEDTKGNNGERGRLIVTNLRLIWHSQAMPRVNLSIGYNCVLNISTKTAQSKLRGNAEALFVLTKCNSTRFEFIFTNLVPGSPRLFTSVIAVHRAYETTKMYRELRLRGALIQNKTLRLLPQEQVYDKVNGVWNLSSDQGNLGTFFITNVRLVWHANMNEAFNVSIPYLQMKTVKVRDSKFGLALVIESSASSGGYVLGFRIDPVEKLHEAVKEIQSLHRVYSSCPIFGIEYETEDKVQSIQE---LTVESVQDDVEIDNSADQSDAFAAYFADGNKQTDREPVFSEDLGLAIEKLKDGFTLTGLWEVVAQ 341          
BLAST of Bardet-Biedl syndrome 5 protein homolog vs. TrEMBL
Match: A0A3P9LKF4 (Bardet-Biedl syndrome 5 protein homolog OS=Oryzias latipes OX=8090 PE=3 SV=1)

HSP 1 Score: 447.588 bits (1150), Expect = 6.864e-154
Identity = 212/346 (61.27%), Postives = 275/346 (79.48%), Query Frame = 2
Query:   86 MSKALYDVLWQDRDIQFDCILQDIRNRPGEKIIDSLDSVEDTKGNNGEKGRLIVTNLRLIWHSHNYPKINLSIGYNCVINITTKSVVSKLKGHTEALFVLTKSRTTRYEFIFTNLVTGSTRLFTSVIAVHRAYDTSRLYRDLKLRISLLDNKKVCLLPNEQIYSETPGVWNLSSDQGNLGTFVLTNVRLIWYAAINTNFNVSLPYIQIKYVKVQDSKFGKALVVQTSEQSGGYVLGFRTDPLEKLNSILQETSSLLKVYVKNPNFGVDYEIEDDIGAHNDGRAISVDQSNDDIEIDNGPEQSDVFAAYLADNVGQETSEPVFNEELGLVIGKLKEGFELSDLWNVL 1123
            M+ AL D LW+DRD++FD   Q ++ RPGE +ID LDS+EDTKGNNG++GRL+VTNLR+IWHS   P++NLS+GYN +INITT++  SKL+G TEAL++LTKS  TR+EFIFTNLV GS RLFTSVIAVHRAY+TS++YRDLKLR +L+ NK++ LLP EQ+Y +  GVWNLSSDQGNLGTF +TNVR++W+A +N +FNVS+PY+QI  ++++DSKFG ALV+++S QSGGYVLGF+ DP++KL   L+E +SL KVY  NP FGVDYE+E+      +   ++VDQ  DD+EI+   EQ+D F AY AD V Q+  EPVF+EELGL I KLK+GF L  LW V+
Sbjct:    1 MASAL-DALWEDRDVRFDITAQQMKTRPGEVLIDCLDSIEDTKGNNGDRGRLLVTNLRIIWHSLALPRVNLSVGYNSIINITTRTANSKLRGQTEALYILTKSNNTRFEFIFTNLVPGSPRLFTSVIAVHRAYETSKMYRDLKLRAALIQNKQLRLLPREQVYDKVNGVWNLSSDQGNLGTFFITNVRIVWHANMNESFNVSIPYLQIWSIRIRDSKFGLALVIESSRQSGGYVLGFKIDPVDKLQDALKEINSLHKVYSANPIFGVDYEMEEKPQPLEE---LTVDQPPDDVEIEPD-EQTDAFTAYFADGVKQQDREPVFSEELGLAIEKLKDGFTLQGLWEVI 341          
BLAST of Bardet-Biedl syndrome 5 protein homolog vs. TrEMBL
Match: A0A091CX66 (Bardet-Biedl syndrome 5 protein homolog OS=Fukomys damarensis OX=885580 GN=H920_16176 PE=3 SV=1)

HSP 1 Score: 447.588 bits (1150), Expect = 7.152e-154
Identity = 208/343 (60.64%), Postives = 275/343 (80.17%), Query Frame = 2
Query:   95 ALYDVLWQDRDIQFDCILQDIRNRPGEKIIDSLDSVEDTKGNNGEKGRLIVTNLRLIWHSHNYPKINLSIGYNCVINITTKSVVSKLKGHTEALFVLTKSRTTRYEFIFTNLVTGSTRLFTSVIAVHRAYDTSRLYRDLKLRISLLDNKKVCLLPNEQIYSETPGVWNLSSDQGNLGTFVLTNVRLIWYAAINTNFNVSLPYIQIKYVKVQDSKFGKALVVQTSEQSGGYVLGFRTDPLEKLNSILQETSSLLKVYVKNPNFGVDYEIEDDIGAHNDGRAISVDQSNDDIEIDNGPEQSDVFAAYLADNVGQETSEPVFNEELGLVIGKLKEGFELSDLWNVL 1123
            ++ DVLW+DRD++FD   Q ++ RPGE +ID LDS+EDTKGNNG++GRL+VTNLR+IWHS   P++NLSIGYNC++NITT++  SKL+G TEAL++LTK  TTR+EFIFTNLV+GS RLFTSVIAVHRAY+TS++YRD KLR +L+ NK++ LLP E +Y +  GVWNLSSDQGNLGTF +TNVR++W+A +N +FNVS+PY+QI+ +K++DSKFG ALV+++S+QSGGYVLGF+ DP+EKL   ++E +SL KVY  NP FGVDYE+E+         A++V+Q  DD+EID+  + +D F AY AD   Q+  EPVF+EELGL I KLK+GF L  LW V+
