SMED30009724

Overview
NameSMED30009724
Smed IDSMED30009724
Length (bp)5513
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30009724 (SMED30009724) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30009724 (SMED30009724) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30009724

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
reproductive organSMED30009724h1SMcG0002953 Contig17304uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30009724h1SMcG0002953 Contig17304newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of SMED30009724 vs. Planmine SMEST
Match: SMESG000001254.1 (SMESG000001254.1)

HSP 1 Score: 1535.39 bits (3974), Expect = 0.000e+0
Identity = 810/1169 (69.29%), Postives = 908/1169 (77.67%), Query Frame = 1
Query: 1483 CFTHLPNYYLLPKRMNEYFINMEMFIYCFPLDDFILLTVDSYEIDKKNSSIAGIGGLPNKSNLTLCAYCYTLVKVYPLRCFTPKVLIIAILPENTEYYEFAKSFDVYCILKTKTHLFNGSSLGLKLTANNTSIQNVNATYFVLSGVDDGTVCFSCNSILSNTVTKCYKFKPLNVVISIEPSDTKIYLPNKSLSIKCSVNPDIFNNKKDIIQFLYYNGSYSKVYPQNLVTSRKNTQTICVICGNRIITNFSCYFCFKEKIILKIEPNFTDVFVNNIKMVVRCTVEPEKVIKENLFKNIYFYMENYNISSNNREITISGTFTEKLCFVCGHLMLRSVRRCYLYAEYVQLEVMPNDIQIYIARKMSIITCQINPEYIENLEMLRNINFIENNSSCKPNDDGIILYDGVNRGTICFRCGNLLFKSPQKCYKYYNKPISVEIEPSFLKIYRVPIPMSITCVVKPEEIIHKDLISNIHFFKNNSTMNESPIRTVLYDGLDRGEICFTCGYFSLIQASRCYMPFKKVITLSISPVNMEIYFYMKPFTISCIIDPKIVFTLITDFVFLINNSTIPADSQLQIKYDGKKRGTICFQCGNSMLFTPLKCFLFFGIKVDLEIRPLDTIVYIHKKEMNITCEIISNETIDEKLLPPIHFFTNNLNITPWSPRVIIYDGINRGLICFECGNQYFRSKKRCYSFYSYRMNITIFPDLTKIFFPNMLMIVYCDVQPVEVITMKFVTDIDFNYCNSTFVNQTDRIYLIDGKS--------FGTICFRCGSIMIDNVTRCYTRFEKKIRLYIVPNDTEIYMPNKTEIVKCLVDP--EIVDSLMDDIEFINYTLPLRRISKSIAVVTGINLGKIVFYCGNFLLGIVSRSYNYYDIPITLRILPNITKIYIANQRMNIICDVSPIEVVIKKMLYNVGFKFNNSTFKPKTPRLIMIDGRDVGRFCVECGHRNLESVQRCYNYYDPPGILNYVSDI------------------------------DFNENNSPFISTIPRVIEITGTNVSRISLKCGNL-LKNTSKFYDYYDKDVSLNINPNYTKIYLPNKILFITCNSNPPELIDENKLLNVSFIFNNSTFPLINERTLRISGKDVGRFCVLCGHRLLRTVRKCYMYYGQNVVINILPSNTKIYFPNTVIEIICHVEP 4866
            C+   PNYYLLPKRMNEYFINMEMFIYCFPLDDFILLTVDSYEIDKKNSSIAGIGGLPNKSNLTLCAYCYTLVKVYPLRCFTPK LIIAILPENTEYYEFAKSFDVYCILKTKTHLFNGSSLGLKLTANNTSIQNVNATYFVLSGVDDGTVCFSCNSILSNTV KCYKFKPLNVVISIEPSDTKIYLPNKSLSIKCSVNPDIFNNKKDIIQFLYYNGSYSKVYPQNLVTSRKNTQTICVICGNRIITNFSCYFCFKEKIILKIEPNFTDVFVNNIKMVVRCTVEPEKVIKENLFKNIYFY+EN+NI+SNNREITISGTFTEKLCFVCGHLMLRSVRRCYLYAEYVQLEVMPNDIQIYIARKMS+ITCQINPEYIENL++LRNINFIENNSSCKPNDDGIILYDGVNRGTICFRCGNLLFKSPQKCYKYYNKPISVEIEPSFLKIYRVPIPMSI CVVKPEEIIHKDLISNIHF KNNSTMNESP RTVLYDG+DRGEICFTCGYFSLIQASRCYMPFKKVITLSISPVNMEIYFYMKPFTISCIIDPKIVFTLITDFVFLINNSTIPADSQLQIKYDGKKRGTICFQCGNSMLFTPLKCFLFFGIKVDLEIRPLDTIVYIHKKEMNITCEIISNETIDEKLLPPIHFFTNNLNITPWSPRVIIYDGINRGLICFECGNQYFRSKKRCYSFY+  +++ IFPD+T I+F N   ++ C + P EVIT K +T + F+      VN TD +Y  D  +        +  IC  C   +  +V RCY  +  ++ + I P+ T+I+ PN   IV C V P   I    + DI+F          +  I ++ G + G I F CG+ ++  V+R Y  +D  I L I+PN T+IY+ N+   + C V P   ++  ++ ++ F       +  +  + ++ G ++G+    CG+  L  V R YNYYD P  L  + +I                               F  NNS F    PR+I I G +V R  ++CG+  L++  + Y+YYDK +SL I P   ++Y+P   + I+C+S P E+I  + + ++   FNN     I++    +S     R C  C   +L    +CY  Y   + + I+P NT +Y       + C ++P
Sbjct:  901 CYDPHPNYYLLPKRMNEYFINMEMFIYCFPLDDFILLTVDSYEIDKKNSSIAGIGGLPNKSNLTLCAYCYTLVKVYPLRCFTPKALIIAILPENTEYYEFAKSFDVYCILKTKTHLFNGSSLGLKLTANNTSIQNVNATYFVLSGVDDGTVCFSCNSILSNTVKKCYKFKPLNVVISIEPSDTKIYLPNKSLSIKCSVNPDIFNNKKDIIQFLYYNGSYSKVYPQNLVTSRKNTQTICVICGNRIITNFSCYFCFKEKIILKIEPNFTDVFVNNIKMVVRCTVEPEKVIKENLFKNIYFYIENHNITSNNREITISGTFTEKLCFVCGHLMLRSVRRCYLYAEYVQLEVMPNDIQIYIARKMSMITCQINPEYIENLDLLRNINFIENNSSCKPNDDGIILYDGVNRGTICFRCGNLLFKSPQKCYKYYNKPISVEIEPSFLKIYRVPIPMSIICVVKPEEIIHKDLISNIHFLKNNSTMNESPKRTVLYDGIDRGEICFTCGYFSLIQASRCYMPFKKVITLSISPVNMEIYFYMKPFTISCIIDPKIVFTLITDFVFLINNSTIPADSQLQIKYDGKKRGTICFQCGNSMLFTPLKCFLFFGIKVDLEIRPLDTIVYIHKKEMNITCEIISNETIDEKLLPPIHFFTNNLNITPWSPRVIIYDGINRGLICFECGNQYFRSKKRCYSFYN-DISVEIFPDITTIYFVNSTFVINCVIIPFEVITKKLITGVRFH------VNYTDVLYSNDFTASFSNVPPPYPIICGTCWHRIFFHVERCYYPYGYRMNITIFPDLTKIFFPNMLMIVYCDVQPLEVITMKFVTDIDFNYCNSTFVNQTDRIYLIDGKSFGTICFRCGSIMIDNVTRCYTRFDKKIRLYIVPNDTEIYMPNKTEIVKCLVDP--EIVDSLMDDIEFINYTLPLRRISKSIAVVTGINLGKIVFNCGNFLLGIVSRSYNYYDIPITLRILPNITKIYIANQRMNIICDVSPIEVVIKKMLYNVGFKFNNSTFKPKTPRLIIIDGRDVGRFCVECGHRNLESVQRCYNYYDKQISLEIYPTNIEVYIPGVPMHISCDSTPKEVIYLDLITDIKLNFNNIWSTRISDTQAILSTSAKTRICYTCESSILNLKLRCYTAYDTPINLTIMPLNTNVYIFTKTFHVKCLIKP 2060          

HSP 2 Score: 935.636 bits (2417), Expect = 0.000e+0
Identity = 626/1594 (39.27%), Postives = 876/1594 (54.96%), Query Frame = 1
Query:  286 FIEPKTTFCYYS----DVVSLISCKKSLPKGYTLELDTQDFVKLSPGVSQIGGKFSKSNQTICAWCEYYGMKTPKHCFHYFERKPSLYVFPVENYYIIGLPPNVSCELTPEDARDCYKNIEL-SFKDKSTTGNLNGQDSQKLCFQCTH-SDFIKVIKCYEPKKRIIKNSMFHALSPKKLNFFFDQISMKISCEPENNLIKLQVNEKYIKRISQSRVKIGN--SSSNITMIYAFCVMGRYTFPRRRFNKFRGPVEFYFNIAGNSYPIGRPLNVLCNIRPPDAIIN--KALVKLISNGKVHSGQLNGKNISEICFECYSICEGCFSIP--KIKRCLSPGINSFLYPSSHTAYFTEKRIDIVCDPYTADSGLRVRSDEIKWNDFRFISIGGFYSMSNRSICVYCFSSLYVNPLICFT-HLPNYYLLPKRMNEYFINMEMFIYCFPLDDFILLTVDSY--EIDKKNSSIAGIGG----LPNKSNLTLCAYCYTLVKVYPLRC--FTPKVLIIAILPENTEYYEFAKSFDVYCILKTKTHLFNGSSLGLKLTANNTSIQNVNATYFVLSGVDDGTVCFSC-NSILSN-TVTKCYKFKPLNVVISIEPSDTKIYLPNKSLSIKCSVNPDIFNNKKDIIQFLYYNGSYSKVYPQN--LVTSRKNTQTICVICGNRIITNFSCYFCFKEKIILKIEPNFTDVFVNNIKMVVRCTVEPEKVIKENLFKNIYFYMENYNISSNNREITI-SGTFTEKLCFVCGHLMLRSVRRCY-LYAEYVQLEVMPNDIQIY-IARKMSIITCQINPEYIENLEMLRNINFIENNSSCKPNDDGIILYDGVNRGTICFRCGNLLFKSPQKCYKYYNKPISVEIEPSFLKIYRVPIPMSITCVVKPEEIIHKDLISNIHFFKNNSTMNESPIRTVLYDGLDRGEICFTCGYFSLIQASRCYMPFKKVITLSISPVNMEIYFYMKPFTISC--IIDPKIVFTLITDFVFLINNSTIPADSQLQIKYDGKKRGTICFQCGNSMLFTPLKCFLFFGIKVDLEIRPLDTIVYIHKKEMNITCEIISNETIDEKLLPPIHFFTNNLNITPWSPRVIIYDGIN--RGLICFECGNQYFRSKKRCYSFYSYRMNITIFPDLTKIFFPNMLMIVYCDVQPVEVITMKFVTDIDFNYCNSTFVNQTDRIYLIDGKSFGTICFRCGSIMIDNVTRCYTRFEKKIRLYIVPNDTEIYMPNKTEIVKCLVDPEIVDSLMDDIEFINYTLPLRRISKSIAVVTGINLGKIVFYCGNFLLGIVSRSYNYYDIPITLRILPNITKIYIANQRMNIICDVSPIEVVIKKMLYNVGFKFNNSTFKPKTPRLIMIDGRDVGRFCVECGHRNLESVQRCYNYYDP---------------PGI---------------LNYVSDIDFNENN--SPFISTIPRVIEITGTNVSRISLKCGNLLKNTS-KFYDYYDKDVSLNINPNYTKIYLPNKILFITCNSNPPELIDENKLL--NVSFIFNNSTFPLINERTLRISGKDVGRFCVLCGHRLLRTVRKCYMYYGQNVVINILPSNTKIYFPNTVIEIICHVEP 4866
            F+ P +   Y++    D+V   S   S  +  + E+   DF  +S     IGG +S SN++IC +C       P  CF +    P L +    N Y +     V C L  +   + +KNI+L  +     +G +NG+D  ++C+QC   +D I      + KK +I +     L P   N +F  +  +I C P  N I  +V+   I   S     IGN  + +N T    +C+   +  P+  +  F         + G  Y IG+ +N+LC + P  ++ N     +  +  G+  SG L+G +I ++CF C   C  C  +P     +C  P  N +L P     YF    + I C P      L V S EI   +     IGG  + SN ++C YC++ + V PL CFT       +LP+    Y       +YC       L    S   ++   N+SI  +      L    + T+C  C +++     +C  F P  ++I+I P +T+ Y   KS  + C       +FN     ++    N S   V     V S  +  T+C  C N I++N +   C+K K   +++ IEP+ T +++ N  + ++C+V P+    K+++ + +Y+      +   N  +  S   T+ +C +CG+ ++ +    + + E + L++ PN   +++     ++ C + PE +   +L +NI F   N +   N+  I +  G     +CF CG+L+ +S ++CY  Y + + +E+ P+ ++IY +   MSII C + PE I + +++ NI+F++NNS+   +    +LYDG++RG ICF CG        +CY  + K I++ I P  ++IY    P +I+C++ P+ +    LI++  F  NNST+       + YDG  RG ICF CG   L    +C++ F   + L I P++  +Y + K   I+C  I +  I   L+    F  NN  I   S   I YDG  RG ICF+CGN    +  +C+ F+   + +EI P  T +Y       I C II  E I +KL+  + F  N  ++   +     +  +     +IC  C ++ F   +RCY  Y YRMNITIFPDLTKIFFPNMLMIVYCDVQP+EVITMKFVTDIDFNYCNSTFVNQTDRIYLIDGKSFGTICFRCGSIMIDNVTRCYTRF+KKIRLYIVPNDTEIYMPNKTEIVKCLVDPEIVDSLMDDIEFINYTLPLRRISKSIAVVTGINLGKIVF CGNFLLGIVSRSYNYYDIPITLRILPNITKIYIANQRMNIICDVSPIEVVIKKMLYNVGFKFNNSTFKPKTPRLI+IDGRDVGRFCVECGHRNLESVQRCYNYYD                PG+               L+ ++DI  N NN  S  IS    ++  +    +RI   C + + N   + Y  YD  ++L I P  T +Y+  K   + C   P    D  K L  ++ F  NNS+   IN+  +++ G +    C  CG  L++ V KCY+ Y    +I I+P++T IYFP T + I C V+P
Sbjct:  579 FLYPSSHTAYFTEKRIDIVCDPSTADSGLRVRSDEIKWNDFRFIS-----IGGFYSMSNRSICVYCFSSLYVNPLICFTHLPTLPKLTLSLPGNVYPLNRTITVYCTLNIK--TNTFKNIKLYKYDSVPDSGFINGKDIGEICYQCKQRADNISEKLLNDYKKCLIAHKP-SFLFPMDYNAYFKPVLTEIHCYPIENYIFQRVDIDEIHFNSHLSFSIGNKFNDNNFTSC-TYCLSTVFMSPKICYKFFDRAPLVDTTLPGEFYVIGKIINILCTLNPISSLRNFKNIFIYNLETGQ-DSGYLDGNDIGKVCFICIHRCRRCVVLPLQNFSKCYDPHPNYYLLPKRMNEYFINMEMFIYCFPLDDFILLTVDSYEIDKKNSSIAGIGGLPNKSNLTLCAYCYTLVKVYPLRCFTPKALIIAILPENTEYYEFAKSFDVYCILKTKTHLFNGSSLGLKLTANNTSIQNVNATYFVLSGVDDGTVCFSCNSILSNTVKKCYKFKPLNVVISIEPSDTKIYLPNKSLSIKC--SVNPDIFNNKKDIIQFLYYNGSYSKVYPQNLVTSRKNTQTICVICGNRIITNFSCYFCFKEK---IILKIEPNFTDVFVNNIKMVVRCTVEPEKVI-KENLFKNIYFYIENHNITSNNREITISGTFTEKLCFVCGHLMLRSVRRCYLYAEYVQLEVMPNDIQIYIARKMSMITCQINPEYIENLDLLRNINFIENNSSCKPNDDGIILYDGVNRGTICFRCGNLLFKSPQKCYKYYNKPISVEIEPSFLKIYRVPIPMSII-CVVKPEEIIHKDLISNIHFLKNNSTMNESPKRTVLYDGIDRGEICFTCGYFSLIQASRCYMPFKKVITLSISPVNMEIYFYMKPFTISCIIDPKIVF--TLITDFVFLINNSTIPADSQLQIKYDGKKRGTICFQCGNSMLFTPLKCFLFFGIKVDLEIRPLDTIVYIHKKEMNITCEIISNETIDEKLLPPIHFFTNNLNITPWSPRVIIYDGINRGLICFECGNQYFRSKKRCYSFYN-DISVEIFPDITTIYFVNSTFVINCVIIPFEVITKKLITGVRFHVNYTDVLYSNDFTASFSNVPPPYPIICGTCWHRIFFHVERCYYPYGYRMNITIFPDLTKIFFPNMLMIVYCDVQPLEVITMKFVTDIDFNYCNSTFVNQTDRIYLIDGKSFGTICFRCGSIMIDNVTRCYTRFDKKIRLYIVPNDTEIYMPNKTEIVKCLVDPEIVDSLMDDIEFINYTLPLRRISKSIAVVTGINLGKIVFNCGNFLLGIVSRSYNYYDIPITLRILPNITKIYIANQRMNIICDVSPIEVVIKKMLYNVGFKFNNSTFKPKTPRLIIIDGRDVGRFCVECGHRNLESVQRCYNYYDKQISLEIYPTNIEVYIPGVPMHISCDSTPKEVIYLDLITDIKLNFNNIWSTRISDTQAILSTSAK--TRICYTCESSILNLKLRCYTAYDTPINLTIMPLNTNVYIFTKTFHVKCLIKP----DNAKTLIKDIRFTENNSSSIQINDLEIKVLGNNSKIICFKCGSILIKNVSKCYIPYDYQFLIYIVPNDTNIYFPYTKVNITCVVDP 2146          

