PKD2-1

Overview
NamePKD2-1 (AKN21727.1)
Smed IDSMED30009733
Length (bp)2434
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of PKD2-1 (SMED30009733) t-SNE clustered cells

Violin plots show distribution of expression levels for PKD2-1 (SMED30009733) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of PKD2-1 (SMED30009733) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for PKD2-1 (SMED30009733) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30009733

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30009733h1SMcG0022018 SmedASXL_015959SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30009733h1SMcG0022018 dd_Smed_v4_12955_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30009733h1SMcG0022018 dd_Smed_v4_12955_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30009733h1SMcG0022018 dd_Smed_v4_12955_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
cilated neuronSMED30009733h1SMcG0022018 dd_Smed_v4_12955_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30009733h1SMcG0022018 dd_Smed_v6_12955_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
neuronSMED30009733h1SMcG0022018 dd_Smed_v6_12955_0_1dd_Smed_v6PMID:30399335
Ross et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
head regionSMED30009733h1SMcG0022018 OX_Smed_1.0.22749ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
GABAergic neuronSMED30009733h1SMcG0022018 dd_Smed_v6_12955_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of PKD2-1 vs. Ensembl Human
Match: PKD2 (polycystin 2, transient receptor potential cation channel [Source:HGNC Symbol;Acc:HGNC:9009])

HSP 1 Score: 416.772 bits (1070), Expect = 2.472e-131
Identity = 283/707 (40.03%), Postives = 424/707 (59.97%), Query Frame = 3
Query:  282 ACGKKFLRVIRRAWSTRYTEELSSNKVVFLKTALRELVTYLVFLIFLMMVAYGTRSENLYYLTTAMSNILI--------TSNFNGITAMDSFWNWINIDFVNALYWNTWYNSMTYLPLNEREFIHYENKLVGVPQIRQLRIGSNTCQIPSFFKNSMSNCYGDYSFSNLNKSDFGISNSTAWXXXXXXXXXXXXXXXXXXXYDDGGFIQVLSRNSLETISILSNLQNNLWLDHGTRAVFIDLTVYNANVNLYCVIKLIFEFPPTGGIIPSSQFRTLKLIRYETGYDFFILFCXXXXXXXXXXXXXXXXXXXKKNKLSYFKKIWNVVDVLMIIMSFISIAINVYRVLSTXXXXXXXXXXXXXXXDFTFFANWNKYFNDAVSITTFFGAVKIFKYISFNKTMNQLTDTLSNSIREXXXXXXXXXXXXXXXXXWGYLQFGSQIVDFCRFQDSVFTLFRLVLGDFNFMALVQANSFIGPXXXXXXXXXXXXXXMNMFVAIIADSYEVVKEKLMQSKDEFQITKFLKAQFF-----NKFTKNRVMKIQEVLENENIANCETLSYQDWRDKLQSRGYADVEIQALFMRYDSDGDRTLDYEERRVMLQDLKNGKISLEGHQTESNESELSVKKEDESMP---------------------------VDEELFGGLVERVDSVEKNISNIVSKIDMVFLRLSEIEKAKLDHQKSIS 2282
            A  ++ +R +R  W TR  EE S+N+  +LK+ LRELVTYL+FLI L ++ YG  S N+YY T  MS + +         +NF  +++M+ FW +     ++ LYW    ++ T    + R FI YEN L+GVP+IRQLR+ + +C IP   ++ +  CY  YS S+ +++ FG  N TAW YT       SS     ATY   G+   LSR   ET + +++L+ N+WLD GTRA FID +VYNAN+NL+CV++L+ EFP TGG+IPS QF+ LKLIRY T +DFF+  CEI+  F++ YY +EE +EI+ +KL YF+  WN +DV+++++S ++I IN+YR  S  +V+ Q + +QN + +F   A W   FN+  ++T FF  +K+FK+I+FN+TM+QL+ T+S   +++ GFA+MFFI+F A+A   YL FG+Q+ DF  FQ+ +FT FR++LGD NF  + +AN  +GP+YF  +VFF+FF+L+NMF+AII D+Y  VK  L Q K E +++  ++  +       K  KN V  I E L          L++ + R  L+ +G+ D EI+A+F +YD DGD+ L   E + M  DL+  +  L     + + S L       S P                           V  E F  LV RVD +E +I +IVSKID V ++L  +E+AKL  ++ + 
Sbjct:  188 AWAERLVRGLRGLWGTRLMEESSTNREKYLKSVLRELVTYLLFLIVLCILTYGMMSSNVYYYTRMMSQLFLDTPVSKTEKTNFKTLSSMEDFWKFTEGSLLDGLYWKMQPSNQT--EADNRSFIFYENLLLGVPRIRQLRVRNGSCSIPQDLRDEIKECYDVYSVSSEDRAPFGPRNGTAWIYTSEKDLNGSSHWGIIATYSGAGYYLDLSRTREETAAQVASLKKNVWLDRGTRATFIDFSVYNANINLFCVVRLLVEFPATGGVIPSWQFQPLKLIRYVTTFDFFLAACEIIFCFFIFYYVVEEILEIRIHKLHYFRSFWNCLDVVIVVLSVVAIGINIYRT-SNVEVLLQFLEDQNTFPNFEHLAYWQIQFNNIAAVTVFFVWIKLFKFINFNRTMSQLSTTMSRCAKDLFGFAIMFFIIFLAYAQLAYLVFGTQVDDFSTFQECIFTQFRIILGDINFAEIEEANRVLGPIYFTTFVFFMFFILLNMFLAIINDTYSEVKSDLAQQKAEMELSDLIRKGYHKALVKLKLKKNTVDDISESLRQ----GGGKLNFDELRQDLKGKGHTDAEIEAIFTKYDQDGDQELTEHEHQQMRDDLEKEREDL-----DLDHSSLPRPMSSRSFPRSLDDSEEDDDEDSGHSSRRRGSISSGVSYEEFQVLVRRVDRMEHSIGSIVSKIDAVIVKLEIMERAKLKRREVLG 882          
BLAST of PKD2-1 vs. Ensembl Human
Match: PKD2L1 (polycystin 2 like 1, transient receptor potential cation channel [Source:HGNC Symbol;Acc:HGNC:9011])

HSP 1 Score: 408.297 bits (1048), Expect = 8.960e-130
Identity = 267/680 (39.26%), Postives = 414/680 (60.88%), Query Frame = 3
Query:  282 ACGKKFLRVIRRAWSTRYTEELSSNKVVFLKTALRELVTYLVFLIFLMMVAYGTRSENLYYLTTAMSNILITS------NFNGITAMDSFWNWINIDFVNALYWNTWYNSMTYLPLNEREFIHYENKLVGVPQIRQLRIGSNTCQIPSFFKNSMSNCYGDYSFSNLNKSDFGISNSTAWXXXXXXXXXXXXXXXXXXXYDDGGFIQVLSRNSLETISILSNLQNNLWLDHGTRAVFIDLTVYNANVNLYCVIKLIFEFPPTGGIIPSSQFRTLKLIRYETGYDFFILFCXXXXXXXXXXXXXXXXXXXKKNKLSYFKKIWNVVDVLMIIMSFISIAINVYRVLSTXXXXXXXXXXXXXXXDFTFFANWNKYFNDAVSITTFFGAVKIFKYISFNKTMNQLTDTLSNSIREXXXXXXXXXXXXXXXXXWGYLQFGSQIVDFCRFQDSVFTLFRLVLGDFNFMALVQANSFIGPXXXXXXXXXXXXXXMNMFVAIIADSYEVVKEKLMQSKDEFQITKFLKAQFFNK------FTKNRVMKIQEVLENENIANCETLSYQDWRDKLQSRGYAD---VEIQALFMRYDSDGDRTLDYEERRVMLQDLKNGKISLEGHQTESNESELSVKKEDESMP--------VDEELFGGLVERVDSVEKNISNIVSKIDMVFLRLSEIEK 2252
            +C     + IR  W T  TE  + N+ +++KT LREL+ Y+VFL+ + ++ YG  S + YY T  MS + + +      +F  I++M  FW++     +++LYW  WYN+ + L      FI+YEN L+GVP++RQL++ +++C +   F+  + +CY  YS     +  FG  N TAW+Y   +     S      +Y  GG+   L  +   +   L  LQ  LWLD GTR VFID +VYNAN+NL+CV++L+ EFP TGG IPS Q RT+KLIRY + +DFFI+ CE++   ++ YY +EE +E+  ++L Y   IWN++D+++I++S +++  +++R L  N+++ +L+   N Y DF F A W   +N+  ++  FF  +KIFKYISFNKTM QL+ TL+   ++++GFAVMFFIVFFA+A  GYL FG+Q+ +F  F   +FT FR++LGDF++ A+  AN  +GP YF+ YVFFVFFVL+NMF+AII D+Y  VKE+L   KDE Q++  LK Q +NK        K RV  +Q+VL+       + + ++D+ + L+  G+A+    E+ A F ++D DG+R LD +E+  M QDL+  +++L     +   S +S   + +S P        V  E F  L  RV  +E  +  +VS+ID V  +L  +E+
Sbjct:   68 SCCLHICQGIRGLWGTTLTENTAENRELYIKTTLRELLVYIVFLVDICLLTYGMTSSSAYYYTKVMSELFLHTPSDTGVSFQAISSMADFWDFAQGPLLDSLYWTKWYNNQS-LGHGSHSFIYYENMLLGVPRLRQLKVRNDSCVVHEDFREDILSCYDVYSPDKEEQLPFGPFNGTAWTYHSQDELGGFSHWGRLTSYSGGGYYLDLPGSRQGSAEALRALQEGLWLDRGTRVVFIDFSVYNANINLFCVLRLVVEFPATGGAIPSWQIRTVKLIRYVSNWDFFIVGCEVIFCVFIFYYVVEEILELHIHRLRYLSSIWNILDLVVILLSIVAVGFHIFRTLEVNRLMGKLLQQPNTYADFEFLAFWQTQYNNMNAVNLFFAWIKIFKYISFNKTMTQLSSTLARCAKDILGFAVMFFIVFFAYAQLGYLLFGTQVENFSTFIKCIFTQFRIILGDFDYNAIDNANRILGPAYFVTYVFFVFFVLLNMFLAIINDTYSEVKEELAGQKDELQLSDLLK-QGYNKTLLRLRLRKERVSDVQKVLQGGE----QEIQFEDFTNTLRELGHAEHEITELTATFTKFDRDGNRILDEKEQEKMRQDLEEERVALNTEIEKLGRSIVS-SPQGKSGPEAARAGGWVSGEEFYMLTRRVLQLETVLEGVVSQIDAVGSKLKMLER 740          
BLAST of PKD2-1 vs. Ensembl Human
Match: PKD2L2 (polycystin 2 like 2, transient receptor potential cation channel [Source:HGNC Symbol;Acc:HGNC:9012])

HSP 1 Score: 342.043 bits (876), Expect = 1.054e-106
Identity = 241/646 (37.31%), Postives = 390/646 (60.37%), Query Frame = 3
Query:  339 EELSSNKVVFLKTALRELVTYLVFLIFLMMVAYGTRSENLYYLTTAMSNILI--------TSNFNGITAMDSFWNWINIDFVNALYWNTWYNSMTYLPLNEREFIHYENKLVGVPQIRQLRIGSNTCQIPSFFKNSMSNCYGDYSFSNLNKSDFGISNSTAWXXXXXXXXXXXXXXXXXXXYDDGGFIQVLSRNSLETISILSNLQNNLWLDHGTRAVFIDLTVYNANVNLYCVIKLIFEFPPTGGIIPSSQFRTLKLIRYETGYDFFILFCXXXXXXXXXXXXXXXXXXXKKNKLSYFKKIWNVVDVLMIIMSFISIAINVYRVLSTXXXXXXXXXXXXXXXDFTFFANWNKYFNDAVSITTFFGAVKIFKYISFNKTMNQLTDTLSNSIREXXXXXXXXXXXXXXXXXWGYLQFGSQIVDFCRFQDSVFTLFRLVLGDFNFMALVQANSFIGPXXXXXXXXXXXXXXMNMFVAIIADSYEVVKEKL-MQSKDEFQITKFLKAQFFNKFTKNRVMKIQEVLENENIANCETLSYQDWRDKLQSRGYADVEIQALFMRYDSDGDRTLDYEERRVM-LQDLKNGKISLEGHQTESNESELSVKKEDESMPVDEELFGGLVERVDSVEKNISNIVSKIDMVFLRLSEI 2246
             +L   K V + T L+EL+ Y +FLI L ++ +G  + ++YYL   MS++ +         +NF  I ++  FW ++    +  LYW++WYN+     L     I+YEN L+GVP++RQL++ +NTC++ S F++ MS CYG Y+ +N + S+FG+  +T W Y+  N+     +      Y +GG+I  LS++  ET +   +L+ N W+  GTR +FID ++YNANVNL+C+I+L+ EFP TGGI+ S QF ++KL+RY + YD+FI  CEI    ++  +  +E  +IK+ K +YFK IWN +++L++++ F++++ N Y  +    ++ QL+ +   Y DF F A W+ Y+N+ ++IT FF  +KIFK+ISFNKTM+QL+ TLS  +++++GFA+MFFI+FFA+A  G+L FGSQ+ DF  FQ+S+F  FR+VLGDFNF  + QAN  +GP+YF+ ++FFVFFVL+NMF+AII D+Y  VK    +  + +F++ K +K  + N   K R+ K Q+                   DK +++G  D+  QA          R   ++E  +   + +K  K  LE       +   S++ +D+  PV +E F  L      +EK +  I  K++ V  ++S +
Sbjct:   15 HKLHYRKEVEITTTLQELLLYFIFLINLCILTFGMVNPHMYYLNKVMSSLFLDTSVPGEERTNFKSIRSITDFWKFMEGPLLEGLYWDSWYNNQQLYNLKNSSRIYYENILLGVPRVRQLKVRNNTCKVYSSFQSLMSECYGKYTSANEDLSNFGLQINTEWRYSTSNTNSPWHWGFLGV-YRNGGYIFTLSKSKSETKNKFIDLRLNSWITRGTRVIFIDFSLYNANVNLFCIIRLVAEFPATGGILTSWQFYSVKLLRYVSYYDYFIASCEITFCIFLFVFTTQEVKKIKEFKSAYFKSIWNWLELLLLLLCFVAVSFNTYYNVQIFLLLGQLLKSTEKYSDFYFLACWHIYYNNIIAITIFFAWIKIFKFISFNKTMSQLSSTLSRCVKDIVGFAIMFFIIFFAYAQLGFLVFGSQVDDFSTFQNSIFAQFRIVLGDFNFAGIQQANPILGPIYFITFIFFVFFVLLNMFLAIINDTYSEVKADYSIGRRLDFELGKMIKQSYKNVLEKFRLKKAQKD-----------------EDK-KTKGSGDLAEQA----------RREGFDENEIQNAEQMKKWKERLE-------KKYYSMEIQDDYQPVTQEEFRELFLYAVELEKELHYINLKLNQVVRKVSAL 624          
BLAST of PKD2-1 vs. Ensembl Human
Match: PKD2L2 (polycystin 2 like 2, transient receptor potential cation channel [Source:HGNC Symbol;Acc:HGNC:9012])

HSP 1 Score: 340.887 bits (873), Expect = 2.217e-106
Identity = 226/572 (39.51%), Postives = 361/572 (63.11%), Query Frame = 3
Query:  339 EELSSNKVVFLKTALRELVTYLVFLIFLMMVAYGTRSENLYYLTTAMSNILI--------TSNFNGITAMDSFWNWINIDFVNALYWNTWYNSMTYLPLNEREFIHYENKLVGVPQIRQLRIGSNTCQIPSFFKNSMSNCYGDYSFSNLNKSDFGISNSTAWXXXXXXXXXXXXXXXXXXXYDDGGFIQVLSRNSLETISILSNLQNNLWLDHGTRAVFIDLTVYNANVNLYCVIKLIFEFPPTGGIIPSSQFRTLKLIRYETGYDFFILFCXXXXXXXXXXXXXXXXXXXKKNKLSYFKKIWNVVDVLMIIMSFISIAINVYRVLSTXXXXXXXXXXXXXXXDFTFFANWNKYFNDAVSITTFFGAVKIFKYISFNKTMNQLTDTLSNSIREXXXXXXXXXXXXXXXXXWGYLQFGSQIVDFCRFQDSVFTLFRLVLGDFNFMALVQANSFIGPXXXXXXXXXXXXXXMNMFVAIIADSYEVVKEKL-MQSKDEFQITKFLKAQFFNKFTKNRVMKIQ-------------------EVLENENIANCETLSYQDWRDKLQSRGYADVEIQ 1970
             +L   K V + T L+EL+ Y +FLI L ++ +G  + ++YYL   MS++ +         +NF  I ++  FW ++    +  LYW++WYN+     L     I+YEN L+GVP++RQL++ +NTC++ S F++ MS CYG Y+ +N + S+FG+  +T W Y+  N+     +      Y +GG+I  LS++  ET +   +L+ N W+  GTR +FID ++YNANVNL+C+I+L+ EFP TGGI+ S QF ++KL+RY + YD+FI  CEI    ++  +  +E  +IK+ K +YFK IWN +++L++++ F++++ N Y  +    ++ QL+ +   Y DF F A W+ Y+N+ ++IT FF  +KIFK+ISFNKTM+QL+ TLS  +++++GFA+MFFI+FFA+A  G+L FGSQ+ DF  FQ+S+F  FR+VLGDFNF  + QAN  +GP+YF+ ++FFVFFVL+NMF+AII D+Y  VK    +  + +F++ K +K  + N   K R+ K Q                   E  +   I N E +  + W+++L+ + Y  +EIQ
Sbjct:   15 HKLHYRKEVEITTTLQELLLYFIFLINLCILTFGMVNPHMYYLNKVMSSLFLDTSVPGEERTNFKSIRSITDFWKFMEGPLLEGLYWDSWYNNQQLYNLKNSSRIYYENILLGVPRVRQLKVRNNTCKVYSSFQSLMSECYGKYTSANEDLSNFGLQINTEWRYSTSNTNSPWHWGFLGV-YRNGGYIFTLSKSKSETKNKFIDLRLNSWITRGTRVIFIDFSLYNANVNLFCIIRLVAEFPATGGILTSWQFYSVKLLRYVSYYDYFIASCEITFCIFLFVFTTQEVKKIKEFKSAYFKSIWNWLELLLLLLCFVAVSFNTYYNVQIFLLLGQLLKSTEKYSDFYFLACWHIYYNNIIAITIFFAWIKIFKFISFNKTMSQLSSTLSRCVKDIVGFAIMFFIIFFAYAQLGFLVFGSQVDDFSTFQNSIFAQFRIVLGDFNFAGIQQANPILGPIYFITFIFFVFFVLLNMFLAIINDTYSEVKADYSIGRRLDFELGKMIKQSYKNVLEKFRLKKAQKDEDKKTKGSGDLAEQARREGFDENEIQNAEQM--KKWKERLEKK-YYSMEIQ 582          
BLAST of PKD2-1 vs. Ensembl Human
Match: PKD2L2 (polycystin 2 like 2, transient receptor potential cation channel [Source:HGNC Symbol;Acc:HGNC:9012])

HSP 1 Score: 325.479 bits (833), Expect = 1.295e-100
Identity = 236/646 (36.53%), Postives = 377/646 (58.36%), Query Frame = 3
Query:  339 EELSSNKVVFLKTALRELVTYLVFLIFLMMVAYGTRSENLYYLTTAMSNILI--------TSNFNGITAMDSFWNWINIDFVNALYWNTWYNSMTYLPLNEREFIHYENKLVGVPQIRQLRIGSNTCQIPSFFKNSMSNCYGDYSFSNLNKSDFGISNSTAWXXXXXXXXXXXXXXXXXXXYDDGGFIQVLSRNSLETISILSNLQNNLWLDHGTRAVFIDLTVYNANVNLYCVIKLIFEFPPTGGIIPSSQFRTLKLIRYETGYDFFILFCXXXXXXXXXXXXXXXXXXXKKNKLSYFKKIWNVVDVLMIIMSFISIAINVYRVLSTXXXXXXXXXXXXXXXDFTFFANWNKYFNDAVSITTFFGAVKIFKYISFNKTMNQLTDTLSNSIREXXXXXXXXXXXXXXXXXWGYLQFGSQIVDFCRFQDSVFTLFRLVLGDFNFMALVQANSFIGPXXXXXXXXXXXXXXMNMFVAIIADSYEVVKEKL-MQSKDEFQITKFLKAQFFNKFTKNRVMKIQEVLENENIANCETLSYQDWRDKLQSRGYADVEIQALFMRYDSDGDRTLDYEERRVM-LQDLKNGKISLEGHQTESNESELSVKKEDESMPVDEELFGGLVERVDSVEKNISNIVSKIDMVFLRLSEI 2246
             +L   K V + T L+EL+ Y +FLI L ++ +G  + ++YYL   MS++ +         +NF  I ++  FW ++    +  LYW++WYN+     L     I+YEN L+GVP++RQL++ +NTC++ S F++ MS CYG Y+ +N + S+FG+  +T W Y+  N+     +      Y +GG+I  LS++  ET +   +L+ N W+  GTR +FID ++YNANVNL+C+I+L+ EFP TGGI+ S QF ++KL+RY + YD+FI  CEI    ++  +  +E  +IK+ K +YFK IWN +++L++++                        +   Y DF F A W+ Y+N+ ++IT FF  +KIFK+ISFNKTM+QL+ TLS  +++++GFA+MFFI+FFA+A  G+L FGSQ+ DF  FQ+S+F  FR+VLGDFNF  + QAN  +GP+YF+ ++FFVFFVL+NMF+AII D+Y  VK    +  + +F++ K +K  + N   K R+ K Q+                   DK +++G  D+  QA          R   ++E  +   + +K  K  LE       +   S++ +D+  PV +E F  L      +EK +  I  K++ V  ++S +
Sbjct:   15 HKLHYRKEVEITTTLQELLLYFIFLINLCILTFGMVNPHMYYLNKVMSSLFLDTSVPGEERTNFKSIRSITDFWKFMEGPLLEGLYWDSWYNNQQLYNLKNSSRIYYENILLGVPRVRQLKVRNNTCKVYSSFQSLMSECYGKYTSANEDLSNFGLQINTEWRYSTSNTNSPWHWGFLGV-YRNGGYIFTLSKSKSETKNKFIDLRLNSWITRGTRVIFIDFSLYNANVNLFCIIRLVAEFPATGGILTSWQFYSVKLLRYVSYYDYFIASCEITFCIFLFVFTTQEVKKIKEFKSAYFKSIWNWLELLLLLLL----------------------KSTEKYSDFYFLACWHIYYNNIIAITIFFAWIKIFKFISFNKTMSQLSSTLSRCVKDIVGFAIMFFIIFFAYAQLGFLVFGSQVDDFSTFQNSIFAQFRIVLGDFNFAGIQQANPILGPIYFITFIFFVFFVLLNMFLAIINDTYSEVKADYSIGRRLDFELGKMIKQSYKNVLEKFRLKKAQKD-----------------EDK-KTKGSGDLAEQA----------RREGFDENEIQNAEQMKKWKERLE-------KKYYSMEIQDDYQPVTQEEFRELFLYAVELEKELHYINLKLNQVVRKVSAL 602          
BLAST of PKD2-1 vs. Ensembl Celegans
Match: pkd-2 (Polycystin-2 [Source:UniProtKB/Swiss-Prot;Acc:Q9U1S7])

HSP 1 Score: 270.396 bits (690), Expect = 2.525e-79
Identity = 213/653 (32.62%), Postives = 349/653 (53.45%), Query Frame = 3
Query:  339 EELSSNKVVFLKTALRELVTYLVFLIFLMMVAYGTRSENLYYLTTAMSNILITSN-------FNGITAMDSFWNWINIDFVNALYWNTWYNSMTYLPLNEREFIHYENKLVGVPQIRQLRIGSNTCQIPSFFKNSMSNCYGDYSFSNLNKSDFGISNSTAWXXXXXXXXXXXXXXXXXXXYDDGGFIQVLS-RNSLETISILSNLQNNLWLDHGTRAVFIDLTVYNANVNLYCVIKLIFEFPPTGGIIPSSQFRTLKLIRYETGYDFFILFCXXXXXXXXXXXXXXXXXXXKKNKLSYFKKIWNVVDVLMIIMSFISIAINVYRVLSTXXXXXXXXXXXXXXXDF-TFFANWNKYFNDAVSITTFFGAVKIFKYISFNKTMNQLTDTLSNSIREXXXXXXXXXXXXXXXXXWGYLQFGSQIVDFCRFQDSVFTLFRLVLGDFNFMALVQANSFIGPXXXXXXXXXXXXXXMNMFVAIIADSYEVVKEKLMQSKDEFQITKFLKAQFFNKFTKNRVMKIQEVLENENIANCETLSYQDWRDKLQSRGYADVEIQALFMRYDSDGDRTLDYEERRVMLQDLKNGKISLEGHQTESNESELSVKKEDESMPVDEELFGGLVERVDSVEKNISNIVSKIDMVFLRLSEIEKAKLDHQ 2270
             E S  K+     +  E+  Y VFLI L+ VA+   S   YY +  MS++ + S        F   T+MD+ W+W++   +  +YW    NS      +    I+YEN+L+G P+IR L++ +++C +   F+  +  C+ +Y     +K+  G  +  A+ Y       +     T A+Y  GGF+Q L    S E  S ++ L+ N W+D G+RA+ +D  +YNAN+NL+CV+KL+FE P +GG+I + +  T  L+ Y+T     ++  E +   +++Y+  EE   I +++L Y  + WN+VDV+++  S  +I ++V R  +    V  ++ N      F    ++ N Y N    +  F   VK+FK+IS NKTM+QL+ TL+ S +++ GFAVMF + FFAFA +GYL FG+QI D+    +S F L RL+LGDFNF AL   N F GP +F+ YVFFV F+L+NMF+AII DSY  VK +L + KD   I  +           N+V  + +  +  + A  E  +Y+D++  L   GYA+ +I   F R++     T    E+  + +D+ +    +    TE   + +   ++          +  L  RVD +++++ +IV +I+ V   L  IEK ++  Q
Sbjct:   60 HEKSDGKIKLTARSFMEVGGYAVFLIVLVYVAFAQNSIQSYYYSKVMSDLFVASTGASGAPAFGSCTSMDNIWDWLSQVLIPGIYWTETSNST-----DNENMIYYENRLLGEPRIRMLKVTNDSCTVMKSFQREIKECFANYEEKLEDKTMVGDGSVDAFIYATAKELENLKTVGTIASYGGGGFVQRLPVAGSTEAQSAIATLKANRWIDRGSRAIIVDFALYNANINLFCVVKLLFELPASGGVITTPKLMTYDLLTYQTSGGTRMMIFEGIFCGFILYFIFEELFAIGRHRLHYLTQFWNLVDVVLLGFSVATIILSVNRTKTGVNRVNSVIENGLTNAPFDDVTSSENSYLNIKACV-VFVAWVKVFKFISVNKTMSQLSSTLTRSAKDIGGFAVMFAVFFFAFAQFGYLCFGTQIADYSNLYNSAFALLRLILGDFNFSALESCNRFFGPAFFIAYVFFVSFILLNMFLAIINDSYVEVKAELARKKDGEGILDWF---------MNKVRGLTKRGKRPD-APGEDATYEDYKLMLYRAGYAEKDINEAFTRFNVT-SMTEHVPEK--VAEDIADEVARM----TEQKRNYMENHRD----------YANLNRRVDQMQESVFSIVDRIEGVNATLQTIEKQRVQQQ 679          
BLAST of PKD2-1 vs. Ensembl Celegans
Match: lov-1 (Location of vulva defective 1 [Source:UniProtKB/Swiss-Prot;Acc:Q09624])

HSP 1 Score: 88.5817 bits (218), Expect = 1.519e-17
Identity = 94/411 (22.87%), Postives = 189/411 (45.99%), Query Frame = 3
Query:  381 LRELVTYLVFLIFLMMVAYGTRSENLYYLTTAMSNIL-------ITSNFNGITAMDSFWNWINIDFVNALYWNTWYNSMTYLPLNEREFIHYE-NKLVGVPQIRQLRIG-SNTCQIPSFFKNSMSNCYGDYSFSNLNK------------SDFGISNSTAWXXXXXXXXXXXXXXXXXXXYDDGGFIQVLSRNSLETISILSNLQNNLWLDHGTRAVFIDLTVYNANVNLYCVIKLIFEFPPTGGIIPSSQFRTLKLIR-----------YETGYDFF--ILFCXXXXXXXXXXXXXXXXXXXKKNKLSYFKKI-------WNVVDVLMIIMSFISI-AINVYRVLSTXXXXXXXXXXXXXXXDFTFFANWNKYFNDAVSITTFFGAVKIFKYISFNKTMNQLTDTLSNSI 1487
            +R+++ +   L  ++M+ Y  +  + Y+    MS IL         + F  I   D FW+W       AL   +WY+      +  R +++ + ++ +G+  IRQ+R   S  C +   F+  +++C  + +  N  K            S+ G   S  ++Y       + + S    +Y  GG+   +S    E I++ + L +  W+D  TRAV I+ + YNA +N + V++L+ E P +G  +P+S   +++LI+           YE  Y FF  ++F + +V +    Y +   ++  +N      ++       WN +D+++  ++  S+ A  + +  +   +     NN N+Y++ T   NW   F+  ++   FF + K+ + + FN+ +  L  TL N++
Sbjct: 2676 IRDMLCFFASLYIMVMLTYYCKDRHGYWYQLEMSTILNINQKNYGDNTFMSIQHADDFWDWARESLATAL-LASWYDGNPAYGM--RAYMNDKVSRSMGIGTIRQVRTKKSAECTMFKQFQGYINDCGEELTSKNEEKTLYMQAGWTELESENGTDASDEYTYKTSEELSTETVSGLLYSYSGGGYTISMSGTQAEIITLFNKLDSERWIDDHTRAVIIEFSAYNAQINYFSVVQLLVEIPKSGIYLPNSWVESVRLIKSEGSDGTVVKYYEMLYIFFSVLIFVKEIVFYLYGRYKVITTMKPTRNPFKIVYQLALGNFSPWNFMDLIVGALAVASVLAYTIRQRTTNRAMEDFNANNGNSYINLTEQRNWEIVFSYCLAGAVFFTSCKMIRILRFNRRIGVLAATLDNAL 3083          
BLAST of PKD2-1 vs. Ensembl Fly
Match: Pkd2 (gene:FBgn0041195 transcript:FBtr0080365)

HSP 1 Score: 156.377 bits (394), Expect = 6.253e-39
Identity = 133/406 (32.76%), Postives = 224/406 (55.17%), Query Frame = 3
Query:  594 MTYLPLNEREFIHYENKLVGVPQIRQLRIGSNTCQIPSFFKNSMSNCYGDYSFSNLNKSDFGISNSTAWXXXXXXXXXXXXXXXXXXXYDDGGFIQVLSRNSLETISILSNLQNNLWLDHGTRAVFIDLTVYNANVNLYCVIKLIFEFPPTGGIIPSSQFRTLKLIRYETGYDFFILFCXXXXXXXXXXXXXXXXXXXKKNKLS-YFKKIWNVVDVLMIIMSFISIAINV---YRVLSTXXXXXXXXXXXXXXXDFTFFANWNKYFNDAVSITTFFGAVKIFKYISFNKTMNQLTDTLSNSIREXXXXXXXXXXXXXXXXXWGYLQFGSQIVDFCRFQDSVFTLFRLVLGDFNFMALVQANSFIGPXXXXXXXXXXXXXXMNMFVAIIADSYEVVKEKLMQSKDEF 1799
            M++  L  R F+ YEN L+G P++RQ+R+   +C +   F    + CY  YS    ++      +     +   +   S+      A Y  GG+   L  +    + I+++L++  WLD G+R   ++  ++N N +++  IKLI E PPTGG+IP +  +T+K+  + T     +    I     VIYY I E  EI+K+ +  YF  + N++D  +++  ++++  N+   ++V+S     +   +     +D   F  WN  + D ++I  F   +KIFK+ISFNKT+ Q T TL    +++ GF++MF IVF A+A  G L FG++  DF  F  S+ T+ R++LGDF +  + QAN  +GP+YFL Y+  VFF+L+NMF+AII ++Y  VK ++ Q +   
Sbjct:  418 MSFHHLEGRVFL-YENLLLGPPRLRQIRVRKESCYVNDAFIRYFNTCYAAYSSGAEDRKPMHKGSP----FRTMHDLDSTPIWTVLAFYRTGGYTVNLDYDKDRNVKIINDLKDIHWLDRGSRLCLVEFNLFNENTDIFQSIKLIAEIPPTGGVIPQAHLQTVKMYSFFTDRSMLMTVIYIFWYIMVIYYTIYEITEIRKSGIKIYFCSMLNILDCAILLGCYLALVYNIWHSFKVMS--LTARAHSDVTYQSLDVLCF--WNIIYVDMMAILAFLVWIKIFKFISFNKTLVQFTTTLKRCSKDLAGFSLMFGIVFLAYAQLGLLLFGTKHPDFRNFITSILTMIRMILGDFQYNLIEQANRVLGPIYFLTYILLVFFILLNMFLAIIMETYNTVKGEITQGRSHL 814          
BLAST of PKD2-1 vs. Ensembl Fly
Match: brv3 (gene:FBgn0040333 transcript:FBtr0340092)