Sbjct:    2 SVLDVLWEDRDVRFDVSSQQMKTRPGEVLIDCLDSIEDTKGNNGDRGRLLVTNLRIIWHSLALPRVNLSIGYNCILNITTRTANSKLRGQTEALYILTKCNTTRFEFIFTNLVSGSPRLFTSVIAVHRAYETSKMYRDFKLRSALIQNKQLRLLPQEHVYDKISGVWNLSSDQGNLGTFFVTNVRIVWHANMNDSFNVSIPYLQIRSIKIRDSKFGLALVIESSQQSGGYVLGFKIDPMEKLQESVKEINSLHKVYSANPIFGVDYEMEE---KPQPLEALTVEQIQDDVEIDSD-DHTDAFVAYFADGNKQQDREPVFSEELGLAIEKLKDGFTLQGLWEVM 340          
BLAST of Bardet-Biedl syndrome 5 protein homolog vs. TrEMBL
Match: H2MRS1 (Bardet-Biedl syndrome 5 protein homolog OS=Oryzias latipes OX=8090 GN=bbs5 PE=3 SV=1)

HSP 1 Score: 447.203 bits (1149), Expect = 1.185e-153
Identity = 212/346 (61.27%), Postives = 275/346 (79.48%), Query Frame = 2
Query:   86 MSKALYDVLWQDRDIQFDCILQDIRNRPGEKIIDSLDSVEDTKGNNGEKGRLIVTNLRLIWHSHNYPKINLSIGYNCVINITTKSVVSKLKGHTEALFVLTKSRTTRYEFIFTNLVTGSTRLFTSVIAVHRAYDTSRLYRDLKLRISLLDNKKVCLLPNEQIYSETPGVWNLSSDQGNLGTFVLTNVRLIWYAAINTNFNVSLPYIQIKYVKVQDSKFGKALVVQTSEQSGGYVLGFRTDPLEKLNSILQETSSLLKVYVKNPNFGVDYEIEDDIGAHNDGRAISVDQSNDDIEIDNGPEQSDVFAAYLADNVGQETSEPVFNEELGLVIGKLKEGFELSDLWNVL 1123
            M+ AL D LW+DRD++FD   Q ++ RPGE +ID LDS+EDTKGNNG++GRL+VTNLR+IWHS   P++NLS+GYN +INITT++  SKL+G TEAL++LTKS  TR+EFIFTNLV GS RLFTSVIAVHRAY+TS++YRDLKLR +L+ NK++ LLP EQ+Y +  GVWNLSSDQGNLGTF +TNVR++W+A +N +FNVS+PY+QI  ++++DSKFG ALV+++S QSGGYVLGF+ DP++KL   L+E +SL KVY  NP FGVDYE+E+      +   ++VDQ  DD+EI+   EQ+D F AY AD V Q+  EPVF+EELGL I KLK+GF L  LW V+
Sbjct:    1 MASAL-DALWEDRDVRFDITAQQMKTRPGEVLIDCLDSIEDTKGNNGDRGRLLVTNLRIIWHSLALPRVNLSVGYNSIINITTRTANSKLRGQTEALYILTKSNNTRFEFIFTNLVPGSPRLFTSVIAVHRAYETSKMYRDLKLRAALIQNKQLRLLPQEQVYDKINGVWNLSSDQGNLGTFFITNVRIVWHANMNESFNVSIPYLQIWSIRIRDSKFGLALVIESSRQSGGYVLGFKIDPVDKLQDALKEINSLHKVYSANPIFGVDYEMEEKPQPLEE---LTVDQPPDDVEIEPD-EQTDAFTAYFADGVKQQDREPVFSEELGLAIEKLKDGFTLQGLWEVI 341          
BLAST of Bardet-Biedl syndrome 5 protein homolog vs. TrEMBL
Match: A0A3P9JIU1 (Bardet-Biedl syndrome 5 protein homolog OS=Oryzias latipes OX=8090 PE=3 SV=1)

HSP 1 Score: 446.817 bits (1148), Expect = 1.610e-153
Identity = 212/346 (61.27%), Postives = 275/346 (79.48%), Query Frame = 2
Query:   86 MSKALYDVLWQDRDIQFDCILQDIRNRPGEKIIDSLDSVEDTKGNNGEKGRLIVTNLRLIWHSHNYPKINLSIGYNCVINITTKSVVSKLKGHTEALFVLTKSRTTRYEFIFTNLVTGSTRLFTSVIAVHRAYDTSRLYRDLKLRISLLDNKKVCLLPNEQIYSETPGVWNLSSDQGNLGTFVLTNVRLIWYAAINTNFNVSLPYIQIKYVKVQDSKFGKALVVQTSEQSGGYVLGFRTDPLEKLNSILQETSSLLKVYVKNPNFGVDYEIEDDIGAHNDGRAISVDQSNDDIEIDNGPEQSDVFAAYLADNVGQETSEPVFNEELGLVIGKLKEGFELSDLWNVL 1123
            M+ AL D LW+DRD++FD   Q ++ RPGE +ID LDS+EDTKGNNG++GRL+VTNLR+IWHS   P++NLS+GYN +INITT++  SKL+G TEAL++LTKS  TR+EFIFTNLV GS RLFTSVIAVHRAY+TS++YRDLKLR +L+ NK++ LLP EQ+Y +  GVWNLSSDQGNLGTF +TNVR++W+A +N +FNVS+PY+QI  ++++DSKFG ALV+++S QSGGYVLGF+ DP++KL   L+E +SL KVY  NP FGVDYE+E+      +   ++VDQ  DD+EI+   EQ+D F AY AD V Q+  EPVF+EELGL I KLK+GF L  LW V+