HSP 3 Score: 919.457 bits (2375), Expect = 0.000e+0
Identity = 640/1665 (38.44%), Postives = 874/1665 (52.49%), Query Frame = 1
Query:  121 GKVENHCYDHLNLLIPINSTWKVNGCLCKCQLVKNVSKIVCENCQLIIHNQTNDYFIEPKTTFCYYSDVVSLISCKKSLPKGYTLELDTQDFVKLSPGVSQIGGKFSKSNQTICAWCEYYGMKTPKHCFHYFERKPSLYVFPVENYYIIGLPPNVSCELTPEDARDCYKNIELSFKDKSTTGNLNGQDSQKLCFQCTHSDFIKVIKCYEPKKRIIKNSMFHALSPKKLNFFFDQISMKISCEPENNLIKLQVNEKYIKRISQSRVKIGNSSSNITMIYAFCVMGRYTFPRRRFNKFRGPVEFYFNIAGNSYPIGRPLNVLCNIRPPDAIINKALVKLISNGKVHSGQ-LNGKNISEICFEC---YSICEGCFSIPKIKRCLSPGINSFLYPSSHTAYFTEKRIDIVCDP--YTADSG--LRVRSDEIKWNDFRFISIGGFYSMSNRSICVYCFSSLYVNPLICFTHL--PNYYLLPKRMNEYFINMEMFIYC--FPLDDFILLTVDSYEIDKKNSSIAGIGGLPNKSNL--------TLCAYCYTLVKVYPLRCFTPKVLIIAILPENTEYYEFAKSFDVYCILKTKTHLFNGSSLGLKLTANNTSIQNVNATYFVLSGVDDGTVCFSCNSILSNTVTKCYKFKPLNVVISIE-PSDTKIYLPNKSLSIKCSVNPDIFNNKKDIIQFLYYNGSYSKVYPQNLVTSRKNTQTICVICGNRIITNFSCYFCFKEKIILKIEPNFT-----DVFVNNIKMVVRCTVEPEKVIKENLFKNIYFYMENYNISSNNREITISGTFTEK---LCFVCGHLMLRSVRRCYLYAEYVQLEVMPNDIQIYIARKMSIITCQINPEYIENLEMLRNINFIENNSSCKPNDDGIILYDGVNRGTICF-------RCGNLLFKSPQKCYK----YYNKP-------ISVEIEPSFLKIYRVPIPMSITCVVKPEEIIHKD-LISNIHFFKNNSTMNESPIRTVLYDGLDRGEICFTCGYFSLIQASRCYMPFKKVITLSISPVNMEIYFYMKPFTISCIIDPKIVFTLITDFVFLI--NNSTIPADSQLQIKYDGKKRGTICFQCGNSMLFTPLKCFLFFGIKVDLEIRPLDTIVYIHKKEMNITCEIISNETIDEKLLPPIHFFTNNLNITPWSPRVIIYDGINRGLICFECGNQYFRSKKRCYSFYSYRMNITIFPDLTKIFFPNMLMIVYCDVQPVEVITMKFVTDIDFNYCNSTFVNQTDRIYLIDGKSFGTICFRCGSIMIDNVTRCYTRFEKKIRLYIVPNDTEIYMPNKTEIVKCLVDPEIVDS--LMDDIEFINYTLPLRRISKSIAVVTGINLGKIVFYCGNFLLGIVSRSYNYYDIPITLRILPNITKIYIANQRMNIICDVSPIEVVIKKMLYNVGFKFNNSTFKPKTPRLIMIDGRDVGRFCVECGHRNLESVQRCYNYY----------------------------DPPGILNYVSDIDFNENNSPFISTIPRVIEITGTNVSRISLKCGN-LLKNTSKFYDYYDKDVSLNINPNYTKIYLPNKILFITCNSNPPELIDENKLLNVSFIFNNSTFPLINERTLRISGKDVGRFCVLCGHRLLRTVRKCYMYYGQNVVINILPSNTKIYFPNTVIEIICHVEPTE 4872
            GKVENHCYDHLNLLIPINSTWKVNGCLCKCQLVKNVSKIVCENCQLIIHNQTNDYFIEPKTTFCYYSDVVSLISCKKSLPKGYTLELDTQDFVKLSPGVSQIGGKFSKSNQTICAWCEYYGMKTPKHCFHYFERKPSLYVFPVENYYIIGLPPNVSCELTPEDARDCY NIELSFKDKSTTGN NGQDSQKLCFQCTHSDFIKVIKCYEPKKRIIKNSMFHALSPKKLNFFFDQISMKISCEPENNLIKLQVNEKYIKRISQSRVKIGNSSSNITMIYAFCVMGRYTFPRRRFNKF+   +F F   GN YP+GR +N  C I P + +   +    +++  +      +G +  EICF C    S+ +    I  I+ CL P     +YP+ +  YF    ++I C P  Y   SG  +   S ++ + +  +I I G+   ++  +C YCF+ L+V+  IC+     P  +      N Y I   + + C   P D  I     +  + K  S+     G  N  N+        ++C  C+++ K+   RC +P +        +T Y+   K  D+ C   T        S  +K   N+    ++   Y     + + ++C  C S L      C+   P    +++  P +  +Y  N+++++ C++N  I  N    I+   Y+       P +   + K+   IC  C  R            +K ++  +P+F      + +   +   + C      + +      I+F        +++   +I   F +     C  C   +  S + CY + +   L       + Y+  K+  I C +NP  I +L   +NI FI N  + +  D G +  DG + G +CF       RC  L  ++  KCY     YY  P       I++E     + IY  P+   I   V   EI  K+  I+ I    N S +                 +C  C     +   RC+ P  K + ++I P N E Y + K F + CI+  K      +     +  NN++I   +       G   GT+CF C + +  T  KC+ F  + V + I P DT +Y+  K ++I C +  N  I       I F   N + +   P+ ++    N   IC  CGN+   +   CY  +  ++ + I P+ T +F  N+ M+V C V+P +VI      +I F Y  +  +   +R   I G     +CF CG +M+ +V RCY  + + ++L ++PND +IY+  K  ++ C ++PE +++  L+ +I FI      +     I +  G+N G I F CGN L     + Y YY+ PI++ I P+  KIY     M+IIC V P E++ K ++ N+ F  NNST      R ++ DG D G  C  CG+ +L    RCY  +                            DP  +   ++D  F  NNS   +     I+  G     I  +CGN +L    K + ++   V L I P  T +Y+  K + ITC     E IDE  L  + F  NN      + R +   G + G  C  CG++  R+ ++CY +Y  ++ + I P  T IYF N+   I C + P E
Sbjct:   25 GKVENHCYDHLNLLIPINSTWKVNGCLCKCQLVKNVSKIVCENCQLIIHNQTNDYFIEPKTTFCYYSDVVSLISCKKSLPKGYTLELDTQDFVKLSPGVSQIGGKFSKSNQTICAWCEYYGMKTPKHCFHYFERKPSLYVFPVENYYIIGLPPNVSCELTPEDARDCYTNIELSFKDKSTTGNPNGQDSQKLCFQCTHSDFIKVIKCYEPKKRIIKNSMFHALSPKKLNFFFDQISMKISCEPENNLIKLQVNEKYIKRISQSRVKIGNSSSNITMIYAFCVMGRYTFPRRRFNKFKILPKFEFTFPGNFYPLGRQINFDCFITPNETVEYFSNFNFLNSKNLSLPIFFDGSDKGEICFTCSLNLSLYDNTEYIKPIQTCLFPIPYLAMYPTEYKYYFFTIYVNIYCMPLNYLLKSGKIITNSSSQVLYKNDTYILIRGYNFTTSPIVCGYCFAGLFVSSKICYKFFGGPVEFYFNIAGNSYPIGRPLNVLCNIRPPDAII-----NKALVKLISNGKVHSGQLNGKNISEICFECYSICEGCFSIPKIK--RCLSPGINSFLYPSSHTAYFT-EKRIDIVCDPSTADSGLRVRSDEIKW--NDFRFISIGGFY----SMSNRSICVYCFSSLYVNPLICFTHLPTLPKLTLSLPGN--VYPLNRTITVYCTLN--IKTNTFKNIKLYKYDSV-----PDSGFINGKDIGEICYQCKQRADNISEKLLNDYKKCLIAHKPSFLFPMDYNAYFKPVLTEIHCYPIENYIFQRVDIDEIHF--------NSHLSFSIGNKFNDNNFTSCTYCLSTVFMSPKICYKFFDRAPLVDTTLPGEFYVIGKIINILCTLNP--ISSLRNFKNI-FIYNLETGQ--DSGYL--DGNDIGKVCFICIHRCRRCVVLPLQNFSKCYDPHPNYYLLPKRMNEYFINME-----MFIYCFPLDDFILLTVDSYEIDKKNSSIAGIGGLPNKSNLT----------------LCAYCYTLVKVYPLRCFTP--KALIIAILPENTEYYEFAKSFDVYCILKTKTHLFNGSSLGLKLTANNTSIQNVNATYFVLSGVDDGTVCFSCNSILSNTVKKCYKFKPLNVVISIEPSDTKIYLPNKSLSIKCSV--NPDIFNNKKDIIQFLYYNGSYSKVYPQNLVTSRKNTQTICVICGNRII-TNFSCYFCFKEKIILKIEPNFTDVFVNNIKMVVRCTVEPEKVIKENLFKNIYF-YIENHNITSNNREITISGTFTEKLCFVCGHLMLRSVRRCYL-YAEYVQLEVMPNDIQIYIARKMSMITCQINPEYIENLDLLRNINFIENNSSCKPNDDGIILYDGVNRGTICFRCGNLLFKSPQKCYKYYNKPISVEIEPSFLKIYRVPIPMSIICVVKPEEIIHKDLISNIHFLKNNSTMNESPKRTVLYDGIDRGEICFTCGYFSLIQASRCYMPFKKVITLSISPVNMEIYFYMKPFTISCIIDPKIVFTLITDFVFLINNSTIPADSQLQIKYDGKKRGTICFQCGNSMLFTPLKCFLFFGIKVDLEIRPLDTIVYIHKKEMNITCEIISNETIDEKLLPPIHFFTNNLNITPWSPRVIIYDGINRGLICFECGNQYFRSKKRCYSFY-NDISVEIFPDITTIYFVNSTFVINCVIIPFE 1622          

HSP 4 Score: 792.341 bits (2045), Expect = 0.000e+0
Identity = 575/1627 (35.34%), Postives = 828/1627 (50.89%), Query Frame = 1
Query:  256 LIIHNQTNDYFIEPKTTFCYYSDVVSLISCKKSLPKGYTLELDTQDFVKLSPGVS-QIGGKFSKSNQTICAWCEYYGMKTPKHCFHYFERKPSLYVFPVENYYIIGLPPNVSCELTPEDARDCYKNIEL-SFKDKSTTGNLNGQDSQKLCFQCTHSDFIKVI-------KCYEPKKRIIKNSMFHALSPKKLNFFFDQISMKISCEPENNLIKLQVNEKYIKRISQSRVKIGN--SSSNITMIYAFCVMGRYTFPRRRFNKFRGPVEFYFNIAGNSYPIGRPLNVLCNIRPPDAIINKALVKL--------ISNGKVHSGQLNGKNISEICFECYSI----CEGCFSIPKIKRCLSPGINSFLYPSSHTAYFTEKRIDIVCDPYTADSGLRVRSDEI--KWNDFRFISIGGFYSM-----------SNRSICVYCFSSLYVN--PLICFTHLPNYYLLPKRMNEYFINMEMFIYCFP---------LDDFILLTVDSYEIDKKNSSIAGIGGLPNKSNLTLCAYCYTLVKVYPLRCFT-PKVLIIAILPENTEYYEFAKSFDVYCILKTKTHLFNGSSL-GLKLTANNTSIQNVNATYFVLSGVDDGTVCFSCNSILSNTVTKCYKFKPLNVVISIEPSDTKIYLPNKSLSIKCSVNPDIFNNKKDI--IQFLYYNGSYSKVYPQNLVTSRKNTQTICVICGN-RIITNFSCYFCFKEKIILKIEPNFTDVFVNNIKMVVRCTVEPEKVIKENLFKNIYFYMENYNISSNNR-EITISGTFTEKLCFVCGHLMLRSVRRCYLY-AEYVQLEVMPNDIQIYIARKMSIITCQINPEYIENLEMLRNINFIENNSSCKPNDDGIILYDGVNRGTICFRCGNLLFKSPQKCYKYYNKPISVEIEPSFLKIYRVPIPMSITCVVKPEEIIHKDLISNIHFFKNNSTMNESPIRTVLYDGLDRGE--ICFTCGYFSLIQASRCYMPFKKVITLSISPVNMEIYFYMKPFTISCIIDPKIVFTL--ITDFVFLINNSTIPADSQLQIKYDGKKRGTICFQCGNSMLFTPLKCFLFFGIKVDLEIRPLDTIVYIHKKEMNITCEIISNETIDEKLLPPIHFFTNNLNITPWSPRVIIYDGINRGLICFECGNQYFRSKKRCYSFYSYRMNITIFPDLTKIFFPNMLMIVYCDVQPVEVITMKFVTDIDFNYCNSTFVNQTDRIYLIDGKSFGTICFRCGSIMIDNVTRCYTRFEKKIRLYIVPNDTEIYMPNKTEIVKCLVDPE--IVDSLMDDIEFINYTLPLRRISKSIAVVTGINLGKIVFYCGNFLLGIVSRSYNYYDIPITLRILPNITKIYIANQRMNIICDVSPIEVVIKKMLYNVGFKFNNSTFKPKTPRLIMIDGRDVGRFCVECGHRNLESVQRCYNYYD----------------------------PPGILNYVSDIDFNENNSPFISTIPRVIEITGTNVSRISLKCGNLLKNTSKFYDYYDKDVSLNINPNYTKIYLPNKILFITCNSNPPELIDENKLLNVSFIFNNSTFPLINERTLRISGKDVGRFCVLCGHRLLRTVRKCYMYYGQNVVINILPSNTKIYFPNTVIEIICHVEPTE 4872
            LI H  +   F+ P     Y+  V++ I C     + Y  +    D +  +  +S  IG KF+ +N T C +C      +PK C+ +F+R P +       +Y+IG   N+ C L P  +   +KNI + + +    +G L+G D  K+CF C H     V+       KCY+P          + L PK++N +F  + M I C P ++ I L V+   I + + S   IG   + SN+T+  A+C      +P R F   +  +          Y   +  +V C ++    + N + + L        I N       L+G +   +CF C SI     + C+    +   +S      + PS    Y   K + I C          V  D    K +  +F+   G YS            + ++ICV C + +  N     CF       + P   + +  N++M + C           L   I   ++++ I   N  I   G    K    LC  C  L+     RC+   + + + ++P + + Y   K   + C +  + ++ N   L  +    NN+S +  +    +  GV+ GT+CF C ++L  +  KCYK+    + + IEPS  KIY     +SI C V P+   +K  I  I FL  N + ++   + ++    +   IC  CG   +I    CY  FK+ I L I P   +++       + C ++P+ V    L  +  F + N  I ++++ +I   G     +CF CG+ ML +  +C+L+    V LE+ P D  +YI +K   ITC+I      + ++L  I+F  NN +  P    +I+YDG+NRG ICF CGN  F+S ++CY +YN  ISVEI P    IY V     I CV+ P E+I K LI+ + F  N + +  S   T  +  +      IC TC +       RCY P+   + ++I P   +I+F      + C + P  V T+  +TD  F   NST    +      DGK  GTICF+CG+ M+    +C+  F  K+ L I P DT +Y+  K   + C ++  E +D  L+  I F    L +   S  + +  GIN G I F CGN       R Y++Y   + + I P++TKI+  N  M + CDV P+EV+  K + ++ F + NSTF  +T R+ +IDG+  G  C  CG   +++V RCY  ++K+I L I P + E+Y+P     + C   P+  I   L+ DI+     +   RIS + A+++     +I + C + +L +  R Y  YD PI L I+P  T +YI  +  ++ C + P     K ++ ++ F  NNS+        I + G +    C +CG   +++V +CY  YD                            PPGILNYVSDIDFNENNSPFISTIPRVIEITGTNVSRISLKCGNLLKNTSKFYDYYDKDVSLNINPNYTKIYLPNKIL+ITCNSNPPELIDENKLLNVSFIFNNSTFPLINERTLRISGKDVGRFCVLCGHRLLRTVRKCYMYYGQNVVINILPSNTKIYFPNTVIEIICHVEPTE
Sbjct:  736 LIAHKPS---FLFPMDYNAYFKPVLTEIHCYPI--ENYIFQRVDIDEIHFNSHLSFSIGNKFNDNNFTSCTYCLSTVFMSPKICYKFFDRAPLVDTTLPGEFYVIGKIINILCTLNPISSLRNFKNIFIYNLETGQDSGYLDGNDIGKVCFICIHRCRRCVVLPLQNFSKCYDPHPN-------YYLLPKRMNEYFINMEMFIYCFPLDDFILLTVDSYEIDKKNSSIAGIGGLPNKSNLTLC-AYCYTLVKVYPLRCFTP-KALIIAILPENTEYYEFAKSFDVYCILKTKTHLFNGSSLGLKLTANNTSIQNVNATYFVLSGVDDGTVCFSCNSILSNTVKKCYKFKPLNVVIS------IEPSDTKIYLPNKSLSIKCS---------VNPDIFNNKKDIIQFLYYNGSYSKVYPQNLVTSRKNTQTICVICGNRIITNFSCYFCFKEKIILKIEPNFTDVFVNNIKMVVRCTVEPEKVIKENLFKNIYFYIENHNITSNNREITISGTFTEK----LCFVCGHLMLRSVRRCYLYAEYVQLEVMPNDIQIYIARKMSMITCQINPE-YIENLDLLRNINFIENNSSCKPNDDGIILYDGVNRGTICFRCGNLLFKSPQKCYKYYNKPISVEIEPSFLKIYRVPIPMSIICVVKPEEIIHKDLISNIHFLKNNSTMNESPKRTVLYDGIDRGEICFTCGYFSLIQASRCYMPFKKVITLSISPVNMEIYFYMKPFTISCIIDPKIVF--TLITDFVFLINNSTIPADSQLQIKYDGKKRGTICFQCGNSMLFTPLKCFLFFGIKVDLEIRPLDTIVYIHKKEMNITCEIISNETIDEKLLPPIHFFTNNLNITPWSPRVIIYDGINRGLICFECGNQYFRSKKRCYSFYND-ISVEIFPDITTIYFVNSTFVINCVIIPFEVITKKLITGVRFHVNYTDVLYSNDFTASFSNVPPPYPIICGTCWHRIFFHVERCYYPYGYRMNITIFPDLTKIFFPNMLMIVYCDVQPLEVITMKFVTDIDFNYCNSTFVNQTDRIYLIDGKSFGTICFRCGSIMIDNVTRCYTRFDKKIRLYIVPNDTEIYMPNKTEIVKC-LVDPEIVDS-LMDDIEFINYTLPLRRISKSIAVVTGINLGKIVFNCGNFLLGIVSRSYNYYDIPITLRILPNITKIYIANQRMNIICDVSPIEVVIKKMLYNVGFKFNNSTFKPKTPRLIIIDGRDVGRFCVECGHRNLESVQRCYNYYDKQISLEIYPTNIEVYIPGVPMHISCDSTPKEVIYLDLITDIKLNFNNIWSTRISDTQAILSTSAKTRICYTCESSILNLKLRCYTAYDTPINLTIMPLNTNVYIFTKTFHVKCLIKPDNA--KTLIKDIRFTENNSSSIQINDLEIKVLGNNSKIICFKCGSILIKNVSKCYIPYDYQFLIYIVPNDTNIYFPYTKVNITCVVDPPGILNYVSDIDFNENNSPFISTIPRVIEITGTNVSRISLKCGNLLKNTSKFYDYYDKDVSLNINPNYTKIYLPNKILYITCNSNPPELIDENKLLNVSFIFNNSTFPLINERTLRISGKDVGRFCVLCGHRLLRTVRKCYMYYGQNVVINILPSNTKIYFPNTVIEIICHVEPTE 2321          