HSP 1 Score: 65.4698 bits (158), Expect = 1.756e-10
Identity = 60/255 (23.53%), Postives = 114/255 (44.71%), Query Frame = 3
Query:  372 KTALRELVTYLVFLIFLMMVAYGTRSENLYYLTTAMSNILI--TSNFNGITA---MDSFWNWINIDFVNALYWNTWYNSMTYLPLNEREFIHYENK-LVGVPQIRQLRIGSNTCQI-PSFFKNSMSNCYGDYSFSNLNKSDFGISNSTAWXXXXX------XXXXXXXXXXXXXXYDD-GGFIQVLSRNSLETISILSNLQNNLWLDHGTRAVFIDLTVYNANVNLYCVIKLIFEFPPTGGIIPSSQFRTLKLIR 1094
            K    +L  Y  + + LM +   TR + LY+ T  ++++ +   +++ G+     ++  +++I    V A   N+  +           + H E   L+GV ++RQLR+ +    + P  F ++         +  L+ SD        W               +     +  +Y +  G++ +L+R++  ++ ++  L  N WL   T AVFID T+YN +VNL+ +  L  E  P GGI+P  Q  + KL+ 
Sbjct:  123 KMIAHDLFIYGPYFLCLMCLVLVTRDQTLYHNTRIITDLFMYNHTDYTGLQEVYFLNQLFDFIESTLVLAFNSNSTESG-------SPGWAHAEQSVLLGVMRLRQLRVSNPQVGLGPPKFSDTYYMPDWQLPYRKLHYSDKYWRIYEPWIPIKMGFEFLDALLMNFDHVGSLNSYPELAGYVSLLARSAANSMKVIDYLSENHWLTLNTSAVFIDFTLYNVDVNLFSICTLRVEKTPFGGIVPDVQVDSAKLLE 370          
BLAST of PKD2-1 vs. Ensembl Fly
Match: brv3 (gene:FBgn0040333 transcript:FBtr0300708)

HSP 1 Score: 65.0846 bits (157), Expect = 1.790e-10
Identity = 60/255 (23.53%), Postives = 114/255 (44.71%), Query Frame = 3
Query:  372 KTALRELVTYLVFLIFLMMVAYGTRSENLYYLTTAMSNILI--TSNFNGITA---MDSFWNWINIDFVNALYWNTWYNSMTYLPLNEREFIHYENK-LVGVPQIRQLRIGSNTCQI-PSFFKNSMSNCYGDYSFSNLNKSDFGISNSTAWXXXXX------XXXXXXXXXXXXXXYDD-GGFIQVLSRNSLETISILSNLQNNLWLDHGTRAVFIDLTVYNANVNLYCVIKLIFEFPPTGGIIPSSQFRTLKLIR 1094
            K    +L  Y  + + LM +   TR + LY+ T  ++++ +   +++ G+     ++  +++I    V A   N+  +           + H E   L+GV ++RQLR+ +    + P  F ++         +  L+ SD        W               +     +  +Y +  G++ +L+R++  ++ ++  L  N WL   T AVFID T+YN +VNL+ +  L  E  P GGI+P  Q  + KL+ 
Sbjct:  123 KMIAHDLFIYGPYFLCLMCLVLVTRDQTLYHNTRIITDLFMYNHTDYTGLQEVYFLNQLFDFIESTLVLAFNSNSTES-------GSPGWAHAEQSVLLGVMRLRQLRVSNPQVGLGPPKFSDTYYMPDWQLPYRKLHYSDKYWRIYEPWIPIKMGFEFLDALLMNFDHVGSLNSYPELAGYVSLLARSAANSMKVIDYLSENHWLTLNTSAVFIDFTLYNVDVNLFSICTLRVEKTPFGGIVPDVQVDSAKLLE 370          
BLAST of PKD2-1 vs. Ensembl Zebrafish
Match: pkd2 (polycystic kidney disease 2 [Source:NCBI gene;Acc:432387])

HSP 1 Score: 435.647 bits (1119), Expect = 2.086e-139
Identity = 272/698 (38.97%), Postives = 431/698 (61.75%), Query Frame = 3
Query:  273 DNHACGKKFLRVIRRAWSTRYTEELSSNKVVFLKTALRELVTYLVFLIFLMMVAYGTRSENLYYLTTAMSNILI--------TSNFNGITAMDSFWNWINIDFVNALYWNTWYNSMTYLPLNEREFIHYENKLVGVPQIRQLRIGSNTCQIPSFFKNSMSNCYGDYSFSNLNKSDFGISNSTAWXXXXXXXXXXXXXXXXXXXYDDGGFIQVLSRNSLETISILSNLQNNLWLDHGTRAVFIDLTVYNANVNLYCVIKLIFEFPPTGGIIPSSQFRTLKLIRYETGYDFFILFCXXXXXXXXXXXXXXXXXXXKKNKLSYFKKIWNVVDVLMIIMSFISIAINVYRVLSTXXXXXXXXXXXXXXXDFTFFANWNKYFNDAVSITTFFGAVKIFKYISFNKTMNQLTDTLSNSIREXXXXXXXXXXXXXXXXXWGYLQFGSQIVDFCRFQDSVFTLFRLVLGDFNFMALVQANSFIGPXXXXXXXXXXXXXXMNMFVAIIADSYEVVKEKLMQSKDEFQITKFLKAQFFNKFTKNRVMK--IQEVLENENIANCETLSYQDWRDKLQSRGYADVEIQALFMRYDSDGDRTLDYEERRVMLQDLKNGK--ISLEGHQTESNESELSVKKEDESMPVDE--------------------ELFGGLVERVDSVEKNISNIVSKIDMVFLRLSEIEKAKLDHQ 2270
            ++ +CGK+ L  +R  W TR   E +SN+ ++LKT LRE++TY++FL+ L ++ YG  S N+YY T  MS + +         +NF  ++ M+ FW +    F+N +YW  WYN+ + LP N+   I+YEN L+GVP++RQLR+ + +C +    ++ + +CY  YS +N +K+ FG  N TAW +   +S   SS+    +TY  GG+ Q LSR   ++ + L  L+NNLWLD GTRAVF+D ++YN NVNL+C+++L+ EFP TGG +PS QF+T++L+RY + +D+F+  CE+    +V+YY +EE +EI+ ++L YFK +WN +DVL++ +S  +I +N+ R  + +  +  L+ N + Y +F   A    +FN+  +I  F   VK+FK+I+FNKTMNQL+ T+S   +++MGFA+MFFIVF A+A   YL FG+Q+ DF  FQ  +FT FR++LGDF+F  + +A+S +GP+YF  +VFF+F +L+NMF+AII D+Y  VK  + Q + E +IT  +K  +     K ++ K  I ++ ++   A    LS+ + R  L+ +G++D EI+A+F +YD DGD+ L   E + M  DL+  +  + LE        S  S  +  +    D+                    E F  LV RVD +E +I +IVSKID V ++L  +E+AK+  +
Sbjct:  121 EHRSCGKRILEKMRVLWDTRLLGESNSNREMYLKTVLREMITYILFLLTLCIITYGMVSTNMYYYTKVMSQLFLDTPLSSGEPTNFKSLSTMEDFWKFTEGPFLNGMYWELWYNNKS-LPENQ-SLIYYENLLLGVPRLRQLRVRNESCSVHEDLRDEVYDCYNVYSPANEDKAPFGPKNGTAWRFKDESSLGESSYWGQVSTYGGGGYYQDLSRTREKSANQLQELKNNLWLDRGTRAVFLDFSIYNGNVNLFCIVRLLVEFPATGGAVPSWQFQTVRLLRYVSSWDYFVGMCEVSFCLFVLYYLVEEALEIRLHRLRYFKSLWNCLDVLIVALSVPAIIMNICRTSAVSHRLHFLLENHSTYPNFEPLARLQVHFNNLAAIIVFLSWVKLFKFINFNKTMNQLSTTMSRCAKDLMGFAIMFFIVFLAYAQLAYLVFGTQVNDFSTFQACIFTQFRIILGDFDFSEIEEADSVLGPIYFTTFVFFIFMILLNMFLAIINDTYSEVKADMAQQRSEMEITDLIKKSYNRAMVKLKLKKSSINDIPDSLQQA-AGKLSFDELRQDLRGKGHSDAEIEAIFAKYDLDGDQELTEHEHQQMRDDLEKEREDLDLEHSSLPRPASGRSFSRSQDDSEEDDDEDSGHSSRRRGSSSGGVSYEEFQVLVRRVDRMEHSIGSIVSKIDAVIVKLEAMERAKMKRR 815          
BLAST of PKD2-1 vs. Ensembl Zebrafish
Match: pkd2l1 (polycystic kidney disease 2-like 1 [Source:ZFIN;Acc:ZDB-GENE-030616-558])

HSP 1 Score: 427.943 bits (1099), Expect = 9.766e-138
Identity = 277/701 (39.51%), Postives = 423/701 (60.34%), Query Frame = 3
Query:  267 EDDNHACGKKFLRVIRRAWSTRYTEELSSNKVVFLKTALRELVTYLVFLIFLMMVAYGTRSENLYYLTTAMSNILIT------SNFNGITAMDSFWNWINIDFVNALYWNTWYNSMTYLPLNEREFIHYENKLVGVPQIRQLRIGSNTCQIPSFFKNSMSNCYGDYSFSNLNKSDFGISNSTAWXXXXXXXXXXXXXXXXXXXYDDGGFIQVLSRNSLETISILSNLQNNLWLDHGTRAVFIDLTVYNANVNLYCVIKLIFEFPPTGGIIPSSQFRTLKLIRYETGYDFFILFCXXXXXXXXXXXXXXXXXXXKKNKLSYFKKIWNVVDVLMIIMSFISIAINVYRVLSTXXXXXXXXXXXXXXXDFTFFANWNKYFNDAVSITTFFGAVKIFKYISFNKTMNQLTDTLSNSIREXXXXXXXXXXXXXXXXXWGYLQFGSQIVDFCRFQDSVFTLFRLVLGDFNFMALVQANSFIGPXXXXXXXXXXXXXXMNMFVAIIADSYEVVKEKLMQSKDEFQITKFLKAQFFNKFTKNRVMK-----IQEVLENENIANCETLSYQDWRDKLQSRGYADVEIQALFMRYDSDGDRTLDYEERRVMLQDLKNGKISLEGHQTESNESELSVKKEDESM-PVDEELFGGLVERVDSVEKNISNIVSKIDMVF--LRLS--EIEKAKLDHQKSISCSLSILTGSQINV 2321
            ED    C   F R I+  W T   ++   N  + +K  L+EL+ Y+VFL+ L ++ YG  S   YY T AM+++ +        +F+ I  M+  W ++    ++ LYW  WYN    L    + FI+YEN L+GVP++RQL++  N+C++P+ FK  +S+C+  Y+    +   FG+ N TAW Y        SS      TY   GF Q L+    E+ ++L +L+ NLWLD GTR +FID T YNAN+NL+CVI+L+ EFP TGG IPS Q RT+KLIRY T +D+FI+ CEIV   +++YY +EE +E + +KLS+F  IWN++D+++I+++ ++I  + +R +  + ++  L+   + Y DF F A W   +N+  ++  FF  +KIFKYISFNKTM QLT TL+    ++ GFA+MFFIVFFA+A  GYL FG+++  F  F   +FT FR++LGDF++ A+ +AN  +GP+YF  YVFFVFFVL+NMF+AII D+Y  VK +L   KDEFQI   +K  +   F K ++ K     +Q+ L+    +    L ++D+R+ L+  G++D EI A F ++D DG++TLD +E+  M Q+L+  + +L     E  + E SV+  +E    V  E +  LV +V  +E ++S I+SK+D V   +RL     E   +D Q +        +G  I+V
Sbjct:   55 EDKKSGCCSFFFRAIKGLWGTALRKDTKENPELNVKANLKELLIYIVFLVDLCLLTYGMTSSATYYYTKAMTDLFVNLPGSNGMSFSSIGCMNDVWTYMEGPLLDNLYWTKWYNDEP-LENGNQSFIYYENLLLGVPRVRQLKVKQNSCKVPTDFKKEISDCFDVYNIKKEDDGAFGLINGTAWQYHSEKEIKGSSHWGLLTTYSGAGFYQDLTTTRDESAALLEDLRENLWLDRGTRVLFIDFTAYNANINLFCVIRLVVEFPATGGAIPSYQIRTVKLIRYVTTWDYFIIGCEIVFCVFILYYIVEEILEFRIHKLSHFTSIWNILDIVVILLAVVAIVFSAFRTIKVDGLLGNLLKQPDIYADFEFLAFWQTQYNNMNAVNLFFAWIKIFKYISFNKTMTQLTSTLARCALDIFGFAIMFFIVFFAYAQLGYLLFGTEVETFSTFNKCIFTQFRIILGDFDYDAIDRANRVLGPIYFFSYVFFVFFVLLNMFLAIINDTYSEVKSELASQKDEFQIADLIKQSYAKTFMKLKLKKEKISDVQKALD----SGASELEFKDFRNALKEMGHSDREISAAFSKFDQDGNQTLDKQEQENMKQELEEKRDALSA---ELRDLENSVEPAEEHRNTVPPEDYQRLVHKVSQLENSVSAIMSKLDFVMEKMRLQTFNTESRDMDKQTNRDDESRPASGGNIHV 747          
BLAST of PKD2-1 vs. Ensembl Zebrafish
Match: pkd1l2a (polycystic kidney disease 1 like 2a [Source:ZFIN;Acc:ZDB-GENE-050208-89])

HSP 1 Score: 138.272 bits (347), Expect = 5.737e-33
Identity = 132/485 (27.22%), Postives = 241/485 (49.69%), Query Frame = 3
Query:  381 LRELVTYLVFLIFLMMVAYGTRSENLYYLTTAMSNILITSNFNGITAMDSFWNWINIDFVNALYWNTWYNSMTYLPLNEREFIHYEN-KLVGVPQIRQLRIGSNTCQIPSFFKNSMSNCYGDYSFSNLNKSDFGIS-NST-----------AWXXXXXXXXXXXXXXXXXXXYDDGGFIQVLSRNSLETISILSNLQNNLWLDHGTRAVFIDLTVYNANVNLYCVIKLIFEFPPTGGIIPSSQFRTLKLIRYETGYDFFILFCXXXXXXXXXXXXXXXXXXXKKNKLSYFKKIWNVVDVLMIIMSFISIAINVYRVLSTXXXXXXXXXXXXXXXDFTFFANWNKYFNDAVSITTFFGAVKIFKYISFNKTMNQLTDTLSNSIREXXXXXXXXXXXXXXXXXWGYLQFGSQIVDFCRFQDSVFTLFRLVLGDFNFMALVQANSFIGPXXXXXXXXXXXXXXMNMFVAIIADSYEVVKEKLMQSKDE 1796
            +RE++ Y+ FL  L++VAYG R  N YYLT  +     T     +   D F  W N   +  LY                 FI   N KLVG  +IRQ+R+  +TC+I +  + S+ +C+  YS+ + +   +    N T            W Y       ++      A Y  GGF+  L  +      +L  L +N WLD  TRAVF++ TVYNANVNL+C++ LIFE    G     S+ + + L +   G+  F++  E +   +++YY + +   +K+ K +YFK  WN++++ +II+S+ ++++ V R +  N+ ++   NN++ +V F   A  +      ++       +K++  +  N  ++ +T TL  +  ++ GF V+  I+F A++    L +G ++  +    ++  T+  L LG FN+  ++  N  +G       + F+ FV++N+F+++I  ++   +E+L  +  E
Sbjct:  617 IREILIYVGFLWMLLLVAYGQRDPNAYYLTHHIRQSFSTGISETLNHKDIFI-WANSSLLRNLYGQY------------PGFITDGNSKLVGNARIRQVRVRRDTCKIANPMQYSVRDCHAPYSWESEDMGSYSPGWNQTRNVNGSKTVLKPWYYQTQAKLRANPVWGGLALYKGGGFVVDLGPDQKNASRLLQYLFDNTWLDVYTRAVFVEFTVYNANVNLFCIVTLIFETTGVGTFQYRSEVQAVHLYQSTGGFHVFVMASEAIYYIFILYYMVVQGKLMKQQKWAYFKSKWNLLELAIIILSWSALSVFVKRTILGNRDIEFYQNNKDMFVSFNETATADAVLGYLIAFLVLLATIKLWHLLRLNPKLHMITSTLQRAWTDISGFIVVMTIMFLAYSIACNLMYGWRLNSYRTLLEAAQTIICLQLGIFNYDEVLDYNPVLGAFLIGSCIIFMTFVVLNLFISVILVAFN--EEQLHPTPSE 1086          
BLAST of PKD2-1 vs. Ensembl Zebrafish
Match: pkd1l2a (polycystic kidney disease 1 like 2a [Source:ZFIN;Acc:ZDB-GENE-050208-89])

HSP 1 Score: 135.961 bits (341), Expect = 4.710e-32
Identity = 133/485 (27.42%), Postives = 242/485 (49.90%), Query Frame = 3
Query:  381 LRELVTYLVFLIFLMMVAYGTRSENLYYLTTAMSNILITSNFNGITAMDSFWNWINIDFVNALYWNTWYNSMTYLPLNEREFIHYEN-KLVGVPQIRQLRIGSNTCQIPSFFKNSMSNCYGDYSFSNLNKSDFGIS-NST-----------AWXXXXXXXXXXXXXXXXXXXYDDGGFIQVLSRNSLETISILSNLQNNLWLDHGTRAVFIDLTVYNANVNLYCVIKLIFEFPPTGGIIPSSQFRTLKLIRYETGYDFFILFCXXXXXXXXXXXXXXXXXXXKKNKLSYFKKIWNVVDVLMIIMSFISIAINVYRVLSTXXXXXXXXXXXXXXXDFTFFANWNKYFNDAVSITTFFGAVKIFKYISFNKTMNQLTDTLSNSIREXXXXXXXXXXXXXXXXXWGYLQFGSQIVDFCRFQDSVFTLFRLVLGDFNFMALVQANSFIGPXXXXXXXXXXXXXXMNMFVAIIADSYEVVKEKLMQSKDE 1796
            +RE++ Y+ FL  L++VAYG R  N YYLT  +     T     +   D F  W N   +  LY    Y            FI   N KLVG  +IRQ+R+  +TC+I +  + S+ +C+  YS+ + +   +    N T            W Y       ++      A Y  GGF+  L  +      +L  L +N WLD  TRAVF++ TVYNANVNL+C++ LIFE    G     S+ + + L +   G+  F++  E +   +++YY + +   +K+ K +YFK  WN++++ +II+S+ ++++ V R +  N+ ++   NN++ +V F   A  +      ++       +K++  +  N  ++ +T TL  +  ++ GF V+  I+F A++    L +G ++  +    ++  T+  L LG FN+  ++  N  +G       + F+ FV++N+F+++I  ++   +E+L  +  E
Sbjct: 1977 IREILIYVGFLWMLLLVAYGQRDPNAYYLTHHIRQSFSTGISETLNHKDIFI-WANSSLLRNLYGQ--YPG----------FITDGNSKLVGNARIRQVRVRRDTCKIANPMQYSVRDCHAPYSWESEDMGSYSPGWNQTRNVNGSKTVLKPWYYQTQAKLRANPVWGGLALYKGGGFVVDLGPDQKNASRLLQYLFDNTWLDVYTRAVFVEFTVYNANVNLFCIVTLIFETTGVGTFQYRSEVQAVHLYQSTGGFHVFVMASEAIYYIFILYYMVVQGKLMKQQKWAYFKSKWNLLELAIIILSWSALSVFVKRTILGNRDIEFYQNNKDMFVSFNETATADAVLGYLIAFLVLLATIKLWHLLRLNPKLHMITSTLQRAWTDISGFIVVMTIMFLAYSIACNLMYGWRLNSYRTLLEAAQTIICLQLGIFNYDEVLDYNPVLGAFLIGSCIIFMTFVVLNLFISVILVAFN--EEQLHPTPSE 2446          
BLAST of PKD2-1 vs. Ensembl Zebrafish
Match: pkd1l2b (polycystic kidney disease 1 like 2b [Source:ZFIN;Acc:ZDB-GENE-141222-87])

HSP 1 Score: 122.094 bits (305), Expect = 7.011e-28
Identity = 124/486 (25.51%), Postives = 229/486 (47.12%), Query Frame = 3
Query:  387 ELVTYLVFLIFLMMVAYGTRSENLYYLTTAMSNILITSNFNGITAMDSFWNWINIDFVNALYWNTWYNSMTYLPLNEREFIHYEN-KLVGVPQIRQLRIGSNTCQIPSFFKNSMSNCYGDYSFSN---------------LNKSDFGISNSTAWXXXXXXXXXXXXXXXXXXXYDDGGFIQVLSRNSLETISILSNLQNNLWLDHGTRAVFIDLTVYNANVNLYCVIKLIFEFPPTGGIIPSSQFRTLKLIRYETGYDFFILFCXXXXXXXXXXXXXXXXXXXKKNKLSYFKKIWNVVDVLMIIMSFISIAINVYRVLSTXXXXXXXXXXXXXXXDFTFFANWNKYFNDAVSITTFFGAVKIFKYISFNKTMNQLTDTLSNSIREXXXXXXXXXXXXXXXXXWGYLQFGSQIVDFCRFQDSVFTLFRLVLGDFNFMALVQANSFIGPXXXXXXXXXXXXXXMNMFVAIIADSYEVVKEKLMQSKDE 1796
            E++ +L FL  L++VAYG +  N +YLT  +         + +   D F  W N   +  L+                 FI   N KLVG  +IRQ+R+  +TC++     +++S C   YS+ N               +N S+ GI   TAW Y   ++  +       A Y  GG++  L  +       L  L N+ WLD  TRAVF++ TVYNANV+L+C++ LI E    G     S  + + L      +  F++   ++   +V+YY   +   +K+ K +YF+  WN++D+ +II+S+ S+++ + + +  N  ++    ++N +  F   A  +      ++     G VK++  +  +  +  +  +L  +  +M    V+ FI+  A++    L FG ++  +    D+   +F L +G FN+  ++ +N  +G V     V    FV++++F++II  +    +E    S++E
Sbjct:  522 EVLIFLGFLSMLLLVAYGQQDPNAFYLTQHIQQSFSKGISDSMKTNDVF-VWANTVLLKNLFGQY------------PGFITDGNSKLVGNARIRQVRVKKDTCKVAKVMLHTVSQCNTPYSWGNEDMMSYGPGWEEFNSVNGSEEGI---TAWQYQSQSTLKALPVWGLTALYRGGGYVMDLGPDKQNATMKLQYLFNSTWLDEYTRAVFVEFTVYNANVDLFCIVTLILESSAVGAFQFRSVLQNVSLYSSVGSFMSFLMASRVIYFLFVVYYMFLQGKLLKRQKWAYFRNKWNLLDMAIIILSWSSLSLFIQKTVQGNIDIQYYQKHKNQFPSFHDTAAVDATLRYVMAFLVLLGCVKLWHLLRLSPKLYVIASSLQRAWDDMSTLTVVIFIILLAYSLACNLIFGWELYTYRTLPDAFTAIFSLQIGIFNYDEVMNSNPALGAVIISSCVLIATFVVLSLFISIILMAVTEERENHQPSEEE 991          
BLAST of PKD2-1 vs. Ensembl Xenopus
Match: usp33 (ubiquitin specific peptidase 33 [Source:Xenbase;Acc:XB-GENE-1016674])

HSP 1 Score: 416.001 bits (1068), Expect = 1.305e-132
Identity = 272/706 (38.53%), Postives = 411/706 (58.22%), Query Frame = 3
Query:  303 RVIRRAWSTRYTEELSSNKVVFLKTALRELVTYLVFLIFLMMVAYGTRSENLYYLTTAMSNILI--------TSNFNGITAMDSFWNWINIDFVNALYWNTWYNSMTYLPLNEREFIHYENKLVGVPQIRQLRIGSNTCQIPSFFKNSMSNCYGDYSFSNLNKSDFGISNSTAWXXXXXXXXXXXXXXXXXXXYDDGGFIQVLSRNSLETISILSNLQNNLWLDHGTRAVFIDLTVYNANVNLYCVIKLIFEFPPTGGIIPSSQFRTLKLIRYETGYDFFILFCXXXXXXXXXXXXXXXXXXXKKNKLSYFKKIWNVVDVLMIIMSFISIAINVYRVLSTXXXXXXXXXXXXXXXDFTFFANWNKYFNDAVSITTFFGAVKIFKYISFNKTMNQLTDTLSNSIREXXXXXXXXXXXXXXXXXWGYLQFGSQIVDFCRFQDSVFTLFRLVLGDFNFMALVQANSFIGPXXXXXXXXXXXXXXMNMFVAIIADSYEVVKEKLMQSKDEFQ----ITKFLKAQFFNKFTKNRVMKIQEVLENENIANCETLSYQDWRDKLQSRGYADVEIQALFMRYDSDGDRTLDYEERRVMLQDLKNGKISLEGHQTESNESELSVKKEDESMP---------------------------VDEELFGGLVERVDSVEKNISNIVSKIDMVFLRLSEIEKAKLDHQKSISCSLSILT 2303
            R  RR W TRYTEE  + +  +LK   REL+TY+VFL+ + ++ Y   + N++Y T  MS + +         +NF  +  MD FW +     ++ LYW+ WYN+ T        FI+YEN L+GVP++RQLR+ + +C +P   K+ + +CY  YS  N + + FG+ N TAW+YT       SS     + Y   G+   LSRN  E+ + ++ L+NNLWLD GTRAVFID +VYNAN+NL+CV++L+ EFP TGG+I S QF+T+KLI Y + ++FF+  CEI+   +++YY IEEF+EI  + L YF+ +WN +D+++I +S  +I I++Y++ S    + + +++ N + +    A W   FN   ++  FF  VK+FK+ +FN+TM QL+ T+S   ++++GFA+MFFI+F A+A + YL FG+QI DF  FQ  +FT FR++LGDF+F  + +AN  +GP+YF  +VFF+FF+L+NMF+AII D+Y  VK  + Q K E +    I K  KA    K  K  V  I E +          L++ + R  L+ +G+ D EI+A+F +YD DGD+ L   E + M  DL+      E    E +   L       S P                           V  E F  LV RVD +E +I +IVSKID V ++L  +E+AKL  ++ +   L  +T
Sbjct:   48 RETRRLWGTRYTEERITTREKYLKIVFRELITYIVFLVIVCVLTYSMVTSNMFYYTKGMSQLFLDGPVSKDERTNFKTLLTMDDFWKFTEGPLMDGLYWDMWYNNRTMA--ENHSFIYYENLLLGVPRLRQLRVKNGSCSVPEDLKDEIKDCYDSYSVRNEDTTPFGLRNGTAWTYTKEKDLNGSSQWGVISVYSGAGYYIDLSRNREESAAQIAMLKNNLWLDRGTRAVFIDFSVYNANLNLFCVVRLLVEFPATGGLITSWQFQTVKLIHYISSFEFFLAACEIIFCIFILYYIIEEFLEIHVHHLHYFRSLWNWLDIVIIGLSLPAIGIHLYKMSSVEGPLNKQLSDLNVFPNLESLAYWQIQFNSVAAVIVFFAWVKLFKFANFNRTMTQLSTTMSRCAKDILGFAIMFFIIFLAYAQFAYLVFGTQIDDFSTFQHCIFTQFRIILGDFDFTEVEEANRILGPIYFTTFVFFMFFILLNMFLAIINDTYSEVKTDMAQQKSEMELIDLIKKVSKAMVKLKLKKTTVDDISESIRQ----GGGKLNFDELRQDLKGKGHTDAEIEAIFAKYDQDGDQELTENEHQQMRDDLEK-----EREDLEMDRGSLPRPMSGRSFPRSLDDSEEDDDEDSGHSSRRRGSSSSGVSYEEFQVLVRRVDRMEHSIGSIVSKIDAVIVKLEAMERAKLKRREVLGRLLDGVT 742          
BLAST of PKD2-1 vs. Ensembl Xenopus
Match: usp33 (ubiquitin specific peptidase 33 [Source:Xenbase;Acc:XB-GENE-1016674])

HSP 1 Score: 411.379 bits (1056), Expect = 3.386e-131
Identity = 266/699 (38.05%), Postives = 410/699 (58.66%), Query Frame = 3
Query:  315 RAWSTRYTEELSSNKVVFLKTALRELVTYLVFLIFLMMVAYGTRSENLYYLTTAMSNILI--------TSNFNGITAMDSFWNWINIDFVNALYWNTWYNSMTYLPLNEREFIHYENKLVGVPQIRQLRIGSNTCQIPSFFKNSMSNCYGDYSFSNLNKSDFGISNSTAWXXXXXXXXXXXXXXXXXXXYDDGGFIQVLSRNSLETISILSNLQNNLWLDHGTRAVFIDLTVYNANVNLYCVIKLIFEFPPTGGIIPSSQFRTLKLIRYETGYDFFILFCXXXXXXXXXXXXXXXXXXXKKNKLSYFKKIWNVVDVLMIIMSFISIAINVYRVLSTXXXXXXXXXXXXXXXDFTFFANWNKYFNDAVSITTFFGAVKIFKYISFNKTMNQLTDTLSNSIREXXXXXXXXXXXXXXXXXWGYLQFGSQIVDFCRFQDSVFTLFRLVLGDFNFMALVQANSFIGPXXXXXXXXXXXXXXMNMFVAIIADSYEVVKEKLMQSKDEFQITKFLKAQFFNKFTKNRVMKIQEVLENENI-ANCETLSYQDWRDKLQSRGYADVEIQALFMRYDSDGDRTLDYEERRVMLQDLKNGKISLEGHQTESNESELSVKKEDESMP---------------------------VDEELFGGLVERVDSVEKNISNIVSKIDMVFLRLSEIEKAKLDHQKSISCSLSILT 2303
            R W TRYTEE  + +  +LK   REL+TY+VFL+ + ++ Y   + N++Y T  MS + +         +NF  +  MD FW +     ++ LYW+ WYN+ T        FI+YEN L+GVP++RQLR+ + +C +P   K+ + +CY  YS  N + + FG+ N TAW+YT       SS     + Y   G+   LSRN  E+ + ++ L+NNLWLD GTRAVFID +VYNAN+NL+CV++L+ EFP TGG+I S QF+T+KLI Y + ++FF+  CEI+   +++YY IEEF+EI  + L YF+ +WN +D+++I +S  +I I++Y++ S    + + +++ N + +    A W   FN   ++  FF  VK+FK+ +FN+TM QL+ T+S   ++++GFA+MFFI+F A+A + YL FG+QI DF  FQ  +FT FR++LGDF+F  + +AN  +GP+YF  +VFF+FF+L+NMF+AII D+Y  VK  + Q K E ++   +K        K ++ K      +E+I      L++ + R  L+ +G+ D EI+A+F +YD DGD+ L   E + M  DL+      E    E +   L       S P                           V  E F  LV RVD +E +I +IVSKID V ++L  +E+AKL  ++ +   L  +T
Sbjct:   14 RLWGTRYTEERITTREKYLKIVFRELITYIVFLVIVCVLTYSMVTSNMFYYTKGMSQLFLDGPVSKDERTNFKTLLTMDDFWKFTEGPLMDGLYWDMWYNNRTMA--ENHSFIYYENLLLGVPRLRQLRVKNGSCSVPEDLKDEIKDCYDSYSVRNEDTTPFGLRNGTAWTYTKEKDLNGSSQWGVISVYSGAGYYIDLSRNREESAAQIAMLKNNLWLDRGTRAVFIDFSVYNANLNLFCVVRLLVEFPATGGLITSWQFQTVKLIHYISSFEFFLAACEIIFCIFILYYIIEEFLEIHVHHLHYFRSLWNWLDIVIIGLSLPAIGIHLYKMSSVEGPLNKQLSDLNVFPNLESLAYWQIQFNSVAAVIVFFAWVKLFKFANFNRTMTQLSTTMSRCAKDILGFAIMFFIIFLAYAQFAYLVFGTQIDDFSTFQHCIFTQFRIILGDFDFTEVEEANRILGPIYFTTFVFFMFFILLNMFLAIINDTYSEVKTDMAQQKSEMELIDLIKKGCSKAMVKLKLKKTTVDDISESIRQGGGKLNFDELRQDLKGKGHTDAEIEAIFAKYDQDGDQELTENEHQQMRDDLEK-----EREDLEMDRGSLPRPMSGRSFPRSLDDSEEDDDEDSGHSSRRRGSSSSGVSYEEFQVLVRRVDRMEHSIGSIVSKIDAVIVKLEAMERAKLKRREVLGRLLDGVT 705          
BLAST of PKD2-1 vs. Ensembl Xenopus
Match: usp33 (ubiquitin specific peptidase 33 [Source:Xenbase;Acc:XB-GENE-1016674])