Sbjct:    1 MASAL-DALWEDRDVRFDITAQQMKTRPGEVLIDCLDSIEDTKGNNGDRGRLLVTNLRIIWHSLALPRVNLSVGYNSIINITTRTANSKLRGQTEALYILTKSNNTRFEFIFTNLVPGSPRLFTSVIAVHRAYETSKMYRDLKLRAALIQNKQLRLLPREQVYDKINGVWNLSSDQGNLGTFFITNVRIVWHANMNESFNVSIPYLQIWSIRIRDSKFGLALVIESSRQSGGYVLGFKIDPVDKLQDALKEINSLHKVYSANPIFGVDYEMEEKPQPLEE---LTVDQPPDDVEIEPD-EQTDAFTAYFADGVKQQDREPVFSEELGLAIEKLKDGFTLQGLWEVI 341          
BLAST of Bardet-Biedl syndrome 5 protein homolog vs. Ensembl Cavefish
Match: bbs5 (Bardet-Biedl syndrome 5 [Source:NCBI gene;Acc:103043779])

HSP 1 Score: 438.343 bits (1126), Expect = 1.171e-153
Identity = 203/343 (59.18%), Postives = 274/343 (79.88%), Query Frame = 2
Query:   95 ALYDVLWQDRDIQFDCILQDIRNRPGEKIIDSLDSVEDTKGNNGEKGRLIVTNLRLIWHSHNYPKINLSIGYNCVINITTKSVVSKLKGHTEALFVLTKSRTTRYEFIFTNLVTGSTRLFTSVIAVHRAYDTSRLYRDLKLRISLLDNKKVCLLPNEQIYSETPGVWNLSSDQGNLGTFVLTNVRLIWYAAINTNFNVSLPYIQIKYVKVQDSKFGKALVVQTSEQSGGYVLGFRTDPLEKLNSILQETSSLLKVYVKNPNFGVDYEIEDDIGAHNDGRAISVDQSNDDIEIDNGPEQSDVFAAYLADNVGQETSEPVFNEELGLVIGKLKEGFELSDLWNVL 1123
             + D LW+DRD++FD   Q ++ RPGE +ID LDS+EDTKGNNG++GRL+VTNLR+IWHS   P++NLS+GYN VINITT++  SKL+G TEAL++LTKS  TR+EFIFTN+V GS RLFTSVIAVHRAY+TS++YRDLKLR +L+ NK++ LLP EQ+Y +  GVWNLSSDQGNLGTF +TNVR++W+A +N +FNVS+PY+QI+ ++++DSKFG ALV+++S+Q+GGYVLGF+ DP++KL   ++E +SL KVY  NP FGV+YE+E+      +   ++V+Q  DD+EI+   EQ+D F AY AD+  Q+  EPVF+EELGL + KLK+GF L  LW V+
Sbjct:    3 GVLDALWEDRDVRFDITAQQMKTRPGEVLIDCLDSIEDTKGNNGDRGRLLVTNLRIIWHSIALPRVNLSVGYNSVINITTRTANSKLRGQTEALYILTKSNNTRFEFIFTNVVPGSPRLFTSVIAVHRAYETSKMYRDLKLRGALIQNKQLRLLPREQVYDKINGVWNLSSDQGNLGTFFITNVRIVWHANMNESFNVSIPYLQIRSIRIRDSKFGLALVIESSQQTGGYVLGFKIDPMDKLQDAVKEINSLHKVYSANPIFGVEYEMEEKPQPLEE---LTVEQPPDDVEIEPD-EQTDAFTAYFADSNKQQDREPVFSEELGLAVEKLKDGFTLQGLWEVM 341          
BLAST of Bardet-Biedl syndrome 5 protein homolog vs. Ensembl Cavefish
Match: bbs5 (Bardet-Biedl syndrome 5 [Source:NCBI gene;Acc:103043779])

HSP 1 Score: 424.476 bits (1090), Expect = 3.381e-148
Identity = 199/343 (58.02%), Postives = 269/343 (78.43%), Query Frame = 2
Query:   95 ALYDVLWQDRDIQFDCILQDIRNRPGEKIIDSLDSVEDTKGNNGEKGRLIVTNLRLIWHSHNYPKINLSIGYNCVINITTKSVVSKLKGHTEALFVLTKSRTTRYEFIFTNLVTGSTRLFTSVIAVHRAYDTSRLYRDLKLRISLLDNKKVCLLPNEQIYSETPGVWNLSSDQGNLGTFVLTNVRLIWYAAINTNFNVSLPYIQIKYVKVQDSKFGKALVVQTSEQSGGYVLGFRTDPLEKLNSILQETSSLLKVYVKNPNFGVDYEIEDDIGAHNDGRAISVDQSNDDIEIDNGPEQSDVFAAYLADNVGQETSEPVFNEELGLVIGKLKEGFELSDLWNVL 1123
             + D LW+DRD++FD   Q ++ RPGE +ID LDS+EDTKGNNG++GRL+VTNLR+IWHS   P++NLS+GYN VINITT++  SKL+G TEAL++LTKS  TR+EFIFTN+V GS RLFTSVIAVHRAY+TS++YRDLKLR +L+ NK++ LLP EQ+Y +  GVWNLSSDQGNLGTF +TNVR++W+A +N +FNVS+PY+QI+ ++++DSKFG ALV+++S+Q+GGYVLGF+ DP++KL   ++E +SL KVY  NP FGV+YE+E+      +   ++V+Q  DD+EI+   EQ+D F         Q+  EPVF+EELGL + KLK+GF L  LW V+