HSP 5 Score: 125.946 bits (315), Expect = 0.000e+0
Identity = 73/196 (37.24%), Postives = 112/196 (57.14%), Query Frame = 3
Query: 4926 MCFICGNEMFISQMRCYEFFDKEIKLSILPNDTKIFIFNQRLFVQCMVDPIEVVNRGLITNISFNFNNASSVMVNNTYIIVRGNDTKIICFKCGHITLTNVGKCYNVYYHKIKLTILPNDTLVYMRNLSMNVICRVDPLEVIXXXXXXXIRFIEYNRSVTEVSERQMFVNGVDKGKLCFTCGHRLLVPVTRCYIYY 5513
            +C  C + +F    RCY  +   + ++I P+ TKIF  N  + V C V P+EV+    +T+I FN+ N++ V   +   ++ G     ICF+CG I + NV +CY  +  KI+L I+PNDT +YM N +  V C VDP   I ++L+ +I FI Y   +  +S+    V G++ GK+ F CG+ LL  V+R Y YY
Sbjct: 1661 ICGTCWHRIFFHVERCYYPYGYRMNITIFPDLTKIFFPNMLMIVYCDVQPLEVITMKFVTDIDFNYCNSTFVNQTDRIYLIDGKSFGTICFRCGSIMIDNVTRCYTRFDKKIRLYIVPNDTEIYMPNKTEIVKCLVDP--EIVDSLMDDIEFINYTLPLRRISKSIAVVTGINLGKIVFNCGNFLLGIVSRSYNYY 1854          

HSP 6 Score: 136.732 bits (343), Expect = 1.152e-31
Identity = 71/205 (34.63%), Postives = 126/205 (61.46%), Query Frame = 3
Query: 4893 KISINVTTGEKMCFICGNEMFISQMRCYEFFDKEIKLSILPNDTKIFIFNQRLFVQCMVDPIEVVNRGLITNISFNFNNASSVMVNNTYIIVRGNDTKIICFKCGHITLTNVGKCYNVYYHKIKLTILPNDTLVYMRNLSMNVICRVDPLEVIXXXXXXXIRFIEYNRSVTEVSERQMFVNGVDKGKLCFTCGHRLLVPVTRCYI 5507
            +I+I+ T  EK+CF+CG+ M  S  RCY  + + ++L ++PND +I+I  +   + C ++P  + N  L+ NI+F  NN+S    ++  I+  G +   ICF+CG++   +  KCY  Y   I + I P+   +Y   + M++IC V P E+I+ +L+ NI F++ N ++ E  +R +  +G+D+G++CFTCG+  L+  +RCY+
Sbjct: 1212 EITISGTFTEKLCFVCGHLMLRSVRRCY-LYAEYVQLEVMPNDIQIYIARKMSMITCQINPEYIENLDLLRNINFIENNSSCKPNDDGIILYDGVNRGTICFRCGNLLFKSPQKCYKYYNKPISVEIEPSFLKIYRVPIPMSIICVVKPEEIIHKDLISNIHFLKNNSTMNESPKRTVLYDGIDRGEICFTCGYFSLIQASRCYM 1415          

HSP 7 Score: 129.028 bits (323), Expect = 2.212e-29
Identity = 78/196 (39.80%), Postives = 114/196 (58.16%), Query Frame = 3
Query: 4926 MCFICGNEMFISQMRCYEFFDKEIKLSILPNDTKIFIFNQRLFVQCMVDPIEVVNRGLITNISFNFNNASSVMVNNTYIIVRGNDTKIICFKCGHITLTNVGKCYNVYYHKIKLTILPNDTLVYMRNLSMNVICRVDPLEVIXXXXXXXIRFIEYNRSVTEVSERQMFVNGVDKGKLCFTCGHRLLVPVTRCYIYY 5513
            +CF CG+ M  +  RCY  FDK+I+L I+PNDT+I++ N+   V+C+VDP E+V+  L+ +I F         ++ +  +V G +   I F CG+  L  V + YN Y   I L ILPN T +Y+ N  MN+IC V P+EV+   +L N+ F   N +    + R + ++G D G+ C  CGHR L  V RCY YY
Sbjct: 1749 ICFRCGSIMIDNVTRCYTRFDKKIRLYIVPNDTEIYMPNKTEIVKCLVDP-EIVD-SLMDDIEFINYTLPLRRISKSIAVVTGINLGKIVFNCGNFLLGIVSRSYNYYDIPITLRILPNITKIYIANQRMNIICDVSPIEVVIKKMLYNVGFKFNNSTFKPKTPRLIIIDGRDVGRFCVECGHRNLESVQRCYNYY 1942          

HSP 8 Score: 129.028 bits (323), Expect = 2.531e-29
Identity = 79/208 (37.98%), Postives = 114/208 (54.81%), Query Frame = 3
Query: 4899 SINVTTG---EKMCFICGNEMFISQMRCYEFFDKEIKLSILPNDTKIFIFNQRLFVQCMVDPIEVVNRGLITNISFNFNNASSVMVNNTYIIVRGNDTKIICFKCGHITLTNVGKCYNVYYHKIKLTILPNDTLVYMRNLSMNVICRVDPLEVIXXXXXXXIRFIEYNRSVTEVSERQMFVNGVDKGKLCFTCGHRLLVPVTRCYIYY 5513
            SI V TG    K+ F CGN +     R Y ++D  I L ILPN TKI+I NQR+ + C V PIEVV + ++ N+ F FNN++        II+ G D    C +CGH  L +V +CYN Y  +I L I P +  VY+  + M++ C   P EVI  +L+ +I+    N   T +S+ Q  ++   K ++C+TC   +L    RCY  Y
Sbjct: 1823 SIAVVTGINLGKIVFNCGNFLLGIVSRSYNYYDIPITLRILPNITKIYIANQRMNIICDVSPIEVVIKKMLYNVGFKFNNSTFKPKTPRLIIIDGRDVGRFCVECGHRNLESVQRCYNYYDKQISLEIYPTNIEVYIPGVPMHISCDSTPKEVIYLDLITDIKLNFNNIWSTRISDTQAILSTSAKTRICYTCESSILNLKLRCYTAY 2030          

HSP 9 Score: 122.479 bits (306), Expect = 2.372e-27
Identity = 69/204 (33.82%), Postives = 117/204 (57.35%), Query Frame = 3
Query: 4902 INVTTGEKMCFICGNEMFISQMRCYEFFDKEIKLSILPNDTKIFIFNQRLFVQCMVDPIEVVNRGLITNISFNFNNASSVMVNNTYIIVRGNDTKIICFKCGHITLTNVGKCYNVYYHKIKLTILPNDTLVYMRNLSMNVICRVDPLEVIXXXXXXXIRFIEYNRSVTEVSERQMFVNGVDKGKLCFTCGHRLLVPVTRCYIYY 5513
            ++ +   ++C+ C + +   ++RCY  +D  I L+I+P +T ++IF +   V+C++ P     + LI +I F  NN+SS+ +N+  I V GN++KIICFKCG I + NV KCY  Y ++  + I+PNDT +Y     +N+ C VDP  ++  N + +I F E N        R + + G +  ++   CG+ LL   ++ Y YY
Sbjct: 2003 LSTSAKTRICYTCESSILNLKLRCYTAYDTPINLTIMPLNTNVYIFTKTFHVKCLIKPDNA--KTLIKDIRFTENNSSSIQINDLEIKVLGNNSKIICFKCGSILIKNVSKCYIPYDYQFLIYIVPNDTNIYFPYTKVNITCVVDPPGIL--NYVSDIDFNENNSPFISTIPRVIEITGTNVSRISLKCGN-LLKNTSKFYDYY 2201          

HSP 10 Score: 119.783 bits (299), Expect = 1.674e-26
Identity = 74/199 (37.19%), Postives = 118/199 (59.30%), Query Frame = 3
Query: 4920 EKMCFICGNEMFISQMRCYEFFDKEIKLSILPNDTKIFIFNQRLFVQCMVDPIEVVNRGLITNISFNFNNASSVMVNNTYIIVRGNDTKIICFKCGHITLTNVGKCYNVYYHKIKLTILPNDTLVYM-RNLSMNVICRVDPLEVIXXXXXXXIRFIEYNRSVTEVSERQMFVNGVDKGKLCFTCGHRLLVPVTRCYIYY 5513
            + +C ICGN + I+   CY  F ++I L I PN T +F+ N ++ V+C V+P +V+   L  NI F   N  ++  NN  I + G  T+ +CF CGH+ L +V +CY +Y   ++L ++PND  +Y+ R +SM + C+++P  + N +LL NI FIE N S     +  +  +GV++G +CF CG+ L     +CY YY
Sbjct: 1135 QTICVICGNRI-ITNFSCYFCFKEKIILKIEPNFTDVFVNNIKMVVRCTVEPEKVIKENLFKNIYFYIEN-HNITSNNREITISGTFTEKLCFVCGHLMLRSVRRCY-LYAEYVQLEVMPNDIQIYIARKMSM-ITCQINPEYIENLDLLRNINFIENNSSCKPNDDGIILYDGVNRGTICFRCGNLLFKSPQKCYKYY 1329          

HSP 11 Score: 116.701 bits (291), Expect = 1.252e-25
Identity = 71/209 (33.97%), Postives = 118/209 (56.46%), Query Frame = 3
Query: 4887 SLKISINVTTGEKMCFICGNEMFISQMRCYEFFDKEIKLSILPNDTKIFIFNQRLFVQCMVDPIEVVNRGLITNISFNFNNASSVMVNNTYIIVRGNDTKIICFKCGHITLTNVGKCYNVYYHKIKLTILPNDTLVYMRNLSMNVICRVDPLEVIXXXXXXXIRFIEYNRSVTEVSERQMFVNGVDKGKLCFTCGHRLLVPVTRCYIYY 5513
             L+I +     + +CF CG+ +  +  +CY  +D +  + I+PNDT I+    ++ + C+VDP  ++N   +++I FN NN+  +      I + G +   I  KCG++ L N  K Y+ Y   + L I PN T +Y+ N  + + C  +P E+I+ N LLN+ FI  N +   ++ER + ++G D G+ C  CGHRLL  V +CY+YY
Sbjct: 2084 DLEIKVLGNNSKIICFKCGSILIKNVSKCYIPYDYQFLIYIVPNDTNIYFPYTKVNITCVVDPPGILN--YVSDIDFNENNSPFISTIPRVIEITGTNVSRISLKCGNL-LKNTSKFYDYYDKDVSLNINPNYTKIYLPNKILYITCNSNPPELIDENKLLNVSFIFNNSTFPLINERTLRISGKDVGRFCVLCGHRLLRTVRKCYMYY 2289          

HSP 12 Score: 116.701 bits (291), Expect = 1.507e-25
Identity = 67/196 (34.18%), Postives = 107/196 (54.59%), Query Frame = 3
Query: 4926 MCFICGNEMFISQMRCYEFFDKEIKLSILPNDTKIFIFNQRLFVQCMVDPIEVVNRGLITNISFNFNNASSVMVNNTYIIVRGN---DTKIICFKCGHITLTNVGKCYNVYYHKIKLTILPNDTLVYMRNLSMNVICRVDPLEVIXXXXXXXIRFIEYNRSVTEVSERQMFVNGVDKGKLCFTCGHRLLVPVTRCY 5504
            +CF CGN+ F S+ RCY F++ +I + I P+ T I+  N    + C++ P EV+ + LIT + F+ N  + V+ +N +     N      IIC  C H    +V +CY  Y +++ +TI P+ T ++  N+ M V C V PLEVI    + +I F   N +    ++R   ++G   G +CF CG  ++  VTRCY
Sbjct: 1572 ICFECGNQYFRSKKRCYSFYN-DISVEIFPDITTIYFVNSTFVINCVIIPFEVITKKLITGVRFHVN-YTDVLYSNDFTASFSNVPPPYPIICGTCWHRIFFHVERCYYPYGYRMNITIFPDLTKIFFPNMLMIVYCDVQPLEVITMKFVTDIDFNYCNSTFVNQTDRIYLIDGKSFGTICFRCGSIMIDNVTRCY 1765          

HSP 13 Score: 109.768 bits (273), Expect = 1.894e-23
Identity = 66/197 (33.50%), Postives = 105/197 (53.30%), Query Frame = 3
Query: 4923 KMCFICGNEMFISQMRCYEFFDKEIKLSILPNDTKIFIFNQRLFVQCMVDPIEVVNRGLITNISFNFNNASSVMVNNTYIIVRGNDTKIICFKCGHITLTNVGKCYNVYYHKIKLTILPNDTLVYMRNLSMNVICRVDPLEVIXXXXXXXIRFIEYNRSVTEVSERQMFVNGVDKGKLCFTCGHRLLVPVTRCYIYY 5513
            + C  CG+    S  RCY ++DK+I L I P + +++I    + + C   P EV+   LIT+I  NFNN  S  +++T  I+  +    IC+ C    L    +CY  Y   I LTI+P +T VY+   + +V C + P       L+ +IRF E N S  ++++ ++ V G +   +CF CG  L+  V++CYI Y
Sbjct: 1922 RFCVECGHRNLESVQRCYNYYDKQISLEIYPTNIEVYIPGVPMHISCDSTPKEVIYLDLITDIKLNFNNIWSTRISDTQAILSTSAKTRICYTCESSILNLKLRCYTAYDTPINLTIMPLNTNVYIFTKTFHVKCLIKPDNA--KTLIKDIRFTENNSSSIQINDLEIKVLGNNSKIICFKCGSILIKNVSKCYIPY 2116          