HSP 1 Score: 415.231 bits (1066), Expect = 5.065e-131
Identity = 272/735 (37.01%), Postives = 422/735 (57.41%), Query Frame = 3
Query:  210 GEKSNSEQNLSSSADLFLLEDDNHACGK-KFLRVIRRAWSTRYTEELSSNKVVFLKTALRELVTYLVFLIFLMMVAYGTRSENLYYLTTAMSNILI--------TSNFNGITAMDSFWNWINIDFVNALYWNTWYNSMTYLPLNEREFIHYENKLVGVPQIRQLRIGSNTCQIPSFFKNSMSNCYGDYSFSNLNKSDFGISNSTAWXXXXXXXXXXXXXXXXXXXYDDGGFIQVLSRNSLETISILSNLQNNLWLDHGTRAVFIDLTVYNANVNLYCVIKLIFEFPPTGGIIPSSQFRTLKLIRYETGYDFFILFCXXXXXXXXXXXXXXXXXXXKKNKLSYFKKIWNVVDVLMIIMSFISIAINVYRVLSTXXXXXXXXXXXXXXXDFTFFANWNKYFNDAVSITTFFGAVKIFKYISFNKTMNQLTDTLSNSIREXXXXXXXXXXXXXXXXXWGYLQFGSQIVDFCRFQDSVFTLFRLVLGDFNFMALVQANSFIGPXXXXXXXXXXXXXXMNMFVAIIADSYEVVKEKLMQSKDEFQITKFLKAQFFNKFTKNRVMKIQEVLENENI-ANCETLSYQDWRDKLQSRGYADVEIQALFMRYDSDGDRTLDYEERRVMLQDLKNGKISLEGHQTESNESELSVKKEDESMP---------------------------VDEELFGGLVERVDSVEKNISNIVSKIDMVFLRLSEIEKAKLDHQKSISCSLSILT 2303
            G K   +  + +  +    E      G  K L  +R  W TRYTEE  + +  +LK   REL+TY+VFL+ + ++ Y   + N++Y T  MS + +         +NF  +  MD FW +     ++ LYW+ WYN+ T        FI+YEN L+GVP++RQLR+ + +C +P   K+ + +CY  YS  N + + FG+ N TAW+YT       SS     + Y   G+   LSRN  E+ + ++ L+NNLWLD GTRAVFID +VYNAN+NL+CV++L+ EFP TGG+I S QF+T+KLI Y + ++FF+  CEI+   +++YY IEEF+EI  + L YF+ +WN +D+++I +S  +I I++Y++ S    + + +++ N + +    A W   FN   ++  FF  VK+FK+ +FN+TM QL+ T+S   ++++GFA+MFFI+F A+A + YL FG+QI DF  FQ  +FT FR++LGDF+F  + +AN  +GP+YF  +VFF+FF+L+NMF+AII D+Y  VK  + Q K E ++   +K        K ++ K      +E+I      L++ + R  L+ +G+ D EI+A+F +YD DGD+ L   E + M  DL+  +  L     E +   L       S P                           V  E F  LV RVD +E +I +IVSKID V ++L  +E+AKL  ++ +   L  +T
Sbjct:  140 GRKRRGDPGMGAGRNGHSTEQPQELEGAGKLLHRVRGLWGTRYTEERITTREKYLKIVFRELITYIVFLVIVCVLTYSMVTSNMFYYTKGMSQLFLDGPVSKDERTNFKTLLTMDDFWKFTEGPLMDGLYWDMWYNNRTMA--ENHSFIYYENLLLGVPRLRQLRVKNGSCSVPEDLKDEIKDCYDSYSVRNEDTTPFGLRNGTAWTYTKEKDLNGSSQWGVISVYSGAGYYIDLSRNREESAAQIAMLKNNLWLDRGTRAVFIDFSVYNANLNLFCVVRLLVEFPATGGLITSWQFQTVKLIHYISSFEFFLAACEIIFCIFILYYIIEEFLEIHVHHLHYFRSLWNWLDIVIIGLSLPAIGIHLYKMSSVEGPLNKQLSDLNVFPNLESLAYWQIQFNSVAAVIVFFAWVKLFKFANFNRTMTQLSTTMSRCAKDILGFAIMFFIIFLAYAQFAYLVFGTQIDDFSTFQHCIFTQFRIILGDFDFTEVEEANRILGPIYFTTFVFFMFFILLNMFLAIINDTYSEVKTDMAQQKSEMELIDLIKKGCSKAMVKLKLKKTTVDDISESIRQGGGKLNFDELRQDLKGKGHTDAEIEAIFAKYDQDGDQELTENEHQQMRDDLEKEREDL-----EMDRGSLPRPMSGRSFPRSLDDSEEDDDEDSGHSSRRRGSSSSGVSYEEFQVLVRRVDRMEHSIGSIVSKIDAVIVKLEAMERAKLKRREVLGRLLDGVT 867          
BLAST of PKD2-1 vs. Ensembl Xenopus
Match: usp33 (ubiquitin specific peptidase 33 [Source:Xenbase;Acc:XB-GENE-1016674])

HSP 1 Score: 411.379 bits (1056), Expect = 1.010e-129
Identity = 266/699 (38.05%), Postives = 411/699 (58.80%), Query Frame = 3
Query:  315 RAWSTRYTEELSSNKVVFLKTALRELVTYLVFLIFLMMVAYGTRSENLYYLTTAMSNILI--------TSNFNGITAMDSFWNWINIDFVNALYWNTWYNSMTYLPLNEREFIHYENKLVGVPQIRQLRIGSNTCQIPSFFKNSMSNCYGDYSFSNLNKSDFGISNSTAWXXXXXXXXXXXXXXXXXXXYDDGGFIQVLSRNSLETISILSNLQNNLWLDHGTRAVFIDLTVYNANVNLYCVIKLIFEFPPTGGIIPSSQFRTLKLIRYETGYDFFILFCXXXXXXXXXXXXXXXXXXXKKNKLSYFKKIWNVVDVLMIIMSFISIAINVYRVLSTXXXXXXXXXXXXXXXDFTFFANWNKYFNDAVSITTFFGAVKIFKYISFNKTMNQLTDTLSNSIREXXXXXXXXXXXXXXXXXWGYLQFGSQIVDFCRFQDSVFTLFRLVLGDFNFMALVQANSFIGPXXXXXXXXXXXXXXMNMFVAIIADSYEVVKEKLMQSKDEFQITKFLKAQFFNKFTKNRVMKIQEVLENENI-ANCETLSYQDWRDKLQSRGYADVEIQALFMRYDSDGDRTLDYEERRVMLQDLKNGKISLEGHQTESNESELSVKKEDESMP---------------------------VDEELFGGLVERVDSVEKNISNIVSKIDMVFLRLSEIEKAKLDHQKSISCSLSILT 2303
            R W TRYTEE  + +  +LK   REL+TY+VFL+ + ++ Y   + N++Y T  MS + +         +NF  +  MD FW +     ++ LYW+ WYN+ T        FI+YEN L+GVP++RQLR+ + +C +P   K+ + +CY  YS  N + + FG+ N TAW+YT       SS     + Y   G+   LSRN  E+ + ++ L+NNLWLD GTRAVFID +VYNAN+NL+CV++L+ EFP TGG+I S QF+T+KLI Y + ++FF+  CEI+   +++YY IEEF+EI  + L YF+ +WN +D+++I +S  +I I++Y++ S    + + +++ N + +    A W   FN   ++  FF  VK+FK+ +FN+TM QL+ T+S   ++++GFA+MFFI+F A+A + YL FG+QI DF  FQ  +FT FR++LGDF+F  + +AN  +GP+YF  +VFF+FF+L+NMF+AII D+Y  VK  + Q K E ++   +K        K ++ K      +E+I      L++ + R  L+ +G+ D EI+A+F +YD DGD+ L   E + M  DL+  +  L     E +   L       S P                           V  E F  LV RVD +E +I +IVSKID V ++L  +E+AKL  ++ +   L  +T
Sbjct:  177 RLWGTRYTEERITTREKYLKIVFRELITYIVFLVIVCVLTYSMVTSNMFYYTKGMSQLFLDGPVSKDERTNFKTLLTMDDFWKFTEGPLMDGLYWDMWYNNRTMA--ENHSFIYYENLLLGVPRLRQLRVKNGSCSVPEDLKDEIKDCYDSYSVRNEDTTPFGLRNGTAWTYTKEKDLNGSSQWGVISVYSGAGYYIDLSRNREESAAQIAMLKNNLWLDRGTRAVFIDFSVYNANLNLFCVVRLLVEFPATGGLITSWQFQTVKLIHYISSFEFFLAACEIIFCIFILYYIIEEFLEIHVHHLHYFRSLWNWLDIVIIGLSLPAIGIHLYKMSSVEGPLNKQLSDLNVFPNLESLAYWQIQFNSVAAVIVFFAWVKLFKFANFNRTMTQLSTTMSRCAKDILGFAIMFFIIFLAYAQFAYLVFGTQIDDFSTFQHCIFTQFRIILGDFDFTEVEEANRILGPIYFTTFVFFMFFILLNMFLAIINDTYSEVKTDMAQQKSEMELIDLIKKGCSKAMVKLKLKKTTVDDISESIRQGGGKLNFDELRQDLKGKGHTDAEIEAIFAKYDQDGDQELTENEHQQMRDDLEKEREDL-----EMDRGSLPRPMSGRSFPRSLDDSEEDDDEDSGHSSRRRGSSSSGVSYEEFQVLVRRVDRMEHSIGSIVSKIDAVIVKLEAMERAKLKRREVLGRLLDGVT 868          
BLAST of PKD2-1 vs. Ensembl Xenopus
Match: usp33 (ubiquitin specific peptidase 33 [Source:Xenbase;Acc:XB-GENE-1016674])

HSP 1 Score: 409.453 bits (1051), Expect = 8.502e-129
Identity = 265/697 (38.02%), Postives = 410/697 (58.82%), Query Frame = 3
Query:  321 WSTRYTEELSSNKVVFLKTALRELVTYLVFLIFLMMVAYGTRSENLYYLTTAMSNILI--------TSNFNGITAMDSFWNWINIDFVNALYWNTWYNSMTYLPLNEREFIHYENKLVGVPQIRQLRIGSNTCQIPSFFKNSMSNCYGDYSFSNLNKSDFGISNSTAWXXXXXXXXXXXXXXXXXXXYDDGGFIQVLSRNSLETISILSNLQNNLWLDHGTRAVFIDLTVYNANVNLYCVIKLIFEFPPTGGIIPSSQFRTLKLIRYETGYDFFILFCXXXXXXXXXXXXXXXXXXXKKNKLSYFKKIWNVVDVLMIIMSFISIAINVYRVLSTXXXXXXXXXXXXXXXDFTFFANWNKYFNDAVSITTFFGAVKIFKYISFNKTMNQLTDTLSNSIREXXXXXXXXXXXXXXXXXWGYLQFGSQIVDFCRFQDSVFTLFRLVLGDFNFMALVQANSFIGPXXXXXXXXXXXXXXMNMFVAIIADSYEVVKEKLMQSKDEFQITKFLKAQFFNKFTKNRVMKIQEVLENENI-ANCETLSYQDWRDKLQSRGYADVEIQALFMRYDSDGDRTLDYEERRVMLQDLKNGKISLEGHQTESNESELSVKKEDESMP---------------------------VDEELFGGLVERVDSVEKNISNIVSKIDMVFLRLSEIEKAKLDHQKSISCSLSILT 2303
            W TRYTEE  + +  +LK   REL+TY+VFL+ + ++ Y   + N++Y T  MS + +         +NF  +  MD FW +     ++ LYW+ WYN+ T        FI+YEN L+GVP++RQLR+ + +C +P   K+ + +CY  YS  N + + FG+ N TAW+YT       SS     + Y   G+   LSRN  E+ + ++ L+NNLWLD GTRAVFID +VYNAN+NL+CV++L+ EFP TGG+I S QF+T+KLI Y + ++FF+  CEI+   +++YY IEEF+EI  + L YF+ +WN +D+++I +S  +I I++Y++ S    + + +++ N + +    A W   FN   ++  FF  VK+FK+ +FN+TM QL+ T+S   ++++GFA+MFFI+F A+A + YL FG+QI DF  FQ  +FT FR++LGDF+F  + +AN  +GP+YF  +VFF+FF+L+NMF+AII D+Y  VK  + Q K E ++   +K        K ++ K      +E+I      L++ + R  L+ +G+ D EI+A+F +YD DGD+ L   E + M  DL+  +  L     E +   L       S P                           V  E F  LV RVD +E +I +IVSKID V ++L  +E+AKL  ++ +   L  +T
Sbjct:  182 WGTRYTEERITTREKYLKIVFRELITYIVFLVIVCVLTYSMVTSNMFYYTKGMSQLFLDGPVSKDERTNFKTLLTMDDFWKFTEGPLMDGLYWDMWYNNRTMA--ENHSFIYYENLLLGVPRLRQLRVKNGSCSVPEDLKDEIKDCYDSYSVRNEDTTPFGLRNGTAWTYTKEKDLNGSSQWGVISVYSGAGYYIDLSRNREESAAQIAMLKNNLWLDRGTRAVFIDFSVYNANLNLFCVVRLLVEFPATGGLITSWQFQTVKLIHYISSFEFFLAACEIIFCIFILYYIIEEFLEIHVHHLHYFRSLWNWLDIVIIGLSLPAIGIHLYKMSSVEGPLNKQLSDLNVFPNLESLAYWQIQFNSVAAVIVFFAWVKLFKFANFNRTMTQLSTTMSRCAKDILGFAIMFFIIFLAYAQFAYLVFGTQIDDFSTFQHCIFTQFRIILGDFDFTEVEEANRILGPIYFTTFVFFMFFILLNMFLAIINDTYSEVKTDMAQQKSEMELIDLIKKGCSKAMVKLKLKKTTVDDISESIRQGGGKLNFDELRQDLKGKGHTDAEIEAIFAKYDQDGDQELTENEHQQMRDDLEKEREDL-----EMDRGSLPRPMSGRSFPRSLDDSEEDDDEDSGHSSRRRGSSSSGVSYEEFQVLVRRVDRMEHSIGSIVSKIDAVIVKLEAMERAKLKRREVLGRLLDGVT 871          
BLAST of PKD2-1 vs. Ensembl Mouse
Match: Pkd2l1 (polycystic kidney disease 2-like 1 [Source:MGI Symbol;Acc:MGI:1352448])

HSP 1 Score: 418.698 bits (1075), Expect = 2.069e-134
Identity = 272/679 (40.06%), Postives = 409/679 (60.24%), Query Frame = 3
Query:  282 ACGKKFLRVIRRAWSTRYTEELSSNKVVFLKTALRELVTYLVFLIFLMMVAYGTRSENLYYLTTAMSNILITS------NFNGITAMDSFWNWINIDFVNALYWNTWYNSMTYLPLNEREFIHYENKLVGVPQIRQLRIGSNTCQIPSFFKNSMSNCYGDYSFSNLNKSDFGISNSTAWXXXXXXXXXXXXXXXXXXXYDDGGFIQVLSRNSLETISILSNLQNNLWLDHGTRAVFIDLTVYNANVNLYCVIKLIFEFPPTGGIIPSSQFRTLKLIRYETGYDFFILFCXXXXXXXXXXXXXXXXXXXKKNKLSYFKKIWNVVDVLMIIMSFISIAINVYRVLSTXXXXXXXXXXXXXXXDFTFFANWNKYFNDAVSITTFFGAVKIFKYISFNKTMNQLTDTLSNSIREXXXXXXXXXXXXXXXXXWGYLQFGSQIVDFCRFQDSVFTLFRLVLGDFNFMALVQANSFIGPXXXXXXXXXXXXXXMNMFVAIIADSYEVVKEKLMQSKDEFQITKFLKAQFFNK------FTKNRVMKIQEVLENENIANCETLSYQDWRDKLQSRGYADVEIQALFMRYDSDGDRTLDYEERRVMLQDLKNGKISLE----------GHQTESNESELSVKKEDESMPVDEELFGGLVERVDSVEKNISNIVSKIDMVFLRLSEIEK 2252
            +C     R IR  W T  TE  + N+ +++KT LRELV Y+VFL+ + ++ YG  S + YY T  MS + + +      +F  I++M  FW++     +++LYW  WYN+ + L      FI+YEN L+G P++RQLR+ +++C +   F+  + NCY  YS    ++  FG  N TAW+Y   N    SS      +Y  GG+   L  +   +   L  LQ  LWLD GTR VFID +VYNAN+NL+C+++L+ EFP TGG IPS Q RT+KLIRY   +DFFI+ CE+V   ++ YY +EE +EI  ++L Y   +WN++D+++I++S +++  +++R L  N+++ +L+   + Y DF F A W   +N+  ++  FF  +KIFKYISFNKTM QL+ TL+   ++++GFA+MFFIVFFA+A  GYL FG+Q+ +F  F   +FT FR++LGDF++ A+  AN  +GPVYF+ YVFFVFFVL+NMF+AII D+Y  VKE+L   KD+ Q++ FLK Q +NK        K RV  +Q+VL+         + ++D+   L+  G+ + EI A F R+D DGD  LD EE+  M Q L+  +++L           GH   S   EL  +       V  E F  L  RV  ++  +  +VS+ID V  +L  +E+
Sbjct:   68 SCCLHICRSIRGLWGTTLTENTAENRELYVKTTLRELVVYIVFLVDICLLTYGMTSSSAYYYTKVMSELFLHTPSDSGVSFQTISSMSDFWDFAQGPLLDSLYWTKWYNNQS-LGRGSHSFIYYENLLLGAPRLRQLRVRNDSCVVHEDFREDILNCYDVYSPDKEDQLPFGPQNGTAWTYHSQNELGGSSHWGRLTSYSGGGYYLDLPGSRQASAEALQGLQEGLWLDRGTRVVFIDFSVYNANINLFCILRLVVEFPATGGTIPSWQIRTVKLIRYVNNWDFFIVGCEVVFCVFIFYYVVEEILEIHLHRLRYLSSVWNILDLVVILLSIVAVGFHIFRTLEVNRLMGKLLQQPDTYADFEFLAFWQTQYNNMNAVNLFFAWIKIFKYISFNKTMTQLSSTLARCAKDILGFAIMFFIVFFAYAQLGYLLFGTQVENFSTFVKCIFTQFRIILGDFDYNAIDNANRILGPVYFVTYVFFVFFVLLNMFLAIINDTYSEVKEELAGQKDQLQLSDFLK-QSYNKTLLRLRLRKERVSDVQKVLKGGE----PEIQFEDFTSTLRELGHEEHEITAAFTRFDQDGDHILDEEEQEQMRQGLEEERVTLNAEIENLGRSVGH---SPPGELGAEAARGQSWVSGEEFDMLTRRVLQLQCVLEGVVSQIDAVGSKLKMLER 737          
BLAST of PKD2-1 vs. Ensembl Mouse
Match: Pkd2 (polycystin 2, transient receptor potential cation channel [Source:MGI Symbol;Acc:MGI:1099818])

HSP 1 Score: 413.69 bits (1062), Expect = 2.862e-130
Identity = 276/707 (39.04%), Postives = 420/707 (59.41%), Query Frame = 3
Query:  282 ACGKKFLRVIRRAWSTRYTEELSSNKVVFLKTALRELVTYLVFLIFLMMVAYGTRSENLYYLTTAMSNILI--------TSNFNGITAMDSFWNWINIDFVNALYWNTWYNSMTYLPLNEREFIHYENKLVGVPQIRQLRIGSNTCQIPSFFKNSMSNCYGDYSFSNLNKSDFGISNSTAWXXXXXXXXXXXXXXXXXXXYDDGGFIQVLSRNSLETISILSNLQNNLWLDHGTRAVFIDLTVYNANVNLYCVIKLIFEFPPTGGIIPSSQFRTLKLIRYETGYDFFILFCXXXXXXXXXXXXXXXXXXXKKNKLSYFKKIWNVVDVLMIIMSFISIAINVYRVLSTXXXXXXXXXXXXXXXDFTFFANWNKYFNDAVSITTFFGAVKIFKYISFNKTMNQLTDTLSNSIREXXXXXXXXXXXXXXXXXWGYLQFGSQIVDFCRFQDSVFTLFRLVLGDFNFMALVQANSFIGPXXXXXXXXXXXXXXMNMFVAIIADSYEVVKEKLMQSKDEFQITKFL-----KAQFFNKFTKNRVMKIQEVLENENIANCETLSYQDWRDKLQSRGYADVEIQALFMRYDSDGDRTLDYEERRVMLQDLKNGKISLEGHQTESNESELSVKKEDESMP---------------------------VDEELFGGLVERVDSVEKNISNIVSKIDMVFLRLSEIEKAKLDHQKSIS 2282
            A  ++ +R +R  W TR  EE ++N+  +LK+ LRELVTYL FL+ L ++ YG  S N+YY T  +S + I         +NF  +++M+ FW +    F++ LYW    ++ T    + R FI YEN L+GVP++RQLR+ + +C IP   ++ +  CY  YS S+ +++ FG  N TAW YT       SS     A+Y   G+   LSR   ET + L+ L+ N WLD GTRA FID +VYNAN+NL+CV++L+ EFP TGG++PS QF+ +KLIRY T +DFF+  CEI+  F++IYY +EE +EI+ ++LSYF+  WN +DV+++++S +++ IN+YR +S  + + Q + +QN++ +F   A W   FN+  ++  F   +K+FK+I+FN+TM+QL+ T+S   +++ GF +MF I+F A+A   YL FG+Q+ DF  FQ+ +FT FR++LGD NF  + +AN  +GP+YF  +VFF+FF+L+NMF+AII DSY  VK  L Q K E +++  +     KA    K  +N V  I E L          L++ + R  L+ +G+ D EI+A+F +YD DGD+ L   E + M  DL+  +  L     +   S L       S P                           V  E F  LV RVD +E +I +IVSKID V ++L  +E+AKL  ++ + 
Sbjct:  186 AWAERLVRGLRGLWGTRLMEESNANREKYLKSVLRELVTYLFFLVVLCILTYGMMSSNVYYYTRTLSQLFIDTPVSKTEKTNFKTLSSMEDFWKFTEGSFLDGLYWKAQTSNHTQA--DNRSFIFYENLLLGVPRLRQLRVRNGSCSIPQDLRDEIKECYDVYSVSSEDRAPFGPRNGTAWMYTSEKELNGSSHWGIIASYSGAGYYLDLSRTREETAAQLAGLRRNFWLDRGTRAAFIDFSVYNANINLFCVVRLLAEFPATGGVVPSWQFQPVKLIRYVTAFDFFLAACEIIFCFFIIYYVVEEILEIRIHRLSYFRSFWNCLDVVIVVLSVVAMVINIYR-MSNAEGLLQFLEDQNSFPNFEHVAYWQIQFNNISAVMVFLVWIKLFKFINFNRTMSQLSTTMSRCAKDLFGFTIMFSIIFLAYAQLAYLVFGTQVDDFSTFQECIFTQFRIILGDINFAEIEEANRVLGPLYFTTFVFFMFFILLNMFLAIINDSYSEVKSDLAQQKAEMELSDLIRKGCQKALVKLKLKRNTVDAISESLRQ----GGGKLNFDELRQDLKGKGHTDAEIEAIFTKYDQDGDQELTEREHQQMRDDLEKEREDL-----DLEHSSLPRPMSSRSFPRSLDDSEEEDDEDSGHSSRRRGSISSGVSYEEFQVLVRRVDRMEHSIGSIVSKIDAVIVKLEIMERAKLKRREVLG 880          
BLAST of PKD2-1 vs. Ensembl Mouse
Match: Pkd2l2 (polycystic kidney disease 2-like 2 [Source:MGI Symbol;Acc:MGI:1858231])

HSP 1 Score: 318.931 bits (816), Expect = 4.116e-98
Identity = 203/503 (40.36%), Postives = 336/503 (66.80%), Query Frame = 3
Query:  375 TALRELVTYLVFLIFLMMVAYGTRSENLYYLTTAMSNILI--------TSNFNGITAMDSFWNWINIDFVNALYWNTWYNSMTYLPLNEREFIHYENKLVGVPQIRQLRIGSNTCQIPSFFKNSMSNCYGDYSFSNLNKSDFGISNSTAWXXXXXXXXXXXXXXXXXXXYDDGGFIQVLSRNSLETISILSNLQNNLWLDHGTRAVFIDLTVYNANVNLYCVIKLIFEFPPTGGIIPSSQFRTLKLIRYETGYDFFILFCXXXXXXXXXXXXXXXXXXXKKNKLSYFKKIWNVVDVLMIIMSFISIAINVYRVLSTXXXXXXXXXXXXXXXDFTFFANWNKYFNDAVSITTFFGAVKIFKYISFNKTMNQLTDTLSNSIREXXXXXXXXXXXXXXXXXWGYLQFGSQIVDFCRFQDSVFTLFRLVLGDFNFMALVQANSFIGPXXXXXXXXXXXXXXMNMFVAIIADSYEVVKEKL-MQSKDEFQITKFLKAQFFNKFTKNRV 1856
            T L EL+ Y +FLI L ++ +G  + ++YYL   MS++ +         S+F  I ++  FW ++    ++ LYW++WY +     +     I+YEN L+G+P++RQLR+ +NTC++   F++ +S+CY  Y+  N + SDFG+  +  W++TP + T    +      Y DGG+I  LS++  ET +   +L+ N W+  GTRAVFID ++YNANVNL+C+I+L+ EFP TGG++ S QF ++KL+RY + YD+FI  CE++   ++  + I+E  ++ + K +YF+ +WN +++L++++ F++++   Y  + +  ++ QL+ N ++Y DF F A W+ Y+N+ ++IT FF  +KIFK+ISFN+TM+QL+ TLS  +++++GFA+MFFI+F A+A  G+L FGSQ+ DF  FQ+S+F  FR+VLGDFNF  + QAN  +GP+YF+ ++FFVFFVL+NMF+AII D+Y  VK    +  + +F++ K ++   FN   K R+
Sbjct:   27 TTLEELLLYFIFLINLCILTFGMVNPHMYYLNKVMSSLFVDTSLPDDERSSFRSIRSITEFWKFMEGPLIDGLYWDSWYGNKQLYSVKNSSRIYYENVLLGIPRVRQLRVRNNTCKVYPAFQSLVSDCYSKYTVENEDFSDFGLKRNPEWTHTPSSRTAPWHWGFVGV-YRDGGYIVTLSKSKSETKAKFVDLRLNNWISRGTRAVFIDFSLYNANVNLFCIIRLLAEFPATGGLLTSWQFYSVKLLRYVSYYDYFIASCEVIFCIFLFVFIIQELRKVNEFKSAYFRSVWNWLEMLLLLLCFLAVSFYAYCNMQSFLLLGQLLKNTDSYPDFYFLAYWHIYYNNVIAITIFFAWIKIFKFISFNETMSQLSSTLSRCMKDIVGFAIMFFIIFSAYAQLGFLVFGSQVDDFSTFQNSIFAQFRIVLGDFNFAGIQQANWILGPIYFITFIFFVFFVLLNMFLAIINDTYSEVKADYSIGRRPDFELGKIIQKSCFNVLEKLRL 528          
BLAST of PKD2-1 vs. Ensembl Mouse
Match: Pkd2l2 (polycystic kidney disease 2-like 2 [Source:MGI Symbol;Acc:MGI:1858231])

HSP 1 Score: 318.931 bits (816), Expect = 4.116e-98
Identity = 203/503 (40.36%), Postives = 336/503 (66.80%), Query Frame = 3
Query:  375 TALRELVTYLVFLIFLMMVAYGTRSENLYYLTTAMSNILI--------TSNFNGITAMDSFWNWINIDFVNALYWNTWYNSMTYLPLNEREFIHYENKLVGVPQIRQLRIGSNTCQIPSFFKNSMSNCYGDYSFSNLNKSDFGISNSTAWXXXXXXXXXXXXXXXXXXXYDDGGFIQVLSRNSLETISILSNLQNNLWLDHGTRAVFIDLTVYNANVNLYCVIKLIFEFPPTGGIIPSSQFRTLKLIRYETGYDFFILFCXXXXXXXXXXXXXXXXXXXKKNKLSYFKKIWNVVDVLMIIMSFISIAINVYRVLSTXXXXXXXXXXXXXXXDFTFFANWNKYFNDAVSITTFFGAVKIFKYISFNKTMNQLTDTLSNSIREXXXXXXXXXXXXXXXXXWGYLQFGSQIVDFCRFQDSVFTLFRLVLGDFNFMALVQANSFIGPXXXXXXXXXXXXXXMNMFVAIIADSYEVVKEKL-MQSKDEFQITKFLKAQFFNKFTKNRV 1856
            T L EL+ Y +FLI L ++ +G  + ++YYL   MS++ +         S+F  I ++  FW ++    ++ LYW++WY +     +     I+YEN L+G+P++RQLR+ +NTC++   F++ +S+CY  Y+  N + SDFG+  +  W++TP + T    +      Y DGG+I  LS++  ET +   +L+ N W+  GTRAVFID ++YNANVNL+C+I+L+ EFP TGG++ S QF ++KL+RY + YD+FI  CE++   ++  + I+E  ++ + K +YF+ +WN +++L++++ F++++   Y  + +  ++ QL+ N ++Y DF F A W+ Y+N+ ++IT FF  +KIFK+ISFN+TM+QL+ TLS  +++++GFA+MFFI+F A+A  G+L FGSQ+ DF  FQ+S+F  FR+VLGDFNF  + QAN  +GP+YF+ ++FFVFFVL+NMF+AII D+Y  VK    +  + +F++ K ++   FN   K R+
Sbjct:   27 TTLEELLLYFIFLINLCILTFGMVNPHMYYLNKVMSSLFVDTSLPDDERSSFRSIRSITEFWKFMEGPLIDGLYWDSWYGNKQLYSVKNSSRIYYENVLLGIPRVRQLRVRNNTCKVYPAFQSLVSDCYSKYTVENEDFSDFGLKRNPEWTHTPSSRTAPWHWGFVGV-YRDGGYIVTLSKSKSETKAKFVDLRLNNWISRGTRAVFIDFSLYNANVNLFCIIRLLAEFPATGGLLTSWQFYSVKLLRYVSYYDYFIASCEVIFCIFLFVFIIQELRKVNEFKSAYFRSVWNWLEMLLLLLCFLAVSFYAYCNMQSFLLLGQLLKNTDSYPDFYFLAYWHIYYNNVIAITIFFAWIKIFKFISFNETMSQLSSTLSRCMKDIVGFAIMFFIIFSAYAQLGFLVFGSQVDDFSTFQNSIFAQFRIVLGDFNFAGIQQANWILGPIYFITFIFFVFFVLLNMFLAIINDTYSEVKADYSIGRRPDFELGKIIQKSCFNVLEKLRL 528          
BLAST of PKD2-1 vs. Ensembl Mouse
Match: Pkd1l2 (polycystic kidney disease 1 like 2 [Source:MGI Symbol;Acc:MGI:2664668])

HSP 1 Score: 152.525 bits (384), Expect = 3.794e-37
Identity = 136/540 (25.19%), Postives = 247/540 (45.74%), Query Frame = 3
Query:  234 NLSSSADLFLLEDDNHACGKKFLRVIRRAWSTRYTEELSSNKVVFLKTALRELVTYLVFLIFLMMVAYGTRSENLYYLTTAMSNILITSNFNGITAMDSFWNWINIDFVNALYWNTWYNSMTYLPLNEREFIHYEN-KLVGVPQIRQLRIGSNTCQIPSFFKNSMSNCYGDYSFSNLNKSDFG-------ISNST----AWXXXXXXXXXXXXXXXXXXXYDDGGFIQVLSRNSLETISILSNLQNNLWLDHGTRAVFIDLTVYNANVNLYCVIKLIFEFPPTGGIIPSSQFRTLKLIRYETGYDFFILFCXXXXXXXXXXXXXXXXXXXKKNKLSYFKKIWNVVDVLMIIMSFISIAINVYRVLSTXXXXXXXXXXXXXXXDFTFFANWNKYFNDAVSITTFFGAVKIFKYISFNKTMNQLTDTLSNSIREXXXXXXXXXXXXXXXXXWGYLQFGSQIVDFCRFQDSVFTLFRLVLGDFNFMALVQANSFIGPXXXXXXXXXXXXXXMNMFVAIIADSYEVVKEKLMQSKDEFQITKFL 1817
            +LSS     L     H+  + +      A     T  L   K   L   +RE++ YL FL  L++VAYG R  N Y+    +     +  F+ +     F+ W N   V  LY +               F+   N KLVG   IRQ+R+  ++C +    ++S+  C+G YS    +  D+G        +NS     AW Y   +             Y  GG++  L  +      IL  L +N WLD  TRAVF++ TVYNANVNL+C + L  E    G        ++L+L  +  G+  F++  E+    ++ YY + +   ++K K  YF   WN+++V +I+ S+ ++ + V R +  ++ +++   +++  + F+  A  +      ++       VK++  +  N  MN +T  L  +  ++ GF  +  I+  A++    L FG ++  +    D+  T+  L LG FN+  ++  +  +G +     + F+ FV++N+F+++I  ++   ++K  Q  +E +I   L
Sbjct: 1897 HLSSPGPGVLFRSRRHSSERAYQPPPMAAIEKMKTTRLKEQKAFAL---IREILAYLAFLWMLLLVAYGQRDPNAYHFHRHLERSF-SQGFSPVLGFRGFFEWANTTLVKNLYGH------------HPGFVTDGNSKLVGSAHIRQVRVRESSCAVAQQLQDSLDGCHGPYSLGIEDLVDYGEGWNASAYNNSNGFPQAWRYQSQSQRRGYPMWGKLTLYGGGGYVVPLGTDHQSASRILQYLFDNSWLDALTRAVFVEFTVYNANVNLFCTVTLTLETSGLGTFFSHVTLQSLRLYPFTDGWHPFVVAAELTYFLFLFYYMVVQGKLMRKQKWGYFCSKWNLLEVAIILASWSALVVFVKRTILADRDLQRYREHRDEGISFSETAAADAALGYIIAFLVLLSTVKLWHLLRLNPKMNMITSALRRAWGDISGFVAVILIMLLAYSFASNLVFGWKLRSYKTLFDAAETMVSLQLGIFNYEEVLDYSPILGSLLIGSCIVFMTFVVLNLFISVILVAFS-EEQKSDQLWEEGEIADLL 2419          
BLAST of PKD2-1 vs. UniProt/SwissProt
Match: sp|Q6IVV8|PKD2_DANRE (Polycystin-2 OS=Danio rerio OX=7955 GN=pkd2 PE=1 SV=1)