Sbjct:    3 GVLDALWEDRDVRFDITAQQMKTRPGEVLIDCLDSIEDTKGNNGDRGRLLVTNLRIIWHSIALPRVNLSVGYNSVINITTRTANSKLRGQTEALYILTKSNNTRFEFIFTNVVPGSPRLFTSVIAVHRAYETSKMYRDLKLRGALIQNKQLRLLPREQVYDKINGVWNLSSDQGNLGTFFITNVRIVWHANMNESFNVSIPYLQIRSIRIRDSKFGLALVIESSQQTGGYVLGFKIDPMDKLQDAVKEINSLHKVYSANPIFGVEYEMEEKPQPLEE---LTVEQPPDDVEIEPD-EQTDAFT--------QQDREPVFSEELGLAVEKLKDGFTLQGLWEVM 333          
BLAST of Bardet-Biedl syndrome 5 protein homolog vs. Ensembl Sea Lamprey
Match: bbs5 (Bardet-Biedl syndrome 5 [Source:NCBI gene;Acc:393269])

HSP 1 Score: 439.884 bits (1130), Expect = 7.459e-155
Identity = 208/343 (60.64%), Postives = 272/343 (79.30%), Query Frame = 2
Query:   95 ALYDVLWQDRDIQFDCILQDIRNRPGEKIIDSLDSVEDTKGNNGEKGRLIVTNLRLIWHSHNYPKINLSIGYNCVINITTKSVVSKLKGHTEALFVLTKSRTTRYEFIFTNLVTGSTRLFTSVIAVHRAYDTSRLYRDLKLRISLLDNKKVCLLPNEQIYSETPGVWNLSSDQGNLGTFVLTNVRLIWYAAINTNFNVSLPYIQIKYVKVQDSKFGKALVVQTSEQSGGYVLGFRTDPLEKLNSILQETSSLLKVYVKNPNFGVDYEIEDDIGAHNDGRAISVDQSNDDIEIDNGPEQSDVFAAYLADNVGQETSEPVFNEELGLVIGKLKEGFELSDLWNVL 1123
            A  D LW+DRDI+FD   Q +R R GE +IDSLDS+EDTKGNNG++GRL+VTNLRLIWHS + P++NLSIGYNCVI+ITT++  SKL+G TEAL++LTK   TR+EFIFTNLV GS RLFTSV+AVHRAY+TS++YRDLKLR +L+ N+++ LLP EQ+Y +  GVWNLSSDQGNLGTF ++NVRL+W+A +N +FNVS+PY+QI+ VK++DSKFG ALV++TS+QSGGYVLGFR DPLEKL   ++E  SL +VY  +P FGV +EIED     ++   ++V+ + DD+EI    E SD F AY AD   Q+  +P+FNE+LGL + KL++GF L  LW+V+
Sbjct:    3 ASLDALWEDRDIRFDVSPQQMRMRAGELLIDSLDSIEDTKGNNGDRGRLLVTNLRLIWHSQSLPRVNLSIGYNCVISITTRTANSKLRGQTEALYILTKCNNTRFEFIFTNLVPGSPRLFTSVMAVHRAYETSKMYRDLKLRGALISNRQLRLLPQEQVYDKINGVWNLSSDQGNLGTFFISNVRLVWHANMNDSFNVSIPYLQIRSVKIRDSKFGLALVIETSQQSGGYVLGFRIDPLEKLQEAVKEIQSLHRVYSASPIFGVQFEIEDRPQPLDE---VTVENALDDVEIQQD-EPSDAFVAYFADGNKQQDRDPIFNEDLGLAVEKLRDGFTLQSLWDVV 341          
BLAST of Bardet-Biedl syndrome 5 protein homolog vs. Ensembl Nematostella
Match: EDO43656 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RY88])

HSP 1 Score: 421.779 bits (1083), Expect = 1.509e-147
Identity = 203/338 (60.06%), Postives = 265/338 (78.40%), Query Frame = 2
Query:  110 LWQDRDIQFDCILQDIRNRPGEKIIDSLDSVEDTKGNNGEKGRLIVTNLRLIWHSHNYPKINLSIGYNCVINITTKSVVSKLKGHTEALFVLTKSRTTRYEFIFTNLVTGSTRLFTSVIAVHRAYDTSRLYRDLKLRISLLDNKKVCLLPNEQIYSETPGVWNLSSDQGNLGTFVLTNVRLIWYAAINTNFNVSLPYIQIKYVKVQDSKFGKALVVQTSEQSGGYVLGFRTDPLEKLNSILQETSSLLKVYVKNPNFGVDYEIEDDIGAHNDGRAISVDQSNDDIEIDNGPEQSDVFAAYLADNVGQETSEPVFNEELGLVIGKLKEGFELSDLWNVL 1123
            LW+DRD++FD  LQ ++ R GE +ID LDSVEDTKGNNG++GRL+VTNLRLIWHS + P++NLS+G++CV+NI+T++  SKL+G TEAL++LTK   TR+EFIFTNLV+GS RLFT+VI+V RAY++S+LYRDLKLR +L+ NK++ LLP EQ+Y +  GVWNLSSDQGNLGTF +TNVRL+W+A +N  FNVS+PY+Q+K V+++DSKFG ALVV+TS+QSGGYVLGFR DP+EKL   ++E  SL KVY  +P FGV++E ED   A +    I+VD   DDIEI N    +D FAAY AD       EPV+++ LGL + KLK+GF L  LW V+