HSP 14 Score: 109.383 bits (272), Expect = 2.318e-23
Identity = 67/197 (34.01%), Postives = 102/197 (51.78%), Query Frame = 3
Query: 4923 KMCFICGNEMFISQMRCYEFFDKEIKLSILPNDTKIFIFNQRLFVQCMVDPIEVVNRGLITNISFNFNNASSVMVNNTYIIVRGNDTKIICFKCGHITLTNVGKCYNVYYHKIKLTILPNDTLVYMRNLSMNVICRVDPLEVIXXXXXXXIRFIEYNRSVTEVSERQMFVNGVDKGKLCFTCGHRLLVPVTRCYIYY 5513
            ++CF CG    I   RCY  F K I LSI P + +I+ + +   + C++DP  V    LIT+  F  NN++    +   I   G     ICF+CG+  L    KC+  +  K+ L I P DT+VY+    MN+ C +   E I+  LL  I F   N ++T  S R +  +G+++G +CF CG++      RCY +Y
Sbjct: 1397 EICFTCGYFSLIQASRCYMPFKKVITLSISPVNMEIYFYMKPFTISCIIDPKIVFT--LITDFVFLINNSTIPADSQLQIKYDGKKRGTICFQCGNSMLFTPLKCFLFFGIKVDLEIRPLDTIVYIHKKEMNITCEIISNETIDEKLLPPIHFFTNNLNITPWSPRVIIYDGINRGLICFECGNQYFRSKKRCYSFY 1591          

HSP 15 Score: 105.145 bits (261), Expect = 4.376e-22
Identity = 58/196 (29.59%), Postives = 106/196 (54.08%), Query Frame = 3
Query: 4926 MCFICGNEMFISQMRCYEFFDKEIKLSILPNDTKIFIFNQRLFVQCMVDPIEVVNRGLITNISFNFNNASSVMVNNTYIIVRGNDTKIICFKCGHITLTNVGKCYNVYYHKIKLTILPNDTLVYMRNLSMNVICRVDPLEVIXXXXXXXIRFIEYNRSVTEVSERQMFVNGVDKGKLCFTCGHRLLVPVTRCYIYY 5513
            +CF CGN +F S  +CY++++K I + I P+  KI+     + + C+V P E++++ LI+NI F  NN++        ++  G D   ICF CG+ +L    +CY  +   I L+I P +  +Y       + C +DP   I   L+ +  F+  N ++   S+ Q+  +G  +G +CF CG+ +L    +C++++
Sbjct: 1310 ICFRCGNLLFKSPQKCYKYYNKPISVEIEPSFLKIYRVPIPMSIICVVKPEEIIHKDLISNIHFLKNNSTMNESPKRTVLYDGIDRGEICFTCGYFSLIQASRCYMPFKKVITLSISPVNMEIYFYMKPFTISCIIDP--KIVFTLITDFVFLINNSTIPADSQLQIKYDGKKRGTICFQCGNSMLFTPLKCFLFF 1503          

HSP 16 Score: 99.7525 bits (247), Expect = 2.085e-20
Identity = 51/150 (34.00%), Postives = 87/150 (58.00%), Query Frame = 3
Query: 4896 ISINVTTGEKMCFICGNEMFISQMRCYEFFDKEIKLSILPNDTKIFIFNQRLFVQCMVDPIEVVNRGLITNISFNFNNASSVMVNNTYIIVRGNDTKIICFKCGHITLTNVGKCYNVYYHKIKLTILPNDTLVYMRNLSMNVICRVDPLE 5345
            I I  T   ++   CGN +  +  + Y+++DK++ L+I PN TKI++ N+ L++ C  +P E+++   + N+SF FNN++  ++N   + + G D    C  CGH  L  V KCY  Y   + + ILP++T +Y  N  + +IC V+P E
Sbjct: 2173 IEITGTNVSRISLKCGN-LLKNTSKFYDYYDKDVSLNINPNYTKIYLPNKILYITCNSNPPELIDENKLLNVSFIFNNSTFPLINERTLRISGKDVGRFCVLCGHRLLRTVRKCYMYYGQNVVINILPSNTKIYFPNTVIEIICHVEPTE 2321          

HSP 17 Score: 83.1889 bits (204), Expect = 1.931e-15
Identity = 54/186 (29.03%), Postives = 94/186 (50.54%), Query Frame = 3
Query: 4926 MCFICGNEMFISQMRCYEFFDKEIKLSILPNDTKIFIFNQRLFVQCMVDPIEVVNRGLITNISFNFNNASSVMVNNTYIIVRGNDTKIICFKCGHITLTNVGKCYNVYYHKIKLTILPNDTLVYMRNLSMNVICRVDPLEVIXXXXXXXIRFIEYNRSVTEVSERQMFVNGVDKGKLCFTCGHRLL 5483
            +C  C   + +  +RC  F  K + ++ILP +T+ + F +   V C++     +  G    +    NN S   VN TY ++ G D   +CF C  I    V KCY      + ++I P+DT +Y+ N S+++ C V+P   I NN    I+F+ YN S ++V  + +  +  +   +C  CG+R++
Sbjct:  965 LCAYCYTLVKVYPLRC--FTPKALIIAILPENTEYYEFAKSFDVYCILKTKTHLFNGSSLGLKLTANNTSIQNVNATYFVLSGVDDGTVCFSCNSILSNTVKKCYKFKPLNVVISIEPSDTKIYLPNKSLSIKCSVNP--DIFNNKKDIIQFLYYNGSYSKVYPQNLVTSRKNTQTICVICGNRII 1146          
BLAST of SMED30009724 vs. Planmine SMEST
Match: SMESG000001254.1 (SMESG000001254.1)

HSP 1 Score: 660.603 bits (1703), Expect = 0.000e+0
Identity = 364/582 (62.54%), Postives = 416/582 (71.48%), Query Frame = 1
Query:  121 GKVENHCYDHLNLLIPINSTWKVNGCLCKCQLVKNVSKIVCENCQLIIHNQTNDYFIEPKTTFCYYSDVVSLISCKKSLPKGYTLELDTQDFVKLSPGVSQIGGKFSKSNQTICAWCEYYGMKTPKHCFHYFERKPSLYVFPVENYYIIGLPPNVSCELTPEDARDCYKNIELSFKDKSTTGNLNGQDSQKLCFQCTHSDFIKVIKCYEPKKRIIKNSMFHALSPKKLNFFFDQISMKISCEPENNLIKLQVNEKYIKRISQSRVKIGNSSSNITMIYAFCVMGRYTFPRRRFNKFRGPVEFYFNIAGNSYPIGRPLNVLCNIRPPDAIINKALVKLISNGKVHSGQ-LNGKNISEICFEC---YSICEGCFSIPKIKRCLSPGINSFLYPSSHTAYFTEKRIDIVCDP--YTADSG--LRVRSDEIKWNDFRFISIGGFYSMSNRSICVYCFSSLYVNPLICFTHL--PNYYLLPKRMNEYFINMEMFIYC--FPLDDFILLTVDSYEIDKKNSSIAGIGGLPNKSNL--------TLCAYCYTLVKVYPLRCFTPKVLIIAILPENTEYYEFAKSFDVYC 1806
            GKVENHCYDHLNLLIPINSTWKVNGCLCKCQLVKNVSKIVCENCQLIIHNQTNDYFIEPKTTFCYYSDVVSLISCKKSLPKGYTLELDTQDFVKLSPGVSQIGGKFSKSNQTICAWCEYYGMKTPKHCFHYFERKPSLYVFPVENYYIIGLPPNVSCELTPEDARDCY NIELSFKDKSTTGN NGQDSQKLCFQCTHSDFIKVIKCYEPKKRIIKNSMFHALSPKKLNFFFDQISMKISCEPENNLIKLQVNEKYIKRISQSRVKIGNSSSNITMIYAFCVMGRYTFPRRRFNKF+   +F F   GN YP+GR +N  C I P + +   +    +++  +      +G +  EICF C    S+ +    I  I+ CL P     +YP+ +  YF    ++I C P  Y   SG  +   S ++ + +  +I I G+   ++  +C YCF+ L+V+  IC+     P  +      N Y I   + + C   P D  I   +     + K  S     G  N  N+        ++C  C+++ K+   RC +P +        +T Y+   K  D+ C
Sbjct:   30 GKVENHCYDHLNLLIPINSTWKVNGCLCKCQLVKNVSKIVCENCQLIIHNQTNDYFIEPKTTFCYYSDVVSLISCKKSLPKGYTLELDTQDFVKLSPGVSQIGGKFSKSNQTICAWCEYYGMKTPKHCFHYFERKPSLYVFPVENYYIIGLPPNVSCELTPEDARDCYTNIELSFKDKSTTGNPNGQDSQKLCFQCTHSDFIKVIKCYEPKKRIIKNSMFHALSPKKLNFFFDQISMKISCEPENNLIKLQVNEKYIKRISQSRVKIGNSSSNITMIYAFCVMGRYTFPRRRFNKFKILPKFEFTFPGNFYPLGRQINFDCFITPNETVEYFSNFNFLNSKNLSLPIFFDGSDKGEICFTCSLNLSLYDNTEYIKPIQTCLFPIPYLAMYPTEYKYYFFTIYVNIYCMPLNYLLKSGKIITNSSSQVLYKNDTYILIRGYNFTTSPIVCGYCFAGLFVSSKICYKFFGGPVEFYFNIAGNSYPIGRPLNVLCNIRPPDAIINKALVKLISNGKVHS-----GQLNGKNISEICFECYSICEGCFSIPKI--KRCLSPGINSFLYPSSHTAYFT-EKRIDIVC 603          

HSP 2 Score: 367.466 bits (942), Expect = 3.693e-110
Identity = 223/425 (52.47%), Postives = 273/425 (64.24%), Query Frame = 1
Query:  289 IEPKTTFCYYSDVVSLISCKKSLPKGYTLELDTQD--FVKLSPGVSQIGGKFSKSNQT-ICAWCEYYGMKTPKHCFHYFERKPSL-YVFPVENYYIIGLPPNVSCELTPEDARDCYKNIE-LSFKDKSTTGNLNGQDSQKLCFQCT-------HSDFIKVIK-CYEPKKRIIKNSMFHALSPKKLNFFFDQISMKISCEPENNLIKLQVNEKYIKRISQSRVKIGNSS---------SNITMIYAFCVMGRYTFPRRRFNKFRGPVEFYFNIAGNSYPIGRPLNVLCNIRPPDAIINKALVKLISNGKVHSGQLNGKNISEICFECYSICEGCFSIPKIKRCLSPGINSFLYPSSHTAYFTEKRIDIVCDPYTADSGLRVRSDEIKWNDFRFISIGGFYSMSNRSICVYCFSSLYVNPLICFTHL 1497
            + PK    ++  +   ISC+   P+   ++L   +    ++S    +IG   S SN T I A+C       P+  F+ F+  P   + FP  N+Y +G   N  C +TP +  + + N   L+ K+ S     +G D  ++CF C+       ++++IK I+ C  P   +       A+ P +  ++F  I + I C P N L+K       I   S S+V   N +         +   ++  +C  G +   +  +  F GPVEFYFNIAGNSYPIGRPLNVLCNIRPPDAIINKALVKLISNGKVHSGQLNGKNISEICFECYSICEGCFSIPKIKRCLSPGINSFLYPSSHTAYFTEKRIDIVCDP TADSGLRVRSDEIKWNDFRFISIGGFYSMSNRSICVYCFSSLYVNPLICFTHL
Sbjct:  252 LSPKKLNFFFDQISMKISCE---PENNLIKLQVNEKYIKRISQSRVKIGN--SSSNITMIYAFCVMGRYTFPRRRFNKFKILPKFEFTFP-GNFYPLGRQINFDCFITPNETVEYFSNFNFLNSKNLSLPIFFDGSDKGEICFTCSLNLSLYDNTEYIKPIQTCLFPIPYL-------AMYPTEYKYYFFTIYVNIYCMPLNYLLK----SGKIITNSSSQVLYKNDTYILIRGYNFTTSPIVCGYCFAGLFVSSKICYKFFGGPVEFYFNIAGNSYPIGRPLNVLCNIRPPDAIINKALVKLISNGKVHSGQLNGKNISEICFECYSICEGCFSIPKIKRCLSPGINSFLYPSSHTAYFTEKRIDIVCDPSTADSGLRVRSDEIKWNDFRFISIGGFYSMSNRSICVYCFSSLYVNPLICFTHL 659          

HSP 3 Score: 77.0258 bits (188), Expect = 9.428e-14
Identity = 126/529 (23.82%), Postives = 213/529 (40.26%), Query Frame = 1
Query: 2707 TICFRCGNLLFKSPQKCYKYYNKPISVEIEPSFLKIYRVPIPMSITCVVKPEEIIHKDLISNIHF-FKNNSTMNESPIRTVLYDGLDRGEICFTCGYFSLIQASRCYMPFKKVITLS----ISPVNMEIYFYMKPFTISCIIDPKIVFTLITDFVFLINNSTIPADSQLQIKYDGKKRG-TICFQ-CGNSMLFTPLKCFLFFGIKVDLEIRPLDTIVYIHKKEMNITCEIISNETIDEKLLPPIHF----FTNNLNITPWSPRVIIYDGINRGLICFECG--------NQYFRSKKRCYSFYSYRMNITIFPDLTKIFFPNMLMIVYCDVQPVEVITMKFVTDIDFNYCNSTFVNQTDRIYLIDGKSFGT---ICFRCGSIMIDNVTRCYTRFEKKIRLY--IVPNDTEIYMPNKTEIVKCLVDPEIVDSLMDDIEFINYTLPLRRISKS---IAVVTGINLGKIVFYCGNFLLGIVSRSYNYYDIPITLRIL---------PNITKIYIANQRMNIICDVSPIEVVIK 4185
            TIC  C     K+P+ C+ Y+ +  S+ + P     Y + +P +++C + PE+   +D  +NI   FK+ ST           +G D  ++CF C +   I+  +CY P K++I  S    +SP  +  +F      ISC  +  ++          +N   I   SQ ++K        T+ +  C       P + F  F I    E        Y   +++N  C I  NET++       +F    F N+ N++      I +DG ++G ICF C          +Y +  + C     Y   + ++P   K +F  + + +YC      + + K +T+      +S  + + D   LI G +F T   +C  C + +  +   CY  F   +  Y  I  N   I  P     V C + P       D I  IN  L ++ IS        + G N+ +I F C +   G  S       IP   R L         P+    Y   +R++I+CD S  +  ++
Sbjct:  141 TICAWCEYYGMKTPKHCFHYFERKPSLYVFP-VENYYIIGLPPNVSCELTPEDA--RDCYTNIELSFKDKSTTGNP-------NGQDSQKLCFQCTHSDFIKVIKCYEPKKRIIKNSMFHALSPKKLNFFFDQISMKISCEPENNLI-------KLQVNEKYIKRISQSRVKIGNSSSNITMIYAFCVMGRYTFPRRRFNKFKILPKFEFT-FPGNFYPLGRQINFDCFITPNETVE-------YFSNFNFLNSKNLS----LPIFFDGSDKGEICFTCSLNLSLYDNTEYIKPIQTCLFPIPY---LAMYPTEYKYYFFTIYVNIYCMPLNYLLKSGKIITN-----SSSQVLYKNDTYILIRGYNFTTSPIVCGYCFAGLFVSSKICYKFFGGPVEFYFNIAGNSYPIGRPLN---VLCNIRPP------DAI--INKAL-VKLISNGKVHSGQLNGKNISEICFECYSICEGCFS-------IPKIKRCLSPGINSFLYPSSHTAYFTEKRIDIVCDPSTADSGLR 613          

HSP 4 Score: 75.0998 bits (183), Expect = 3.456e-13
Identity = 148/641 (23.09%), Postives = 249/641 (38.85%), Query Frame = 1
Query: 1477 LICFTHLPNYYLLPKRMNEYFINMEMFIYCF-PLDDFILLTVDSYEIDKKNSSIAGIGGLPNKSNLTLCAYCYTLVKVYPLRCF-----TPKVLIIAILPENTEYYEFAKSFDVYCILKTKTHLFNGSSLGLKLTANNTSIQNVNATYFVLSGVDDGTVCFSCNSILSNTVTKCYKFKPL----NVVISIEPSDTKIYLPNKSLSIKCSVNPDIFNNKKDIIQFLYYNGSYSKVYPQNLVTSRKNTQTICVICGNRIITNFSCYFCFKEKIILKIEPNFTDVFVNNIKMVVR-----CTVEPEKVIKENLFKNIYFYMENYN-ISSNNREITI--SGTFTEKLCFVCGHLM--------LRSVRRCYLYAEYVQLEVMPNDIQIYIARKMSIITCQINPEYIENLEMLRNINFIENNSS-CKPNDDGIILYDGVNRGT---ICFRCGNLLFKSPQKCYKYYNKPISVEIEPSFLKIYRVPIPMSITCVVK-PEEIIHKDLISNIHFFKNNSTMNESPIRTVLYDGLDRGEICFTC-----GYFSLIQASRCYMPFKKVITLSISPVNMEIYFYMKPFTISCIIDPKIVFTLITDFVFLINNSTIPADSQLQIKYDG---KKRGTICFQCGNSMLFTPLKCF 3282
            LI      +Y++ PK    Y+ ++   I C   L     L +D+ +  K +  ++ IGG  +KSN T+CA+C       P  CF      P + +  +  EN  YY      +V C L  +      +++ L     +T+  N N       G D   +CF C       V KCY+ K      ++  ++ P     +    S+ I C    ++          L  N  Y K   Q+ V    ++  I +I    ++  ++  F  +     KI P F   F  N   + R     C + P + ++         Y  N+N ++S N  + I   G+   ++CF C   +        ++ ++ C     Y  L + P + + Y        T  +N   +    +L++   I N+SS     +D  IL  G N  T   +C  C   LF S + CYK++  P+      +    Y +  P+++ C ++ P+ II+K L+  I         +   + +   +G +  EICF C     G FS+ +  RC  P    I   + P +   YF  K   I C  DP        D    + +  I  +    I   G       +IC  C +S+   PL CF
Sbjct:   75 LIIHNQTNDYFIEPKTTFCYYSDVVSLISCKKSLPKGYTLELDTQDFVKLSPGVSQIGGKFSKSNQTICAWCEYYGMKTPKHCFHYFERKPSLYVFPV--EN--YYIIGLPPNVSCELTPEDARDCYTNIELSFKDKSTT-GNPN-------GQDSQKLCFQCTHSDFIKVIKCYEPKKRIIKNSMFHALSPKKLNFFFDQISMKISCEPENNLIK--------LQVNEKYIKRISQSRVKIGNSSSNITMIYAFCVMGRYT--FPRRRFNKFKILPKFEFTFPGNFYPLGRQINFDCFITPNETVE---------YFSNFNFLNSKNLSLPIFFDGSDKGEICFTCSLNLSLYDNTEYIKPIQTCLFPIPY--LAMYPTEYKYY------FFTIYVNIYCMPLNYLLKSGKIITNSSSQVLYKNDTYILIRGYNFTTSPIVCGYCFAGLFVSSKICYKFFGGPVEFYFNIA-GNSYPIGRPLNVLCNIRPPDAIINKALVKLI---------SNGKVHSGQLNGKNISEICFECYSICEGCFSIPKIKRCLSP---GINSFLYPSSHTAYFTEKRIDIVC--DPSTA-----DSGLRVRSDEIKWNDFRFISIGGFYSMSNRSICVYCFSSLYVNPLICF 656          
BLAST of SMED30009724 vs. Planmine SMEST
Match: SMESG000045326.1 (SMESG000045326.1)