HSP 1 Score: 435.647 bits (1119), Expect = 1.575e-138
Identity = 272/698 (38.97%), Postives = 431/698 (61.75%), Query Frame = 3
Query:  273 DNHACGKKFLRVIRRAWSTRYTEELSSNKVVFLKTALRELVTYLVFLIFLMMVAYGTRSENLYYLTTAMSNILI--------TSNFNGITAMDSFWNWINIDFVNALYWNTWYNSMTYLPLNEREFIHYENKLVGVPQIRQLRIGSNTCQIPSFFKNSMSNCYGDYSFSNLNKSDFGISNSTAWXXXXXXXXXXXXXXXXXXXYDDGGFIQVLSRNSLETISILSNLQNNLWLDHGTRAVFIDLTVYNANVNLYCVIKLIFEFPPTGGIIPSSQFRTLKLIRYETGYDFFILFCXXXXXXXXXXXXXXXXXXXKKNKLSYFKKIWNVVDVLMIIMSFISIAINVYRVLSTXXXXXXXXXXXXXXXDFTFFANWNKYFNDAVSITTFFGAVKIFKYISFNKTMNQLTDTLSNSIREXXXXXXXXXXXXXXXXXWGYLQFGSQIVDFCRFQDSVFTLFRLVLGDFNFMALVQANSFIGPXXXXXXXXXXXXXXMNMFVAIIADSYEVVKEKLMQSKDEFQITKFLKAQFFNKFTKNRVMK--IQEVLENENIANCETLSYQDWRDKLQSRGYADVEIQALFMRYDSDGDRTLDYEERRVMLQDLKNGK--ISLEGHQTESNESELSVKKEDESMPVDE--------------------ELFGGLVERVDSVEKNISNIVSKIDMVFLRLSEIEKAKLDHQ 2270
            ++ +CGK+ L  +R  W TR   E +SN+ ++LKT LRE++TY++FL+ L ++ YG  S N+YY T  MS + +         +NF  ++ M+ FW +    F+N +YW  WYN+ + LP N+   I+YEN L+GVP++RQLR+ + +C +    ++ + +CY  YS +N +K+ FG  N TAW +   +S   SS+    +TY  GG+ Q LSR   ++ + L  L+NNLWLD GTRAVF+D ++YN NVNL+C+++L+ EFP TGG +PS QF+T++L+RY + +D+F+  CE+    +V+YY +EE +EI+ ++L YFK +WN +DVL++ +S  +I +N+ R  + +  +  L+ N + Y +F   A    +FN+  +I  F   VK+FK+I+FNKTMNQL+ T+S   +++MGFA+MFFIVF A+A   YL FG+Q+ DF  FQ  +FT FR++LGDF+F  + +A+S +GP+YF  +VFF+F +L+NMF+AII D+Y  VK  + Q + E +IT  +K  +     K ++ K  I ++ ++   A    LS+ + R  L+ +G++D EI+A+F +YD DGD+ L   E + M  DL+  +  + LE        S  S  +  +    D+                    E F  LV RVD +E +I +IVSKID V ++L  +E+AK+  +
Sbjct:  121 EHRSCGKRILEKMRVLWDTRLLGESNSNREMYLKTVLREMITYILFLLTLCIITYGMVSTNMYYYTKVMSQLFLDTPLSSGEPTNFKSLSTMEDFWKFTEGPFLNGMYWELWYNNKS-LPENQ-SLIYYENLLLGVPRLRQLRVRNESCSVHEDLRDEVYDCYNVYSPANEDKAPFGPKNGTAWRFKDESSLGESSYWGQVSTYGGGGYYQDLSRTREKSANQLQELKNNLWLDRGTRAVFLDFSIYNGNVNLFCIVRLLVEFPATGGAVPSWQFQTVRLLRYVSSWDYFVGMCEVSFCLFVLYYLVEEALEIRLHRLRYFKSLWNCLDVLIVALSVPAIIMNICRTSAVSHRLHFLLENHSTYPNFEPLARLQVHFNNLAAIIVFLSWVKLFKFINFNKTMNQLSTTMSRCAKDLMGFAIMFFIVFLAYAQLAYLVFGTQVNDFSTFQACIFTQFRIILGDFDFSEIEEADSVLGPIYFTTFVFFIFMILLNMFLAIINDTYSEVKADMAQQRSEMEITDLIKKSYNRAMVKLKLKKSSINDIPDSLQQA-AGKLSFDELRQDLRGKGHSDAEIEAIFAKYDLDGDQELTEHEHQQMRDDLEKEREDLDLEHSSLPRPASGRSFSRSQDDSEEDDDEDSGHSSRRRGSSSGGVSYEEFQVLVRRVDRMEHSIGSIVSKIDAVIVKLEAMERAKMKRR 815          
BLAST of PKD2-1 vs. UniProt/SwissProt
Match: sp|Q4GZT3|PKD2_BOVIN (Polycystin-2 OS=Bos taurus OX=9913 GN=PKD2 PE=2 SV=1)

HSP 1 Score: 429.483 bits (1103), Expect = 1.954e-135
Identity = 287/734 (39.10%), Postives = 430/734 (58.58%), Query Frame = 3
Query:  210 GEKSNSEQNLSSSADLFLLEDDNH---ACGKKFLRVIRRAWSTRYTEELSSNKVVFLKTALRELVTYLVFLIFLMMVAYGTRSENLYYLTTAMSNILI--------TSNFNGITAMDSFWNWINIDFVNALYWNTWYNSMTYLPLNEREFIHYENKLVGVPQIRQLRIGSNTCQIPSFFKNSMSNCYGDYSFSNLNKSDFGISNSTAWXXXXXXXXXXXXXXXXXXXYDDGGFIQVLSRNSLETISILSNLQNNLWLDHGTRAVFIDLTVYNANVNLYCVIKLIFEFPPTGGIIPSSQFRTLKLIRYETGYDFFILFCXXXXXXXXXXXXXXXXXXXKKNKLSYFKKIWNVVDVLMIIMSFISIAINVYRVLSTXXXXXXXXXXXXXXXDFTFFANWNKYFNDAVSITTFFGAVKIFKYISFNKTMNQLTDTLSNSIREXXXXXXXXXXXXXXXXXWGYLQFGSQIVDFCRFQDSVFTLFRLVLGDFNFMALVQANSFIGPXXXXXXXXXXXXXXMNMFVAIIADSYEVVKEKLMQSKDEFQITKFLKAQFF-----NKFTKNRVMKIQEVLENENIANCETLSYQDWRDKLQSRGYADVEIQALFMRYDSDGDRTLDYEERRVMLQDLKNGKISLEGHQTESNESELSVKKEDESMP---------------------------VDEELFGGLVERVDSVEKNISNIVSKIDMVFLRLSEIEKAKLDHQKSIS 2282
            G  S S           L  D  H   A  ++ +R +R  W TR  EE S+++  +LK+ LREL TYL+FLI L ++ YG  S ++YY T  MS + +         +NF  +++M+ FW +     ++ LYW T  ++ T    + R FI+YEN L+GVP+IRQLR+ + +C IP   ++ +  CY  YS S+ +++ FG  N TAW YT       SS     ATY   G+   LSR   ET + ++NL+ N+WLD GTRA+FID TVYNAN+NL+CVI+L+ EFP TGG+IPS QF+ +KLIRY T +DFF+  CEI+   +++YY +EE +EI+ +KL YF+  WN +DV++I++S ++I IN+YR  S  + + Q + +QN + +F   A W   FN+  ++  FF  +K+FK+I+FN+TM+QL+ T+S   +++ GFA+MFFI+F A+A   YL FG+Q+ DF  FQ+ +FT FR++LGD NF  + +AN  +GP+YF  +VFF+FF+L+NMF+AII D+Y  VK  L Q K E +++  ++  +       K  KN V  I E L          L++ + R  L+ +G+ D EI+A+F +YD DGD+ L   E + M  DL+  +  L     + + S L       S P                           V  E F  LV RVD +E +I +IVSKID V ++L  +E+AKL  ++ + 
Sbjct:  163 GPPSPSPAGGGDPLHRHLPLDGQHPRVAWAERLVRGLRGLWGTRLMEESSTDREKYLKSVLRELATYLLFLIVLCILTYGMMSSSVYYYTRIMSQLFLDTPVSKMEKTNFKTLSSMEDFWKFTEGALLDGLYWKTQPSNRT--EADNRSFIYYENLLLGVPRIRQLRVRNGSCSIPLDLRDEIKECYDVYSVSSEDRAPFGPRNGTAWIYTSEKDLNGSSHWGMIATYSGAGYYLDLSRTREETAAQVANLKKNVWLDRGTRAIFIDFTVYNANINLFCVIRLLIEFPATGGVIPSWQFQPVKLIRYVTTFDFFLAACEIIFCLFILYYVVEEILEIRIHKLHYFRSFWNCLDVVIIVLSVVAIGINIYRT-SNVEALLQFLEDQNTFPNFENLAYWQTQFNNIAAVIVFFVWIKLFKFINFNRTMSQLSTTMSRCAKDLFGFAIMFFIIFLAYAQLAYLVFGTQVDDFSTFQECIFTQFRIILGDINFAEIEEANRVLGPIYFTTFVFFMFFILLNMFLAIINDTYSEVKSDLAQQKAEMELSDLIRKGYHKALIKLKLKKNTVDDISESLRQ----GGGKLNFDELRQDLKGKGHTDAEIEAIFTKYDQDGDQELTEHEHQQMRDDLEKEREDL-----DLDHSSLPRPMSSRSFPRSLDDSEEEDDDDSGHSSRRRGSISSGVSYEEFQVLVRRVDRMEHSIGSIVSKIDAVIVKLEIMERAKLKRREVLG 884          
BLAST of PKD2-1 vs. UniProt/SwissProt
Match: sp|A2A259|PK2L1_MOUSE (Polycystic kidney disease 2-like 1 protein OS=Mus musculus OX=10090 GN=Pkd2l1 PE=1 SV=1)

HSP 1 Score: 418.698 bits (1075), Expect = 1.447e-133
Identity = 272/679 (40.06%), Postives = 409/679 (60.24%), Query Frame = 3
Query:  282 ACGKKFLRVIRRAWSTRYTEELSSNKVVFLKTALRELVTYLVFLIFLMMVAYGTRSENLYYLTTAMSNILITS------NFNGITAMDSFWNWINIDFVNALYWNTWYNSMTYLPLNEREFIHYENKLVGVPQIRQLRIGSNTCQIPSFFKNSMSNCYGDYSFSNLNKSDFGISNSTAWXXXXXXXXXXXXXXXXXXXYDDGGFIQVLSRNSLETISILSNLQNNLWLDHGTRAVFIDLTVYNANVNLYCVIKLIFEFPPTGGIIPSSQFRTLKLIRYETGYDFFILFCXXXXXXXXXXXXXXXXXXXKKNKLSYFKKIWNVVDVLMIIMSFISIAINVYRVLSTXXXXXXXXXXXXXXXDFTFFANWNKYFNDAVSITTFFGAVKIFKYISFNKTMNQLTDTLSNSIREXXXXXXXXXXXXXXXXXWGYLQFGSQIVDFCRFQDSVFTLFRLVLGDFNFMALVQANSFIGPXXXXXXXXXXXXXXMNMFVAIIADSYEVVKEKLMQSKDEFQITKFLKAQFFNK------FTKNRVMKIQEVLENENIANCETLSYQDWRDKLQSRGYADVEIQALFMRYDSDGDRTLDYEERRVMLQDLKNGKISLE----------GHQTESNESELSVKKEDESMPVDEELFGGLVERVDSVEKNISNIVSKIDMVFLRLSEIEK 2252
            +C     R IR  W T  TE  + N+ +++KT LRELV Y+VFL+ + ++ YG  S + YY T  MS + + +      +F  I++M  FW++     +++LYW  WYN+ + L      FI+YEN L+G P++RQLR+ +++C +   F+  + NCY  YS    ++  FG  N TAW+Y   N    SS      +Y  GG+   L  +   +   L  LQ  LWLD GTR VFID +VYNAN+NL+C+++L+ EFP TGG IPS Q RT+KLIRY   +DFFI+ CE+V   ++ YY +EE +EI  ++L Y   +WN++D+++I++S +++  +++R L  N+++ +L+   + Y DF F A W   +N+  ++  FF  +KIFKYISFNKTM QL+ TL+   ++++GFA+MFFIVFFA+A  GYL FG+Q+ +F  F   +FT FR++LGDF++ A+  AN  +GPVYF+ YVFFVFFVL+NMF+AII D+Y  VKE+L   KD+ Q++ FLK Q +NK        K RV  +Q+VL+         + ++D+   L+  G+ + EI A F R+D DGD  LD EE+  M Q L+  +++L           GH   S   EL  +       V  E F  L  RV  ++  +  +VS+ID V  +L  +E+
Sbjct:   68 SCCLHICRSIRGLWGTTLTENTAENRELYVKTTLRELVVYIVFLVDICLLTYGMTSSSAYYYTKVMSELFLHTPSDSGVSFQTISSMSDFWDFAQGPLLDSLYWTKWYNNQS-LGRGSHSFIYYENLLLGAPRLRQLRVRNDSCVVHEDFREDILNCYDVYSPDKEDQLPFGPQNGTAWTYHSQNELGGSSHWGRLTSYSGGGYYLDLPGSRQASAEALQGLQEGLWLDRGTRVVFIDFSVYNANINLFCILRLVVEFPATGGTIPSWQIRTVKLIRYVNNWDFFIVGCEVVFCVFIFYYVVEEILEIHLHRLRYLSSVWNILDLVVILLSIVAVGFHIFRTLEVNRLMGKLLQQPDTYADFEFLAFWQTQYNNMNAVNLFFAWIKIFKYISFNKTMTQLSSTLARCAKDILGFAIMFFIVFFAYAQLGYLLFGTQVENFSTFVKCIFTQFRIILGDFDYNAIDNANRILGPVYFVTYVFFVFFVLLNMFLAIINDTYSEVKEELAGQKDQLQLSDFLK-QSYNKTLLRLRLRKERVSDVQKVLKGGE----PEIQFEDFTSTLRELGHEEHEITAAFTRFDQDGDHILDEEEQEQMRQGLEEERVTLNAEIENLGRSVGH---SPPGELGAEAARGQSWVSGEEFDMLTRRVLQLQCVLEGVVSQIDAVGSKLKMLER 737          
BLAST of PKD2-1 vs. UniProt/SwissProt
Match: sp|Q13563|PKD2_HUMAN (Polycystin-2 OS=Homo sapiens OX=9606 GN=PKD2 PE=1 SV=3)

HSP 1 Score: 416.772 bits (1070), Expect = 1.187e-130
Identity = 283/707 (40.03%), Postives = 424/707 (59.97%), Query Frame = 3
Query:  282 ACGKKFLRVIRRAWSTRYTEELSSNKVVFLKTALRELVTYLVFLIFLMMVAYGTRSENLYYLTTAMSNILI--------TSNFNGITAMDSFWNWINIDFVNALYWNTWYNSMTYLPLNEREFIHYENKLVGVPQIRQLRIGSNTCQIPSFFKNSMSNCYGDYSFSNLNKSDFGISNSTAWXXXXXXXXXXXXXXXXXXXYDDGGFIQVLSRNSLETISILSNLQNNLWLDHGTRAVFIDLTVYNANVNLYCVIKLIFEFPPTGGIIPSSQFRTLKLIRYETGYDFFILFCXXXXXXXXXXXXXXXXXXXKKNKLSYFKKIWNVVDVLMIIMSFISIAINVYRVLSTXXXXXXXXXXXXXXXDFTFFANWNKYFNDAVSITTFFGAVKIFKYISFNKTMNQLTDTLSNSIREXXXXXXXXXXXXXXXXXWGYLQFGSQIVDFCRFQDSVFTLFRLVLGDFNFMALVQANSFIGPXXXXXXXXXXXXXXMNMFVAIIADSYEVVKEKLMQSKDEFQITKFLKAQFF-----NKFTKNRVMKIQEVLENENIANCETLSYQDWRDKLQSRGYADVEIQALFMRYDSDGDRTLDYEERRVMLQDLKNGKISLEGHQTESNESELSVKKEDESMP---------------------------VDEELFGGLVERVDSVEKNISNIVSKIDMVFLRLSEIEKAKLDHQKSIS 2282
            A  ++ +R +R  W TR  EE S+N+  +LK+ LRELVTYL+FLI L ++ YG  S N+YY T  MS + +         +NF  +++M+ FW +     ++ LYW    ++ T    + R FI YEN L+GVP+IRQLR+ + +C IP   ++ +  CY  YS S+ +++ FG  N TAW YT       SS     ATY   G+   LSR   ET + +++L+ N+WLD GTRA FID +VYNAN+NL+CV++L+ EFP TGG+IPS QF+ LKLIRY T +DFF+  CEI+  F++ YY +EE +EI+ +KL YF+  WN +DV+++++S ++I IN+YR  S  +V+ Q + +QN + +F   A W   FN+  ++T FF  +K+FK+I+FN+TM+QL+ T+S   +++ GFA+MFFI+F A+A   YL FG+Q+ DF  FQ+ +FT FR++LGD NF  + +AN  +GP+YF  +VFF+FF+L+NMF+AII D+Y  VK  L Q K E +++  ++  +       K  KN V  I E L          L++ + R  L+ +G+ D EI+A+F +YD DGD+ L   E + M  DL+  +  L     + + S L       S P                           V  E F  LV RVD +E +I +IVSKID V ++L  +E+AKL  ++ + 
Sbjct:  188 AWAERLVRGLRGLWGTRLMEESSTNREKYLKSVLRELVTYLLFLIVLCILTYGMMSSNVYYYTRMMSQLFLDTPVSKTEKTNFKTLSSMEDFWKFTEGSLLDGLYWKMQPSNQT--EADNRSFIFYENLLLGVPRIRQLRVRNGSCSIPQDLRDEIKECYDVYSVSSEDRAPFGPRNGTAWIYTSEKDLNGSSHWGIIATYSGAGYYLDLSRTREETAAQVASLKKNVWLDRGTRATFIDFSVYNANINLFCVVRLLVEFPATGGVIPSWQFQPLKLIRYVTTFDFFLAACEIIFCFFIFYYVVEEILEIRIHKLHYFRSFWNCLDVVIVVLSVVAIGINIYRT-SNVEVLLQFLEDQNTFPNFEHLAYWQIQFNNIAAVTVFFVWIKLFKFINFNRTMSQLSTTMSRCAKDLFGFAIMFFIIFLAYAQLAYLVFGTQVDDFSTFQECIFTQFRIILGDINFAEIEEANRVLGPIYFTTFVFFMFFILLNMFLAIINDTYSEVKSDLAQQKAEMELSDLIRKGYHKALVKLKLKKNTVDDISESLRQ----GGGKLNFDELRQDLKGKGHTDAEIEAIFTKYDQDGDQELTEHEHQQMRDDLEKEREDL-----DLDHSSLPRPMSSRSFPRSLDDSEEDDDEDSGHSSRRRGSISSGVSYEEFQVLVRRVDRMEHSIGSIVSKIDAVIVKLEIMERAKLKRREVLG 882          
BLAST of PKD2-1 vs. UniProt/SwissProt
Match: sp|O35245|PKD2_MOUSE (Polycystin-2 OS=Mus musculus OX=10090 GN=Pkd2 PE=1 SV=2)

HSP 1 Score: 413.69 bits (1062), Expect = 2.002e-129
Identity = 276/707 (39.04%), Postives = 420/707 (59.41%), Query Frame = 3
Query:  282 ACGKKFLRVIRRAWSTRYTEELSSNKVVFLKTALRELVTYLVFLIFLMMVAYGTRSENLYYLTTAMSNILI--------TSNFNGITAMDSFWNWINIDFVNALYWNTWYNSMTYLPLNEREFIHYENKLVGVPQIRQLRIGSNTCQIPSFFKNSMSNCYGDYSFSNLNKSDFGISNSTAWXXXXXXXXXXXXXXXXXXXYDDGGFIQVLSRNSLETISILSNLQNNLWLDHGTRAVFIDLTVYNANVNLYCVIKLIFEFPPTGGIIPSSQFRTLKLIRYETGYDFFILFCXXXXXXXXXXXXXXXXXXXKKNKLSYFKKIWNVVDVLMIIMSFISIAINVYRVLSTXXXXXXXXXXXXXXXDFTFFANWNKYFNDAVSITTFFGAVKIFKYISFNKTMNQLTDTLSNSIREXXXXXXXXXXXXXXXXXWGYLQFGSQIVDFCRFQDSVFTLFRLVLGDFNFMALVQANSFIGPXXXXXXXXXXXXXXMNMFVAIIADSYEVVKEKLMQSKDEFQITKFL-----KAQFFNKFTKNRVMKIQEVLENENIANCETLSYQDWRDKLQSRGYADVEIQALFMRYDSDGDRTLDYEERRVMLQDLKNGKISLEGHQTESNESELSVKKEDESMP---------------------------VDEELFGGLVERVDSVEKNISNIVSKIDMVFLRLSEIEKAKLDHQKSIS 2282
            A  ++ +R +R  W TR  EE ++N+  +LK+ LRELVTYL FL+ L ++ YG  S N+YY T  +S + I         +NF  +++M+ FW +    F++ LYW    ++ T    + R FI YEN L+GVP++RQLR+ + +C IP   ++ +  CY  YS S+ +++ FG  N TAW YT       SS     A+Y   G+   LSR   ET + L+ L+ N WLD GTRA FID +VYNAN+NL+CV++L+ EFP TGG++PS QF+ +KLIRY T +DFF+  CEI+  F++IYY +EE +EI+ ++LSYF+  WN +DV+++++S +++ IN+YR +S  + + Q + +QN++ +F   A W   FN+  ++  F   +K+FK+I+FN+TM+QL+ T+S   +++ GF +MF I+F A+A   YL FG+Q+ DF  FQ+ +FT FR++LGD NF  + +AN  +GP+YF  +VFF+FF+L+NMF+AII DSY  VK  L Q K E +++  +     KA    K  +N V  I E L          L++ + R  L+ +G+ D EI+A+F +YD DGD+ L   E + M  DL+  +  L     +   S L       S P                           V  E F  LV RVD +E +I +IVSKID V ++L  +E+AKL  ++ + 
Sbjct:  186 AWAERLVRGLRGLWGTRLMEESNANREKYLKSVLRELVTYLFFLVVLCILTYGMMSSNVYYYTRTLSQLFIDTPVSKTEKTNFKTLSSMEDFWKFTEGSFLDGLYWKAQTSNHTQA--DNRSFIFYENLLLGVPRLRQLRVRNGSCSIPQDLRDEIKECYDVYSVSSEDRAPFGPRNGTAWMYTSEKELNGSSHWGIIASYSGAGYYLDLSRTREETAAQLAGLRRNFWLDRGTRAAFIDFSVYNANINLFCVVRLLAEFPATGGVVPSWQFQPVKLIRYVTAFDFFLAACEIIFCFFIIYYVVEEILEIRIHRLSYFRSFWNCLDVVIVVLSVVAMVINIYR-MSNAEGLLQFLEDQNSFPNFEHVAYWQIQFNNISAVMVFLVWIKLFKFINFNRTMSQLSTTMSRCAKDLFGFTIMFSIIFLAYAQLAYLVFGTQVDDFSTFQECIFTQFRIILGDINFAEIEEANRVLGPLYFTTFVFFMFFILLNMFLAIINDSYSEVKSDLAQQKAEMELSDLIRKGCQKALVKLKLKRNTVDAISESLRQ----GGGKLNFDELRQDLKGKGHTDAEIEAIFTKYDQDGDQELTEREHQQMRDDLEKEREDL-----DLEHSSLPRPMSSRSFPRSLDDSEEEDDEDSGHSSRRRGSISSGVSYEEFQVLVRRVDRMEHSIGSIVSKIDAVIVKLEIMERAKLKRREVLG 880          
BLAST of PKD2-1 vs. TrEMBL
Match: A0A0H3YFQ9 (PKD2-1 OS=Schmidtea mediterranea OX=79327 GN=PKD2-1 PE=2 SV=1)

HSP 1 Score: 1301.58 bits (3367), Expect = 0.000e+0
Identity = 757/757 (100.00%), Postives = 757/757 (100.00%), Query Frame = 3
Query:   57 MSRQASVLRLTXXXXXXXXXXXXXXXXXXXHPVDVDNSDTVYEIKDFDNYSGEKSNSEQNLSSSADLFLLEDDNHACGKKFLRVIRRAWSTRYTEELSSNKVVFLKTALRELVTYLVFLIFLMMVAYGTRSENLYYLTTAMSNILITSNFNGITAMDSFWNWINIDFVNALYWNTWYNSMTYLPLNEREFIHYENKLVGVPQIRQLRIGSNTCQIPSFFKNSMSNCYGDYSFSNLNKSDFGISNSTAWXXXXXXXXXXXXXXXXXXXYDDGGFIQVLSRNSLETISILSNLQNNLWLDHGTRAVFIDLTVYNANVNLYCVIKLIFEFPPTGGIIPSSQFRTLKLIRYETGYDFFILFCXXXXXXXXXXXXXXXXXXXKKNKLSYFKKIWNVVDVLMIIMSFISIAINVYRVLSTXXXXXXXXXXXXXXXDFTFFANWNKYFNDAVSITTFFGAVKIFKYISFNKTMNQLTDTLSNSIREXXXXXXXXXXXXXXXXXWGYLQFGSQIVDFCRFQDSVFTLFRLVLGDFNFMALVQANSFIGPXXXXXXXXXXXXXXMNMFVAIIADSYEVVKEKLMQSKDEFQITKFLKAQFFNKFTKNRVMKIQEVLENENIANCETLSYQDWRDKLQSRGYADVEIQALFMRYDSDGDRTLDYEERRVMLQDLKNGKISLEGHQTESNESELSVKKEDESMPVDEELFGGLVERVDSVEKNISNIVSKIDMVFLRLSEIEKAKLDHQKSISCSLSILTGSQINVLV 2327
            MSRQASVLRLTSSIGGSIASIKSLLSKSKIHPVDVDNSDTVYEIKDFDNYSGEKSNSEQNLSSSADLFLLEDDNHACGKKFLRVIRRAWSTRYTEELSSNKVVFLKTALRELVTYLVFLIFLMMVAYGTRSENLYYLTTAMSNILITSNFNGITAMDSFWNWINIDFVNALYWNTWYNSMTYLPLNEREFIHYENKLVGVPQIRQLRIGSNTCQIPSFFKNSMSNCYGDYSFSNLNKSDFGISNSTAWSYTPPNSTYSSSFSATFATYDDGGFIQVLSRNSLETISILSNLQNNLWLDHGTRAVFIDLTVYNANVNLYCVIKLIFEFPPTGGIIPSSQFRTLKLIRYETGYDFFILFCEIVVIFYVIYYFIEEFIEIKKNKLSYFKKIWNVVDVLMIIMSFISIAINVYRVLSTNKVVKQLVNNQNNYVDFTFFANWNKYFNDAVSITTFFGAVKIFKYISFNKTMNQLTDTLSNSIREMMGFAVMFFIVFFAFAGWGYLQFGSQIVDFCRFQDSVFTLFRLVLGDFNFMALVQANSFIGPVYFLCYVFFVFFVLMNMFVAIIADSYEVVKEKLMQSKDEFQITKFLKAQFFNKFTKNRVMKIQEVLENENIANCETLSYQDWRDKLQSRGYADVEIQALFMRYDSDGDRTLDYEERRVMLQDLKNGKISLEGHQTESNESELSVKKEDESMPVDEELFGGLVERVDSVEKNISNIVSKIDMVFLRLSEIEKAKLDHQKSISCSLSILTGSQINVLV
Sbjct:    1 MSRQASVLRLTSSIGGSIASIKSLLSKSKIHPVDVDNSDTVYEIKDFDNYSGEKSNSEQNLSSSADLFLLEDDNHACGKKFLRVIRRAWSTRYTEELSSNKVVFLKTALRELVTYLVFLIFLMMVAYGTRSENLYYLTTAMSNILITSNFNGITAMDSFWNWINIDFVNALYWNTWYNSMTYLPLNEREFIHYENKLVGVPQIRQLRIGSNTCQIPSFFKNSMSNCYGDYSFSNLNKSDFGISNSTAWSYTPPNSTYSSSFSATFATYDDGGFIQVLSRNSLETISILSNLQNNLWLDHGTRAVFIDLTVYNANVNLYCVIKLIFEFPPTGGIIPSSQFRTLKLIRYETGYDFFILFCEIVVIFYVIYYFIEEFIEIKKNKLSYFKKIWNVVDVLMIIMSFISIAINVYRVLSTNKVVKQLVNNQNNYVDFTFFANWNKYFNDAVSITTFFGAVKIFKYISFNKTMNQLTDTLSNSIREMMGFAVMFFIVFFAFAGWGYLQFGSQIVDFCRFQDSVFTLFRLVLGDFNFMALVQANSFIGPVYFLCYVFFVFFVLMNMFVAIIADSYEVVKEKLMQSKDEFQITKFLKAQFFNKFTKNRVMKIQEVLENENIANCETLSYQDWRDKLQSRGYADVEIQALFMRYDSDGDRTLDYEERRVMLQDLKNGKISLEGHQTESNESELSVKKEDESMPVDEELFGGLVERVDSVEKNISNIVSKIDMVFLRLSEIEKAKLDHQKSISCSLSILTGSQINVLV 757          
BLAST of PKD2-1 vs. TrEMBL
Match: R7T913 (Uncharacterized protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_169289 PE=4 SV=1)

HSP 1 Score: 502.286 bits (1292), Expect = 2.834e-163
Identity = 317/723 (43.85%), Postives = 462/723 (63.90%), Query Frame = 3
Query:  264 LEDDNHACGKKFLRVIRRAWSTRYTEELSSNKVVFLKTALRELVTYLVFLIFLMMVAYGTRSENLYYLTTAMSNILITSNF-------NGITAMDSFWNWINIDFVNALYWNTWYNSMTYLPLNEREFIHYENKLVGVPQIRQLRIGSNTCQIPSFFKNSMSNCYGDYSFSNLNKSDFGISNSTAWXXXXXXXXXXXXXXXXXXXYDDGGFIQVLSRNSLETISILSNLQNNLWLDHGTRAVFIDLTVYNANVNLYCVIKLIFEFPPTGGIIPSSQFRTLKLIRYETGYDFFILFCXXXXXXXXXXXXXXXXXXXKKNKLSYFKKIWNVVDVLMIIMSFISIAINVYRVLSTXXXXXXXXXXXXXXXDFTFFANWNKYFNDAVSITTFFGAVKIFKYISFNKTMNQLTDTLSNSIREXXXXXXXXXXXXXXXXXWGYLQFGSQIVDFCRFQDSVFTLFRLVLGDFNFMALVQANSFIGPXXXXXXXXXXXXXXMNMFVAIIADSYEVVKEKLMQSKDEFQITKFLKAQFFNK------FTKNRVMKIQEVLENENIANCETLSYQDWRDKLQSRGYADVEIQALFMRYDSDGDRTLDYEERRVMLQDL--KNGKISLEGHQTE----------SNESELSVKKEDESMPVDEELFGG----------------LVERVDSVEKNISNIVSKIDMVFLRLSEIEKAKLDHQKSISCSLSILTGS 2309
            + + N  C  KF + IR  W+TR+TEE+  N+ + +KT LRELV Y+VFL+ L +V +G  S  +YY T  MS + + S F        G+T M  FW +     V+ LYW TWYN    +  +E  +I YENKL+GVP++RQL++ +++C +   FK ++  CY  Y+ S  +K+ FG+ N +AWSY+  +    SS      TY  GGF Q L+ N  ++++++++L+ NLWLD GTR VF+D TVYNAN+NL+CVI+L+ EFP TGG IPS  FRT+KLIRY +  D+F++ CE + + YVIYY IEE +EIK++KL YFK  WN++D+++++++   I  NVYR ++   ++  L+++ N Y DF F + W   FN A++I  FF  +K+FKYISFNKTM QL+ TL+   +++ GFAVMFFI+F AFA  GYL FG+Q+ DF  F D+VFTLFR++LGDFNF  L QAN  +GP YF+ YVFFVFFVL+NMF+AII D+Y  VKE++   K+EF++  + K Q +NK        +++++ IQ+ L+  +I N + L + +WR +L++RGYA+ EI+A+F +YD DGDR LD  E+R M  DL  +  K+S E  Q E          S +S+ +  +EDES        GG                L  RVD +E +I +IVSKID V ++L  +EKAK   ++++S  L  +T S
Sbjct:    7 VRESNKGCWHKFSQGIRSLWATRHTEEIKDNQELHIKTTLRELVVYIVFLVILCIVTFGMTSSTMYYYTKVMSELFLDSQFPETKNTFRGMTTMHDFWRFAESPLVDGLYWETWYNDRN-VSSDELGYIFYENKLLGVPRVRQLKVRNDSCVVHDDFKENIKACYDTYASSIEDKNPFGLINGSAWSYSSEDELDGSSHWGYITTYGGGGFYQDLALNKADSLALIADLKQNLWLDRGTRVVFVDFTVYNANINLFCVIRLVVEFPATGGAIPSWNFRTVKLIRYVSASDYFVMACECIFVLYVIYYIIEETLEIKRHKLGYFKSFWNILDIIVLMIAVCCIGFNVYRTVAVADMLDTLLDSPNEYADFEFLSYWQVVFNSALAIMVFFAWIKVFKYISFNKTMTQLSSTLARCAKDLAGFAVMFFIIFLAFAQLGYLIFGTQVKDFSSFDDAVFTLFRIILGDFNFHELEQANRVLGPAYFILYVFFVFFVLLNMFLAIINDTYSEVKEEISNQKNEFEMGDYFK-QGYNKMLDKLNLKRDKIVDIQKALQTADINNDDRLDFDEWRQELKTRGYAEAEIEAVFAKYDIDGDRVLDKTEQRKMQADLEGQKAKLSKEYDQLENKGDAKGSRVSFDSDENTDEEDESHGTKSSSRGGSNRNVVNGVSYEEFTVLSRRVDRMEHSIGSIVSKIDAVLVKLEAMEKAKSKRRETMSKILDSITES 727          
BLAST of PKD2-1 vs. TrEMBL
Match: X1ZBN2 (Uncharacterized protein OS=Capitella teleta OX=283909 PE=4 SV=1)