Sbjct:    5 LWEDRDVRFDITLQQMQLRAGEVMIDKLDSVEDTKGNNGDRGRLLVTNLRLIWHSQSMPRVNLSVGFSCVVNISTRTAHSKLRGQTEALYILTKCNNTRFEFIFTNLVSGSPRLFTTVISVFRAYESSKLYRDLKLRGALILNKQLRLLPLEQVYDKINGVWNLSSDQGNLGTFYITNVRLVWHANMNDTFNVSIPYLQMKTVRIRDSKFGLALVVETSQQSGGYVLGFRVDPVEKLQEAVKEIQSLQKVYSASPIFGVEFETEDKPEALD---KITVDPVQDDIEIVN-EGSTDAFAAYFADGEKTSDREPVYSDHLGLAVEKLKDGFTLQGLWEVV 338          
BLAST of Bardet-Biedl syndrome 5 protein homolog vs. Ensembl Medaka
Match: bbs5 (Bardet-Biedl syndrome 5 [Source:NCBI gene;Acc:101157654])

HSP 1 Score: 447.203 bits (1149), Expect = 4.462e-157
Identity = 212/346 (61.27%), Postives = 275/346 (79.48%), Query Frame = 2
Query:   86 MSKALYDVLWQDRDIQFDCILQDIRNRPGEKIIDSLDSVEDTKGNNGEKGRLIVTNLRLIWHSHNYPKINLSIGYNCVINITTKSVVSKLKGHTEALFVLTKSRTTRYEFIFTNLVTGSTRLFTSVIAVHRAYDTSRLYRDLKLRISLLDNKKVCLLPNEQIYSETPGVWNLSSDQGNLGTFVLTNVRLIWYAAINTNFNVSLPYIQIKYVKVQDSKFGKALVVQTSEQSGGYVLGFRTDPLEKLNSILQETSSLLKVYVKNPNFGVDYEIEDDIGAHNDGRAISVDQSNDDIEIDNGPEQSDVFAAYLADNVGQETSEPVFNEELGLVIGKLKEGFELSDLWNVL 1123
            M+ AL D LW+DRD++FD   Q ++ RPGE +ID LDS+EDTKGNNG++GRL+VTNLR+IWHS   P++NLS+GYN +INITT++  SKL+G TEAL++LTKS  TR+EFIFTNLV GS RLFTSVIAVHRAY+TS++YRDLKLR +L+ NK++ LLP EQ+Y +  GVWNLSSDQGNLGTF +TNVR++W+A +N +FNVS+PY+QI  ++++DSKFG ALV+++S QSGGYVLGF+ DP++KL   L+E +SL KVY  NP FGVDYE+E+      +   ++VDQ  DD+EI+   EQ+D F AY AD V Q+  EPVF+EELGL I KLK+GF L  LW V+
Sbjct:    1 MASAL-DALWEDRDVRFDITAQQMKTRPGEVLIDCLDSIEDTKGNNGDRGRLLVTNLRIIWHSLALPRVNLSVGYNSIINITTRTANSKLRGQTEALYILTKSNNTRFEFIFTNLVPGSPRLFTSVIAVHRAYETSKMYRDLKLRAALIQNKQLRLLPQEQVYDKINGVWNLSSDQGNLGTFFITNVRIVWHANMNESFNVSIPYLQIWSIRIRDSKFGLALVIESSRQSGGYVLGFKIDPVDKLQDALKEINSLHKVYSANPIFGVDYEMEEKPQPLEE---LTVDQPPDDVEIEPD-EQTDAFTAYFADGVKQQDREPVFSEELGLAIEKLKDGFTLQGLWEVI 341          
BLAST of Bardet-Biedl syndrome 5 protein homolog vs. Planmine SMEST
Match: SMESG000052420.1 (SMESG000052420.1)

HSP 1 Score: 712.605 bits (1838), Expect = 0.000e+0
Identity = 349/349 (100.00%), Postives = 349/349 (100.00%), Query Frame = 2
Query:   86 MSKALYDVLWQDRDIQFDCILQDIRNRPGEKIIDSLDSVEDTKGNNGEKGRLIVTNLRLIWHSHNYPKINLSIGYNCVINITTKSVVSKLKGHTEALFVLTKSRTTRYEFIFTNLVTGSTRLFTSVIAVHRAYDTSRLYRDLKLRISLLDNKKVCLLPNEQIYSETPGVWNLSSDQGNLGTFVLTNVRLIWYAAINTNFNVSLPYIQIKYVKVQDSKFGKALVVQTSEQSGGYVLGFRTDPLEKLNSILQETSSLLKVYVKNPNFGVDYEIEDDIGAHNDGRAISVDQSNDDIEIDNGPEQSDVFAAYLADNVGQETSEPVFNEELGLVIGKLKEGFELSDLWNVLPKT 1132
            MSKALYDVLWQDRDIQFDCILQDIRNRPGEKIIDSLDSVEDTKGNNGEKGRLIVTNLRLIWHSHNYPKINLSIGYNCVINITTKSVVSKLKGHTEALFVLTKSRTTRYEFIFTNLVTGSTRLFTSVIAVHRAYDTSRLYRDLKLRISLLDNKKVCLLPNEQIYSETPGVWNLSSDQGNLGTFVLTNVRLIWYAAINTNFNVSLPYIQIKYVKVQDSKFGKALVVQTSEQSGGYVLGFRTDPLEKLNSILQETSSLLKVYVKNPNFGVDYEIEDDIGAHNDGRAISVDQSNDDIEIDNGPEQSDVFAAYLADNVGQETSEPVFNEELGLVIGKLKEGFELSDLWNVLPKT