HSP 1 Score: 442.965 bits (1138), Expect = 8.846e-151
Identity = 402/1540 (26.10%), Postives = 682/1540 (44.29%), Query Frame = 1
Query:  532 LYVFPVENYYIIGLP---PNVSCELTPEDARDCYKNIELSFKDKSTTG------NLNGQDSQKLCFQCTHSDFIKVIKCYEPKKRIIKNSMFHALSPKKLNFFFDQISMKISCEPENNLIKLQVNEKYIKRISQSRVKIGNSSSNITMIYAFCVMGRYTF-----------PRRRFNKFRGPVEFYFNIAGNS-YPIGRPLNVLCNIRPPDAIINKALVKLISNG-------KVHSGQLNGKNISEICFECYSICEGCFSIPKIKRCL---SPGINSFLYPSSHTAYFTEKRIDIVCDPYTADSGLRVRSDEIKWNDFRFISIGG----FYSMSNRSICVYCFSSLYVNPLICFTHLPNYYLLPKRM---NEYFINMEMFIYCFPLDDFILLTVDSYEIDKK---NSSIAGIGGLPNKSNLTLCAYCYTLVKVYPL---RC---FTPKVLIIAILPENTEYYEFAKSFDVYCILKTKTHLFNGSSLGLKLTANNTSIQNVNATYFVLSGVDDGTVCFSCNSILSNTVTKCYKFKPLNVVISIEPSDTKIYLPNKSLSIKCSVNPD--IFNNKKDIIQFLYYNGSYSKVYPQNLVTSRKNTQTICVICGN-RIITNFSCY-FCFKEKIILKIEPNFTDVFVNNIKMVVRCTVEPEKVIKENLFKNIYFYMENYNISSNN-REITISGTFTEKLCFVCGHLMLRSVRRCYLY--AEYVQLEVMPNDIQIYIARKMSIITCQINPEYIENLEMLRNINFIENNSSCKPNDDGIILYDGVNRGTICFRCGNLLFKSPQKCYKYYNKPISVEIEPSFLKIYRVPIPMSITCVVKPEEIIHKDLISNIHFFKNNSTMNESPIRTVLYDGLDRGEICFTCGYFSLIQASRCYMPFKKVITLSISPVNMEIYFYMKPFTISCIIDPKIVFT--LITDFVFLINNSTIPADSQLQIKYDGKKRGTICFQCGNSMLFTPLKCFLFFGIKVDLEIRPLDTIVYIHKKEMNITCEIISNETIDEKLLPPIHFFTNNLNITPWSPRVIIYDGINRGLICFECGNQYFRSKKRCYSFYSYRMNITIFPD---LTKIFFPNMLMIVYCDVQPVEVITMKFVTDIDFNYCNSTFVNQTDRIYLIDGKSFGTICFRCGSIMIDNVTRCYTRFEKKIRLYIVPNDTEIYMPNKTEIVKCLVDPEIVD--SLMDDIEFINYTLPLRRISKSIAVVTGINLGKIVFYCGNFLLGIVSRSYNYYDIPITLRILPNITKIYIANQRMNIICDVSPIEVVIKKMLYNVGFKFNNSTFKPKTPRLIMIDGRDVGRFCVECGHRNLESVQRCYNYYD----------------------------PPGIL--NYVSDIDFNENNSPFISTIPRVIEITGTNVSRISLKCGNLLKNTS-KFYDYYDKDVSLNINPNYTKIYLPNKILFITCNSNPPELIDENKLLN-VSFIFNNSTFPLINERTLRISGKDVGRFCVLCGHRLLRTVRKCYMYYGQNVVINILPSNTKIYFPNTVIEIICHVEPTE 4872
            L++ P  NY  I  P    +V C++ P D      +I ++    +          + G   + +C  C +     + KCY+      K+   H + P   + +     + + C      I      + I  I  ++  I N S    M+     +G+  F            +R ++ F G +        +S YP GR +++ C + P  AI     ++ I N        K+H  Q+ G N   IC  C           +  RC          ++ P+    Y+T + ++I+C  Y  D   RV   +  +N+  F++ G      +  +   IC  C + +      C+ ++    L  K M     YF N+EM I C    +F  L  +++ ID +    ++I     L   S   +   C+T    Y L   +C   F+ KV   +I P  T+ Y   K  DV C +     +       +   A+   + N+      + G D GT+CF C   L   V +CY +   ++ I I P DT  Y    +++I+C+V PD    N+   I+ F+Y N + + V P+ +     +   IC  CG+  ++ +  CY F  + K+ + I P    V+ +N++M V C V P+    E+    I F   N +++S   + I   G  T+ + FVCG+  L    R Y Y  ++ V + + P   ++Y  +K   +TC + P+Y+ N  ++ +I F  +N++    D    +        ICF C N +F S  KCY Y++  I V+I P+  +IY      ++ CV+ PE +I  +++ N  F  NN+ +   P     + G     +CFTCG+  +I  SRCY  F   ++  I P  ++++  ++   ++C + P  + T  LITD     ++S +      ++      +  ICF CG+S+     KCFL++G  V   I P  T +Y+    M + C +     +    +    F+ N   I      +    G + G +CF CG+Q F    RCY +Y   +N++I P+     ++F P   + V C V+P E++    +  IDF   NST++++T R  ++  K  G ICF CG ++I   +RCY   E++I+++I P+    Y+      V C V        S + D+E  +  + L R  +    + G ++G + F C N  +    + + ++   +   I P+ T+IY+    MNI CDV+P     +  + ++GF +NNST    T  LI+ DGR+ G  C ECGH  L    +CY Y++                            PP I+    +  IDF  NNS F  +  R I I G+NV  I  +CG    N   + Y+Y+D D+   I P+  +IYL +  + I C+  P   ++   L+N +SF F N+T        +RIS  +    C  CGH+  R   KCY  + + + ++I+P++ KIY+      + C+V P E
Sbjct:  401 LFIHP--NYTSIYFPNYLMDVYCQVVPNDLISLMTDITITANSTNIISLGQRHLQITGAGKELICITCGNPVLKPIQKCYQ---YFGKDVALH-IEPNNTDIYVAHQGLNVFCNVHPKEIDTNSLIQDIILIGDNKELIQNDSRR--MMIPGKNLGKVCFQCSSKMVLNVPAKRCYDYFEGSISLEIMPNTSSIYPQGRLMDLYCKVLPQSAIDKIRNIEFIGNSSNLRVISKLHL-QILGDNEGTICLRCQHPIAN-----ESTRCYEYYGEPYGIYITPNDTLYYYTFREMEILCLFYPNDLINRVTEIDFIFNNSTFVNSGPRRIVLFGNNMGYICFSCGNDVLGGNTRCYNYIDIRDLEMKIMPLYKIYFANIEMDIECLVKPEF--LQNETFGIDFRFWNATTIRVSQRLIRISGTDMALICFTCGNKYILIIRKCYEYFSAKVQF-SIHPNYTKIYLPQKKMDVECSVDPVQIITLYKVRDIDFQADKKGVTNIVYLKMRIPGDDLGTICFKCGHKLFPYVDRCYSYYSKSISIHILPDDTLYYYSMLTMNIECNVLPDEIYLNSLVVIVDFIYQNATGADVSPRLIKIDGTDVGRICFTCGHIFLVIDNRCYDFIDRSKLNITILPARL-VYFSNVEMEVECVVYPKFFNNESF--EIRFLFANASLASRTYKLIRTKGIDTDTIGFVCGNKYLPLTARTYNYFDSKSVNVTIYPQYREVYFKKKGLNVTCVVKPDYVLNASIINDIEFTADNANAVKADRYYYIIPIDCTVKICFICKNKIFSSENKCYDYFDDDIYVDIRPNNTQIYLPRRIFNVRCVILPEILITNNIVKNFFFSLNNTIL---PGFDYSFSGSISDLMCFTCGHSEMITVSRCYKSFDLNVSFYIKPDGVKLHTKLRSLKVTCHVLPLSIITDDLITDIELTTSSSDVLRIGPREMVIPPSNKDDICFFCGSSLFEKVTKCFLYYGEDVYFWIEPNFTDIYLRGVNMKVACLVYPQTLLTLNYINSTEFYMNGTRIHSGEKELT---GEDLGTLCFSCGHQLFSLVWRCYFYYDKIINVSILPENITFYRLFTP---LTVQCSVKPDEILKNNLIRGIDFYEFNSTYISKTVREIIVKTKDIGLICFSCGHVLIQPGSRCY---EEQIKVFIEPSFMNAYLDKVAFDVTCNVPANKAHRTSELVDLELTS-DVTLERNDRLSLQMPGKDIGTVCFNCTNNFVYFGFKCFQFFGYGVEFIINPDYTEIYLPGVVMNITCDVNP-PTFKRDNIKDIGFTYNNSTVNLTTLNLIIHDGRNDGTICFECGHPFLSVTTKCYEYFEKEVVSIIEPEYKKYYLRNRKLTFRCKIEPPEIITNGLIEGIDFFYNNSTFKPSGVREITIDGSNVGTICFRCGREFFNPPLRCYEYFDDDLKFVILPD-VEIYLVHSEMEIQCSVTPS--LELYLLVNSISFTFYNATVIYKTNVLIRISDTNDQIICFKCGHKFFRFAEKCYQPFDKTIRLSIVPNHLKIYYEKITTNVTCNVSPEE 1903          

HSP 2 Score: 113.235 bits (282), Expect = 8.846e-151
Identity = 68/196 (34.69%), Postives = 105/196 (53.57%), Query Frame = 3
Query: 4926 MCFICGNEMFISQMRCYEFFDKEIKLSILPNDTKIFIFNQRLFVQCMVDPIEVVNRGLITNI---SFNFNNASSVMVNNTYIIVRGNDTKIICFKCGHITLTNVGKCYNVYYHKIKLTILPNDTLVYMRNLSMNVICRVDPLEVIXXXXXXXIRFIEYNRSVTEVSERQMFVNGVDKGKLCFTCGHRLLVPVTRCY 5504
            +CF CGNE+  +   CYEF+DK+I L I PN T I++ N+ L + C V P E++ R L++ I   S N  +AS V      II+ G D   +CF+CG+  L +  KCY+ Y   I + I+P   ++Y     +++ C V P E++  ++   + F   N +   V++R + V      K C  C H LLV   +CY
Sbjct: 1938 ICFKCGNEIVSNVKMCYEFYDKKINLIIQPNYTDIYVNNKSLSISCEVQPSELITRDLLSRIRLYSLNNTDASDVSFE---IIIGGKDMGRLCFRCGYTFLMSPIKCYDYYDLNITIRIIPFQRVLYFHREYVDIECVVFPKEIMKTDMKDGLEFTFNNSTFNLVNKRTIRVYDSKIYKFCLKCSHPLLVERAKCY 2130          