HSP 1 Score: 496.893 bits (1278), Expect = 3.749e-161
Identity = 314/721 (43.55%), Postives = 459/721 (63.66%), Query Frame = 3
Query:  264 LEDDNHACGKKFLRVIRRAWSTRYTEELSSNKVVFLKTALRELVTYLVFLIFLMMVAYGTRSENLYYLTTAMSNILITSNF-------NGITAMDSFWNWINIDFVNALYWNTWYNSMTYLPLNEREFIHYENKLVGVPQIRQLRIGSNTCQIPSFFKNSMSNCYGDYSFSNLNKSDFGISNSTAWXXXXXXXXXXXXXXXXXXXYDDGGFIQVLSRNSLETISILSNLQNNLWLDHGTRAVFIDLTVYNANVNLYCVIKLIFEFPPTGGIIPSSQFRTLKLIRYETGYDFFILFCXXXXXXXXXXXXXXXXXXXKKNKLSYFKKIWNVVDVLMIIMSFISIAINVYRVLSTXXXXXXXXXXXXXXXDFTFFANWNKYFNDAVSITTFFGAVKIFKYISFNKTMNQLTDTLSNSIREXXXXXXXXXXXXXXXXXWGYLQFGSQIVDFCRFQDSVFTLFRLVLGDFNFMALVQANSFIGPXXXXXXXXXXXXXXMNMFVAIIADSYEVVKEKLMQSKDEFQITKFLKAQFFNK------FTKNRVMKIQEVLENENIANCETLSYQDWRDKLQSRGYADVEIQALFMRYDSDGDRTLDYEERRVMLQDL--KNGKISLEGHQTE----------SNESELSVKKEDESMPVDEELFGG----------------LVERVDSVEKNISNIVSKIDMVFLRLSEIEKAKLDHQKSISCSLSILT 2303
            + + N  C  KF + IR  W+TR+TEE+  N+ + +KT LRELV Y+VFL+ L +  +G  S  +YY T  MS + + S F        G+T M  FW       V+ LYW TWYN    +  +E  +I YENKL+GVP++RQL++ +++C +   FK ++  CY  Y+ S  +K+ FG+ N +AWSY+  +    SS      TY  GGF Q L+ N  ++++++++L+ NLWLD GTR VF+D TVYNAN+NL+CVI+L+ EFP TGG IPS  FRT+KLIRY +  D+F++ CE + + YVIYY IEE +E+K++KL YFK  WN++D+++++++   I  NVYR ++   ++  L+++ N Y DF F + W   FN A++I  FF  +K+FKYISFNKTM QL+ TL+   +++ GFAVMFFI+F AFA  GYL FG+Q+ DF  F D+VFTLFR++LGDFNF  L QAN  +GP YF+ YVFFVFFVL+NMF+AII D+Y  VKE++   K+EF++  + K Q +NK        +++++ IQ+ L+  +I N + L + +WR +L++RGYA+ EI+A+F +YD DGDR LD  E+R M  DL  +  K+S E  Q E          S +S+ +  +EDES        GG                L  RVD +E +I +IVSKID V ++L  +EKAK   ++++S  L  +T
Sbjct:    7 VRESNKGCWHKFSQGIRCLWATRHTEEIKDNQELHIKTTLRELVVYIVFLVILCIGTFGMTSSTMYYYTKVMSELFLDSQFPETKNTFRGMTTMHDFWRVAESPLVDGLYWETWYNDRN-VSSDELGYIFYENKLLGVPRVRQLKVRNDSCVVHDDFKENIKACYDTYASSIEDKNPFGLINGSAWSYSSEDELDGSSHWGYITTYGGGGFYQDLALNKADSLALIADLKQNLWLDRGTRVVFVDFTVYNANINLFCVIRLVVEFPATGGAIPSWNFRTVKLIRYVSASDYFVMACECIFVLYVIYYIIEETLEVKRHKLGYFKSFWNILDIIVLMIAVCCIGFNVYRTVAVADMLDTLLDSPNEYADFEFLSYWQVVFNSALAIMVFFAWIKVFKYISFNKTMTQLSSTLARCAKDLAGFAVMFFIIFLAFAQLGYLIFGTQVKDFSSFDDAVFTLFRIILGDFNFHELEQANRVLGPAYFILYVFFVFFVLLNMFLAIINDTYSEVKEEISNQKNEFEMGDYFK-QGYNKMLDKLNLKRDKIVDIQKALQTADINNDDRLDFDEWRQELKTRGYAEAEIEAVFAKYDIDGDRVLDKTEQRKMQADLEGQKAKLSKEYDQLENKGDAKGSRVSFDSDENTDEEDESHGTKSSSRGGSNRNVVNGVSYEEFTVLSRRVDRMEHSIGSIVSKIDAVLVKLEAMEKAKSKRRETMSKILDSIT 725          
BLAST of PKD2-1 vs. TrEMBL
Match: A0A1S3KAZ3 (polycystin-2 isoform X2 OS=Lingula unguis OX=7574 GN=LOC106180089 PE=4 SV=1)

HSP 1 Score: 497.278 bits (1279), Expect = 2.411e-160
Identity = 298/692 (43.06%), Postives = 448/692 (64.74%), Query Frame = 3
Query:  282 ACGKKFLRVIRRAWSTRYTEELSSNKVVFLKTALRELVTYLVFLIFLMMVAYGTRSENLYYLTTAMSNILITSNFNG-------ITAMDSFWNWINIDFVNALYWNTWYNSMTYLPLNEREFIHYENKLVGVPQIRQLRIGSNTCQIPSFFKNSMSNCYGDYSFSNLNKSDFGISNSTAWXXXXXXXXXXXXXXXXXXXYDDGGFIQVLSRNSLETISILSNLQNNLWLDHGTRAVFIDLTVYNANVNLYCVIKLIFEFPPTGGIIPSSQFRTLKLIRYETGYDFFILFCXXXXXXXXXXXXXXXXXXXKKNKLSYFKKIWNVVDVLMIIMSFISIAINVYRVLSTXXXXXXXXXXXXXXXDFTFFANWNKYFNDAVSITTFFGAVKIFKYISFNKTMNQLTDTLSNSIREXXXXXXXXXXXXXXXXXWGYLQFGSQIVDFCRFQDSVFTLFRLVLGDFNFMALVQANSFIGPXXXXXXXXXXXXXXMNMFVAIIADSYEVVKEKLMQSKDEFQITKFLKAQFFN-----KFTKNRVMKIQEVLENENIANCETLSYQDWRDKLQSRGYADVEIQALFMRYDSDGDRTLDYEERRVMLQDLKNGKISLEGHQTESNESELSVKKEDE------SMPVDEELFGGLVERVDSVEKNISNIVSKIDMVFLRLSEIEKAKLDHQKSISCSLSILT 2303
             C  KFL  IR  W TR T + S NK +++KT L+EL+ YL+FL+ L ++ +G  S N+YY T  MS + + ++FN        I+ +  +W +     ++ LYW TWYN+   +  +E  FI YENKL+GVP+IRQL++ + +C++ S F + + +CYG Y+  + +KS FG +N TAWSY        S        Y+ GG++Q LS    ++++I+ +L+ NLWL  GTRAVF D TVYNAN+NL+CVI+L+ E+P TGG + S  FRT+KLIRY +  D+F++ CE + I ++IYY IEE +EIKK+K+ YFK  WNVVD+L++++S + IA ++YR ++ + ++++L+ N   + DF F + W   FN AV++  FF  VK+FKYISFNKTM QL+ TLS    ++ GF VMF I+FFAFA  G L FG+ I DF  F ++VFTLFR++LGDF+F +L   + F+GP+YF CYVFFVF +L+NMF+AII D+Y  VK  +   K++F++T + K  +        F +++++ IQ+ L + ++ N   + + +WR +L+ RGYAD EI+ALF +YD DGDRTLD  E++ M        + LEG + + +E E  ++K+ E       M V  E F  L  RVD +E +I +IVSKID V ++L  +EKAKL  +++++  L  +T
Sbjct:   97 GCCGKFLGGIRSLWRTRETVDASGNKDLYIKTTLKELIIYLLFLVVLCVITFGMTSSNMYYYTKVMSELFLDNSFNSNGQTFRSISNLGDYWQFARGPLMDGLYWETWYNNRN-VSQDELGFIFYENKLLGVPRIRQLKVKNGSCKVESNFGHVIDDCYGPYASGDEDKSTFGKANGTAWSYQTSEQLDGSGHYGILTRYEGGGYVQKLSTTKAKSLAIVDDLKQNLWLTRGTRAVFTDFTVYNANINLFCVIRLLVEYPATGGALSSWSFRTIKLIRYVSVGDYFVMACECIFILFIIYYIIEEVLEIKKHKVEYFKHFWNVVDILVLVISSVCIAFSIYRTIAVDTMLEKLLENPEEFPDFEFLSFWQMQFNSAVAVAVFFAWVKVFKYISFNKTMTQLSSTLSRCAGDLAGFLVMFCIMFFAFAQLGVLVFGAVIRDFSNFWNAVFTLFRIILGDFDFNSLQDFDKFLGPLYFFCYVFFVFLILLNMFLAIINDTYADVKSDIALQKNDFEMTDYFKKGYQKMMDKLNFKRDKIVDIQKALASADMDNDMVVDFDEWRTELKKRGYADTEIEALFAKYDVDGDRTLDESEQKQM-------AVELEGQKAKLDEEENEIEKDKEMAQAGRKMGVTVEEFSVLQRRVDRMEHSIGSIVSKIDAVLVKLEAMEKAKLKRRETMAKILDSIT 780          
BLAST of PKD2-1 vs. TrEMBL
Match: A0A1S3KAA4 (polycystin-2 isoform X3 OS=Lingula unguis OX=7574 GN=LOC106180089 PE=4 SV=1)

HSP 1 Score: 495.738 bits (1275), Expect = 7.478e-160
Identity = 298/694 (42.94%), Postives = 450/694 (64.84%), Query Frame = 3
Query:  282 ACGKKFLRVIRRAWSTRYT--EELSSNKVVFLKTALRELVTYLVFLIFLMMVAYGTRSENLYYLTTAMSNILITSNFNG-------ITAMDSFWNWINIDFVNALYWNTWYNSMTYLPLNEREFIHYENKLVGVPQIRQLRIGSNTCQIPSFFKNSMSNCYGDYSFSNLNKSDFGISNSTAWXXXXXXXXXXXXXXXXXXXYDDGGFIQVLSRNSLETISILSNLQNNLWLDHGTRAVFIDLTVYNANVNLYCVIKLIFEFPPTGGIIPSSQFRTLKLIRYETGYDFFILFCXXXXXXXXXXXXXXXXXXXKKNKLSYFKKIWNVVDVLMIIMSFISIAINVYRVLSTXXXXXXXXXXXXXXXDFTFFANWNKYFNDAVSITTFFGAVKIFKYISFNKTMNQLTDTLSNSIREXXXXXXXXXXXXXXXXXWGYLQFGSQIVDFCRFQDSVFTLFRLVLGDFNFMALVQANSFIGPXXXXXXXXXXXXXXMNMFVAIIADSYEVVKEKLMQSKDEFQITKFLKAQFFN-----KFTKNRVMKIQEVLENENIANCETLSYQDWRDKLQSRGYADVEIQALFMRYDSDGDRTLDYEERRVMLQDLKNGKISLEGHQTESNESELSVKKEDE------SMPVDEELFGGLVERVDSVEKNISNIVSKIDMVFLRLSEIEKAKLDHQKSISCSLSILT 2303
             C  KFL  IR  W+TR    EE + N+ +++KT LREL+ Y++FL+ LM++ +G  S N+YY T  MS + + ++FN        I+ +  +W +     ++ LYW TWYN+   +  +E  FI YENKL+GVP+IRQL++ + +C++ S F + + +CYG Y+  + +KS FG +N TAWSY        S        Y+ GG++Q LS    ++++I+ +L+ NLWL  GTRAVF D TVYNAN+NL+CVI+L+ E+P TGG + S  FRT+KLIRY +  D+F++ CE + I ++IYY IEE +EIKK+K+ YFK  WNVVD+L++++S + IA ++YR ++ + ++++L+ N   + DF F + W   FN AV++  FF  VK+FKYISFNKTM QL+ TLS    ++ GF VMF I+FFAFA  G L FG+ I DF  F ++VFTLFR++LGDF+F +L   + F+GP+YF CYVFFVF +L+NMF+AII D+Y  VK  +   K++F++T + K  +        F +++++ IQ+ L + ++ N   + + +WR +L+ RGYAD EI+ALF +YD DGDRTLD  E++ M        + LEG + + +E E  ++K+ E       M V  E F  L  RVD +E +I +IVSKID V ++L  +EKAKL  +++++  L  +T
Sbjct:   97 GCCGKFLGGIRSMWATRQLQFEESTKNQELYIKTTLRELIVYILFLVILMVLTFGMTSSNMYYYTKVMSELFLDNSFNSNGQTFRSISNLGDYWQFARGPLMDGLYWETWYNNRN-VSQDELGFIFYENKLLGVPRIRQLKVKNGSCKVESNFGHVIDDCYGPYASGDEDKSTFGKANGTAWSYQTSEQLDGSGHYGILTRYEGGGYVQKLSTTKAKSLAIVDDLKQNLWLTRGTRAVFTDFTVYNANINLFCVIRLLVEYPATGGALSSWSFRTIKLIRYVSVGDYFVMACECIFILFIIYYIIEEVLEIKKHKVEYFKHFWNVVDILVLVISSVCIAFSIYRTIAVDTMLEKLLENPEEFPDFEFLSFWQMQFNSAVAVAVFFAWVKVFKYISFNKTMTQLSSTLSRCAGDLAGFLVMFCIMFFAFAQLGVLVFGAVIRDFSNFWNAVFTLFRIILGDFDFNSLQDFDKFLGPLYFFCYVFFVFLILLNMFLAIINDTYADVKSDIALQKNDFEMTDYFKKGYQKMMDKLNFKRDKIVDIQKALASADMDNDMVVDFDEWRTELKKRGYADTEIEALFAKYDVDGDRTLDESEQKQM-------AVELEGQKAKLDEEENEIEKDKEMAQAGRKMGVTVEEFSVLQRRVDRMEHSIGSIVSKIDAVLVKLEAMEKAKLKRRETMAKILDSIT 782          
BLAST of PKD2-1 vs. Ensembl Cavefish
Match: pkd2l1 (polycystic kidney disease 2-like 1 protein [Source:NCBI gene;Acc:103031316])

HSP 1 Score: 435.647 bits (1119), Expect = 2.609e-140
Identity = 284/694 (40.92%), Postives = 436/694 (62.82%), Query Frame = 3
Query:  267 EDDNHACGKKFLRVIRRAWSTRYTEELSSNKVVFLKTALRELVTYLVFLIFLMMVAYGTRSENLYYLTTAMSNILITS------NFNGITAMDSFWNWINIDFVNALYWNTWYNSMTYLPLNEREFIHYENKLVGVPQIRQLRIGSNTCQIPSFFKNSMSNCYGDYSFSNLNKSDFGISNSTAWXXXXXXXXXXXXXXXXXXXYDDGGFIQVLSRNSLETISILSNLQNNLWLDHGTRAVFIDLTVYNANVNLYCVIKLIFEFPPTGGIIPSSQFRTLKLIRYETGYDFFILFCXXXXXXXXXXXXXXXXXXXKKNKLSYFKKIWNVVDVLMIIMSFISIAINVYRVLSTXXXXXXXXXXXXXXXDFTFFANWNKYFNDAVSITTFFGAVKIFKYISFNKTMNQLTDTLSNSIREXXXXXXXXXXXXXXXXXWGYLQFGSQIVDFCRFQDSVFTLFRLVLGDFNFMALVQANSFIGPXXXXXXXXXXXXXXMNMFVAIIADSYEVVKEKLMQSKDEFQITKFLKAQFFNKFTKNRVMK-----IQEVLENENIANCETLSYQDWRDKLQSRGYADVEIQALFMRYDSDGDRTLDYEERRVMLQDL--KNGKISLEGHQT----ESNESELSVKKEDESMPVDEELFGGLVERVDSVEKNISNIVSKIDMVFLRLSEIEKAKLDHQKSISCSLSI 2297
            E  +  C    LR I+  W T  T++ + N+ +F++T LRELV Y+VFL+ + ++ YG  S   YY T  M+++ + +       F  I  MD FW++     ++ LYW +WYN+ + L      FI+YEN L+GVP++RQL++ + +C++   F+  +S+C+  Y+    + S FG+ N TAW Y        S+     ATY  GG+ Q L+    E+  +L+NL NNLWLDHGTRAVFID + YNAN+NL+CVI+L+ EFP TGG IPS Q RT+KLIRY T +D+FI+ CEIV   +++YY +EE +E++ +KLSYFK IWN++DV++I+++ ++I  NV+R +  +K++  L+   + Y DF F A W   +N+  ++  FF  +KIFKYISFNKTM QL+ TL+    +++GFA+MFFIVFFA+A  GYL FG+++  F  F   +FT FR++LGDF++  + +AN  +GP+YF  YVFFVFFVL+NMF+AII D+Y  VKE+L   KD+ QIT  +K  +   F K ++ K     +Q+VL     +  + L ++D+R+ L+  G+AD EI A F ++D DG++ LD EE+  M Q+L  K   +S+E H      E N  E    ++  S+ V  + F  LV++V  +E +++  ++KID+V  +L   +  K + + +    L+I
Sbjct:   82 EKKSSGCCSFLLRGIKGLWGTTLTKDTTENRELFVRTTLRELVVYIVFLVDMCLLTYGMTSSTTYYYTKVMTDLFVNAPSDSGVTFQSIGTMDDFWSYAQGPLLDGLYWTSWYNNQS-LQTGTHSFIYYENMLLGVPRVRQLKVKNKSCKVHKDFEEEISDCFDVYNEKKEDDSSFGLINGTAWQYHTEKELKGSNHWGMLATYSGGGYYQDLALTKEESAGVLANLNNNLWLDHGTRAVFIDFSTYNANINLFCVIRLVVEFPATGGAIPSYQIRTVKLIRYITTWDYFIIGCEIVFCVFILYYIVEEILELRIHKLSYFKSIWNILDVVIIMLAIVAIVFNVFRTIKVDKLLGNLLKEPSIYADFEFLAFWQTQYNNMNAVNLFFAWIKIFKYISFNKTMTQLSSTLARCATDILGFAIMFFIVFFAYAQLGYLLFGTEVESFSTFHKCIFTQFRIILGDFDYDGIERANRVLGPIYFFTYVFFVFFVLLNMFLAIINDTYSEVKEELASQKDDLQITDLIKQSYSKTFMKLKLKKEKISDVQKVLR----SGSKELEFKDFRETLKEMGHADHEISAAFSKFDYDGNQILDKEEQETMKQELEEKRDALSVELHNLGINYEKNGKETDDNEKTNSVLVTAQQFQMLVKQVVELECSLATTMAKIDVVMEKLGLQDAGKTNKKDATGKHLTI 770          
BLAST of PKD2-1 vs. Ensembl Cavefish
Match: pkd2 (polycystin 2, transient receptor potential cation channel [Source:NCBI gene;Acc:103043751])

HSP 1 Score: 414.846 bits (1065), Expect = 1.619e-131
Identity = 267/701 (38.09%), Postives = 428/701 (61.06%), Query Frame = 3
Query:  267 EDDNHACGKKFLRVIRRAWSTRYTEELSSNKVVFLKTALRELVTYLVFLIFLMMVAYGTRSENLYYLTTAMSNILI--------TSNFNGITAMDSFWNWINIDFVNALYWNTWYNSMTYLPLNEREFIHYENKLVGVPQIRQLRIGSNTCQIPSFFKNSMSNCYGDYSFSNLNKSDFGISNSTAWXXXXXXXXXXXXXXXXXXXYDDGGFIQVLSRNSLETISILSNLQNNLWLDHGTRAVFIDLTVYNANVNLYCVIKLIFEFPPTGGIIPSSQFRTLKLIRYETGYDFFILFCXXXXXXXXXXXXXXXXXXXKKNKLSYFKKIWNVVDVLMIIMSFISIAINVYRVLSTXXXXXXXXXXXXXXXDFTFFANWNKYFNDAVSITTFFGAVKIFKYISFNKTMNQLTDTLSNSIREXXXXXXXXXXXXXXXXXWGYLQFGSQIVDFCRFQDSVFTLFRLVLGDFNFMALVQANSFIGPXXXXXXXXXXXXXXMNMFVAIIADSYEVVKEKLMQSKDEFQITKFLKAQFFNKFTKNRVMK--IQEVLENENIANCETLSYQDWRDKLQSRGYADVEIQALFMRYDSDGDRTLDYEERRVMLQDLKNGK--ISLEGHQTESNESELSVKKEDESMPVDE--------------------ELFGGLVERVDSVEKNISNIVSKIDMVFLRLSEIEKAKLDHQK 2273
            E   H  GK+ L  +R  W TR  E+  S++ V+LK  LRE VTY+ FLI L ++ YG  S N+Y+ T  MS + +         + F  ++ M+ FW +    F+N +YW+ WYN+ + LP N+   I+YEN L+GVP++RQ+++ + +C +    K+ + +CY  YS ++ +K+ FG+ N+TAW Y+  N    SS+    ATY  GG+ Q L+R+  E+   L  L++NLWLD GTRAVF+D +VYN NVNL+C+++++ EFP TGG + S QF+T++L+RY + +D+F+  CE+V   +V+YY +EE +EI+ ++L YFK +WN +DV+++ +S  +I +N+YR  + +  ++ L+ N + Y +F   A     FN   ++  F   VK+FK+I+FNKTM+QL+ T+S   ++++GFA+MFFIVF A+A   YL FG+Q+ DF  FQ  +FT FR++LGDF+F  + + N  +GP+YF  +VFF+F +L+NMF+AII D+Y  VK  + Q + E +IT  +K  +     K R+ K  + ++ ++   A  + L++ + R  L+ +G++D EI+A+F +YD DGD+ L   E + M  DL+  +  + LE        S  S  +  +    D+                    E F  LV RVD +E +I +IVSKID V ++L  +E+AKL  ++
Sbjct:  122 EGMQHGWGKRILAKLRILWGTRLMEDSESSREVYLKNVLRETVTYIFFLITLCIITYGMVSTNMYFYTKVMSQLFLDTPLSKGDPTTFKTLSTMEDFWKYTEGPFLNGMYWDVWYNNKS-LPENQ-SLIYYENLLLGVPRLRQVKVLNKSCPVHEDLKDEVYDCYSIYSPASEDKAPFGLKNNTAWVYSEENILGESSYWGEVATYRGGGYYQDLARSREESARQLKELKDNLWLDRGTRAVFLDFSVYNGNVNLFCIVRMLVEFPATGGAVTSWQFQTVRLVRYVSSWDYFVGTCEVVFCLFVLYYMVEEVLEIRLHRLRYFKSLWNCLDVIIVTLSAPAIIMNIYRTSAVSNRLRYLLENHSTYPNFQPLAQVQVQFNHLAAVIVFLAWVKLFKFINFNKTMSQLSTTMSRCAKDLLGFAIMFFIVFLAYAQLAYLVFGNQLNDFSTFQACIFTQFRIILGDFDFSEIEETNRVLGPIYFTTFVFFMFMILLNMFLAIINDTYSEVKADMAQQRSEMEITDLIKKGYQKAMVKLRLRKTTVDDISDSLRQAGGK-LNFDELRQDLRGKGHSDAEIEAIFAKYDLDGDQELSEHEHQQMKDDLEKEREDLDLERSSLPRPMSGRSFSRSQDDSEEDDDEDSGHSSRRRGSSSGGVSYEEFQVLVRRVDRMEHSIGSIVSKIDAVIVKLEAMERAKLKRRE 819          
BLAST of PKD2-1 vs. Ensembl Cavefish
Match: pkd1l2a (polycystin 1 like 2 [Source:NCBI gene;Acc:103044173])

HSP 1 Score: 143.28 bits (360), Expect = 2.269e-34
Identity = 133/506 (26.28%), Postives = 245/506 (48.42%), Query Frame = 3
Query:  381 LRELVTYLVFLIFLMMVAYGTRSENLYYLTTAMSNILITSNFNGITAMDSFWNWINIDFVNALYWNTWYNSMTYLPLNEREFIHYEN-KLVGVPQIRQLRIGSNTCQIPSFFKNSMSNCYGDYSFSNLNKSDFGI------------SNSTAWXXXXXXXXXXXXXXXXXXXYDDGGFIQVLSRNSLETISILSNLQNNLWLDHGTRAVFIDLTVYNANVNLYCVIKLIFEFPPTGGIIPSSQFRTLKLIRYETGYDFFILFCXXXXXXXXXXXXXXXXXXXKKNKLSYFKKIWNVVDVLMIIMSFISIAINVYRVLSTXXXXXXXXXXXXXXXDFTFFANWNKYFNDAVSITTFFGAVKIFKYISFNKTMNQLTDTLSNSIREXXXXXXXXXXXXXXXXXWGYLQFGSQIVDFCRFQDSVFTLFRLVLGDFNFMALVQANSFIGPXXXXXXXXXXXXXXMNMFVAII--ADSYEVVKEKLMQSKDEFQITKFLKAQFFNKFTKNR 1853
            +RE++ Y+ FL  L++VAYG R  N +YLT  +         + +T  + F  W N   +N L+              +  FI   N KLVG  ++RQ+R+   +C++    +NS+ +C+  YS+   +   +G             +  T W Y   +   +       A Y  GGF+  L  N     S L  L  N WLD  TRA+F++ TVYNANVNL+C++ L+FE    G     S+ ++++L +   G   F++  E+V   ++ YY  ++   +K+ K  YF+  WN++D+ +II+S+ ++ + + R L  N+ ++   N+++ Y  F   A  +      ++       VK++  +  N  ++ +T TL  +  ++ GF V+  I+F A++    L +G ++  +    ++  T+  L LG FN+  ++  N  +G       + F+ FV++N+F+++I  A S E +  K  + ++   +        F    KN+
Sbjct: 2090 IREILIYMGFLWMLLLVAYGQRDPNAFYLTQHIQQSFSNGISDSMTHGEVF-QWANSTLLNNLFGQ------------QPGFITDGNSKLVGNARLRQVRVQDGSCRVDRSMRNSVPDCHAPYSWDMEDLGSYGPGWNPSIDANLSKTLPTPWQYQTQSRLRAHPIWGGVAVYRGGGFVVDLGPNRENASSSLQYLFENTWLDMFTRAIFVEFTVYNANVNLFCIVTLMFETTAVGAFQYRSELQSVRLYQSTGGLHIFVMASEVVYFLFIFYYMFQQGKLMKQQKWEYFRSKWNLLDMAIIILSWSALPVFIKRTLLGNQSIEYYQNHKDEYAGFNETATADAVLGYIIAFLVLLATVKLWHLLRLNPKLHMITSTLQRAWNDISGFIVVMTIMFLAYSVACNLLYGWKLYSYRTLLNAAQTIVSLQLGIFNYEEVLDYNPVLGAFIVGSCIIFMTFVVLNLFISVILVAFSEEQIHHKPSEEEEIVDLMLMKICSLFGVKVKNQ 2582          
BLAST of PKD2-1 vs. Ensembl Cavefish
Match: ENSAMXT00000006495.2 (pep primary_assembly:Astyanax_mexicanus-2.0:5:35007331:35041448:1 gene:ENSAMXG00000006274.2 transcript:ENSAMXT00000006495.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 125.946 bits (315), Expect = 4.768e-29
Identity = 121/497 (24.35%), Postives = 235/497 (47.28%), Query Frame = 3
Query:  387 ELVTYLVFLIFLMMVAYGTRSENLYYLTTAMSNILITSNFNGITAMDSFWNWINIDFVNALYWNTWYNSMTYLPLNEREFIHYEN-KLVGVPQIRQLRIGSNTCQIPSFFKNSMSNCYGDYSF-----------------SNLNKSDFGISNSTAWXXXXXXXXXXXXXXXXXXXYDDGGFIQVLSRNSLETISILSNLQNNLWLDHGTRAVFIDLTVYNANVNLYCVIKLIFEFPPTGGIIPSSQFRTLKLIRYETG---------YDFFILFCXXXXXXXXXXXXXXXXXXXKKNKLSYFKKIWNVVDVLMIIMSFISIAINVYRVLSTXXXXXXXXXXXXXXXDFTFFANWNKYFNDAVSITTFFGAVKIFKYISFNKTMNQLTDTLSNSIREXXXXXXXXXXXXXXXXXWGYLQFGSQIVDFCRFQDSVFTLFRLVLGDFNFMALVQANSFIGPXXXXXXXXXXXXXXMNMFVAIIADSYEVVKEKLMQSKDE 1796
            E++ YL F   L+M AY  R  N ++LT  +         + ++  D F  W N   +  L+    Y+           FI   N KLVG  ++RQ+R+  ++C+  S  ++S+ +C+  YS+                 SN++K+ F     T W Y   +   + +     A Y  GGF+  L  +   + S+L  L  N WLD  TRA+FI+ TVYNANVNL+C++ L+ E    G     ++ + ++L +   G         Y  FIL+           Y   +   +K+ K  YF+  WN++++ +I++S+ + ++ + +++  ++ +K   +++N +  F   A  +       ++      +K++  +  N  +N +T+TL  +  ++  F V+  I+F A++    L FG ++  +    D+   +  L LG FN+  ++  N  +G       + F+ FV++N+F+++I +++   +     S++E
Sbjct: 1211 EILIYLGFFCMLLMAAYSQRDPNAFFLTRHIQQSFSNGISDSMSQQDVFI-WANSSLLTNLFGQ--YSG----------FITDGNSKLVGTARLRQVRVQKSSCRKASSVRSSVPDCHAPYSWEVEDMGSYGPGWTSLIDSNMSKALF-----TPWQYQTQSRLRAHTVWGGMALYRGGGFVVDLEPDQQNSSSVLQYLFENAWLDIYTRALFIEFTVYNANVNLFCIVTLMLETTAVGAFQYRTELQNIRLFQTTDGIPTLVSEAIYFLFILY-----------YMFLQAKLMKQQKWEYFRNKWNILELAIILLSWSAFSVFIKKMVQGDQDLKYYQDHRNQFPSFYETAAADSVLGYLTAVLVLLATIKMWHLMRLNSKLNMITNTLQQAWSDISSFIVVIVIMFLAYSIVSNLLFGWKLYTYKTLIDAATAMVSLQLGIFNYEEILDLNPVLGAFIIGSCIIFMTFVVLNLFISVILEAFSQEQRHHKPSEEE 1678          
BLAST of PKD2-1 vs. Ensembl Cavefish
Match: pkd1a (polycystic kidney disease 1a [Source:ZFIN;Acc:ZDB-GENE-100707-1])

HSP 1 Score: 56.6102 bits (135), Expect = 1.151e-7
Identity = 49/209 (23.44%), Postives = 98/209 (46.89%), Query Frame = 3
Query:  867 GGFIQVLSRNSLETISILSNLQNNLWLDHGTRAVFIDLTVYNANVNLYCVIKLIFEFPPTGGIIPSSQFRTLKLIRYETGYDFFILFCXXXXXXXXXXXXXXXXXXXKKNKLSYFKKIWNVVDVLMIIMSFISIAINVYRVLSTXXXXXXXXXXXXXXXDFTFFANWNKYFNDAVSITTFFGAVKIFKYISFNKTMNQLTDTLSNSIRE 1493
            GGF+Q LSR   ++ S++  L ++ W    TRA+F++ ++YN N +L  V  L+ EFP +     S   +T  L     G D  +    +++IF + +   E     ++ + SYF ++WN+  +  ++++ +  A+++ R     ++    +  + ++ DF   A  N+      +   F   +K    + F +       TL  S+ E
Sbjct: 3727 GGFVQELSRRMEDSRSLIQQLLSHQW----TRALFVEFSLYNTNTDLLAVFTLLLEFPVSERAQSSLDLKTCSLHTLHHGLDLSLFLTLLLMIFIIYFSVREGVAAHRQGR-SYFLRVWNLAGMCTLLLAAVVSALHLSRSALATRLWASFLQQRESFTDFFPLAQQNQVLTQLNATLLFLLVLKASHQLRFLREWAVFGRTLRRSVWE 3930          
BLAST of PKD2-1 vs. Ensembl Sea Lamprey
Match: pkd2l1 (polycystic kidney disease 2-like 1 [Source:ZFIN;Acc:ZDB-GENE-030616-558])