Sbjct:    1 MSKALYDVLWQDRDIQFDCILQDIRNRPGEKIIDSLDSVEDTKGNNGEKGRLIVTNLRLIWHSHNYPKINLSIGYNCVINITTKSVVSKLKGHTEALFVLTKSRTTRYEFIFTNLVTGSTRLFTSVIAVHRAYDTSRLYRDLKLRISLLDNKKVCLLPNEQIYSETPGVWNLSSDQGNLGTFVLTNVRLIWYAAINTNFNVSLPYIQIKYVKVQDSKFGKALVVQTSEQSGGYVLGFRTDPLEKLNSILQETSSLLKVYVKNPNFGVDYEIEDDIGAHNDGRAISVDQSNDDIEIDNGPEQSDVFAAYLADNVGQETSEPVFNEELGLVIGKLKEGFELSDLWNVLPKT 349          
The following BLAST results are available for this feature:
BLAST of Bardet-Biedl syndrome 5 protein homolog vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 4
Match NameE-valueIdentityDescription
BBS52.736e-15158.31Bardet-Biedl syndrome 5 [Source:HGNC Symbol;Acc:HG... [more]
BBS51.971e-13655.10Bardet-Biedl syndrome 5 [Source:HGNC Symbol;Acc:HG... [more]
AC093899.25.676e-13358.44novel protein[more]
BBS51.373e-1356.52Bardet-Biedl syndrome 5 [Source:HGNC Symbol;Acc:HG... [more]
back to top
BLAST of Bardet-Biedl syndrome 5 protein homolog vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
bbs-58.763e-9143.14Bardet-Biedl syndrome 5 protein homolog [Source:U... [more]
back to top
BLAST of Bardet-Biedl syndrome 5 protein homolog vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
BBS56.498e-9842.31gene:FBgn0037280 transcript:FBtr0078872[more]
back to top
BLAST of Bardet-Biedl syndrome 5 protein homolog vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
bbs51.378e-15459.18Bardet-Biedl syndrome 5 [Source:NCBI gene;Acc:3932... [more]
back to top
BLAST of Bardet-Biedl syndrome 5 protein homolog vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
bbs55.556e-15358.89Bardet-Biedl syndrome 5 [Source:NCBI gene;Acc:5489... [more]
bbs56.605e-14257.10Bardet-Biedl syndrome 5 [Source:NCBI gene;Acc:5489... [more]
bbs59.858e-13557.27Bardet-Biedl syndrome 5 [Source:NCBI gene;Acc:5489... [more]
bbs52.681e-13457.62Bardet-Biedl syndrome 5 [Source:NCBI gene;Acc:5489... [more]
bbs58.487e-12556.95Bardet-Biedl syndrome 5 [Source:NCBI gene;Acc:5489... [more]
back to top
BLAST of Bardet-Biedl syndrome 5 protein homolog vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Bbs52.735e-15459.77Bardet-Biedl syndrome 5 (human) [Source:MGI Symbol... [more]
Bbs52.003e-13956.56Bardet-Biedl syndrome 5 (human) [Source:MGI Symbol... [more]
Bbs54.395e-3560.92Bardet-Biedl syndrome 5 (human) [Source:MGI Symbol... [more]
Bbs53.131e-1735.25Bardet-Biedl syndrome 5 (human) [Source:MGI Symbol... [more]
back to top
BLAST of Bardet-Biedl syndrome 5 protein homolog vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q7ZWB7|BBS5_DANRE1.040e-15359.18Bardet-Biedl syndrome 5 protein homolog OS=Danio r... [more]