HSP 3 Score: 464.537 bits (1194), Expect = 2.143e-133
Identity = 432/1666 (25.93%), Postives = 737/1666 (44.24%), Query Frame = 1
Query:  145 DHLNLLIPINSTWKVNGCL-CKCQLVKNVSKIVCENCQLIIHNQTNDYF-------IEPKTTFCYYSDVVSLISCKKSLPKGYTLELDTQDFVKLSPG---VSQIGGKFSKSNQ-TICAWCEYYGMKTPKHCFHYFERKPSLYVFPVEN-YYIIGLPPNVSCELTPEDARDCYKNIELSFKDKSTTGN------LNGQDSQKLCFQCTHSDFIKVIKCYEPKKRIIKNSMFHALSPKKLNFFFDQISMKISC-------EPENNLIKLQVNEKYIKRISQSRVKIGNSSSNITMIYAFCVMGRYTFPRRRFNKFRGPVEFYFNIAGNSYPIGRP---LNVLCNIRPPDAII--------NKALVKLISNGKVHSGQLNGKNISEICFECYSICEGCFSIPKIKRCLS---PGINSFLYPSSHTAYFTEKRIDIVCDPYTAD---SGLRVRSDEIKWNDF------RFISIGGFYSMSNRSICVYCFSSLYVNPLICFTHLP----NYYLLPKRMNEYFINMEMFIYCFPLDDFILLTVDSYEIDK--KNSSIAG-------IGGLPNKSNLTLCAYCYTLVKVYPLRCFTPKVLIIAILPENTEYYEFAKSFDVYCILKTKTHLFNGSSLG-LKLTANNTSIQNVNATYFVLSGVDDGTVCFSCNSILSNTVTKCYKFKPLNVVISIEPSDTKIYLPNKSLSIKCSVNPDIFNNKKDIIQFLYYNGSYSKVYPQNLVTSRKNTQTICVICGN-RIITNFSCYFCFKEKIILKIEPNFTDVFVNNIKMVVRCTVEPEKVIKENLFKNIYFYMENYNISS-NNREITISGTFTEKLCFVCGHLMLRSVRRCYLY-AEYVQLEVMPNDIQIYIARKMSIITCQINPEYIENLEMLRNINFIENNSSCKPNDDGIILYDGVNRGTICFRCGNLLFKSPQKCYKYYNKPISVEIEPSFLKIYRVPIPMSITCVVKPEEIIHKDLISNIHFFKNNSTMNESPIRTVLYDGLDRGEICFTCGYFSLIQASRCYMPFKKVITLSISPVNMEIYFYMKPFTISCIIDPKIVFTLITDFV--FLINNSTIPADSQLQIKYDGKKRGTICFQCGNSMLFTPLKCFLFFGIKVDLEIRPLDTIVYIHKKEMNITCEIISNETIDEKLLPPIHFFTNNLNITPWSPRVIIYDGINRGLICFECGNQYFRSKKRCYSFYSYRMNITIFPDLTKIFFPNMLMIVYCDVQPVEVITMKFVTDIDFNYCNSTFVNQTDRIYLIDGKSFGTICFRCGSIMIDNVTRCYTRFEKKIRLYIVPNDTEIYMPNKTEIVKCLVDPEI-VDSLMDDIEFINYTLPLRRISKSIAVVTGINLGKIVFYCGNFLLGIVSRSYNYYDIPITLRILPNITKIYIANQRMNIICDVSPIEVVIKKMLYNVGFKFNNSTFKPKTPRLIMIDGRDVGRFCVECGHRNLESVQRCYNYYD----------------------------PPGIL--NYVSDIDFNENNSPFISTIPRVIEITGTNVSRISLKCG-NLLKNTSKFYDYYDKDVSLNINPNYTKIYLPNKILFITCNSNPPELIDENKLLNVSFIFNNSTFPLINERTLRISGKDVGRFCVLCGHRLLRTVRKCYMYYGQNVVINILPSNTKIYFPNTVI 4842
            D   ++IP  +  KV  C  C  ++V NV    C            DYF       I P T+  Y    +  + CK  LP+    ++   +F+  S     +S++  +    N+ TIC  C++        C+ Y+     +Y+ P +  YY       + C   P D  +    I+  F + +   +      L G +   +CF C +       +CY      I++     +   K+  +F  I M I C       + E   I  +       R+SQ  ++I  S +++ +I   C        R+ +  F   V+F  +I  N   I  P   ++V C++ P   I          +A  K ++N      ++ G ++  ICF+C     G    P + RC S     I+  + P     Y++   ++I C+    +   + L V  D I  N        R I I G        IC  C     V    C+  +     N  +LP R+  YF N+EM + C     F     +S+EI     N+S+A          G+   +   +C   Y  +       F  K + + I P+  E Y   K  +V C++K   ++ N S +  ++ TA+N +    +  Y+++       +CF C + + ++  KCY +   ++ + I P++T+IYLP +  +++C + P+I     +I++  +++ + + +   +   S   +  +C  CG+  +IT   CY  F   +   I+P+   +      + V C V P  +I ++L  +I     + ++     RE+ I  +  + +CF CG  +   V +C+LY  E V   + PN   IY+      + C + P+ +  L  + +  F  N +     +  +    G + GT+CF CG+ LF    +CY YY+K I+V I P  +  YR+  P+++ C VKP+EI+  +LI  I F++ NST     +R ++    D G ICF+CG+  +   SRCY   ++ I + I P  M  Y     F ++C + P       ++ V   L ++ T+  + +L ++  GK  GT+CF C N+ ++   KCF FFG  V+  I P  T +Y+    MNITC++ +  T     +  I F  NN  +   +  +II+DG N G ICFECG+ +     +CY ++   +   I P+  K +  N  +   C ++P E+IT   +  IDF Y NSTF     R   IDG + GTICFRCG    +   RCY  F+  ++  I+P D EIY+ +    ++C V P + +  L++ I F  Y   +   +  +  ++  N   I F CG+       + Y  +D  I L I+PN  KIY      N+ C+VSP E + K  + ++    +N            +   ++G  C +CG+  + +V+ CY +YD                            P  ++  + +S I     N+   S +   I I G ++ R+  +CG   L +  K YDYYD ++++ I P    +Y   + + I C   P E++  +    + F FNNSTF L+N+RT+R+    + +FC+ C H LL    KCY Y  ++V  +    N  +Y  N  I
Sbjct:  536 DSRRMMIPGKNLGKV--CFQCSSKMVLNVPAKRCY-----------DYFEGSISLEIMPNTSSIYPQGRLMDLYCK-VLPQSAIDKIRNIEFIGNSSNLRVISKLHLQILGDNEGTICLRCQHPIANESTRCYEYYGEPYGIYITPNDTLYYYTFREMEILCLFYPNDLINRVTEIDFIFNNSTFVNSGPRRIVLFGNNMGYICFSCGNDVLGGNTRCYNYID--IRDLEMKIMPLYKI--YFANIEMDIECLVKPEFLQNETFGIDFRFWNATTIRVSQRLIRI--SGTDMALICFTCGNKYILIIRKCYEYFSAKVQF--SIHPNYTKIYLPQKKMDVECSVDPVQIITLYKVRDIDFQADKKGVTNIVYLKMRIPGDDLGTICFKC-----GHKLFPYVDRCYSYYSKSISIHILPDDTLYYYSMLTMNIECNVLPDEIYLNSLVVIVDFIYQNATGADVSPRLIKIDG---TDVGRICFTCGHIFLVIDNRCYDFIDRSKLNITILPARL-VYFSNVEMEVECVVYPKF--FNNESFEIRFLFANASLASRTYKLIRTKGIDTDTIGFVCGNKYLPLTARTYNYFDSKSVNVTIYPQYREVYFKKKGLNVTCVVKPD-YVLNASIINDIEFTADNANAVKADRYYYIIPIDCTVKICFICKNKIFSSENKCYDYFDDDIYVDIRPNNTQIYLPRRIFNVRCVILPEILITN-NIVKNFFFSLNNTILPGFDYSFSGSISDLMCFTCGHSEMITVSRCYKSFDLNVSFYIKPDGVKLHTKLRSLKVTCHVLPLSIITDDLITDIELTTSSSDVLRIGPREMVIPPSNKDDICFFCGSSLFEKVTKCFLYYGEDVYFWIEPNFTDIYLRGVNMKVACLVYPQTLLTLNYINSTEFYMNGTRIHSGEKELT---GEDLGTLCFSCGHQLFSLVWRCYFYYDKIINVSILPENITFYRLFTPLTVQCSVKPDEILKNNLIRGIDFYEFNSTYISKTVREIIVKTKDIGLICFSCGHVLIQPGSRCY---EEQIKVFIEPSFMNAYLDKVAFDVTCNV-PANKAHRTSELVDLELTSDVTLERNDRLSLQMPGKDIGTVCFNCTNNFVYFGFKCFQFFGYGVEFIINPDYTEIYLPGVVMNITCDV-NPPTFKRDNIKDIGFTYNNSTVNLTTLNLIIHDGRNDGTICFECGHPFLSVTTKCYEYFEKEVVSIIEPEYKKYYLRNRKLTFRCKIEPPEIITNGLIEGIDFFYNNSTFKPSGVREITIDGSNVGTICFRCGREFFNPPLRCYEYFDDDLKFVILP-DVEIYLVHSEMEIQCSVTPSLELYLLVNSISFTFYNATVIYKTNVLIRISDTNDQIICFKCGHKFFRFAEKCYQPFDKTIRLSIVPNHLKIYYEKITTNVTCNVSPEEALNK--MKDILLTVDNPLVSRINSMTFAMPQYNLGTICFKCGNEIVSNVKMCYEFYDKKINLIIQPNYTDIYVNNKSLSISCEVQPSELITRDLLSRIRLYSLNNTDASDVSFEIIIGGKDMGRLCFRCGYTFLMSPIKCYDYYDLNITIRIIPFQRVLYFHREYVDIECVVFPKEIMKTDMKDGLEFTFNNSTFNLVNKRTIRVYDSKIYKFCLKCSHPLLVERAKCY-YNFKSVKFHWYHENKNVYMINETI 2154          

HSP 4 Score: 429.098 bits (1102), Expect = 6.354e-122
Identity = 417/1670 (24.97%), Postives = 732/1670 (43.83%), Query Frame = 1
Query:  205 KCQLVKNVSKIVCENCQLIIHNQTND----------YFIEPKTTFCYYSDVVSLISCKK------SLPKGYTLELDTQDFVKLSPGVSQIGGKFSKSNQTICAWCEYYGMKTPKHCFHYFERKPSLYVFPVE-NYYIIGLPPNVSCELTPE--DARDCYKNIELSFKDKSTTGN------LNGQDSQKLCFQCTHSDFIKVIKCYEPKKR---IIKNSMFHALSPKKLNFFFDQISMKISCE--PENNLIKLQ-----VNEKYIKRISQSRVKI-GNSSSNITMIYAFCVMGRYTFPRRRFNKFRGPVEFYFNIAGNS---YPIGRPLNVLCNIRPPDAIINKALVKLISNGK--VHSGQ----LNGKNISEICFECYSICEG----CFSIPKIKRCLSPGINSFLYPSSHTAYFTEKRIDIVC---DPYTADSGLRVRSDEIKWN------DFRFISIGGF------YSMSNRSICVYCFSSLYVNPLICFTHLPNY---YLLPKRMN-EYFINMEMFIYCFPLDDFILLTVDSYEIDKKNSS--IAGIGGLPNKSNLTLCAYCYTLVKVYPLRCFT--PKVLIIAILPENTEYYEFAKSFDVYCILKTKTHLFNGSSLGLKLTANNTSIQNVNATYFVLSGVDDGTVCFSCNSILSNTVTKCYKF---KPLNVVISIEPSDTKIYLPNKSLSIKCSVNPDIFNNKKDIIQFLYYNGSYSKVYPQNLVTSRKNTQTICVICGNRII-TNFSCYFCFKEKII-LKIEPNFTDVFVNNIKMVVRCTVEPEKVIKENLFKNIYFYMENYNISSNNR-EITISGTFTEKLCFVCGHLMLRSVRRCYLY-AEYVQLEVMPNDIQIYIARKMSIITCQINPEYIENLEMLRNINFIENNSSCKPNDDGIILYDGVNRGTICFRCGNLLFKSPQKCYKYYNKPISVEIEPSFLKIYRVPIPMSITCVVKPEEIIHKDLISNIHFFKNNSTMNESPIRTVLYDGLDRGEICFTCGYFSLIQASRCYMPFKKVITLSISPVNMEIYFYMKPFTISCIIDPKIVFTL--ITDFVFLINNSTIPADSQLQIKYDGKKRGTICFQCGNSMLFTPLKCFLFFGIKVDLEIRPLDTIVYIHKKEMNITCEIISNETIDEKLLPPIHFFTNNLNITPWSPRVIIYDGINRGLICFECGNQYFRSKKRCYSFYSYRMNITIFPDLTKIFFPNMLMIVYCDVQPVEVITMKFVTDIDFNYCNSTFVNQTDRIYL-IDGKSFGTICFRCGSIMIDNVTRCYTRFEKKIRLYIVPNDTEIYMPNKTEIVKCLVDPEIVDSLMDDIEFINYTL---PLRRISKSIAVVTGINLGKIVFYCGNFLLGIVSRSYNYYDIPITLRILPNITKIYIANQRMNIICDVSPIEVVIKKMLYNVGFKFNNSTFKPKTPRLIMIDGRDVGRFCVECGHRNLESVQRCYNYYD--------------------------PPGILNY--VSDIDFNENNSPFISTIPRVIEITGTNVSRISLKCGN-LLKNTSKFYDYYDKDVSLNINPNYTKIYLPNKILFITCNSNPPELIDENKLLNVSFIFNNSTFPLINERTLRISGKDVGRFCVLCGHRLLRTVRKCYMYYGQNVVINILPSNTKIYFPNTVIEIICHVEPTE 4872
            K ++  +VS+    +C L+I    +D           FI P  T  Y+ + +  + C+       SL    T+  ++ + + L     QI G      + IC  C    +K  + C+ YF +  +L++ P   + Y+     NV C + P+  D     ++I L   +K    N      + G++  K+CFQC+    + V     P KR     + S+   + P   + +     M + C+  P++ + K++      N   ++ IS+  ++I G++   I +     +    T   R +  +  P   Y  I  N    Y   R + +LC   P D I     +  I N    V+SG     L G N+  ICF C +   G    C++   I R L   I        +  YF    +DI C     +  +    +  D   WN        R I I G       ++  N+ I +      Y +  + F+  PNY   YL  K+M+ E  ++    I  + + D        ++ DKK  +  +     +P     T+C  C   +  Y  RC++   K + I ILP++T YY    + ++ C +       N   + +     N +  +V+     + G D G +CF+C  I      +CY F     LN  I+I P+   +Y  N  + ++C V P  FNN+   I+FL+ N S +    + + T   +T TI  +CGN+ +      Y  F  K + + I P + +V+     + V C V+P+ V+  ++  +I F  +N N    +R    I    T K+CF+C + +  S  +CY Y  + + +++ PN+ QIY+ R++  + C I PE +    +++N  F  NN+     D     + G     +CF CG+    +  +CYK ++  +S  I+P  +K++     + +TC V P  II  DLI++I    ++S +     R ++    ++ +ICF CG     + ++C++ + + +   I P   +IY       ++C++ P+ + TL  I    F +N + I +  +   +  G+  GT+CF CG+ +     +C+ ++   +++ I P +   Y     + + C +  +E +   L+  I F+  N      + R II    + GLICF CG+   +   RC   Y  ++ + I P     +   +   V C+V   +      + D++    +   + + DR+ L + GK  GT+CF C +  +    +C+  F   +   I P+ TEIY+P     + C V+P       D+I+ I +T     +   + ++ +  G N G I F CG+  L + ++ Y Y++  +   I P   K Y+ N+++   C + P E++   ++  + F +NNSTFKP   R I IDG +VG  C  CG        RCY Y+D                           P +  Y  V+ I F   N+  I     +I I+ TN   I  KCG+   +   K Y  +DK + L+I PN+ KIY       +TCN +P E +  NK+ ++    +N     IN  T  +   ++G  C  CG+ ++  V+ CY +Y + + + I P+ T IY  N  + I C V+P+E
Sbjct:  365 KTRIGYSVSEDNAMDCSLVISKHDDDTKITLSGDVKLFIHPNYTSIYFPNYLMDVYCQVVPNDLISLMTDITITANSTNIISLGQRHLQITGA---GKELICITCGNPVLKPIQKCYQYFGKDVALHIEPNNTDIYVAHQGLNVFCNVHPKEIDTNSLIQDIILIGDNKELIQNDSRRMMIPGKNLGKVCFQCSSKMVLNV-----PAKRCYDYFEGSISLEIMPNTSSIYPQGRLMDLYCKVLPQSAIDKIRNIEFIGNSSNLRVISKLHLQILGDNEGTICLRCQHPIANEST---RCYEYYGEPYGIY--ITPNDTLYYYTFREMEILCLFYPNDLINRVTEIDFIFNNSTFVNSGPRRIVLFGNNMGYICFSCGNDVLGGNTRCYNYIDI-RDLEMKIMPL-----YKIYFANIEMDIECLVKPEFLQNETFGI--DFRFWNATTIRVSQRLIRISGTDMALICFTCGNKYILIIRKCYEYFSAKVQFSIHPNYTKIYLPQKKMDVECSVDPVQIITLYKVRDI------DFQADKKGVTNIVYLKMRIPGDDLGTICFKCGHKLFPYVDRCYSYYSKSISIHILPDDTLYYYSMLTMNIECNVLPDEIYLNSLVVIVDFIYQNATGADVSPRLIKIDGTDVGRICFTCGHIFLVIDNRCYDFIDRSKLN--ITILPARL-VYFSNVEMEVECVVYPKFFNNESFEIRFLFANASLASRTYKLIRTKGIDTDTIGFVCGNKYLPLTARTYNYFDSKSVNVTIYPQYREVYFKKKGLNVTCVVKPDYVLNASIINDIEFTADNANAVKADRYYYIIPIDCTVKICFICKNKIFSSENKCYDYFDDDIYVDIRPNNTQIYLPRRIFNVRCVILPEILITNNIVKNFFFSLNNTILPGFDYS---FSGSISDLMCFTCGHSEMITVSRCYKSFDLNVSFYIKPDGVKLHTKLRSLKVTCHVLPLSIITDDLITDIELTTSSSDVLRIGPREMVIPPSNKDDICFFCGSSLFEKVTKCFLYYGEDVYFWIEPNFTDIYLRGVNMKVACLVYPQTLLTLNYINSTEFYMNGTRIHSGEK---ELTGEDLGTLCFSCGHQLFSLVWRCYFYYDKIINVSILPENITFYRLFTPLTVQCSVKPDEILKNNLIRGIDFYEFNSTYISKTVREIIVKTKDIGLICFSCGHVLIQPGSRC---YEEQIKVFIEPSFMNAYLDKVAFDVTCNVPANKAHRTSELVDLELT--SDVTLERNDRLSLQMPGKDIGTVCFNCTNNFVYFGFKCFQFFGYGVEFIINPDYTEIYLPGVVMNITCDVNPPTFKR--DNIKDIGFTYNNSTVNLTTLNLIIHDGRNDGTICFECGHPFLSVTTKCYEYFEKEVVSIIEPEYKKYYLRNRKLTFRCKIEPPEIITNGLIEGIDFFYNNSTFKPSGVREITIDGSNVGTICFRCGREFFNPPLRCYEYFDDDLKFVILPDVEIYLVHSEMEIQCSVTPSLELYLLVNSISFTFYNATVIYKTNVLIRISDTNDQIICFKCGHKFFRFAEKCYQPFDKTIRLSIVPNHLKIYYEKITTNVTCNVSPEEAL--NKMKDILLTVDNPLVSRINSMTFAMPQYNLGTICFKCGNEIVSNVKMCYEFYDKKINLIIQPNYTDIYVNNKSLSISCEVQPSE 1989          