HSP 1 Score: 420.239 bits (1079), Expect = 3.361e-137
Identity = 266/658 (40.43%), Postives = 407/658 (61.85%), Query Frame = 3
Query:  321 WSTRYTEELSSNKVVFLKTALRELVTYLVFLIFLMMVAYGTRSENLYYLTTAMSNILITS--------NFNGITAMDSFWNWINIDFVNALYWNTWYNSMTYLPLNEREFIHYENKLVGVPQIRQLRIGSNTCQIPSFFKNSMSNCYGDYSFSNLNKSDFGISNSTAWXXXXXXXXXXXXXXXXXXXYDDGGFIQVLSRNSLETISILSNLQNNLWLDHGTRAVFIDLTVYNANVNLYCVIKLIFEFPPTGGIIPSSQFRTLKLIRYETGYDFFILFCXXXXXXXXXXXXXXXXXXXKKNKLSYFKKIWNVVDVLMIIMSFISIAINVYRVLSTXXXXXXXXXXXXXXXDFTFFANWNKYFNDAVSITTFFGAVKIFKYISFNKTMNQLTDTLSNSIREXXXXXXXXXXXXXXXXXWGYLQFGSQIVDFCRFQDSVFTLFRLVLGDFNFMALVQANSFIGPXXXXXXXXXXXXXXMNMFVAIIADSYEVVKEKLMQSKDEFQITKFLKAQFFN-----KFTKNRVMKIQEVLENENIANCETLSYQDWRDKLQSRGYADVEIQALFMRYDSDGDRTLDYEERRVMLQDLKNGKISLEGHQTESNESELSVK------KEDESMPVDEELFGGLVERVDSVEKNISNIVSKIDMVFLRL 2237
            W TR TE ++S +  + KT LREL+ Y+VFLI L ++ +G  + N YY T  M ++ + S        NFN I++MD FW  +    ++ LYW  WYN    LP+N   FI YEN ++GVP++RQL++ + +C I   F+N +  CY  YS    +K  FG    TAW Y        SS     A Y   G+ + LSR   E+  +L  L++ LWLDHGTRAVFID T YN N+NL+CV++L+ EFP TGG +PS QFRT+KLIRY + +D+FI+ CE++   +++YY +EE +E++ + + YFK +WN +D+++I++S ++I  N+ R ++ + ++  L+N+ N Y DF + A W   FN+ ++I  FF  +KIFKY+SFNKT+ QL+ TL+   ++++GFAVMFFI+FFA+A  GYL FGSQ+ DF  F + +FT FR++LGDF+F A+  AN  +GP+YF  Y+FFVFFVL+NMF+AII D+Y  VK +L  +KD+F+I  F K  + N     K  K+ +  +Q  L++      + L Y  WR  L   G++D EI A F ++D D D  LD +E++ +       +  LEG + + NE   ++K      K  ++  V ++ F     RV  +E ++ +++SK++ +  +L
Sbjct:   12 WGTRLTE-VNSTREQYFKTTLRELIIYVVFLIDLCLLTFGMMNTNTYYYTKVMMDLFVESPVSPIDGTNFNSISSMDDFWKVVQGPVLDGLYWEKWYNG-DQLPVN-LSFIQYENVMLGVPRVRQLKVRNGSCTIYPLFRNIIPGCYDGYSCGEEDKETFGRGTGTAWKYWSEEELSGSSHWGLLAQYSGAGYYRDLSRRKNESAPMLQELKDYLWLDHGTRAVFIDFTTYNGNINLFCVVRLVVEFPLTGGALPSYQFRTVKLIRYVSAFDYFIMACEVIFCCFILYYVVEECLELRLHGMKYFKSVWNCLDIIVIVLSMVAIIFNICRTIAVSNLLGALLNDPNIYADFEYLAFWQTQFNNMLAINVFFAWIKIFKYVSFNKTLTQLSSTLARCAKDVLGFAVMFFIIFFAYAQTGYLVFGSQVEDFSSFVNCIFTQFRIILGDFDFHAIENANRILGPIYFTTYIFFVFFVLLNMFLAIINDTYTDVKAELADTKDDFEIGDFFKQGYKNMLNKLKMKKDDIADMQRALDSAG----KHLEYDIWRKNLIRLGHSDEEIAAAFSKFDKDSDNVLDEDEQKQL-------RAELEGQKDKLNEDIEALKTMDNSGKPGDASRVTKDDFNRFASRVAKMESSMDSLMSKVESLLTKL 655          
BLAST of PKD2-1 vs. Ensembl Sea Lamprey
Match: pkd2l1 (polycystic kidney disease 2-like 1 [Source:ZFIN;Acc:ZDB-GENE-030616-558])

HSP 1 Score: 404.831 bits (1039), Expect = 6.915e-130
Identity = 271/700 (38.71%), Postives = 427/700 (61.00%), Query Frame = 3
Query:  267 EDDNHACGKKFLRVIRRAWSTRYTEELSSNKVVFLKTALRELVTYLVFLIFLMMVAYGTRSENLYYLTTAMSNILI--------TSNFNGITAMDSFWNWINIDFVNALYWNTWYNSMTYLPLNERE-FIHYENKLVGVPQIRQLRIGSNTCQIPSFFKNSMSNCYGDYSFSNLNKSDFGISNSTAWXXXXXXXXXXXXXXXXXXXYDDGGFIQVLSRNSLETISILSNLQNNLWLDHGTRAVFIDLTVYNANVNLYCVIKLIFEFPPTGGIIPSSQFRTLKLIRYETGYDFFILFCXXXXXXXXXXXXXXXXXXXKKNKLSYFKKIWNVVDVLMIIMSFISIAINVYRVLSTXXXXXXXXXXXXXXXDFTFFANWNKYFNDAVSITTFFGAVKIFKYISFNKTMNQLTDTLSNSIREXXXXXXXXXXXXXXXXXWGYLQFGSQIVDFCRFQDSVFTLFRLVLGDFNFMALVQANSFIGPXXXXXXXXXXXXXXM--NMFVAIIADSYEVVKEKLMQSKDEFQITKFLKAQFFN---KFTKNR--VMKIQEVLENENIANCETLSYQDWRDKLQSRGYADVEIQALFMRYDSDGDRTLDYEERRVMLQDLKNGK----------------------ISLEGHQTESNESELSVKKEDESMPVDEELFGGLVERVDSVEKNISNIVSKIDMVFLRLSEIEK 2252
            ED +    K    V+R  W TR TE+++ ++  ++KT LREL  Y+ FLI L+++ +G  S+ +Y  T AM N+ +        + NFN I   D FW  +    +N LYW  WYN    +PL E + FI+YEN L+GVP+IRQL++ +++C + + F+  +  CY  YS    +K+ FG +  T W Y+  +    SS     ATY  GG+   L+R+  E+  +L +L +  WLD GTRA+ ID + YN N+NL+ VI+L+ EFPPTGG +PSSQ  T+KLIRY TG D+FIL CE +   +++YY +EE +E+  +K +YFK +WN +D+L+I++S ++I  NVYR ++ NK++K L++  N Y +F F A W   +N+ V++  FF  +K FKY+SFNKTM QL+ TL+   ++++GFAVMFFI+FFA+A  GYL FG+Q+ DF  F + +FT FR++LGDF+F A+  AN  +GP+YF  YVF VFFVL+  NMF+AII D+Y  VK +L + ++EF +  + K  + +   K  KNR  ++ +  VL+    A+ + ++Y DWR KL+  G++D EI+A F ++D D +  LD  E ++M  +LK+ K                      +        +   E++ ++  + +     ++  LV+ VD++E++IS + SK+D++  ++  + K
Sbjct:   80 EDQSGGPKKSRKSVLRGLWGTRLTEDIT-DRDKYVKTTLRELFVYIAFLINLIILTFGMTSDLMYKYTLAMDNLFLQNTVSPNDSVNFNSIFTFDDFWKVVQGPVLNGLYWEKWYND---IPLVENQSFIYYENFLLGVPRIRQLKVRNDSCTVHADFQKDVQGCYAAYSEDAEDKASFGPATGTPWKYSTSSDMNGSSHWGLLATYSGGGYYLDLTRSKSESAILLQDLFDKQWLDRGTRAILIDFSSYNGNINLFSVIRLLVEFPPTGGAVPSSQIYTVKLIRYVTGSDYFILACEGIFCCFILYYIVEEILELSIHKFAYFKSVWNCLDLLVIMLSVVAIIFNVYRTVTVNKLLKALLDEPNRYGNFQFLAFWQTQYNNMVAVNVFFCWIKFFKYVSFNKTMTQLSSTLARCAKDVLGFAVMFFIIFFAYAQLGYLLFGTQVEDFSTFSNCIFTQFRIILGDFDFNAIENANRVLGPLYFTTYVFVVFFVLLPKNMFLAIINDTYAEVKNELAEKENEFDVGGYFKKVYLDIRKKLGKNRGNIVDMISVLD----ASSQKINYDDWRLKLKRLGHSDEEIEAAFAKFDKDKNSVLDSNEMKLMRDELKSQKKDGSMDRVLSPCVLLNYVIFRNLDCSAKCINNLSGEINHRRYADDISTLYNVYKRLVQNVDNLEQSISTMFSKVDVIMNKVGSLAK 771          
BLAST of PKD2-1 vs. Ensembl Sea Lamprey
Match: pkd2 (polycystic kidney disease 2 [Source:NCBI gene;Acc:432387])

HSP 1 Score: 223.787 bits (569), Expect = 6.629e-63
Identity = 189/698 (27.08%), Postives = 329/698 (47.13%), Query Frame = 3
Query:  321 WSTRYTEELSSNKVVFLKTALRELVTYLVFLIFLMMVAYGTRSENLYYLTTAMSNILITS--------NFNGITAMDSFWNWINIDFVNALYWNTWYNSMTYLPLNEREFIHYENKLVGVPQIRQLRIGSNTC-QIPSFFKNSMSNCYGDYSFSNLNKSDFGISNSTAWXXXXXXXXXXXXXXXXXXXYDDGGFIQVLSRNSLETI-SILSNLQNNLWLDHGTRAVFIDLTVYNANVNLYCVIKLIFEFPPTGGIIPSSQFRTLKLIRYETGYDFFILFCXXXXXXXXXXXXXXXXXXXKKNKLSYFKKIWNVVDVLMIIMSFISIAINVYR-VLSTXXXXXXXXXXXXXXXDFTFFANWNKYFNDAVSITTFFGAVKIFKYISFNKTMNQLTDTLSNSIREXXXXXXXXXXXXXXXXXWGYLQFGSQIVDFCRFQDSVFTLFRLVLGDFNFMALVQANSFIGPXXXXXXXXXXXXXXMNMFVAIIADSYEVVKEKLMQSKDEFQITKFLK-AQFFNKFT--KNRVMKIQEVLENENIANCETLSYQDWRDKLQSRGYADVEIQALFMRYDSDGDRTLDYEERRVMLQDLKNGKISLEGHQTESNESE-------------------------LSVKK-----EDESMPVDEELFGGLVERVDSVEKNISNIVSKIDMVFLRLSEIEKAKLDHQKSIS 2282
            W+TR+TE    N+  ++K A+RE VT+ VFL  L +VAY +R    Y  T A+S +  +S         F+ +  ++  W   +      L W   +NS +    N    +  EN +V    I Q R+ +N+C  + +      + CYG YS +N NK  FG +NST W +                 Y  GG+   L  +S       L+ L++  WLD  TR + +D  + N N+ LY V++L  EFPPTGGI+ +      + +     +D   +   +  +  + Y   E           +    W  +D+ +I +  +  A  V+  +LS++ + +   +   ++   +  A W + F     +  F   +K+ ++ S  +T+      L+    +++G+ ++F  VF AFA   +L FG  + DF  F   + T  R++LGDF+F +L  A+  +GP+YF+ YVF V  ++M MF+AI++++Y   K +   S+ +FQ++  +K  +  ++ +  K RV  IQ+ L      N     +  WR  L+ +G+AD EI+A+F RYD DG   L   E+  M +DL+  K ++  H + S   +                         ++V +     +     V  E F  LV RV+ +E +I ++VSK+D V ++L  +E+ +L  +  +S
Sbjct:    3 WATRWTESPVLNRERYVKLAIREAVTFSVFLALLCVVAYSSRIPLAYEYTHAVSEMFTSSPLSNADPTTFHNLATIEQVWQVFHGYLTGPLLWAL-HNSGSRNLTNS--MVSGENLVVEPVIIWQARVHNNSCWSLSTNLGTGTTECYGPYSSANENKDPFGPANSTVWRFDSEAGVPWQGALGW---YGPGGYAVRLPADSRTAAWQELAALRDASWLDRATRLLSVDAALLNPNLRLYMVVRLSMEFPPTGGILTALSLTPGRPLGTPL-WDARAVCGLLAALLTIYYLVEEVLELRNLGPAGFLSSPWTFLDISIIALCVVGTAFGVHHGILSSSLLGEASSSRAMSFSTVSTVAEWEQNFIIVTGVIVFVAWIKVVRFGSMCRTLTMCGCALTRCAWDLLGYTLVFATVFLAFAQLAFLIFGGALPDFSSFSSCILTQVRILLGDFDFSSLEAASRIMGPIYFVSYVFCVGLIMMVMFLAIVSEAYSEEKSEQAHSQPQFQLSSVIKQVKVVDRLSCKKPRVAGIQKTLPPSGQIN-----FATWRQNLKGQGFADAEIEAVFARYDGDG--ALTRAEQLQMRRDLRLEKQTIRLHISVSPREKKKKHQVTSRDDDDDDDDGDSDEDDDITVVRRGNHHQGGGGGVSREEFRVLVRRVNQMEHSIGSVVSKMDAVMVKLEAMERQRLRRRDVLS 686          
BLAST of PKD2-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007306.1 (pep scaffold:Pmarinus_7.0:GL480012:400827:419749:1 gene:ENSPMAG00000006595.1 transcript:ENSPMAT00000007306.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 66.6254 bits (161), Expect = 1.998e-11
Identity = 66/274 (24.09%), Postives = 124/274 (45.26%), Query Frame = 3
Query:  858 YDDGGFIQVLSRNSLETISILSNLQNNLWLDHGTRAVFIDLTVYNANVNLYCVIKLIFEFPPTGGIIPSSQFRTLKLIRYE---------TGYDFFILFCXXXXXXXXXXXXXXXXXXXKKNKLSYFKKIWNVVDVLMIIMSFISIAINVYRVLSTXXXXXXXXXXXXXXXDFTFFANWNKYFNDAVSITTFFGAVKIFKYISFNKTMNQLTDTLSNSIREXXXXXXXXXXXXXXXXXWGYLQFGSQIVDFCRFQDSVFTLFRLVLGDFNFMAL 1652
            Y  GGFI  L  N  +   I++NL +  WLDH TRAV  + T YN N +L+C + L+ EF    G      +  + + R E         TG   +I+F        ++     E + + +  ++YFK  WN+ ++L I +   S+     ++    + +++   + + +V+F     W++  ++ ++   F   +K+  ++   +    L    S +   + GFAV+  +VF +F     L F   + ++  F   +  LF L+LG   +  L
Sbjct:  767 YSGGGFIAELGLNLADGTEIVANLSSASWLDHSTRAVLTEFTGYNMNTDLFCSVTLLLEFSQGAGDAHGHAY--IHVFRIESFVGKLETLTGV-VYIVFA-----ILLVIIAATEALRLSELGVAYFKSFWNIAELLSITLGAASVVTYFIKMSVATRTLEKFRTDPHKFVNFQELVTWDQQLSELLATLVFVSTIKVLGHMKSLRQFEVLVGAFSEARDHIQGFAVIVVVVFCSFGQLTSLLFAGSLRNYRTFTTCLEQLFSLLLGQPGYGEL 1032          
BLAST of PKD2-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002645.1 (pep scaffold:Pmarinus_7.0:GL476683:134:12081:-1 gene:ENSPMAG00000002415.1 transcript:ENSPMAT00000002645.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 48.9062 bits (115), Expect = 2.760e-6
Identity = 63/309 (20.39%), Postives = 131/309 (42.39%), Query Frame = 3
Query:  858 YDDGGFIQVLSRNSLETISILSNLQNNLWLDHGTRAVFIDLTVYNANVNLYCVIKLIFEFPPTGGIIPSSQFRTLKLIRYETGYDFFILFCXXXXXXXXXXXXXXXXXXXKKNKLSYFKKIWNVVDVLMIIMSFISIAINVYRVLSTXXXXXXXXXXXXXXXDFTFFANWNKYFNDA---------VSITTFFGAVKIFKYISFNKTMNQLTDTLSNSIREXXXXXXXXXXXXXXXXXWGYLQFGSQIVDFCRFQDSVFTLFRLVLGDFNFMALVQANSFIGPXXXXXXXXXXXXXXMNMFVAIIADSY 1757
            +   G+I  L     E    +S L+ N W+D  T  ++    +YNAN NL+C+++++ E        PSS  +  +L      Y        I  +   +Y+       I K K  Y KK  NV +++ I +  + +   V R                ++++F F  N+   ++           + +  F   ++I     +N TM++     ++   ++  F+++FF++  +++   +   G+++  +  F  SV +LF  + G   F  L  A  ++  + +  ++     +L+NM V +I + Y
Sbjct:    6 FIGSGYIADLGLTFAEASGNMSYLEQNSWVDARTTGLYAQFIIYNANANLFCLVEVLVESLSADMFQPSSNLKVFRLFNNRISYIILDNVAYIFYLIISMYFLTCVIFSITKEKFEYLKKPMNVAEIMNITLMIMKLIKQVSR-----------SPALGSHLNFFFLINYCTLYSHKPLILLSTQFLGLVLFLATLRILPLFRYNTTMSEAVTLAAHCAHKLCSFSLIFFVLLISYSLIFWNVLGTRVGAYRSFGKSVGSLFAALHGAPVFGDLYAAGGYMAALLYFSFMLLFTVLLLNMMVVVIEEVY 303          
BLAST of PKD2-1 vs. Ensembl Nematostella
Match: EDO47023 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RN85])

HSP 1 Score: 486.108 bits (1250), Expect = 2.901e-159
Identity = 295/733 (40.25%), Postives = 447/733 (60.98%), Query Frame = 3
Query:  282 ACGKKFLRVIRRAWSTRYTEELSSNKVVFLKTALRELVTYLVFLIFLMMVAYGTRSENLYYLTTAMSNILITSN------FNGITAMDSFWNWINIDFVNALYWNTWYNSMTYL-PLNEREFIHYENKLVGVPQIRQLRIGSNTCQIPSFFKNSMSNCYGDYSFSNLNKSDFGISNSTAWXXXXXXXXXXXXXXXXXXXYDDGGFIQVLSRNSLETISILSNLQNNLWLDHGTRAVFIDLTVYNANVNLYCVIKLIFEFPPTGGIIPSSQFRTLKLIRYETGYDFFILFCXXXXXXXXXXXXXXXXXXXKKNKLSYFKKIWNVVDVLMIIMSFISIAINVYRVLSTXXXXXXXXXXXXXXXDFTFFANWNKYFNDAVSITTFFGAVKIFKYISFNKTMNQLTDTLSNSIREXXXXXXXXXXXXXXXXXWGYLQFGSQIVDFCRFQDSVFTLFRLVLGDFNFMALVQANSFIGPXXXXXXXXXXXXXXMNMFVAIIADSYEVVKEKLMQSKDEFQITKFLKAQFFN-----KFTKNRVMKIQEVLENENIANCETLSYQDWRDKLQSRGYADVEIQALFMRYDSDGDRTLDYEERRVMLQDLKNGKISLEGHQTESNESELSVKKEDESMP---------------------------------------------VDEELFGGLVERVDSVEKNISNIVSKIDMVFLRLSEIEKAKLDHQKSISCSLSILTGS 2309
             C  +F R+IR  W TR TE+  S++ + +KT LREL+ YLVF+  L ++ +G  S  +YY T  M ++ + S+      F  IT M+ FW +      + LYW  +YN+     P ++  FI++ENK++G P+ RQLR+ +++C +   FK+ +  CY  YS +  + + FG  N +AW+Y         S+     TY  GGF Q+L+    ET  I+ +L+ NLWLD GTRAVFID TVYNAN+NL+C+++L+FE+PPTGG IPS  FRT+KLIRY   +D F++ CE + I ++IYY IEE +EIKK+K+ YFK  WNV+DV++I++ ++++  N+YR ++   ++  L+ + + Y +F     W   FN+ V++  FF  +K+FKYISFNKTM QL+ TLS   +++ GFA+MFFI+FFA+A  GYL FG+Q+ DF  F+DS+FTLFR++LGDF+F  +  AN  +GP++F+ YVFFVFFVL+NMF+AII D+Y  VK  +   + EF+IT + K  + N      F + +++ IQ+ L++ ++     L +++WR  L+SRG+AD EI+A+F +YD DGDR LD +E+R M +D       LEG + E N+    ++++ ES P                                             V  E F  L  RVD +E +I +IVSKID V ++L  +EKAKL  +++++  L  +T S
Sbjct:   83 GCWTRFKRIIRGLWRTRQTEDTDSDREMHIKTTLRELIIYLVFITILCILTFGMTSSTMYYFTKVMRDLFVESSMSNRNTFKDITTMNEFWMYTTETLSDGLYWEQYYNNQNVTKPKDDLGFIYFENKILGRPRFRQLRVLNDSCTVHDDFKSVIKECYAAYSPNVEDMNTFGKMNGSAWTYQTEKDLQGRSYWGRMTTYSGGGFTQLLAPTKAETQQIIEDLKQNLWLDRGTRAVFIDFTVYNANINLFCIVRLVFEYPPTGGCIPSFNFRTVKLIRYVDTFDHFVMACEGIFILFIIYYTIEEGLEIKKHKMKYFKSFWNVLDVVVIMLGYVAVVFNLYRTMAVGDLLSSLLEDGSQYANFDSLGFWQTQFNNMVAVAVFFAWIKVFKYISFNKTMTQLSSTLSKCAKDVAGFAIMFFIIFFAYAQLGYLIFGTQVRDFSTFEDSIFTLFRIILGDFDFHQIENANRVLGPLFFMTYVFFVFFVLLNMFLAIINDTYAEVKSDIASQESEFEITDYFKKGYQNMLNKLSFKREKILDIQKALKSADVNQDNKLDFEEWRANLKSRGHADAEIEAVFAKYDLDGDRILDEDEQRRMQED-------LEGQKAELNDEIEEMERQKESRPKSASRMSFRGSDADSDDDDDDSQGGLSGRVGSAAGHRRGGGGGGGVSYEEFNVLSRRVDRMEHSIGSIVSKIDAVLVKLEAMEKAKLKRRETMAKLLDSITES 808          
BLAST of PKD2-1 vs. Ensembl Nematostella
Match: EDO49200 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RHB8])

HSP 1 Score: 177.563 bits (449), Expect = 6.018e-46
Identity = 160/585 (27.35%), Postives = 285/585 (48.72%), Query Frame = 3
Query:  150 PVDVDNSDTVYEIKDFDNYSGEKSNSEQNLSSSADLFLLEDDNHACGKKFLRVIRRAWSTRYTEELSSNKVVFLKTALRELVTYLVFLIFLMMVAYGTRSENLYYLTTAMSNILITSNFNGITA--------------MDSFWNWINIDFVNALYWNTWYNSMTYLPLNEREFIHYE-NKLVGVPQIRQLRIGSNTCQIPSFFKNSMSNCYGDYSFSNLNKSDFGIS----NSTAWXXXXXXXXXXXXXX------XXXXXYDDGGFIQVLSRNSLETISILSNLQNNLWLDHGTRAVFIDLTVYNANVNLYCVIKLIFEFPPTGGIIPSSQFRTLKLIRYETGYDFFILFCXXXXXXXXXXXXXXXXXXXKKNKLSYFKKIWNVVDVLMIIMSFISIAINVYRVLSTXXXXXXXXXXXXXXXDFTFFANWNKYFNDAVSITTFFGAVKIFKYISFNKTMNQLTDTLSNSIREXXXXXXXXXXXXXXXXXWGYLQFGSQIVDFCRFQDSVFTLFRLVLGDFNFMALVQANSFIGPXXXXXXXXXXXXXXMNMFVAIIADSYEVVKEKLMQSKDEFQITKFLKAQF 1829
            PVDVD  +T  E+K+   +  EKS  +  L    D    E+D    G      +  A   R  E       + +   L+E++ Y +F+  L++VAYG R  N Y L   +    ++ + +G++                DS W+W     +  LY    YN     P     ++    N LVG+ ++R  R+ + +C IP         CYG++S+SN +  D+ +     N +A        + +  FS           Y  GG+   L  +    ++++++L ++ W++  TR VFI+  +YNAN NL+ V  L  EF PTGG  P  +F+  +L  Y   +  F+L  E++++ ++ Y+   E   + K K  YFK  WN ++V MI++ F+ + +   R+   +K   +L +N  ++V F +    ++  N  + I  FF  ++  K + FN+ M  L +T++   + +  F + F +VF +FA +G + FG  +  F  F  ++ T   + LGDF+++ + + N  +G +YF  +++F+   LMNMF+AII DS+  VK      K+E+++ +F+  +F
Sbjct:  551 PVDVDEEET--ELKEVPKHMREKS-VQDLLREMED----EEDEIKKGPPDALHLLAARQKRLKE-------IQMSMILKEILAYFIFIAVLLLVAYGNRDPNAYLLRKTLVEEFVSLDESGVSLDEVQWKNGTIIVGDGDSLWHWARETLIKNLYPGNLYNGK---PDKYTGYLEDRVNYLVGISRLRLERVKNGSCTIPKEMDRFFDECYGEFSYSNSDSDDYEVEWMFLNKSAAPSARKRRSIAEQFSFGFPYWGKMNFYSGGGYPADLGYDYPTALTVVADLHSHNWVNSNTRGVFIEFAIYNANTNLFGVAFLYVEFLPTGGAFPHGEFKVARLYSYVGPFANFVLAMEVIMLLFMFYFVYREVKSMYKLKKKYFKGFWNWLEVAMIVLEFLMLGLFFARMWEVDKNFIELHHNPKDFVSFQYALASDETLNYVIGILVFFVTIRFIKLLRFNRRMALLGNTIALIAKPIGQFLISFTLVFISFAFFGNMIFGIGLDKFRSFTTTMMTQLNICLGDFDYLEMEEENRMLGRIYFFSFMYFIVMYLMNMFLAIINDSFSEVKTSNDDLKNEYEMVEFILDRF 1118          
BLAST of PKD2-1 vs. Ensembl Nematostella
Match: EDO40051 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S8E5])

HSP 1 Score: 165.236 bits (417), Expect = 8.340e-44
Identity = 141/501 (28.14%), Postives = 249/501 (49.70%), Query Frame = 3
Query:  369 LKTALRELVTYLVFLIFLMMVAYGTRSENLYYLTTAMSNILITSNFNGITAMDS------FWNWINIDFVNALYWNTWYN----SMTYLPLNEREFIHYENKLVGVPQIRQLRIGSNTCQIPSFFKNSMSNCYGDYSFSNLNKSDFGISN----STAWXXXXXXXXXXXXXXXXXXXYDDGGFIQVL----SRNSLETISILSNLQNNLWLDHGTRAVFIDLTVYNANVNLYCVIKLIFEFPPTGGIIPSSQFRTLKLIRYETGYDFFILFCXXXXXXXXXXXXXXXXXXXKKNKLSYFKKIWNVVDVLMIIMSFISIAINVYRVLSTXXXXXXXXXXXXXXXDFTFFANWNKYFNDAVSITTFFGAVKIFKYISFNKTMNQLTDTLSNSIREXXXXXXXXXXXXXXXXXWGYLQFGSQIVDFCRFQDSVFTLFRLVLGDFNFMALVQANSFIGPXXXXXXXXXXXXXXMNMFVAIIADSYEVVKEKLMQSKDEFQITKFL 1817
            + + +RE+V YL+FL  ++ ++YG R      +T  + N+ + +++NG T  D       +W W+    + +++   WYN     + YL      ++      + V ++RQLR+  +TC +    ++ + +C  D+  S+  +    +       TAW Y       +  +    ATY  GG++QV     ++N  +  ++   L  N WLD  TRAVF + ++YNAN NL+CV+ L+ E  PTGGI       TL+L RY  G  FF+  CEI+ + +  Y+   E  +  K  L   K  W+++++ +  +S   + +   R+  T +VVK + N+   +V   + A  +++    + +  FF  +KI + + FN+ M+ L  TL   I ++  F +++ I FFA+A    L FG     F     S  TL   +LG F    +   N  IGP +F  Y   + F+L+NMF++II DS+  V   + +  ++++I  F+
Sbjct:    5 MASIMREIVWYLIFLFIVLSISYGNRDPYTQLVTNNVENVFLQASYNGSTKFDEIGSTRDYWPWLKDTVIPSIFIEKWYNDQDYHLGYLADTPTAWV------LAVARLRQLRMQKHTCPLLPALQHVIPSC-NDFYSSDEEERGMLLPGWKEPKTAWQYQTGEELKTFPYWGQKATYSAGGYVQVFPPSTAKNYDKAQALADALNENDWLDKYTRAVFTEFSIYNANSNLFCVVTLLIEQLPTGGIFKFPSILTLRLYRYVGGEMFFVAACEIIYLLFTAYFIFREIKQAYKLGLDKLKNPWSILEIFVTCLSLSMVVLYFLRIKFTAEVVKDMRNDPTRFVSLHYTAFLDEWIKCLMGLIVFFSFIKIVRLLRFNRRMSLLAQTLKLCIPKIGAFVIVYGIAFFAYAQLACLVFGQNAEGFMTIPRSAATLMDTLLGKFTLKEMSDINRLIGPTFFYIYTLSMIFILINMFMSIINDSFAEVNSDVSKQANDYEIVDFM 498          
BLAST of PKD2-1 vs. Ensembl Nematostella
Match: EDO44744 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RUR6])

HSP 1 Score: 164.081 bits (414), Expect = 1.295e-41
Identity = 147/584 (25.17%), Postives = 283/584 (48.46%), Query Frame = 3
Query:  165 NSDTVYEIKDFDNYSGEKSNSEQNLSSSADLFLLEDDNHACGKKFLRVIRRAWSTRYTEELSSNKVVFLKTALRELVTYLVFLIFLMMVAYGTRSENLYYLTTAMSNILITSNFNG-----------------ITAMDSFWNWINIDFVNALYWNTWYNSMTYLPLNEREFIHYENKLVGVPQIRQLRIGSNTCQIPSFFKNSMSNCYGDYSFSNLNKSDF-------GISNST----AWXXXXXXXXXXXXXXXXXXXYDDGGFIQVLSRNSLETISILSNLQNNLWLDHGTRAVFIDLTVYNANVNLYCVIKLIFEFPPTGGIIPSSQFRTLKLIRYETGYDFFILFCXXXXXXXXXXXXXXXXXXXKKNKLSY-FKKIWNVVDVLMIIMSFISIAINVYRVLSTXXXXXXXXXXXXXXXDFTFFANWNKYFNDAVSITTFFGAVKIFKYISFNKTMNQLTDTLSNSIREXXXXXXXXXXXXXXXXXWGYLQFGSQIVDFCRFQDSVFTLFRLVLGDFNFMALVQANSFIGPXXXXXXXXXXXXXXMNMFVAIIADSYEVVKEKLMQSKDEFQITKFLKAQF 1829
            NS+   + +  + + G++      +S+    +L  D +          ++RA   R+ E         +   ++E++ Y +F+  +++VAYG R  N + +   + ++     F+G                 ++ + SFWNW     +  LY  +WYN  +  P        + + ++G  ++RQLR+ +  C++   +   ++ C G YS+   + +           SN +    AW Y   +   S  +    A Y  GG+   L +   + +++L+ L+ + W+D  TRA+F++ TVY+   NL+CV  L+ E  P+GG  P S+    ++ RY   +  F+L CEI+ + + +Y+  ++  EI +  ++Y F + W+ V++++   S+ SI +   R       V     + + +V+F   A  ++ F    +   FF ++K  +   FNK M+ L  TL  S +E+  F+++F +VF AF  + YL F +++  F     +V TL  ++LG F++  L+Q N  + P  F  Y   V F+L+NMF++II ++++ VK +     +E++I  F+  QF
Sbjct:  555 NSELAKDRQWLEEHVGQRDKRRNAISNDKPKYLPPDPS---------ALQRARLQRFKERK-------MFEVIQEILFYALFVWVVLVVAYGHRDPNAHVMNQGLEDV-----FSGRAKHDHSVPDGHSLLFQVSDITSFWNWTEAVLIPGLYSESWYNGRSDKP---GFLADHTSWMLGTARMRQLRVKAGDCKVHDVYSGYLAQCNGPYSWDTEDTTPVFRPGWRPAPSNYSTAQNAWKYRDSSELRSLPYLGKLALYSGGGYAFDLGKKE-KAMAMLAQLKRDKWVDRSTRAIFVEFTVYSPYTNLHCVGYLLLEVLPSGGTSPFSELLVTRIDRYAGNFMIFVLLCEILFVLFTVYFTYKQGKEIAREGVAYHFHEYWSWVELVLSGCSWTSIVLYFVRFGINKSTVLTYHKDTSVFVNFHALAASDQVFGYVYAFVAFFVSLKFLRLFRFNKRMSLLATTLKCSAKELAHFSIVFGLVFMAFVHFCYLIFSTELYIFHTVLSTVETLISVMLGKFSYERLLQTNRLLAPFMFFFYSIVVVFILINMFISIIIENFQRVKSQNDLQSNEYEIVDFMTEQF 1113          
BLAST of PKD2-1 vs. Ensembl Nematostella
Match: EDO44884 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RUD7])