sp|Q9CZQ9|BBS5_MOUSE1.913e-15359.77Bardet-Biedl syndrome 5 protein homolog OS=Mus mus... [more]
sp|Q4R649|BBS5_MACFA7.206e-15158.31Bardet-Biedl syndrome 5 protein homolog OS=Macaca ... [more]
sp|Q8N3I7|BBS5_HUMAN1.314e-15058.31Bardet-Biedl syndrome 5 protein OS=Homo sapiens OX... [more]
sp|Q66IS6|BBS5_XENLA7.533e-13456.43Bardet-Biedl syndrome 5 protein homolog OS=Xenopus... [more]
back to top
BLAST of Bardet-Biedl syndrome 5 protein homolog vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
R7V9C21.121e-15661.34Uncharacterized protein OS=Capitella teleta OX=283... [more]
A0A3P9LKF46.864e-15461.27Bardet-Biedl syndrome 5 protein homolog OS=Oryzias... [more]
A0A091CX667.152e-15460.64Bardet-Biedl syndrome 5 protein homolog OS=Fukomys... [more]
H2MRS11.185e-15361.27Bardet-Biedl syndrome 5 protein homolog OS=Oryzias... [more]
A0A3P9JIU11.610e-15361.27Bardet-Biedl syndrome 5 protein homolog OS=Oryzias... [more]
back to top
BLAST of Bardet-Biedl syndrome 5 protein homolog vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
bbs51.171e-15359.18Bardet-Biedl syndrome 5 [Source:NCBI gene;Acc:1030... [more]
bbs53.381e-14858.02Bardet-Biedl syndrome 5 [Source:NCBI gene;Acc:1030... [more]
back to top
BLAST of Bardet-Biedl syndrome 5 protein homolog vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
bbs57.459e-15560.64Bardet-Biedl syndrome 5 [Source:NCBI gene;Acc:3932... [more]
back to top
BLAST of Bardet-Biedl syndrome 5 protein homolog vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Bardet-Biedl syndrome 5 protein homolog vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO436561.509e-14760.06Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Bardet-Biedl syndrome 5 protein homolog vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
bbs54.462e-15761.27Bardet-Biedl syndrome 5 [Source:NCBI gene;Acc:1011... [more]
back to top
BLAST of Bardet-Biedl syndrome 5 protein homolog vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000052420.10.000e+0100.00SMESG000052420.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30009735 ID=SMED30009735|Name=Bardet-Biedl syndrome 5 protein homolog|organism=Schmidtea mediterranea sexual|type=transcript|length=1229bp
CCAATTTAAATAAATATCTTTAAAATTAATTAATTTTGATAAATTTTAGA
GTTTTAATTATTATAAAATAATTCTATCAGACGCAATGTCAAAAGCGCTT
TACGACGTCCTTTGGCAAGACCGAGATATTCAGTTTGATTGCATTCTTCA
GGATATTAGAAATAGGCCTGGAGAAAAAATAATCGATTCCCTAGATTCTG
TCGAAGATACAAAAGGAAATAATGGAGAAAAAGGACGCTTAATAGTTACT
AATTTGCGATTAATATGGCATTCGCACAATTATCCGAAGATAAATTTATC
AATCGGTTACAACTGTGTGATTAATATCACAACTAAGTCAGTTGTTTCAA
AATTGAAAGGACATACTGAAGCATTATTTGTGCTGACAAAGTCTCGGACA
ACACGATATGAATTTATATTTACTAATCTCGTCACTGGTAGCACTCGTCT
CTTCACCTCGGTTATAGCTGTCCATAGGGCATATGACACTAGTAGGCTTT