HSP 5 Score: 400.593 bits (1028), Expect = 6.358e-113
Identity = 391/1540 (25.39%), Postives = 659/1540 (42.79%), Query Frame = 1
Query:  532 LYVFPVENYYIIGLPPNVSCELTPEDARDCYKNIELSFKDKSTTGN------LNGQDSQKLCFQCTHSDFIKVIKCYEPKKRIIKN-SMFHALSPKKLNFFFDQISMKISCE--PEN-------NLIKLQVNEKYIKRISQSRVKIGNSSSNITMIYAFCVMGRYTFPRRRFNKFRGPVEFYFNIAGNSYPIGRPLNVLCNIRPPDAIINKALVKLISNGKVHSGQLNGKNISEICFECYSICEGCFSIPKIKRCLS----PGINSFLYPSSHTAYFTEKRIDIVC---------DP-------YTADSGLRVR--------SDEIKWNDFRFISIG-GFYSMSNRSICVYCFSSLYVNPLICFTHLPNYYLLPKRMNEYFINMEMFIYCFPLDDFILLTVDSYEIDKKNSSIAG--IGGLPNKSNLTLCAYCYTLVKVYPLRCFTPKVLIIAILPENTEYYEFAKSFDVYCILKTKTHLFNGSSLGLKLTANNTSIQNVNATYFVLSGVDDGTVCFSCNSILSNTVTKCYKFKPLNVVISIEPSDTKIYLPNKSLSIKCSVNPDIFNNK---KDIIQFLYYNGSYSKVYPQNLVTSRKNTQTICVICGNRIITNF---SCYFCFKEKIILKIEPNFTDVFVNNIKMVVRCTVEPEKVIKENLFKNIYFYMENYNISSNNR-EITISGTFTEKLCFVCGHLMLRSVRRCY-LYAEYVQLEVMPNDIQIYIARKMSIITCQINPEYIENLEMLRNINFIENNSSCKPNDDGIILYDGVNRGTICFRCGNLLFKSPQKCYKYYN-KPISVEIEPSFLKIYRVPIPMSITCVVKPEEIIHKDLISNIHFFKNNSTMNESPIRTVLYDGLDRGEICFTCGYFSLIQASRCYMPFKKVITLSISPVNMEIYFYMKPFTISCIIDPKIVFTL--ITDFVFLINNSTIPADSQLQIKYDGKKRGTICFQCGNSMLFTPLKCFLFFGIKVDLEIRPLDTIVYIHKKEMNITCEIISNETIDEKLLPPIHFFTNNLNITPWSPRVIIYDGINRGLICFECGNQYFRSKKRCYSFYSY-RMNITIFPDLTKIFFPNMLMIVYCDVQPVEVITMKFVTDIDFNYCNSTFVNQTDRIYLIDGKSFGTICFRCGSIMIDNVTRCYTRFE-KKIRLYIVPNDTEIYMPNKTEIVKCLVDPEIV--DSLMDDIEFINYTLPLRRISKSIAVVTGINLGKIVFYCGNFLLGIVSRSYNYYDIPITLRILPNITKIYIANQRMNIICDVSPIEVVIKKMLYNVGFKFNNSTFKPKTPRLIMIDGRDVGRFCVECGHRNLESVQRCYNYYD--------PPGIL----------------------NYVSDIDFNENNSPFISTIPRVIEITGTNVSRISLKCG-NLLKNTSKFYDYYDKDVSLNINPNYTKIYLPNKILFITCNSNPPELIDENKLLNVSFIFNNSTFPLINERTLRISGKDVGRFCVLCGHRLLRTVRKCYMYYGQNVVINILPSNTKIYFPNTVIEIICHVEPTE 4872
            + + P    Y I +   + C+++P+  +D    I+L+  + +          + G+D++ +CFQC + DF   IKCY     +  N +M   ++P  ++ +     + +SCE  PEN       N IK   N   I+ + Q  + +         I   C        ++ +  F  P +         Y   + + +       D I N +    ++   +    + G N   ICF C     G   +    RC        +N  + P ++  +   + +D+ C         DP       +T  +G  V         SD IK     F  I  G   +    +    FS   VN LI   +L  YY + + M    +          LD F+  T   Y + + N+      I    + + +TL       VK++             I P  T  Y      DVYC +     +       + +TAN+T+I ++   +  ++G     +C +C + +   + KCY++   +V + IEP++T IY+ ++ L++ C+V+P   +     +DII  +  N    +   + ++   KN   +C  C ++++ N     CY  F+  I L+I PN + ++     M + C V P+  I +   +NI F   + N+   ++  + I G     +C  C H +     RCY  Y E   + + PND   Y   +   I C   P  + N   +  I+FI NNS+   +    I+  G N G ICF CGN +     +CY Y + + + ++I P + KIY   I M I C+VKPE + ++    +  F+  N+T      R +   G D   ICFTCG   ++   +CY  F   +  SI P   +IY   K   + C +DP  + TL  + D  F  +   +     L+++  G   GTICF+CG+ +     +C+ ++   + + I P DT+ Y     MNI C ++ +E     L+  + F   N      SPR+I  DG + G ICF CG+ +     RCY F    ++NITI P    ++F N+ M V C V P       F  +I F + N++  ++T ++    G    TI F CG+  +    R Y  F+ K + + I P   E+Y   K   V C+V P+ V   S+++DIEF        +  +   ++      KI F C N +    ++ Y+Y+D  I + I PN T+IY+  +  N+ C + P  ++   ++ N  F  NN+             G      C  CGH  + +V RCY  +D        P G+                       + ++DI+   ++S  +   PR + I  +N   I   CG +L +  +K + YY +DV   I PN+T IYL    + + C   P  L+  N + +  F  N +    I+     ++G+D+G  C  CGH+L   V +CY YY + + ++ILP N   Y   T + + C V+P E
Sbjct:    1 MEITPSYEVYYINVDMLIVCDISPDFFKDPKFKIKLTSINATVVFKSILSLLIQGKDTRTICFQCGNPDFKVTIKCY-----VFSNIAMRLEIAPSDVDIYLPNKQLDVSCEKFPENVTDKDLINNIKFDSNSTSIQVVDQFHISLNGKGETACFI---CGSSIVRIVKKCYTYFDNPFQIIIQPNYTLYYYSKKIVI-------DFIFNNSTYVPVA---LRVITIYGHNKQRICFSC-----GHVLLAIDFRCYDYIDIANLNIQILP-NYIVFLENQNMDVTCVFTPYEKFKDPSFEIIFQWTNATGNWVDKWKITINGSDRIKEMSDAFHQINKGMRKLQQMDVNEERFSE--VNKLIQ-KNLACYYEINREMKPQTVQTT-------LDRFVKKTRIGYSVSEDNAMDCSLVISKHDDDTKITLSGD----VKLF-------------IHPNYTSIYFPNYLMDVYCQVVPNDLI--SLMTDITITANSTNIISLGQRHLQITGAGKELICITCGNPVLKPIQKCYQYFGKDVALHIEPNNTDIYVAHQGLNVFCNVHPKEIDTNSLIQDII-LIGDNKELIQNDSRRMMIPGKNLGKVCFQCSSKMVLNVPAKRCYDYFEGSISLEIMPNTSSIYPQGRLMDLYCKVLPQSAIDK--IRNIEFIGNSSNLRVISKLHLQILGDNEGTICLRCQHPIANESTRCYEYYGEPYGIYITPNDTLYYYTFREMEILCLFYPNDLIN--RVTEIDFIFNNSTFVNSGPRRIVLFGNNMGYICFSCGNDVLGGNTRCYNYIDIRDLEMKIMPLY-KIYFANIEMDIECLVKPEFLQNETFGIDFRFW--NATTIRVSQRLIRISGTDMALICFTCGNKYILIIRKCYEYFSAKVQFSIHPNYTKIYLPQKKMDVECSVDPVQIITLYKVRDIDFQADKKGVTNIVYLKMRIPGDDLGTICFKCGHKLFPYVDRCYSYYSKSISIHILPDDTLYYYSMLTMNIECNVLPDEIYLNSLVVIVDFIYQNATGADVSPRLIKIDGTDVGRICFTCGHIFLVIDNRCYDFIDRSKLNITILP-ARLVYFSNVEMEVECVVYPKFFNNESF--EIRFLFANASLASRTYKLIRTKGIDTDTIGFVCGNKYLPLTARTYNYFDSKSVNVTIYPQYREVYFKKKGLNVTCVVKPDYVLNASIINDIEFTADNANAVKADRYYYIIPIDCTVKICFICKNKIFSSENKCYDYFDDDIYVDIRPNNTQIYLPRRIFNVRCVILPEILITNNIVKNFFFSLNNTILPGFDYSF---SGSISDLMCFTCGHSEMITVSRCYKSFDLNVSFYIKPDGVKLHTKLRSLKVTCHVLPLSIITDDLITDIELTTSSSDVLRIGPREMVIPPSNKDDICFFCGSSLFEKVTKCFLYYGEDVYFWIEPNFTDIYLRGVNMKVACLVYPQTLLTLNYINSTEFYMNGTR---IHSGEKELTGEDLGTLCFSCGHQLFSLVWRCYFYYDKIINVSILPENITFYRLFTPLTVQCSVKPDE 1470          

HSP 6 Score: 293.508 bits (750), Expect = 5.929e-104
Identity = 248/923 (26.87%), Postives = 435/923 (47.13%), Query Frame = 1
Query: 2263 LKIEPNFTDVFVNNIKMVVRCTVEPEKVIKENLFKNIYFYMENYNISSNNREITISGTFTEKLCFVCGHLMLRSVRRCYLYAE-YVQLEVMPNDIQIYIARKMSIITCQINPEYIENLEMLRNINFIENNSSCKPNDDGIILYDGVNRGTICFRCGNLLFKSPQKCYKYYNKPISVEIEPSFLKIYRVPIPMSITCVVKPEEIIHKDLISNIHFFKNNSTMNESPIRTVLYDGLDRGEICFTCGYFSLIQASRCYMPFKKVITLSISPV-NMEIYFYMKPFTISCIIDPKIVFTLIT-DFVFLINNSTIPADSQLQIKYDGKKRGTICFQCGNSMLFTPLKCFLFFGIKVDLEIRPLDTIVYIHKKEMNITCEIIS--NETIDEKLLPPIHFFTNNLNITPWSPRVIIYDGINRGLICFECGNQYFRSKKRCYSFYSYRMNITIFPDL--------TKIFFPNMLMIVYCDVQPVEVITMKFVTDIDFNYCNSTFVNQTDRIYLIDGKSFGTICFRCGSIMIDNVTRCYTRFEKKIRLYIVPNDTEIYMPNKTEIVKCLVDPEIVD--SLMDDIEFINYTLPLRRISKSIAVVTGINLGKIVFYCGNFLLGIV--SRSYNYYDIPITLRILPNITKIYIANQRMNIICDVSPIEVVIKKMLYNVGFKFNNSTFKPKTPRLIMIDGRDVGRFCVECGHRNLESVQRCYNYYDPP----------------------------GILNYVSDIDFNENNSPFISTIPRVIEITGTNVSRISLKCGN-LLKNTSKFYDYYD-KDVSLNINPNYTKIYLPNKILFITCNSNPPELIDENKLLNVSFIFNNSTFPLINERTLRISGKDVGRFCVLCGHRLLRTVRKCYMYYGQNVVINILPSNTKIYFPNTVIEIICHVEPTE*QIIPL 4890
            ++I P++ +V+  N+ M++ C + P+   K+  FK     +    +  +   + I G  T  +CF CG+   +   +CY+++   ++LE+ P+D+ IY+  K   ++C+  PE + + +++ NI F  N++S +  D   I  +G    T CF CG+ + +  +KCY Y++ P  + I+P++   Y              ++I+       I F  NNST     +R +   G ++  ICF+CG+  L    RCY  +  +  L+I  + N  ++   +   ++C+  P   F   + + +F   N+T     + +I  +G  R               +K       +++  +R L        ++M++  E  S  N+ I + L     ++  N  + P + +  +   + +  I +              S +     IT+  D+        T I+FPN LM VYC V P ++I++  +TDI     ++  ++   R   I G     IC  CG+ ++  + +CY  F K + L+I PN+T+IY+ ++   V C V P+ +D  SL+ DI  I     L +      ++ G NLGK+ F C + ++  V   R Y+Y++  I+L I+PN + IY   + M++ C V P   + K  + N+ F  N+S  +  +   + I G + G  C+ C H       RCY YY  P                             ++N V++IDF  NNS F+++ PR I + G N+  I   CGN +L   ++ Y+Y D +D+ + I P Y KIY  N  + I C   P  L  +N+   + F F N+T   +++R +RISG D+   C  CG++ +  +RKCY Y+   V  +I P+ TKIY P   +++ C V+P   QII L
Sbjct:    1 MEITPSY-EVYYINVDMLIVCDISPD-FFKDPKFKIKLTSINATVVFKSILSLLIQGKDTRTICFQCGNPDFKVTIKCYVFSNIAMRLEIAPSDVDIYLPNKQLDVSCEKFPENVTDKDLINNIKFDSNSTSIQVVDQFHISLNGKGE-TACFICGSSIVRIVKKCYTYFDNPFQIIIQPNYTLYYY------------SKKIV-------IDFIFNNSTYVPVALRVITIYGHNKQRICFSCGHVLLAIDFRCY-DYIDIANLNIQILPNYIVFLENQNMDVTCVFTPYEKFKDPSFEIIFQWTNATGNWVDKWKITINGSDR---------------IKEMSDAFHQINKGMRKL--------QQMDVNEERFSEVNKLIQKNLAC---YYEINREMKPQTVQTTLDRFVKKTRIGYSVSEDNAMDCSLVISKHDDDTKITLSGDVKLFIHPNYTSIYFPNYLMDVYCQVVPNDLISL--MTDITITANSTNIISLGQRHLQITGAGKELICITCGNPVLKPIQKCYQYFGKDVALHIEPNNTDIYVAHQGLNVFCNVHPKEIDTNSLIQDIILIGDNKELIQNDSRRMMIPGKNLGKVCFQCSSKMVLNVPAKRCYDYFEGSISLEIMPNTSSIYPQGRLMDLYCKVLPQSAIDK--IRNIEFIGNSSNLRVISKLHLQILGDNEGTICLRCQHPIANESTRCYEYYGEPYGIYITPNDTLYYYTFREMEILCLFYPNDLINRVTEIDFIFNNSTFVNSGPRRIVLFGNNMGYICFSCGNDVLGGNTRCYNYIDIRDLEMKIMPLY-KIYFANIEMDIECLVKPEFL--QNETFGIDFRFWNATTIRVSQRLIRISGTDMALICFTCGNKYILIIRKCYEYFSAKVQFSIHPNYTKIYLPQKKMDVECSVDPV--QIITL 865          

HSP 7 Score: 106.686 bits (265), Expect = 5.929e-104
Identity = 72/215 (33.49%), Postives = 109/215 (50.70%), Query Frame = 3
Query: 4872 MTNHTSLKISINVTTGEKMCFICGNEMFISQMRCYEFFDKEIKLSILPNDTKIFIFNQRLFVQCMVDPIEVVNRGLITNISFNFNNASSVMVNNTYIIVRGNDTKIICFKCGHITLTNVGKCYN-VYYHKIKLTILPNDTLVYMRNLSMNVICRVDPLEVIXXXXXXXIRFIEYNRSVTEVSERQMFVNGVDKGKLCFTCGHRLLVPVTRCYIYY 5513
            +TN   LK+ I       +CF CG+++F    RCY ++ K I + ILP+DT  +     + ++C V P E+    L+  + F + NA+   V+   I + G D   ICF CGHI L    +CY+ +   K+ +TILP   LVY  N+ M V C V P     NN    IRF+  N S+   + + +   G+D   + F CG++ L    R Y Y+
Sbjct:  880 VTNIVYLKMRIPGDDLGTICFKCGHKLFPYVDRCYSYYSKSISIHILPDDTLYYYSMLTMNIECNVLPDEIYLNSLVVIVDFIYQNATGADVSPRLIKIDGTDVGRICFTCGHIFLVIDNRCYDFIDRSKLNITILPA-RLVYFSNVEMEVECVVYP--KFFNNESFEIRFLFANASLASRTYKLIRTKGIDTDTIGFVCGNKYLPLTARTYNYF 1091          

HSP 8 Score: 150.599 bits (379), Expect = 6.424e-36
Identity = 79/218 (36.24%), Postives = 128/218 (58.72%), Query Frame = 3
Query: 4866 YRMTNHTSLKIS-----INVTTGEKMCFICGNEMFISQMRCYEFFDKEIKLSILPNDTKIFIFNQRLFVQCMVDPIEVVNRGLITNISFNFNNASSVMVNNTYIIVRGNDTKIICFKCGHITLTNVGKCYNVYYHKIKLTILPNDTLVYMRNLSMNVICRVDPLEVIXXXXXXXIRFIEYNRSVTEVSERQMFVNGVDKGKLCFTCGHRLLVPVTRCY 5504
            +R  N T++++S     I+ T    +CF CGN+  +   +CYE+F  +++ SI PN TKI++  +++ V+C VDP++++    + +I F  +      +    + + G+D   ICFKCGH     V +CY+ Y   I + ILP+DTL Y   L+MN+ C V P E+  N+L++ + FI  N +  +VS R + ++G D G++CFTCGH  LV   RCY
Sbjct:  785 FRFWNATTIRVSQRLIRISGTDMALICFTCGNKYILIIRKCYEYFSAKVQFSIHPNYTKIYLPQKKMDVECSVDPVQIITLYKVRDIDFQADKKGVTNIVYLKMRIPGDDLGTICFKCGHKLFPYVDRCYSYYSKSISIHILPDDTLYYYSMLTMNIECNVLPDEIYLNSLVVIVDFIYQNATGADVSPRLIKIDGTDVGRICFTCGHIFLVIDNRCY 1002          

HSP 9 Score: 128.642 bits (322), Expect = 3.532e-29
Identity = 68/197 (34.52%), Postives = 111/197 (56.35%), Query Frame = 3
Query: 4926 MCFICGNEMFISQMRCYEFFD-KEIKLSILPNDTKIFIFNQRLFVQCMVDPIEVVNRGLITNISFNFNNASSVMVNNTYIIVRGNDTKIICFKCGHITLTNVGKCYNVYYHKIKLTILPNDTLVYMRNLSMNVICRVDPLEVIXXXXXXXIRFIEYNRSVTEVSERQMFVNGVDKGKLCFTCGHRLLVPVTRCYIYY 5513
            +CF CGN++     RCY + D +++++ I+P   KI+  N  + ++C+V P  + N      I F F NA+++ V+   I + G D  +ICF CG+  +  + KCY  +  K++ +I PN T +Y+    M+V C VDP+++I    + +I F    + VT +   +M + G D G +CF CGH+L   V RCY YY
Sbjct:  724 ICFSCGNDVLGGNTRCYNYIDIRDLEMKIMPL-YKIYFANIEMDIECLVKPEFLQNETF--GIDFRFWNATTIRVSQRLIRISGTDMALICFTCGNKYILIIRKCYEYFSAKVQFSIHPNYTKIYLPQKKMDVECSVDPVQIITLYKVRDIDFQADKKGVTNIVYLKMRIPGDDLGTICFKCGHKLFPYVDRCYSYY 917          