HSP 1 Score: 150.599 bits (379), Expect = 2.304e-37
Identity = 142/506 (28.06%), Postives = 237/506 (46.84%), Query Frame = 3
Query:  369 LKTALRELVTYLVFLIFLMMVAYGTRSENLYYLTTAMSNIL------------ITSNFNGITAMDSFWNWINIDFVNALYWNTWYNSMTYLPLNEREFIHYENKLVGVPQIRQLRIGSNTCQIPSFFKNSMSNCYGDYSFSN------------LNKSDFGISNSTAWXXXXXXXXXXXXXXXXXXXYDDGGFIQVLSRNSLETISILSNLQNNLWLDHGTRAVFIDLTVYNANVNLYCVIKLIFEFPPTGGIIPSSQFRTLKLIRYETGYDFFILFCXXXXXXXXXXXXXXXXXXXKKNKLSYFKKIWNVVDVLMIIMSFISIAINVYRVLSTXXXXXXXXXXXXXXXDFTFFANWNKYFNDAVSITTFFGAVKIFKYISFNKTMNQLTDTLSNSIREXXXXXXXXXXXXXXXXXWGYLQFGSQIVDFCRFQDSVFTLFRLVLGDFNFMALVQANSFIGPXXXXXXXXXXXXXXMNMFVAIIADSYEVVKEKLMQSKDEFQITKF 1814
            +   L ++ TYL FL  L+++A+       Y+ + ++S++L            +T  F  I+     W W N   + ALY   WY      P   R        +VG  + RQLR   +TC I    +  + +C   YS S              N SD   S ST WS+   +      +    +TY  GG+I   S    + +  + + +NN W+D  T  +F + T+YN   NL+    ++ E  PTGG     +F T +L      +  F L C++V + +  Y+   E  ++ K+K SYF+  WN  +++++++++I++A     +      +K    N N+Y +F + + W   F   + I  F   +K  K + FNK M  L  TLS S +++  + +MF IVF +FA + YL  GS    F  F  S+  L  ++LG F+F   +     +G   F  Y+    F+L+NMF+AII +S+  VK     +++EF+I +F
Sbjct:  548 MSVILTDIGTYLTFLWVLLVIAHSRVDSAAYWQSRSISDVLMKTTYESPPESGLTKTFQKISNDSEIWLWTNHVLLPALYNLDWYYYTKTAPKLVRG---GAGLVVGFARWRQLRKKKDTCLITGVMRGVIHHCTDPYSMSTQDETNYNSRWRPFNTSDVPPSPSTIWSFNSASKLNGYPYFGEISTYSGGGYIVPFSSIYYKAVKEIKHARNNSWIDRYTAGLFTEFTLYNPYSNLFTASTVLVEVLPTGGFHVRPEFFTFRLYSLVGDFHIFTLVCDVVFLLFTSYFTFRELKKLYKDKCSYFRDYWNWAEIVIMVLAWIAVADYFICLGIRKWTLKLHQENPNDYTNFQYISAWQMSFESILGILVFISTIKFIKLLRFNKKMFLLAYTLSRSAKDLAHYGIMFLIVFLSFAQFYYLLLGSDYDSFSTFVKSIEKLINVLLGRFSFEEFLIPFRIMGAFGFFLYMTLTNFLLLNMFIAIIVESFTEVKLSPELARNEFEIMEF 1050          
BLAST of PKD2-1 vs. Ensembl Medaka
Match: pkd2l1 (polycystin 2 like 1, transient receptor potential cation channel [Source:NCBI gene;Acc:100820724])

HSP 1 Score: 411.379 bits (1056), Expect = 2.593e-131
Identity = 268/673 (39.82%), Postives = 420/673 (62.41%), Query Frame = 3
Query:  309 IRRAWSTRYTEELSSNKVVFLKTALRELVTYLVFLIFLMMVAYGTRSENLYYLTTAMSNILITSN------FNGITAMDSFWNWINIDFVNALYWNTWYNSMTYLPLNEREFIHYENKLVGVPQIRQLRIGSNTCQIPSFFKNSMSNCYGDYSFSNLNKSDFGISNSTAWXXXXXXXXXXXXXXXXXXXYDDGGFIQVLSRNSLETISILSNLQNNLWLDHGTRAVFIDLTVYNANVNLYCVIKLIFEFPPTGGIIPSSQFRTLKLIRYETGYDFFILFCXXXXXXXXXXXXXXXXXXXKKNKLSYFKKIWNVVDVLMIIMSFISIAINVYRVLSTXXXXXXXXXXXXXXXDFTFFANWNKYFNDAVSITTFFGAVKIFKYISFNKTMNQLTDTLSNSIREXXXXXXXXXXXXXXXXXWGYLQFGSQIVDFCRFQDSVFTLFRLVLGDFNFMALVQANSFIGPXXXXXXXXXXXXXXMNMFVAIIADSYEVVKEKLMQSKDEFQITKFLKAQFFNKFT-----KNRVMKIQEVLENENIANCETLSYQDWRDKLQSRGYADVEIQALFMRYDSDGDRTLDYEERRVMLQDLKNGKISL--------EGHQTESNESELSVKKEDESMP----VDEELFGGLVERVDSVEKNISNIVSKIDMVFLRLSEIEKAK 2258
            I+  W T  TE +S+N+  +++T LREL+ YL+FL+ + ++ YG  S + YY T AM+++ + S       F  I  M  FW++     ++ LYW  WYN  + L    + FI+YEN L+GVP++RQ+++ +N+C++   FK+ +  CY  Y     +  +FG+ N TAW+Y        SS     +TY   G+ Q L R    +  ILS L +N WL  GTR VFID + YNAN+N++CVI L+ EFP TGG +PS Q RT+KL+RY T +D+FIL CE V   +++YY +EE +E++ ++ SY K +WN++D+++I+++ ++IA NV+R +  + ++ +L+ N N Y DF F A W   +N+  ++  FF  +KIFKYISFNKTM QL+ TL    ++++GFAVMFFIVFFA+A  GYL FG+++  F  F   +FT FR++LGDFNF A+ QAN  +GP+YF+ YVFFVFFVL+NMF+AII D+Y  VKE+L   KDE QIT  +K  +   FT     K+++  +Q+ L+    A    + ++D++  L   G+ D EI A F ++D DG++ LD EE+  M ++L+  + +L        + ++ E  E+E     E  S+     VD++ F  L  +V  V++++++I S+++++  ++   EKAK
Sbjct:   86 IKGLWGTALTENVSNNREKYIRTTLRELLVYLLFLLDICLLTYGMTSSSTYYFTKAMTDLFVNSGGDAGVAFQSIGTMADFWSFAQGPLLDGLYWTKWYNQQS-LNNGNQSFIYYENMLLGVPRMRQIKMKNNSCKVHQDFKDEIFGCYDVYDEKKEDDLNFGLINGTAWTYHTEKEMRGSSHWGLLSTYSGAGYYQDLDRTRERSAEILSTLMDNCWLGRGTRVVFIDFSAYNANINMFCVISLMVEFPATGGAVPSYQIRTVKLLRYVTRWDYFILGCEAVFCVFILYYMVEEVLELRIHRFSYLKSVWNILDIVVILLALVAIAFNVFRTIKVDNLLGKLLENPNIYADFEFLAFWQTQYNNMNAVNLFFAWIKIFKYISFNKTMTQLSTTLGRCAKDILGFAVMFFIVFFAYAQLGYLLFGTEVDTFSTFVKCIFTQFRIILGDFNFDAIDQANRVLGPIYFVTYVFFVFFVLLNMFLAIINDTYSEVKEELTSQKDELQITDIIKQSYMKTFTRLKLKKDKITDVQKALQ----AGSGEIQFKDFKQTLIEMGHTDGEISAAFSKFDRDGNQVLDAEEQERMKRELQEKRDALSTELNHLGKNYEKEPVETESFPPHEQRSVSNQTFVDQQQFQSLARQVLQVQRSVADITSRMELILAQMGLQEKAK 753          
BLAST of PKD2-1 vs. Ensembl Medaka
Match: pkd2l1 (polycystin 2 like 1, transient receptor potential cation channel [Source:NCBI gene;Acc:100820724])

HSP 1 Score: 410.223 bits (1053), Expect = 1.784e-129
Identity = 268/673 (39.82%), Postives = 420/673 (62.41%), Query Frame = 3
Query:  309 IRRAWSTRYTEELSSNKVVFLKTALRELVTYLVFLIFLMMVAYGTRSENLYYLTTAMSNILITSN------FNGITAMDSFWNWINIDFVNALYWNTWYNSMTYLPLNEREFIHYENKLVGVPQIRQLRIGSNTCQIPSFFKNSMSNCYGDYSFSNLNKSDFGISNSTAWXXXXXXXXXXXXXXXXXXXYDDGGFIQVLSRNSLETISILSNLQNNLWLDHGTRAVFIDLTVYNANVNLYCVIKLIFEFPPTGGIIPSSQFRTLKLIRYETGYDFFILFCXXXXXXXXXXXXXXXXXXXKKNKLSYFKKIWNVVDVLMIIMSFISIAINVYRVLSTXXXXXXXXXXXXXXXDFTFFANWNKYFNDAVSITTFFGAVKIFKYISFNKTMNQLTDTLSNSIREXXXXXXXXXXXXXXXXXWGYLQFGSQIVDFCRFQDSVFTLFRLVLGDFNFMALVQANSFIGPXXXXXXXXXXXXXXMNMFVAIIADSYEVVKEKLMQSKDEFQITKFLKAQFFNKFT-----KNRVMKIQEVLENENIANCETLSYQDWRDKLQSRGYADVEIQALFMRYDSDGDRTLDYEERRVMLQDLKNGKISL--------EGHQTESNESELSVKKEDESMP----VDEELFGGLVERVDSVEKNISNIVSKIDMVFLRLSEIEKAK 2258
            I+  W T  TE +S+N+  +++T LREL+ YL+FL+ + ++ YG  S + YY T AM+++ + S       F  I  M  FW++     ++ LYW  WYN  + L    + FI+YEN L+GVP++RQ+++ +N+C++   FK+ +  CY  Y     +  +FG+ N TAW+Y        SS     +TY   G+ Q L R    +  ILS L +N WL  GTR VFID + YNAN+N++CVI L+ EFP TGG +PS Q RT+KL+RY T +D+FIL CE V   +++YY +EE +E++ ++ SY K +WN++D+++I+++ ++IA NV+R +  + ++ +L+ N N Y DF F A W   +N+  ++  FF  +KIFKYISFNKTM QL+ TL    ++++GFAVMFFIVFFA+A  GYL FG+++  F  F   +FT FR++LGDFNF A+ QAN  +GP+YF+ YVFFVFFVL+NMF+AII D+Y  VKE+L   KDE QIT  +K  +   FT     K+++  +Q+ L+    A    + ++D++  L   G+ D EI A F ++D DG++ LD EE+  M ++L+  + +L        + ++ E  E+E     E  S+     VD++ F  L  +V  V++++++I S+++++  ++   EKAK
Sbjct:   86 IKGLWGTALTENVSNNREKYIRTTLRELLVYLLFLLDICLLTYGMTSSSTYYFTKAMTDLFVNSGGDAGVAFQSIGTMADFWSFAQGPLLDGLYWTKWYNQQS-LNNGNQSFIYYENMLLGVPRMRQIKMKNNSCKVHQDFKDEIFGCYDVYDEKKEDDLNFGLINGTAWTYHTEKEMRGSSHWGLLSTYSGAGYYQDLDRTRERSAEILSTLMDNCWLGRGTRVVFIDFSAYNANINMFCVISLMVEFPATGGAVPSYQIRTVKLLRYVTRWDYFILGCEAVFCVFILYYMVEEVLELRIHRFSYLKSVWNILDIVVILLALVAIAFNVFRTIKVDNLLGKLLENPNIYADFEFLAFWQTQYNNMNAVNLFFAWIKIFKYISFNKTMTQLSTTLGRCAKDILGFAVMFFIVFFAYAQLGYLLFGTEVDTFSTFVKCIFTQFRIILGDFNFDAIDQANRVLGPIYFVTYVFFVFFVLLNMFLAIINDTYSEVKEELTSQKDELQITDIIKQSYMKTFTRLKLKKDKITDVQKALQ----AGSGEIQFKDFKQTLIEMGHTDGEISAAFSKFDRDGNQVLDAEEQERMKRELQEKRDALSTELNHLGKNYEKEPVETESFPPHEQRSVSNQTFVDQQQFQSLARQVLQVQRSVADITSRMELILAQMGLQEKAK 753          
BLAST of PKD2-1 vs. Ensembl Medaka
Match: pkd2 (polycystin 2, transient receptor potential cation channel [Source:NCBI gene;Acc:100192346])

HSP 1 Score: 409.068 bits (1050), Expect = 2.725e-129
Identity = 267/705 (37.87%), Postives = 417/705 (59.15%), Query Frame = 3
Query:  267 EDDNH---ACGKKFLRVIRRAWSTRYTEELSSNKVVFLKTALRELVTYLVFLIFLMMVAYGTRSENLYYLTTAMSNILITS--------NFNGITAMDSFWNWINIDFVNALYWNTWYNSMTYLPLNEREFIHYENKLVGVPQIRQLRIGSNTCQIPSFFKNSMSNCYGDYSFSNLNKSDFGISNSTAWXXXXXXXXXXXXXXXXXXXYDDGGFIQVLSRNSLETISILSNLQNNLWLDHGTRAVFIDLTVYNANVNLYCVIKLIFEFPPTGGIIPSSQFRTLKLIRYETGYDFFILFCXXXXXXXXXXXXXXXXXXXKKNKLSYFKKIWNVVDVLMIIMSFISIAINVYRVLSTXXXXXXXXXXXXXXXDFTFFANWNKYFNDAVSITTFFGAVKIFKYISFNKTMNQLTDTLSNSIREXXXXXXXXXXXXXXXXXWGYLQFGSQIVDFCRFQDSVFTLFRLVLGDFNFMALVQANSFIGPXXXXXXXXXXXXXXMNMFVAIIADSYEVVKEKLMQSKDEFQITKFLKAQFFNKFTKNRVMK--IQEVLENENIANCETLSYQDWRDKLQSRGYADVEIQALFMRYDSDGDRTLDYEERRVMLQDLKNGKISLEGHQTESNESELSVKKEDESMPVDE---------------------------ELFGGLVERVDSVEKNISNIVSKIDMVFLRLSEIEKAKL 2261
            + D H    C K+  + IR  W T   E+  SN+  +L   LREL+TY+ FLI + ++ YG  S N+YY T AMS + + +         F  ++ M+ FW +    F+  +YW  WYN+ + LP N+  FI+YEN L+GVP++RQ+R+ + TC I    ++ +  CYG Y+ SN + S FG  N TAW +T  +   +S+     + Y  GG+ Q LSR   E+   L  L+++LWLD GTRA+F+D +VYN NVNL C+ +L+ EFP TGG++ S QF+T++LI+Y + +D+F+  CE+    +V+YY +EE +EI  ++L YFK +WN +DVL++ +S ++I +++ R  +    + + + N  ++  F   AN    FN+  ++  FF  VK+FK+I+FNKTM+QL+ T+S   ++++GFA+MFFI+F A+A   YL FG+Q+ DF  FQ SVFT FR++LGDF+F  + +AN  +GP+YF+ +V F+FF+LMNMF+AII D+Y  VK  + Q + E ++T F+K        K R+ K  + ++ ++   A  + L+Y +    L+ +G+ + EIQA+F +YD DGD  L   + + M  DL+  +  L+    E N   L+      S P  +                           E F  LV RVD +E +I +IVSKID V ++L  +E+AKL
Sbjct:  122 QQDRHEHPGCMKRIFQNIRILWGTELMEDGDSNRERYLWNVLRELLTYIAFLITICILTYGMISTNMYYYTKAMSQLFLDAPLSSENPKTFRSLSTMEDFWKYTQGPFLGGMYWEVWYNNQS-LPGNQ-SFIYYENILLGVPRLRQVRVHNETCSIHEDLRDEVQGCYGVYTPSNEDNSPFGPQNGTAWVHTTESKMNASTHWGQVSKYGGGGYYQDLSRTREESGLQLQFLKDHLWLDRGTRAIFLDFSVYNGNVNLVCIARLLVEFPATGGVLTSWQFQTVRLIKYVSSWDYFVGVCEVAFCLFVLYYVVEEVLEIHIHRLHYFKNLWNCLDVLIVTLSVVAIIMSITRA-AMGGDLLKGLENYTSHTSFDSLANLQVQFNNMAAVIVFFCWVKLFKFINFNKTMSQLSTTMSRCAKDLVGFAIMFFIIFLAYAQLAYLVFGTQVNDFSTFQGSVFTQFRIILGDFDFFEIKEANPVLGPIYFITFVLFIFFILMNMFLAIINDTYSEVKADMAQHRSEMEMTDFIKKGCTKALVKLRLKKTTVDDISDSLRQAGGK-LNYDELLQDLKEKGHTEAEIQAIFAKYDQDGDLELTEHDHQQMRDDLEKEREDLD---LERN--SLTRPSSGRSFPRTQDDSEEDDDEDSGHSSRRRGSSSGGVSYEEFQVLVRRVDRMEHSIGSIVSKIDAVIVKLEGMERAKL 817          
BLAST of PKD2-1 vs. Ensembl Medaka
Match: pkd2 (polycystin 2, transient receptor potential cation channel [Source:NCBI gene;Acc:100192346])

HSP 1 Score: 408.683 bits (1049), Expect = 8.681e-129
Identity = 267/705 (37.87%), Postives = 417/705 (59.15%), Query Frame = 3
Query:  267 EDDNH---ACGKKFLRVIRRAWSTRYTEELSSNKVVFLKTALRELVTYLVFLIFLMMVAYGTRSENLYYLTTAMSNILITS--------NFNGITAMDSFWNWINIDFVNALYWNTWYNSMTYLPLNEREFIHYENKLVGVPQIRQLRIGSNTCQIPSFFKNSMSNCYGDYSFSNLNKSDFGISNSTAWXXXXXXXXXXXXXXXXXXXYDDGGFIQVLSRNSLETISILSNLQNNLWLDHGTRAVFIDLTVYNANVNLYCVIKLIFEFPPTGGIIPSSQFRTLKLIRYETGYDFFILFCXXXXXXXXXXXXXXXXXXXKKNKLSYFKKIWNVVDVLMIIMSFISIAINVYRVLSTXXXXXXXXXXXXXXXDFTFFANWNKYFNDAVSITTFFGAVKIFKYISFNKTMNQLTDTLSNSIREXXXXXXXXXXXXXXXXXWGYLQFGSQIVDFCRFQDSVFTLFRLVLGDFNFMALVQANSFIGPXXXXXXXXXXXXXXMNMFVAIIADSYEVVKEKLMQSKDEFQITKFLKAQFFNKFTKNRVMK--IQEVLENENIANCETLSYQDWRDKLQSRGYADVEIQALFMRYDSDGDRTLDYEERRVMLQDLKNGKISLEGHQTESNESELSVKKEDESMPVDE---------------------------ELFGGLVERVDSVEKNISNIVSKIDMVFLRLSEIEKAKL 2261
            + D H    C K+  + IR  W T   E+  SN+  +L   LREL+TY+ FLI + ++ YG  S N+YY T AMS + + +         F  ++ M+ FW +    F+  +YW  WYN+ + LP N+  FI+YEN L+GVP++RQ+R+ + TC I    ++ +  CYG Y+ SN + S FG  N TAW +T  +   +S+     + Y  GG+ Q LSR   E+   L  L+++LWLD GTRA+F+D +VYN NVNL C+ +L+ EFP TGG++ S QF+T++LI+Y + +D+F+  CE+    +V+YY +EE +EI  ++L YFK +WN +DVL++ +S ++I +++ R  +    + + + N  ++  F   AN    FN+  ++  FF  VK+FK+I+FNKTM+QL+ T+S   ++++GFA+MFFI+F A+A   YL FG+Q+ DF  FQ SVFT FR++LGDF+F  + +AN  +GP+YF+ +V F+FF+LMNMF+AII D+Y  VK  + Q + E ++T F+K        K R+ K  + ++ ++   A  + L+Y +    L+ +G+ + EIQA+F +YD DGD  L   + + M  DL+  +  L+    E N   L+      S P  +                           E F  LV RVD +E +I +IVSKID V ++L  +E+AKL
Sbjct:  122 QQDRHEHPGCMKRIFQNIRILWGTELMEDGDSNRERYLWNVLRELLTYIAFLITICILTYGMISTNMYYYTKAMSQLFLDAPLSSENPKTFRSLSTMEDFWKYTQGPFLGGMYWEVWYNNQS-LPGNQ-SFIYYENILLGVPRLRQVRVHNETCSIHEDLRDEVQGCYGVYTPSNEDNSPFGPQNGTAWVHTTESKMNASTHWGQVSKYGGGGYYQDLSRTREESGLQLQFLKDHLWLDRGTRAIFLDFSVYNGNVNLVCIARLLVEFPATGGVLTSWQFQTVRLIKYVSSWDYFVGVCEVAFCLFVLYYVVEEVLEIHIHRLHYFKNLWNCLDVLIVTLSVVAIIMSITRA-AMGGDLLKGLENYTSHTSFDSLANLQVQFNNMAAVIVFFCWVKLFKFINFNKTMSQLSTTMSRCAKDLVGFAIMFFIIFLAYAQLAYLVFGTQVNDFSTFQGSVFTQFRIILGDFDFFEIKEANPVLGPIYFITFVLFIFFILMNMFLAIINDTYSEVKADMAQHRSEMEMTDFIKKGCTKALVKLRLKKTTVDDISDSLRQAGGK-LNYDELLQDLKEKGHTEAEIQAIFAKYDQDGDLELTEHDHQQMRDDLEKEREDLD---LERN--SLTRPSSGRSFPRTQDDSEEDDDEDSGHSSRRRGSSSGGVSYEEFQVLVRRVDRMEHSIGSIVSKIDAVIVKLEGMERAKL 817          
BLAST of PKD2-1 vs. Ensembl Medaka
Match: pkd2 (polycystin 2, transient receptor potential cation channel [Source:NCBI gene;Acc:100192346])

HSP 1 Score: 347.436 bits (890), Expect = 2.730e-106
Identity = 244/705 (34.61%), Postives = 387/705 (54.89%), Query Frame = 3
Query:  267 EDDNH---ACGKKFLRVIRRAWSTRYTEELSSNKVVFLKTALRELVTYLVFLIFLMMVAYGTRSENLYYLTTAMSNILITS--------NFNGITAMDSFWNWINIDFVNALYWNTWYNSMTYLPLNEREFIHYENKLVGVPQIRQLRIGSNTCQIPSFFKNSMSNCYGDYSFSNLNKSDFGISNSTAWXXXXXXXXXXXXXXXXXXXYDDGGFIQVLSRNSLETISILSNLQNNLWLDHGTRAVFIDLTVYNANVNLYCVIKLIFEFPPTGGIIPSSQFRTLKLIRYETGYDFFILFCXXXXXXXXXXXXXXXXXXXKKNKLSYFKKIWNVVDVLMIIMSFISIAINVYRVLSTXXXXXXXXXXXXXXXDFTFFANWNKYFNDAVSITTFFGAVKIFKYISFNKTMNQLTDTLSNSIREXXXXXXXXXXXXXXXXXWGYLQFGSQIVDFCRFQDSVFTLFRLVLGDFNFMALVQANSFIGPXXXXXXXXXXXXXXMNMFVAIIADSYEVVKEKLMQSKDEFQITKFLKAQFFNKFTKNRVMK--IQEVLENENIANCETLSYQDWRDKLQSRGYADVEIQALFMRYDSDGDRTLDYEERRVMLQDLKNGKISLEGHQTESNESELSVKKEDESMPVDE---------------------------ELFGGLVERVDSVEKNISNIVSKIDMVFLRLSEIEKAKL 2261
            + D H    C K+  + IR  W T   E+  SN+  +L   LREL+TY+ FLI + ++ YG  S N+YY T AMS + + +         F  ++ M+ FW +    F+  +YW  WYN+ + LP N+  FI+YEN L+GVP++RQ+R+ + TC I    ++ +  CYG Y+ SN + S FG  N TAW +T  +   +S+     + Y  GG+ Q LSR   E+   L  L+++LWLD GTRA+F+D +VYN NVNL C+ +L+ EFP TGG++ S QF+T++LI+Y + +D+F+  CE+    +V+YY +EE +EI  ++L YFK +WN +DVL++ +S ++I +++ R  +    + + + N  ++  F   AN    FN+  ++  FF  VK+FK+I+FNKTM+QL+ T+S   ++++GFA+MFFI+F A+A   YL FG+Q+ DF  FQ SV     L    +N            P++FL          +++F          VK  + Q + E ++T F+K        K R+ K  + ++ ++   A  + L+Y +    L+ +G+ + EIQA+F +YD DGD  L   + + M  DL+  +  L+    E N   L+      S P  +                           E F  LV RVD +E +I +IVSKID V ++L  +E+AKL
Sbjct:  122 QQDRHEHPGCMKRIFQNIRILWGTELMEDGDSNRERYLWNVLRELLTYIAFLITICILTYGMISTNMYYYTKAMSQLFLDAPLSSENPKTFRSLSTMEDFWKYTQGPFLGGMYWEVWYNNQS-LPGNQ-SFIYYENILLGVPRLRQVRVHNETCSIHEDLRDEVQGCYGVYTPSNEDNSPFGPQNGTAWVHTTESKMNASTHWGQVSKYGGGGYYQDLSRTREESGLQLQFLKDHLWLDRGTRAIFLDFSVYNGNVNLVCIARLLVEFPATGGVLTSWQFQTVRLIKYVSSWDYFVGVCEVAFCLFVLYYVVEEVLEIHIHRLHYFKNLWNCLDVLIVTLSVVAIIMSITRA-AMGGDLLKGLENYTSHTSFDSLANLQVQFNNMAAVIVFFCWVKLFKFINFNKTMSQLSTTMSRCAKDLVGFAIMFFIIFLAYAQLAYLVFGTQVNDFSTFQGSVSRTDLL----YNLR----------PLHFLYSHGEKGICTVSLF----------VKADMAQHRSEMEMTDFIKKGCTKALVKLRLKKTTVDDISDSLRQAGGK-LNYDELLQDLKEKGHTEAEIQAIFAKYDQDGDLELTEHDHQQMRDDLEKEREDLD---LERN--SLTRPSSGRSFPRTQDDSEEDDDEDSGHSSRRRGSSSGGVSYEEFQVLVRRVDRMEHSIGSIVSKIDAVIVKLEGMERAKL 793          
BLAST of PKD2-1 vs. Planmine SMEST
Match: SMESG000005014.1 (SMESG000005014.1)

HSP 1 Score: 1097.03 bits (2836), Expect = 0.000e+0
Identity = 633/635 (99.69%), Postives = 635/635 (100.00%), Query Frame = 3
Query:  423 MMVAYGTRSENLYYLTTAMSNILITSNFNGITAMDSFWNWINIDFVNALYWNTWYNSMTYLPLNEREFIHYENKLVGVPQIRQLRIGSNTCQIPSFFKNSMSNCYGDYSFSNLNKSDFGISNSTAWXXXXXXXXXXXXXXXXXXXYDDGGFIQVLSRNSLETISILSNLQNNLWLDHGTRAVFIDLTVYNANVNLYCVIKLIFEFPPTGGIIPSSQFRTLKLIRYETGYDFFILFCXXXXXXXXXXXXXXXXXXXKKNKLSYFKKIWNVVDVLMIIMSFISIAINVYRVLSTXXXXXXXXXXXXXXXDFTFFANWNKYFNDAVSITTFFGAVKIFKYISFNKTMNQLTDTLSNSIREXXXXXXXXXXXXXXXXXWGYLQFGSQIVDFCRFQDSVFTLFRLVLGDFNFMALVQANSFIGPXXXXXXXXXXXXXXMNMFVAIIADSYEVVKEKLMQSKDEFQITKFLKAQFFNKFTKNRVMKIQEVLENENIANCETLSYQDWRDKLQSRGYADVEIQALFMRYDSDGDRTLDYEERRVMLQDLKNGKISLEGHQTESNESELSVKKEDESMPVDEELFGGLVERVDSVEKNISNIVSKIDMVFLRLSEIEKAKLDHQKSISCSLSILTGSQINVLV 2327
            MMVAYGTRSENLYYLTTAMSNILITSNFNGITAMDSFWNWIN+DFVNALYWNTWYNSMTYLPLNEREFIHYENKLVGVPQIRQLRIGSNTCQIPSFFKNSMSNCYGDYSF+NLNKSDFGISNSTAWSYTPPNSTYSSSFSATFATYDDGGFIQVLSRNSLETISILSNLQNNLWLDHGTRAVFIDLTVYNANVNLYCVIKLIFEFPPTGGIIPSSQFRTLKLIRYETGYDFFILFCEIVVIFYVIYYFIEEFIEIKKNKLSYFKKIWNVVDVLMIIMSFISIAINVYRVLSTNKVVKQLVNNQNNYVDFTFFANWNKYFNDAVSITTFFGAVKIFKYISFNKTMNQLTDTLSNSIREMMGFAVMFFIVFFAFAGWGYLQFGSQIVDFCRFQDSVFTLFRLVLGDFNFMALVQANSFIGPVYFLCYVFFVFFVLMNMFVAIIADSYEVVKEKLMQSKDEFQITKFLKAQFFNKFTKNRVMKIQEVLENENIANCETLSYQDWRDKLQSRGYADVEIQALFMRYDSDGDRTLDYEERRVMLQDLKNGKISLEGHQTESNESELSVKKEDESMPVDEELFGGLVERVDSVEKNISNIVSKIDMVFLRLSEIEKAKLDHQKSISCSLSILTGSQINVLV
Sbjct:    1 MMVAYGTRSENLYYLTTAMSNILITSNFNGITAMDSFWNWINVDFVNALYWNTWYNSMTYLPLNEREFIHYENKLVGVPQIRQLRIGSNTCQIPSFFKNSMSNCYGDYSFNNLNKSDFGISNSTAWSYTPPNSTYSSSFSATFATYDDGGFIQVLSRNSLETISILSNLQNNLWLDHGTRAVFIDLTVYNANVNLYCVIKLIFEFPPTGGIIPSSQFRTLKLIRYETGYDFFILFCEIVVIFYVIYYFIEEFIEIKKNKLSYFKKIWNVVDVLMIIMSFISIAINVYRVLSTNKVVKQLVNNQNNYVDFTFFANWNKYFNDAVSITTFFGAVKIFKYISFNKTMNQLTDTLSNSIREMMGFAVMFFIVFFAFAGWGYLQFGSQIVDFCRFQDSVFTLFRLVLGDFNFMALVQANSFIGPVYFLCYVFFVFFVLMNMFVAIIADSYEVVKEKLMQSKDEFQITKFLKAQFFNKFTKNRVMKIQEVLENENIANCETLSYQDWRDKLQSRGYADVEIQALFMRYDSDGDRTLDYEERRVMLQDLKNGKISLEGHQTESNESELSVKKEDESMPVDEELFGGLVERVDSVEKNISNIVSKIDMVFLRLSEIEKAKLDHQKSISCSLSILTGSQINVLV 635          
BLAST of PKD2-1 vs. Planmine SMEST
Match: SMESG000005014.1 (SMESG000005014.1)