ATCGGGATCTCAAGTTGAGAATCTCTCTACTCGACAATAAAAAAGTCTGT
TTATTGCCGAATGAGCAGATTTATTCAGAAACTCCTGGTGTGTGGAATCT
TTCTTCAGACCAAGGAAATCTCGGAACTTTTGTTCTTACAAATGTAAGAT
TGATATGGTATGCAGCAATAAACACAAACTTTAATGTCAGCTTGCCTTAC
ATTCAGATTAAATATGTCAAAGTTCAAGATTCTAAATTCGGCAAAGCTCT
TGTTGTTCAAACTTCAGAACAGAGTGGTGGCTATGTACTCGGATTCAGAA
CTGACCCTCTGGAAAAATTAAATTCTATTCTACAAGAAACGAGTAGTTTG
TTAAAAGTTTACGTGAAAAATCCAAATTTCGGAGTTGATTATGAAATCGA
AGATGATATTGGGGCACACAATGACGGGCGCGCAATTTCAGTGGACCAAT
CGAATGACGATATCGAGATAGATAACGGGCCAGAGCAATCAGATGTATTT
GCTGCATATCTTGCTGATAATGTTGGCCAGGAAACATCAGAGCCGGTTTT
CAATGAAGAATTGGGTCTGGTAATTGGGAAACTGAAGGAGGGATTTGAAT
TGTCGGATTTATGGAATGTGTTACCGAAAACCTGAATCAGTAAAACTCGT
TCAGTTCCACTGTTGTTTTTGTTTTGTGATGTCTCAATGAGCCATGTGAT
AAATATATATTGTTTTTCTCTGAAAAAAA
back to top

protein sequence of SMED30009735-orf-1

>SMED30009735-orf-1 ID=SMED30009735-orf-1|Name=SMED30009735-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=350bp
MSKALYDVLWQDRDIQFDCILQDIRNRPGEKIIDSLDSVEDTKGNNGEKG
RLIVTNLRLIWHSHNYPKINLSIGYNCVINITTKSVVSKLKGHTEALFVL
TKSRTTRYEFIFTNLVTGSTRLFTSVIAVHRAYDTSRLYRDLKLRISLLD
NKKVCLLPNEQIYSETPGVWNLSSDQGNLGTFVLTNVRLIWYAAINTNFN
VSLPYIQIKYVKVQDSKFGKALVVQTSEQSGGYVLGFRTDPLEKLNSILQ
ETSSLLKVYVKNPNFGVDYEIEDDIGAHNDGRAISVDQSNDDIEIDNGPE
QSDVFAAYLADNVGQETSEPVFNEELGLVIGKLKEGFELSDLWNVLPKT*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0034451centriolar satellite
GO:0034464BBSome
GO:0005622intracellular
GO:0005737cytoplasm
GO:0005815microtubule organizing center
GO:0005856cytoskeleton
GO:0005886plasma membrane
GO:0005929cilium
GO:0005930axoneme
GO:0016020membrane
GO:0036064ciliary basal body
GO:0042995cell projection
GO:0060170ciliary membrane
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0000099neuron
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR014003DM16_repeat
IPR030804BBS5/fem-3
IPR006606BBL5
IPR001024PLAT/LH2_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0001103RNA polymerase II repressing transcription factor binding
GO:0032266phosphatidylinositol-3-phosphate binding
Vocabulary: biological process
TermDefinition
GO:0006810transport
GO:0015031protein transport
GO:0030030cell projection organization
GO:0046907intracellular transport
GO:0060271cilium morphogenesis
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR014003DM16 repeatSMARTSM00683dm16coord: 30..84
e-value: 2.2E-24
score: 97.0
coord: 160..214
e-value: 4.6E-22
score: 89.3
IPR030804Bardet-Biedl syndrome 5 protein/sex-determination protein fem-3PIRSFPIRSF010072BBS5_fem-3coord: 1..349
e-value: 1.4E-134
score: 446.3
IPR006606Bardet-Biedl syndrome 5 proteinPFAMPF07289BBL5coord: 9..345
e-value: 3.6E-140
score: 466.7
IPR006606Bardet-Biedl syndrome 5 proteinPANTHERPTHR21351BARDET-BIEDL SYNDROME PROTEIN 5coord: 5..347