HSP 1 Score: 1093.95 bits (2828), Expect = 0.000e+0
Identity = 632/634 (99.68%), Postives = 634/634 (100.00%), Query Frame = 3
Query:  426 MVAYGTRSENLYYLTTAMSNILITSNFNGITAMDSFWNWINIDFVNALYWNTWYNSMTYLPLNEREFIHYENKLVGVPQIRQLRIGSNTCQIPSFFKNSMSNCYGDYSFSNLNKSDFGISNSTAWXXXXXXXXXXXXXXXXXXXYDDGGFIQVLSRNSLETISILSNLQNNLWLDHGTRAVFIDLTVYNANVNLYCVIKLIFEFPPTGGIIPSSQFRTLKLIRYETGYDFFILFCXXXXXXXXXXXXXXXXXXXKKNKLSYFKKIWNVVDVLMIIMSFISIAINVYRVLSTXXXXXXXXXXXXXXXDFTFFANWNKYFNDAVSITTFFGAVKIFKYISFNKTMNQLTDTLSNSIREXXXXXXXXXXXXXXXXXWGYLQFGSQIVDFCRFQDSVFTLFRLVLGDFNFMALVQANSFIGPXXXXXXXXXXXXXXMNMFVAIIADSYEVVKEKLMQSKDEFQITKFLKAQFFNKFTKNRVMKIQEVLENENIANCETLSYQDWRDKLQSRGYADVEIQALFMRYDSDGDRTLDYEERRVMLQDLKNGKISLEGHQTESNESELSVKKEDESMPVDEELFGGLVERVDSVEKNISNIVSKIDMVFLRLSEIEKAKLDHQKSISCSLSILTGSQINVLV 2327
            MVAYGTRSENLYYLTTAMSNILITSNFNGITAMDSFWNWIN+DFVNALYWNTWYNSMTYLPLNEREFIHYENKLVGVPQIRQLRIGSNTCQIPSFFKNSMSNCYGDYSF+NLNKSDFGISNSTAWSYTPPNSTYSSSFSATFATYDDGGFIQVLSRNSLETISILSNLQNNLWLDHGTRAVFIDLTVYNANVNLYCVIKLIFEFPPTGGIIPSSQFRTLKLIRYETGYDFFILFCEIVVIFYVIYYFIEEFIEIKKNKLSYFKKIWNVVDVLMIIMSFISIAINVYRVLSTNKVVKQLVNNQNNYVDFTFFANWNKYFNDAVSITTFFGAVKIFKYISFNKTMNQLTDTLSNSIREMMGFAVMFFIVFFAFAGWGYLQFGSQIVDFCRFQDSVFTLFRLVLGDFNFMALVQANSFIGPVYFLCYVFFVFFVLMNMFVAIIADSYEVVKEKLMQSKDEFQITKFLKAQFFNKFTKNRVMKIQEVLENENIANCETLSYQDWRDKLQSRGYADVEIQALFMRYDSDGDRTLDYEERRVMLQDLKNGKISLEGHQTESNESELSVKKEDESMPVDEELFGGLVERVDSVEKNISNIVSKIDMVFLRLSEIEKAKLDHQKSISCSLSILTGSQINVLV
Sbjct:    1 MVAYGTRSENLYYLTTAMSNILITSNFNGITAMDSFWNWINVDFVNALYWNTWYNSMTYLPLNEREFIHYENKLVGVPQIRQLRIGSNTCQIPSFFKNSMSNCYGDYSFNNLNKSDFGISNSTAWSYTPPNSTYSSSFSATFATYDDGGFIQVLSRNSLETISILSNLQNNLWLDHGTRAVFIDLTVYNANVNLYCVIKLIFEFPPTGGIIPSSQFRTLKLIRYETGYDFFILFCEIVVIFYVIYYFIEEFIEIKKNKLSYFKKIWNVVDVLMIIMSFISIAINVYRVLSTNKVVKQLVNNQNNYVDFTFFANWNKYFNDAVSITTFFGAVKIFKYISFNKTMNQLTDTLSNSIREMMGFAVMFFIVFFAFAGWGYLQFGSQIVDFCRFQDSVFTLFRLVLGDFNFMALVQANSFIGPVYFLCYVFFVFFVLMNMFVAIIADSYEVVKEKLMQSKDEFQITKFLKAQFFNKFTKNRVMKIQEVLENENIANCETLSYQDWRDKLQSRGYADVEIQALFMRYDSDGDRTLDYEERRVMLQDLKNGKISLEGHQTESNESELSVKKEDESMPVDEELFGGLVERVDSVEKNISNIVSKIDMVFLRLSEIEKAKLDHQKSISCSLSILTGSQINVLV 634          
BLAST of PKD2-1 vs. Planmine SMEST
Match: SMESG000018492.1 (SMESG000018492.1)

HSP 1 Score: 457.603 bits (1176), Expect = 1.341e-149
Identity = 289/689 (41.94%), Postives = 438/689 (63.57%), Query Frame = 3
Query:  279 HACGKKFLRVIRRAWSTRYTEELSSNKVVFLKTALRELVTYLVFLIFLMMVAYGTRSENLYYLTTAMSNILITSNFN-------GITAMDSFWNWINIDFVNALYWNTWYNSMTYLPLNEREFIHYENKLVGVPQIRQLRIGSNTCQIPSFFKNSMSNCYGDYSFSNLNKSDFGISNSTAWXXXXXXXXXXXXXXXXXXXYDDGGFIQVLSRNSLETISILSNLQNNLWLDHGTRAVFIDLTVYNANVNLYCVIKLIFEFPPTGGIIPSSQFRTLKLIRYETGYDFFILFCXXXXXXXXXXXXXXXXXXXKKNKLSYFKKIWNVVDVLMIIMSFISIAINVYRVLSTXXXXXXXXXXXXXXXDFTFFANWNKYFNDAVSITTFFGAVKIFKYISFNKTMNQLTDTLSNSIREXXXXXXXXXXXXXXXXXWGYLQFGSQIVDFCRFQDSVFTLFRLVLGDFNFMALVQANSFIGPXXXXXXXXXXXXXXMNMFVAIIADSYEVVKEKLMQSKDEFQITKFLK-------AQFFNKFTKNRVMKIQEVLENENIANCETLSYQDWRDKLQSRGYADVEIQALFMRYDSDGDRTLDYEERRVMLQDLKNGKISLEGHQTESNESELSVKKEDESMP-VDEELFGGLVERVDSVEKNISNIVSKIDMVFLRLSEIEKAKLDHQKSISCSLSIL 2300
            ++C  +F   IR  W+TR+TE+   ++ +++KT LRELV Y+ FL  L+++++G  +   Y+ T  +S +  TSNFN         T    FW ++    +N LYW TWYN++ +   ++  F++YEN+L+G+P++RQ+R+ +++C IPS F+  +  C+  YS S+ +K  +G  NST W YT  +   ++ +    ATY  GGF   L+   +++ + +  L NNLW+D GTRAV ID TVYNAN+NL+C IKL+ EFPPTGG++ SSQFRT+KLIRY    DFF+L CE++ + +++YY +EE +EIK  K  YF  IWN++D+L+II S      N+ R L+   +++ LV N N + +F     W   F++ ++IT F   VK+FKYISFNKTM QL+ TLS   +++ GFA+MFFI+F AFA  GYL FG+Q+ DF + Q  ++TLFR++LGDF+F  L  A+   GP+YF+ YVFFVFFVL NMF+AII D+Y  VKE+L   K+EF+I  ++K       A+   K  K++++ IQ  +   +  N   + + +WR +L+SRGY D EI+A+F RYD+DGD+ LD  E+  M ++L++ K SL+  + +  +SE+  K  D  +P V  E +  L  RVD ++ N   IV+KID V   L  IEK K   ++++   L+ L
Sbjct:   40 NSCWNRFKNGIRSLWATRHTEDTKVDRQLYIKTTLRELVIYIFFLAVLVIISFGMTTVQAYWFTNLLSGLFTTSNFNDNSGTFAASTTESDFWKFLTGPLLNGLYWTTWYNNINFTS-DQINFLYYENRLIGLPRLRQVRVRNDSCSIPSDFQGEIKQCFAAYSMSSESKDSYGQQNSTPWVYTNSSVLDTTEYQGIVATYGGGGFYVNLNSTQVDSFNTIMTLFNNLWIDRGTRAVIIDFTVYNANINLFCYIKLVGEFPPTGGLLVSSQFRTVKLIRYVGSIDFFVLACELLFVVFIVYYIVEESLEIKMLKFEYFFSIWNILDILVIIFSLTCSIFNIVRTLTVQNIIQTLVANDNIHPNFESLTFWQLQFDNLIAITLFLAWVKVFKYISFNKTMTQLSATLSRCSKDLAGFAIMFFIIFIAFAQLGYLIFGAQVNDFSKLQYCIYTLFRIILGDFDFAQLEVAHRIFGPLYFVFYVFFVFFVLFNMFLAIITDTYGEVKEELANQKNEFEIADYVKERTEVVLAKLHLK--KDKIIDIQNAVLAGDTNNDGKMDFDEWRVELKSRGYGDAEIEAVFARYDTDGDKALDEAEQIAMQKELEDQKNSLD-LEIQYEKSEILNKTRDVILPVVSLEEYRALNRRVDRMDNNTRVIVTKIDTVLEALESIEKDKARSRETMGIILNTL 724          
BLAST of PKD2-1 vs. Planmine SMEST
Match: SMESG000033381.1 (SMESG000033381.1)

HSP 1 Score: 428.713 bits (1101), Expect = 1.640e-138
Identity = 264/695 (37.99%), Postives = 430/695 (61.87%), Query Frame = 3
Query:  276 NHACGKKFLRVIRRAWSTRYTEELSSNKVVFLKTALRELVTYLVFLIFLMMVAYGTRSENLYYLTTAMSNILITSNFNG-------ITAMDSFWNWINIDFVNALYWNTWYNSMTYLPLNEREFIHYENKLVGVPQIRQLRIGSNTCQIPSFFKNSMSNCYGDYSFSNLNKSDFGISNSTAWXXXXXXXXXXXXXXXXXXXYDDGGFIQVLSRNSLETISILSNLQNNLWLDHGTRAVFIDLTVYNANVNLYCVIKLIFEFPPTGGIIPSSQFRTLKLIRYETGYDFFILFCXXXXXXXXXXXXXXXXXXXKKNKLSYFKKIWNVVDVLMIIMSFISIAINVYRVLSTXXXXXXXXXXXXXXXDFTFFANWNKYFNDAVSITTFFGAVKIFKYISFNKTMNQLTDTLSNSIREXXXXXXXXXXXXXXXXXWGYLQFGSQIVDFCRFQDSVFTLFRLVLGDFNFMALVQANSFIGPXXXXXXXXXXXXXXMNMFVAIIADSYEVVKEKLMQSKDEFQITKFLKAQFFN-----KFTKNRVMKIQEVLENENIANCETLSYQDWRDKLQSRGYADVEIQALFMRYDSDGDRTLDYEERRVMLQDLKNGKISLEGHQTESNESELSVKKEDES----MPVDEELFGGLVERVDSVEKNISNIVSKIDMVFLRLSEIEKAKLDHQKSISCSLSILTGSQ 2312
            ++ C  KF R++R  W+T+ TE+   N+ +++KT +REL+ Y+VFL  LM++A+G   +  +Y T A+  + +   F+        ++ + + W ++   F+N LYW+ WYN       ++ + ++YEN+++G+P+IRQL++ +N+C+IP  F+  M +CY ++S  N +K++FG++NSTAW YT P S  SS + + F+ Y DGGF Q LSRN   T+ +L +L  N W+  GTR +FID T+YN N+NL+ V++LIFEFP  GG+  S++FR +KL+RY + +D+FI  CE++   +++YY +EE IEI+K+KL+YF + WN +D+++II+S +    ++YR  S  K+++ L++N+N +  F F +   + FN+AV+I  F   +KIFKYISFNKTM QL+ TL+ S +++ GFAVMFFI+FFAFA  GY  FGSQI DF     S  T FR++LGDF++  L  A+  IGP                            VK ++   K+EF++  + +    N     +F + ++  IQ+ + N +I + + L Y +WR++L+SRGYAD EI+++F++YD DGDRTL+  E++ +      G++++E    E +  E      + S      +D + +  L  RVD +E+NIS+IV K+D +    S+++K K+D  K IS  L  L  ++
Sbjct:   57 SNGCWWKFKRILRSLWATKLTEDTGENRELYIKTTVRELIIYVVFLTILMIIAFGMIDQVTFYYTKALKTLFLDEKFDDKEKSFTTVSTISNVWQYLFGPFLNGLYWDRWYNGQDIT--DDTDLVYYENQILGIPRIRQLKVRNNSCEIPKVFQGDMKHCYSEFSSENEDKNNFGLNNSTAWIYTSPESLNSSGYFSLFSEYHDGGFYQDLSRNKTITLQMLRSLFENSWVTLGTRVIFIDFTLYNPNINLFSVMRLIFEFPTIGGVKTSNEFRVVKLLRYISTFDYFIAACEVIFCLFIVYYIVEETIEIRKHKLAYFYEFWNWLDIVVIIISLVCAIFDIYRTASVQKLIQGLLSNENQFPAFDFLSYCQQQFNNAVAINLFIAWIKIFKYISFNKTMTQLSSTLTRSSKDLFGFAVMFFIIFFAFAELGYFIFGSQIEDFENLIKSALTQFRIILGDFDYQQLESAHRIIGP----------------------------VKAEIATQKNEFEMADYFRNTARNVLQLLQFKQQKIRDIQDAILNADINSDKKLDYDEWRNELKSRGYADAEIESVFVKYDKDGDRTLNLNEQKNL-----EGELNIEKELIEKDIEETKQFNGENSDYNKTNIDIDEYNILKRRVDRMEENISDIVLKLDKLLQNFSQLDKMKIDQSKVISSLLEALNNTE 716          
BLAST of PKD2-1 vs. Planmine SMEST
Match: SMESG000018504.1 (SMESG000018504.1)

HSP 1 Score: 423.32 bits (1087), Expect = 1.000e-136
Identity = 261/680 (38.38%), Postives = 421/680 (61.91%), Query Frame = 3
Query:  276 NHACGKKFLRVIRRAWSTRYTEELSSNKVVFLKTALRELVTYLVFLIFLMMVAYGTRSENLYYLTTAMSNILITSNFN-------GITAMDSFWNWINIDFVNALYWNTWYNSMTYLPLNEREFIHYENKLVGVPQIRQLRIGSNTCQIPSFFKNSMSNCYGDYSFSNLNKSDFGISNSTAWXXXXXXXXXXXXXXXXXXXYDDGGFIQVLSRNSLETISILSNLQNNLWLDHGTRAVFIDLTVYNANVNLYCVIKLIFEFPPTGGIIPSSQFRTLKLIRYETGYDFFILFCXXXXXXXXXXXXXXXXXXXKKNKLSYFKKIWNVVDVLMIIMSFISIAINVYRVLSTXXXXXXXXXXXXXXXDFTFFANWNKYFNDAVSITTFFGAVKIFKYISFNKTMNQLTDTLSNSIREXXXXXXXXXXXXXXXXXWGYLQFGSQIVDFCRFQDSVFTLFRLVLGDFNFMALVQANSFIGPXXXXXXXXXXXXXXMNMFVAIIADSYEVVKEKLMQSKDEFQITKFLKAQFFNKFTKNRVMKIQEVLENENIANCETLSYQDWRDKLQSRGYADVEIQALFMRYDSDGDRTLDYEERRVMLQDLKNGKISLEGHQTESNESELSVKKEDESMPVDEELFGGLVERVDSVEKNISNIVSKIDMVFLRLSEIEKAKLDHQKSISCSLS 2294
            N  C  KF   IR  W+T++TE    +K ++  T +RELV Y++FL+ L ++ +  R   ++Y T  ++N+ +T+ FN        + A   FW ++    +N LYWN WYNS   +P NE+ +I++ENKL+GVP+IRQ+R+ +N+C IP+  +N ++ CY  YS +   K  FG  NS+AW+YT  +   S SF     TY  GGF   L+ +   +++I+ +L NN WLD  TRAV +D T+YNAN+NL+C+IKL+ EFPP GG++PS +FRT+KLIRY    DFF+L CEI+ + Y++YY IEE IEI K+K +YF  +WNV+DV+++ +  I ++ ++YR+     ++ +L+ N N + +F + + W   +++  +   F    KIFKYISFNK M QL  TL+  +++++GF++MFFIVF AFA  GYL FGSQ+ ++  F   +FTLFR++L D NF  L+  N  +GP+YF+ YVFFVFF+L NMF+AI+ D+Y+ +KEK  +  ++  +             + +++ ++  ++  +  N   + + +W+ +L+ RGYA+ EI++LF ++D+DGDR LD +E+  ML++L + K +LE    E  +++  + + D   P+    + GL   +D +E  I  +  K D++      I K K   ++S    L+
Sbjct:   23 NENCWNKFKIGIRSLWATKHTENCDEDKNLYANTTVRELVVYMLFLVLLFIITFSMRPGYMFYFTNFLNNLFLTTQFNDNSGTFSSLQAQSDFWKFLMGPLLNGLYWNVWYNSRN-MPANEQNYIYFENKLLGVPRIRQIRVKNNSCIIPNILQNKVNQCYAAYSRNIELKESFGFQNSSAWNYTEDSILQSGSFQGQITTYGGGGFYVDLATSQENSLNIILSLFNNRWLDRNTRAVLVDFTIYNANINLFCIIKLVGEFPPVGGVLPSYEFRTVKLIRYVNPLDFFVLACEILFVLYLLYYIIEELIEIDKHKSAYFCSLWNVLDVIVLSLGVICVSFHIYRMYMIQTMLSKLLENGNIHPNFEYLSFWQLQYDNLSAFLLFLAITKIFKYISFNKMMTQLISTLNYCLKDLVGFSLMFFIVFLAFAQAGYLIFGSQLANYREFYICIFTLFRIILNDCNFKELLPLNPILGPLYFILYVFFVFFILFNMFLAILDDAYDFLKEKSRKVFEKLHL------------KREKIVDLENAMKTVDTNNDGVMDFDEWKTELKRRGYAETEIESLFAKFDTDGDRVLDEQEQLKMLKELNDQKTALETELIEERDNQEKLIESDAIQPISYAKYMGLSRHIDDLENIIEILTQKFDIILDNFQNIIKTKEKSRESTEIILN 689          
The following BLAST results are available for this feature:
BLAST of PKD2-1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PKD22.472e-13140.03polycystin 2, transient receptor potential cation ... [more]
PKD2L18.960e-13039.26polycystin 2 like 1, transient receptor potential ... [more]
PKD2L21.054e-10637.31polycystin 2 like 2, transient receptor potential ... [more]
PKD2L22.217e-10639.51polycystin 2 like 2, transient receptor potential ... [more]
PKD2L21.295e-10036.53polycystin 2 like 2, transient receptor potential ... [more]
back to top
BLAST of PKD2-1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
pkd-22.525e-7932.62Polycystin-2 [Source:UniProtKB/Swiss-Prot;Acc:Q9U... [more]
lov-11.519e-1722.87Location of vulva defective 1 [Source:UniProtKB/S... [more]
back to top
BLAST of PKD2-1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Pkd26.253e-3932.76gene:FBgn0041195 transcript:FBtr0080365[more]
brv31.756e-1023.53gene:FBgn0040333 transcript:FBtr0340092[more]
brv31.790e-1023.53gene:FBgn0040333 transcript:FBtr0300708[more]
back to top
BLAST of PKD2-1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pkd22.086e-13938.97polycystic kidney disease 2 [Source:NCBI gene;Acc:... [more]
pkd2l19.766e-13839.51polycystic kidney disease 2-like 1 [Source:ZFIN;Ac... [more]
pkd1l2a5.737e-3327.22polycystic kidney disease 1 like 2a [Source:ZFIN;A... [more]
pkd1l2a4.710e-3227.42polycystic kidney disease 1 like 2a [Source:ZFIN;A... [more]
pkd1l2b7.011e-2825.51polycystic kidney disease 1 like 2b [Source:ZFIN;A... [more]
back to top
BLAST of PKD2-1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
usp331.305e-13238.53ubiquitin specific peptidase 33 [Source:Xenbase;Ac... [more]
usp333.386e-13138.05ubiquitin specific peptidase 33 [Source:Xenbase;Ac... [more]
usp335.065e-13137.01ubiquitin specific peptidase 33 [Source:Xenbase;Ac... [more]
usp331.010e-12938.05ubiquitin specific peptidase 33 [Source:Xenbase;Ac... [more]
usp338.502e-12938.02ubiquitin specific peptidase 33 [Source:Xenbase;Ac... [more]
back to top
BLAST of PKD2-1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pkd2l12.069e-13440.06polycystic kidney disease 2-like 1 [Source:MGI Sym... [more]
Pkd22.862e-13039.04polycystin 2, transient receptor potential cation ... [more]
Pkd2l24.116e-9840.36polycystic kidney disease 2-like 2 [Source:MGI Sym... [more]
Pkd2l24.116e-9840.36polycystic kidney disease 2-like 2 [Source:MGI Sym... [more]
Pkd1l23.794e-3725.19polycystic kidney disease 1 like 2 [Source:MGI Sym... [more]
back to top
BLAST of PKD2-1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6IVV8|PKD2_DANRE1.575e-13838.97Polycystin-2 OS=Danio rerio OX=7955 GN=pkd2 PE=1 S... [more]
sp|Q4GZT3|PKD2_BOVIN1.954e-13539.10Polycystin-2 OS=Bos taurus OX=9913 GN=PKD2 PE=2 SV... [more]
sp|A2A259|PK2L1_MOUSE1.447e-13340.06Polycystic kidney disease 2-like 1 protein OS=Mus ... [more]
sp|Q13563|PKD2_HUMAN1.187e-13040.03Polycystin-2 OS=Homo sapiens OX=9606 GN=PKD2 PE=1 ... [more]
sp|O35245|PKD2_MOUSE2.002e-12939.04Polycystin-2 OS=Mus musculus OX=10090 GN=Pkd2 PE=1... [more]
back to top
BLAST of PKD2-1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0H3YFQ90.000e+0100.00PKD2-1 OS=Schmidtea mediterranea OX=79327 GN=PKD2-... [more]
R7T9132.834e-16343.85Uncharacterized protein OS=Capitella teleta OX=283... [more]
X1ZBN23.749e-16143.55Uncharacterized protein OS=Capitella teleta OX=283... [more]
A0A1S3KAZ32.411e-16043.06polycystin-2 isoform X2 OS=Lingula unguis OX=7574 ... [more]
A0A1S3KAA47.478e-16042.94polycystin-2 isoform X3 OS=Lingula unguis OX=7574 ... [more]
back to top
BLAST of PKD2-1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pkd2l12.609e-14040.92polycystic kidney disease 2-like 1 protein [Source... [more]
pkd21.619e-13138.09polycystin 2, transient receptor potential cation ... [more]
pkd1l2a2.269e-3426.28polycystin 1 like 2 [Source:NCBI gene;Acc:10304417... [more]
ENSAMXT00000006495.24.768e-2924.35pep primary_assembly:Astyanax_mexicanus-2.0:5:3500... [more]
pkd1a1.151e-723.44polycystic kidney disease 1a [Source:ZFIN;Acc:ZDB-... [more]
back to top
BLAST of PKD2-1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pkd2l13.361e-13740.43polycystic kidney disease 2-like 1 [Source:ZFIN;Ac... [more]
pkd2l16.915e-13038.71polycystic kidney disease 2-like 1 [Source:ZFIN;Ac... [more]
pkd26.629e-6327.08polycystic kidney disease 2 [Source:NCBI gene;Acc:... [more]
ENSPMAT00000007306.11.998e-1124.09pep scaffold:Pmarinus_7.0:GL480012:400827:419749:1... [more]
ENSPMAT00000002645.12.760e-620.39pep scaffold:Pmarinus_7.0:GL476683:134:12081:-1 ge... [more]
back to top
BLAST of PKD2-1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of PKD2-1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO470232.901e-15940.25Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO492006.018e-4627.35Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO400518.340e-4428.14Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO447441.295e-4125.17Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO448842.304e-3728.06Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of PKD2-1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pkd2l12.593e-13139.82polycystin 2 like 1, transient receptor potential ... [more]
pkd2l11.784e-12939.82polycystin 2 like 1, transient receptor potential ... [more]
pkd22.725e-12937.87polycystin 2, transient receptor potential cation ... [more]
pkd28.681e-12937.87polycystin 2, transient receptor potential cation ... [more]
pkd22.730e-10634.61polycystin 2, transient receptor potential cation ... [more]
back to top
BLAST of PKD2-1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000005014.10.000e+099.69SMESG000005014.1[more]
SMESG000005014.10.000e+099.68SMESG000005014.1[more]
SMESG000018492.11.341e-14941.94SMESG000018492.1[more]
SMESG000033381.11.640e-13837.99SMESG000033381.1[more]
SMESG000018504.11.000e-13638.38SMESG000018504.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30009733
GenBankAKN21727.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30009733 ID=SMED30009733|Name=PKD2-1|organism=Schmidtea mediterranea sexual|type=transcript|length=2434bp
AGGCAGTCAAATATTTTCATTGAATTTTTATCTGAAACTTGTCATTATTT
AAAAAAATGTCACGTCAAGCGTCAGTGTTGCGGTTGACATCCTCAATTGG
TGGCTCTATAGCCAGCATTAAATCTTTATTGTCAAAAAGTAAAATTCATC
CAGTTGATGTTGACAATTCCGACACGGTTTATGAAATTAAAGATTTTGAC
AATTATTCTGGCGAAAAATCAAATTCAGAACAAAATTTGTCATCTTCAGC
AGATTTATTTCTTCTTGAAGATGATAATCATGCATGTGGGAAAAAGTTTC
TTCGAGTTATTAGAAGAGCCTGGTCAACAAGATATACAGAAGAACTTAGC
TCAAATAAAGTTGTTTTTCTAAAAACAGCCCTTAGGGAATTGGTTACCTA
TTTGGTATTCCTGATATTTTTAATGATGGTTGCTTATGGAACCAGATCTG
AAAATTTGTATTACCTTACAACTGCAATGTCAAATATTCTTATAACCTCA
AATTTCAATGGGATTACTGCGATGGATTCTTTCTGGAATTGGATAAATAT
TGACTTCGTAAATGCTCTTTACTGGAATACGTGGTACAATTCCATGACCT
ACTTACCTTTAAATGAAAGAGAATTTATTCACTACGAAAATAAGCTTGTT
GGGGTTCCACAGATCCGTCAATTACGTATCGGATCAAATACTTGCCAAAT
TCCATCGTTTTTTAAGAATTCAATGAGTAATTGCTATGGAGACTATTCTT
TTAGCAATTTAAACAAAAGTGACTTTGGAATATCTAATTCTACTGCATGG
AGTTACACTCCCCCAAATTCAACATACTCATCGTCATTTAGTGCTACGTT
TGCTACTTATGACGACGGAGGATTCATACAAGTTCTTAGCAGGAATTCTC
TTGAAACTATAAGCATACTTTCGAATTTACAGAATAATCTTTGGTTGGAC
CATGGAACTAGAGCCGTCTTCATTGATTTGACAGTTTACAATGCTAATGT
CAATTTGTACTGCGTAATCAAACTTATTTTTGAATTTCCCCCAACAGGAG
GAATCATTCCTTCTAGTCAATTCAGGACATTGAAACTGATCCGTTATGAA
ACGGGTTATGATTTTTTCATTCTATTTTGTGAAATTGTAGTAATATTCTA
TGTCATTTACTACTTCATAGAAGAATTTATTGAGATAAAAAAAAATAAAC
TTTCTTATTTCAAAAAAATCTGGAATGTTGTAGATGTTTTGATGATTATT
ATGAGCTTCATTTCAATTGCCATAAACGTTTATCGGGTCCTTTCAACAAA
TAAGGTGGTCAAACAGTTGGTAAATAATCAAAACAATTATGTGGATTTTA
CATTTTTTGCAAATTGGAACAAATATTTTAATGATGCCGTATCTATTACT
ACGTTTTTCGGTGCAGTAAAAATATTCAAATATATAAGTTTCAATAAAAC
AATGAACCAACTGACCGATACACTGAGCAATTCGATTCGGGAAATGATGG
GGTTTGCTGTTATGTTTTTCATTGTGTTTTTTGCATTCGCCGGTTGGGGC
TATCTACAATTTGGATCTCAAATTGTGGATTTCTGTCGGTTTCAAGATTC
GGTTTTTACTCTATTTCGATTGGTTTTGGGAGATTTCAATTTCATGGCTC
TCGTTCAAGCGAATTCATTTATTGGTCCGGTTTACTTTCTCTGTTATGTA
TTTTTTGTGTTTTTTGTTTTAATGAACATGTTTGTTGCGATTATTGCCGA
TTCGTATGAAGTTGTGAAAGAGAAATTGATGCAATCGAAAGATGAATTTC
AAATCACGAAATTTCTGAAAGCGCAATTTTTTAATAAATTTACTAAAAAT
CGAGTGATGAAAATTCAAGAAGTCTTAGAAAATGAAAATATCGCCAATTG
TGAAACTCTTAGCTATCAAGATTGGAGAGATAAACTTCAAAGTCGAGGTT
ATGCTGATGTTGAAATTCAAGCGCTGTTCATGCGGTATGACTCTGACGGA
GACCGAACACTGGATTATGAAGAAAGGCGCGTTATGCTCCAAGATCTTAA
AAATGGAAAAATAAGTTTAGAAGGACATCAAACTGAAAGTAATGAATCCG
AACTTTCTGTCAAAAAGGAGGACGAATCAATGCCTGTTGACGAGGAATTA
TTCGGTGGACTTGTAGAAAGAGTTGATTCAGTTGAGAAGAACATTTCTAA
TATTGTTTCCAAGATTGACATGGTTTTTTTAAGATTGAGTGAAATAGAAA
AGGCTAAACTCGACCATCAAAAAAGCATAAGTTGCAGTCTATCAATTCTA
ACTGGATCTCAAATAAACGTTTTAGTTTGATACTATTTCTTAACTTGATT
TTGATTTTGTTGCAACTTTTAATAATGTTTATTTATCTATCAAGAAAAAT
AACTATGTCTCTTCTTGACAAATGCTATTGTCGG
back to top

protein sequence of SMED30009733-orf-1

>SMED30009733-orf-1 ID=SMED30009733-orf-1|Name=SMED30009733-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=758bp
MSRQASVLRLTSSIGGSIASIKSLLSKSKIHPVDVDNSDTVYEIKDFDNY
SGEKSNSEQNLSSSADLFLLEDDNHACGKKFLRVIRRAWSTRYTEELSSN
KVVFLKTALRELVTYLVFLIFLMMVAYGTRSENLYYLTTAMSNILITSNF
NGITAMDSFWNWINIDFVNALYWNTWYNSMTYLPLNEREFIHYENKLVGV
PQIRQLRIGSNTCQIPSFFKNSMSNCYGDYSFSNLNKSDFGISNSTAWSY
TPPNSTYSSSFSATFATYDDGGFIQVLSRNSLETISILSNLQNNLWLDHG
TRAVFIDLTVYNANVNLYCVIKLIFEFPPTGGIIPSSQFRTLKLIRYETG
YDFFILFCEIVVIFYVIYYFIEEFIEIKKNKLSYFKKIWNVVDVLMIIMS
FISIAINVYRVLSTNKVVKQLVNNQNNYVDFTFFANWNKYFNDAVSITTF
FGAVKIFKYISFNKTMNQLTDTLSNSIREMMGFAVMFFIVFFAFAGWGYL
QFGSQIVDFCRFQDSVFTLFRLVLGDFNFMALVQANSFIGPVYFLCYVFF
VFFVLMNMFVAIIADSYEVVKEKLMQSKDEFQITKFLKAQFFNKFTKNRV
MKIQEVLENENIANCETLSYQDWRDKLQSRGYADVEIQALFMRYDSDGDR
TLDYEERRVMLQDLKNGKISLEGHQTESNESELSVKKEDESMPVDEELFG
GLVERVDSVEKNISNIVSKIDMVFLRLSEIEKAKLDHQKSISCSLSILTG
SQINVLV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
PLANA:0000464GABAergic neuron
Vocabulary: INTERPRO
TermDefinition
IPR003915PKD_2
IPR013122PKD1_2_channel
IPR011992EF-hand-dom_pair
IPR002048EF_hand_dom
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: molecular function
TermDefinition
GO:0005509calcium ion binding
GO:0005262calcium channel activity
Vocabulary: biological process
TermDefinition
GO:0050982detection of mechanical stimulus
GO:0070588calcium ion transmembrane transport
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003915Polycystic kidney disease type 2 proteinPRINTSPR01433POLYCYSTIN2coord: 705..723
score: 58.95
coord: 435..460
score: 37.69
coord: 543..564
score: 66.36
coord: 125..146
score: 40.0
coord: 303..325
score: 60.87
coord: 389..409
score: 36.19
coord: 358..380
score: 43.48
coord: 482..503
score: 61.82
NoneNo IPR availableGENE3DG3DSA:1.10.238.170coord: 617..660
e-value: 2.7E-15
score: 57.9
NoneNo IPR availableGENE3DG3DSA:1.10.287.70coord: 464..571
e-value: 6.5E-11
score: 44.1
NoneNo IPR availableGENE3DG3DSA:1.20.5.340coord: 692..752
e-value: 6.4E-10
score: 40.8
NoneNo IPR availablePANTHERPTHR10877:SF114POLYCYSTIN-2coord: 66..672
NoneNo IPR availablePANTHERPTHR10877POLYCYSTIN-RELATEDcoord: 66..672
NoneNo IPR availableSUPERFAMILYSSF81324Voltage-gated potassium channelscoord: 351..568
NoneNo IPR availableTMHMMTMhelixcoord: 391..413
NoneNo IPR availableTMHMMTMhelixcoord: 481..503
NoneNo IPR availableTMHMMTMhelixcoord: 349..371
NoneNo IPR availableTMHMMTMhelixcoord: 542..564
NoneNo IPR availableTMHMMTMhelixcoord: 518..540
NoneNo IPR availableTMHMMTMhelixcoord: 440..462
NoneNo IPR availableTMHMMTMhelixcoord: 112..129
IPR013122Polycystin cation channel, PKD1/PKD2PFAMPF08016PKD_channelcoord: 148..569
e-value: 3.6E-117
score: 391.6
IPR002048EF-hand domainPROSITEPS50222EF_HAND_2coord: 632..667
score: 10.05
IPR011992EF-hand domain pairSUPERFAMILYSSF47473EF-handcoord: 585..673