HSP 10 Score: 126.716 bits (317), Expect = 1.249e-28
Identity = 75/210 (35.71%), Postives = 114/210 (54.29%), Query Frame = 3
Query: 4884 TSLKISINVTTGEKMCFICGNEMFISQMRCYEFFDKEIKLSILPNDTKIFIFNQRLFVQCMVDPIEVVNRGLITNISFNFNNASSVMVNNTYIIVRGNDTKIICFKCGHITLTNVGKCYNVYYHKIKLTILPNDTLVYMRNLSMNVICRVDPLEVIXXXXXXXIRFIEYNRSVTEVSERQMFVNGVDKGKLCFTCGHRLLVPVTRCYIYY 5513
            T++ I I+ T  + +CF CG++ F    +CY+ FDK I+LSI+PN  KI+       V C V P E +N+  + +I    +N     +N+    +   +   ICFKCG+  ++NV  CY  Y  KI L I PN T +Y+ N S+++ C V P E+I  +LL  IR    N +       ++ + G D G+LCF CG+  L+   +CY YY
Sbjct: 1838 TNVLIRISDTNDQIICFKCGHKFFRFAEKCYQPFDKTIRLSIVPNHLKIYYEKITTNVTCNVSPEEALNK--MKDILLTVDNPLVSRINSMTFAMPQYNLGTICFKCGNEIVSNVKMCYEFYDKKINLIIQPNYTDIYVNNKSLSISCEVQPSELITRDLLSRIRLYSLNNTDASDVSFEIIIGGKDMGRLCFRCGYTFLMSPIKCYDYY 2045          

HSP 11 Score: 119.013 bits (297), Expect = 3.132e-26
Identity = 70/208 (33.65%), Postives = 114/208 (54.81%), Query Frame = 3
Query: 4893 KISINVTTGEKMCFICGNEMFISQMRCYEFFDKEIKLSILPNDTKIFIFNQRLFVQCMVDP-IEVVNRGLITNISFNFNNASSVMVNNTYIIVRGNDTKIICFKCGHITLTNVGKCYNVYYHKIKLTILPNDTLVYMRNLSMNVICRVDPLEVIXXXXXXXIRFIEYNRSVTEVSERQMFVNGVDKGKLCFTCGHRLLVPVTRCYIYY 5513
            +I+I+ +    +CF CG E F   +RCYE+FD ++K  ILP D +I++ +  + +QC V P +E+    L+ +ISF F NA+ +   N  I +   + +IICFKCGH       KCY  +   I+L+I+PN   +Y   ++ NV C V P E +  N + +I     N  V+ ++     +   + G +CF CG+ ++  V  CY +Y
Sbjct: 1755 EITIDGSNVGTICFRCGREFFNPPLRCYEYFDDDLKFVILP-DVEIYLVHSEMEIQCSVTPSLELY--LLVNSISFTFYNATVIYKTNVLIRISDTNDQIICFKCGHKFFRFAEKCYQPFDKTIRLSIVPNHLKIYYEKITTNVTCNVSPEEAL--NKMKDILLTVDNPLVSRINSMTFAMPQYNLGTICFKCGNEIVSNVKMCYEFY 1957          

HSP 12 Score: 111.694 bits (278), Expect = 5.191e-24
Identity = 64/205 (31.22%), Postives = 103/205 (50.24%), Query Frame = 3
Query: 4899 SINVTTGEKMCFICGNEMFISQMRCYEFFDKEIKLSILPNDTKIFIFNQRLFVQCMVDPIEVVNRGLITNISFNFNNASSVMVNNTYIIVRGNDTKIICFKCGHITLTNVGKCYNVYYHKIKLTILPNDTLVYMRNLSMNVICRVDPLEVIXXXXXXXIRFIEYNRSVTEVSERQMFVNGVDKGKLCFTCGHRLLVPVTRCYIYY 5513
            S + +  + MCF CG+   I+  RCY+ FD  +   I P+  K+    + L V C V P+ ++   LIT+I    +++  + +    +++  ++   ICF CG      V KC+  Y   +   I PN T +Y+R ++M V C V P  ++    L  I   E+  + T +   +  + G D G LCF+CGH+L   V RCY YY
Sbjct: 1237 SFSGSISDLMCFTCGHSEMITVSRCYKSFDLNVSFYIKPDGVKLHTKLRSLKVTCHVLPLSIITDDLITDIELTTSSSDVLRIGPREMVIPPSNKDDICFFCGSSLFEKVTKCFLYYGEDVYFWIEPNFTDIYLRGVNMKVACLVYPQTLL---TLNYINSTEFYMNGTRIHSGEKELTGEDLGTLCFSCGHQLFSLVWRCYFYY 1438          

HSP 13 Score: 106.686 bits (265), Expect = 1.610e-22
Identity = 62/208 (29.81%), Postives = 110/208 (52.88%), Query Frame = 3
Query: 4896 ISINVTTGEKMCFICGNEMFISQMRCYEFFDKEIKLSILPNDTKIFIFNQRLFVQCMVDPIEVVNRGLITNISFNFNNASSVMVNNTYIIVRGNDTKIICFKCGHITLTNVG--KCYNVYYHKIKLTILPNDTLVYMRNLSMNVICRVDPLEVIXXXXXXXIRFIEYNRSVTEVSERQMFVNGVDKGKLCFTCGHRLLVPVTRCYIYY 5513
            + I     E +C  CGN +     +CY++F K++ L I PN+T I++ +Q L V C V P E+    LI +I    +N   +  ++  +++ G +   +CF+C    + NV   +CY+ +   I L I+PN + +Y +   M++ C+V P   I  + + NI FI  + ++  +S+  + + G ++G +C  C H +    TRCY YY
Sbjct:  452 LQITGAGKELICITCGNPVLKPIQKCYQYFGKDVALHIEPNNTDIYVAHQGLNVFCNVHPKEIDTNSLIQDIILIGDNKELIQNDSRRMMIPGKNLGKVCFQCSSKMVLNVPAKRCYDYFEGSISLEIMPNTSSIYPQGRLMDLYCKVLPQSAI--DKIRNIEFIGNSSNLRVISKLHLQILGDNEGTICLRCQHPIANESTRCYEYY 657          

HSP 14 Score: 103.219 bits (256), Expect = 1.671e-21
Identity = 59/196 (30.10%), Postives = 98/196 (50.00%), Query Frame = 3
Query: 4926 MCFICGNEMFISQMRCYEFFDKEIKLSILPNDTKIFIFNQRLFVQCMVDPIEVVNRGLITNISFNFNNASSVMVNNTYIIVRGNDTKIICFKCGHITLTNVGKCYNVYYHKIKLTILPNDTLVYMRNLSMNVICRVDPLEVIXXXXXXXIRFIEYNRSVTEVSERQMFVNGVDKGKLCFTCGHRLLVPVTRCYIYY 5513
            +CF C N       +C++FF   ++  I P+ T+I++    + + C V+P     R  I +I F +NN++  +     II  G +   ICF+CGH  L+   KCY  +  ++   I P     Y+RN  +   C+++P E+I N L+  I F   N +      R++ ++G + G +CF CG     P  RCY Y+
Sbjct: 1591 VCFNCTNNFVYFGFKCFQFFGYGVEFIINPDYTEIYLPGVVMNITCDVNP-PTFKRDNIKDIGFTYNNSTVNLTTLNLIIHDGRNDGTICFECGHPFLSVTTKCYEYFEKEVVSIIEPEYKKYYLRNRKLTFRCKIEPPEIITNGLIEGIDFFYNNSTFKPSGVREITIDGSNVGTICFRCGREFFNPPLRCYEYF 1785          

HSP 15 Score: 101.679 bits (252), Expect = 5.807e-21
Identity = 59/194 (30.41%), Postives = 100/194 (51.55%), Query Frame = 3
Query: 4926 MCFICGNEMFISQMRCYEFFDKEIKLSILPNDTKIFIFNQRLFVQCMVDPIEVVNRGLITNISFNFNNASSVMVNNTYIIVRGNDTKIICFKCGHITLTNVGKCYNVYYHKIKLTILPNDTLVYMRNLSMNVICRVDP-LEVIXXXXXXXIRFIEYNRSVTEVSERQMFVNGVDKGKLCFTCGHRLLVPVTRCY 5504
            +CF CG+       +CYE+F+KE+   I P   K ++ N++L  +C ++P E++  GLI  I F +NN++        I + G++   ICF+CG        +CY  +   +K  ILP D  +Y+ +  M + C V P LE+    L+ +I F  YN +V   +   + ++  +   +CF CGH+      +CY
Sbjct: 1678 ICFECGHPFLSVTTKCYEYFEKEVVSIIEPEYKKYYLRNRKLTFRCKIEPPEIITNGLIEGIDFFYNNSTFKPSGVREITIDGSNVGTICFRCGREFFNPPLRCYEYFDDDLKFVILP-DVEIYLVHSEMEIQCSVTPSLEL--YLLVNSISFTFYNATVIYKTNVLIRISDTNDQIICFKCGHKFFRFAEKCY 1868          

HSP 16 Score: 98.9821 bits (245), Expect = 3.315e-20
Identity = 60/198 (30.30%), Postives = 104/198 (52.53%), Query Frame = 3
Query: 4923 KMCFICGNEMF--ISQMRCYEFFDKEIKLSILPNDTKIFIFNQRLFVQCMVDPIEVVNRGLITNISFNFNNASSVMVNNTYIIVRGNDTKIICFKCGHITLTNVGKCYNVYYHKIKLTILPNDTLVYMRNLSMNVICRVDPLEVIXXXXXXXIRFIEYNRSVTEVSERQMFVNGVDKGKLCFTCGHRLLVPVTRCYIY 5510
            K+CF C ++M   +   RCY++F+  I L I+PN + I+   + + + C V P   +++  I NI F  N+++  +++  ++ + G++   IC +C H       +CY  Y     + I PNDTL Y     M ++C   P ++I  N +  I FI  N +      R++ + G + G +CF+CG+ +L   TRCY Y
Sbjct:  549 KVCFQCSSKMVLNVPAKRCYDYFEGSISLEIMPNTSSIYPQGRLMDLYCKVLPQSAIDK--IRNIEFIGNSSNLRVISKLHLQILGDNEGTICLRCQHPIANESTRCYEYYGEPYGIYITPNDTLYYYTFREMEILCLFYPNDLI--NRVTEIDFIFNNSTFVNSGPRRIVLFGNNMGYICFSCGNDVLGGNTRCYNY 742          

HSP 17 Score: 98.2117 bits (243), Expect = 5.777e-20
Identity = 56/176 (31.82%), Postives = 100/176 (56.82%), Query Frame = 3
Query: 4992 EIKLSILPNDTKIFIFNQRLFVQCMVDPIEVVNRGLITNISFNFNNASSVMVNNTYIIVRGNDTKIICFKCGHITLTNVGKCYNVYYHKIKLTILPNDTLVYMRNLSMNVICRVDPLEVIXXXXXXXIRFIEYNRSVTEVSERQMFVNGVDKGKLCFTCGHRLL--VPVTRCYIYY 5513
            ++KL I PN T I+  N  + V C V P ++++  L+T+I+   N+ + + +   ++ + G   ++IC  CG+  L  + KCY  +   + L I PN+T +Y+ +  +NV C V P E+  N+L+ +I  I  N+ + +   R+M + G + GK+CF C  +++  VP  RCY Y+
Sbjct:  398 DVKLFIHPNYTSIYFPNYLMDVYCQVVPNDLIS--LMTDITITANSTNIISLGQRHLQITGAGKELICITCGNPVLKPIQKCYQYFGKDVALHIEPNNTDIYVAHQGLNVFCNVHPKEIDTNSLIQDIILIGDNKELIQNDSRRMMIPGKNLGKVCFQCSSKMVLNVPAKRCYDYF 571          

HSP 18 Score: 96.6709 bits (239), Expect = 1.696e-19
Identity = 66/207 (31.88%), Postives = 102/207 (49.28%), Query Frame = 3
Query: 4890 LKISINVTTGEKMCFICGNEMFISQMRCYEFFDKEIKLSILPNDTKIFIFNQRLFVQCMVDPIEVVNRGLITNISFNFNNASSVMVNNTYIIVRGNDTKIICFKCGHITLTNVGKCYNVYYHKIKLTILPNDTLVYMRNLSMNVICRVDPLEVIXXXXXXXIRFIEYNRSVTEVSERQMFVNGVDKGKLCFTCGHRLLVPVTRCYIY 5510
            L + I       +CF CGN  F   ++CY F +  ++L I P+D  I++ N++L V C   P  V ++ LI NI F+ N+ S  +V+  +I + G   +  CF CG   +  V KCY  + +  ++ I PN TL Y    S  ++                I FI  N +   V+ R + + G +K ++CF+CGH LL    RCY Y
Sbjct:   49 LSLLIQGKDTRTICFQCGNPDFKVTIKCYVFSNIAMRLEIAPSDVDIYLPNKQLDVSCEKFPENVTDKDLINNIKFDSNSTSIQVVDQFHISLNGKG-ETACFICGSSIVRIVKKCYTYFDNPFQIIIQPNYTLYYY---SKKIV----------------IDFIFNNSTYVPVALRVITIYGHNKQRICFSCGHVLLAIDFRCYDY 235          

HSP 19 Score: 95.1301 bits (235), Expect = 5.418e-19
Identity = 66/235 (28.09%), Postives = 119/235 (50.64%), Query Frame = 3
Query: 4803 TFKHQDLFSKYSN*DNMSRRTYRMTNHTSLKISINVTTGEKMCFICGNEMFISQMRCYEFFD-KEIKLSILPNDTKIFIFNQRLFVQCMVDPIEVVNRGLITNISFNFNNASSVMVNNTYIIVRGNDTKIICFKCGHITLTNVGKCYNVYYHKIKLTILPNDTLVYMRNLSMNVICRVDPLEVIXXXXXXXIRFIEYNRSVTEVSERQMFVNGVDKGKLCFTCGHRLLVPVTRCY 5504
            +F+ + LF+  S    ++ RTY++     +         + + F+CGN+      R Y +FD K + ++I P   +++   + L V C+V P  V+N  +I +I F  +NA++V  +  Y I+  + T  ICF C +   ++  KCY+ +   I + I PN+T +Y+     NV C + P E++  N ++   F   N ++    +     +G     +CFTCGH  ++ V+RCY
Sbjct: 1042 SFEIRFLFANAS----LASRTYKLIRTKGIDT-------DTIGFVCGNKYLPLTARTYNYFDSKSVNVTIYPQYREVYFKKKGLNVTCVVKPDYVLNASIINDIEFTADNANAVKADRYYYIIPIDCTVKICFICKNKIFSSENKCYDYFDDDIYVDIRPNNTQIYLPRRIFNVRCVILP-EILITNNIVKNFFFSLNNTILPGFDYSF--SGSISDLMCFTCGHSEMITVSRCY 1262          

HSP 20 Score: 90.8929 bits (224), Expect = 1.004e-17
Identity = 62/205 (30.24%), Postives = 103/205 (50.24%), Query Frame = 3
Query: 4914 TGEKM---CFICGNEMFISQMRCYEFFDKEIKLSILPNDTKIFIFNQRLFVQCMVDPIEVVNRGLITNISFNFNNASSVMVNNTYIIVRGNDTKIICFKCGHITLTNVGKCYNVYYHKIKLTILPNDTLVYMRNLSMNVICRVDPLEVIXXXXXXXIRFIEYNRSVT-EVSER-QMFVNGVDKGKLCFTCGHRLLVPVTRCYIYY 5513
            TGE +   CF CG+++F    RCY ++DK I +SILP +   +     L VQC V P E++   LI  I F   N++ +      IIV+  D  +ICF CGH+ +    +CY     +IK+ I P+    Y+  ++ +V C V   +    +    +  +E    VT E ++R  + + G D G +CF C +  +    +C+ ++
Sbjct: 1412 TGEDLGTLCFSCGHQLFSLVWRCYFYYDKIINVSILPENITFYRLFTPLTVQCSVKPDEILKNNLIRGIDFYEFNSTYISKTVREIIVKTKDIGLICFSCGHVLIQPGSRCYE---EQIKVFIEPSFMNAYLDKVAFDVTCNVPANKA---HRTSELVDLELTSDVTLERNDRLSLQMPGKDIGTVCFNCTNNFVYFGFKCFQFF 1610          

HSP 21 Score: 83.1889 bits (204), Expect = 1.913e-15
Identity = 65/211 (30.81%), Postives = 110/211 (52.13%), Query Frame = 3
Query: 4896 ISINVTTGEKMCFICGNEMFISQMRCYEFFDK-EIKLSILPNDTKIFIFNQRLFVQCMVDPIEVVNRGLITNISFNFNNASSVMVNNTYIIVR--GNDTKIICFKCGHITLTNVGKCYNVYYHK-IKLTILPNDTLVYMRNLSMNVICRVDPLEVIXXXXXXXIRFIEYNRSVTEVSERQMFVNGVD-KGKLCFTCGHRLLVPVTRCYIYY 5513
            I I+ T   ++CF CG+   +   RCY+F D+ ++ ++ILP    ++  N  + V+C+V P    N      I F F NAS  + + TY ++R  G DT  I F CG+  L    + YN +  K + +TI P    VY +   +NV C V P  V+N +++ +I F   N +  + ++R  ++  +D   K+CF C +++     +CY Y+
Sbjct:  976 IKIDGTDVGRICFTCGHIFLVIDNRCYDFIDRSKLNITILPARL-VYFSNVEMEVECVVYPKFFNNESF--EIRFLFANAS--LASRTYKLIRTKGIDTDTIGFVCGNKYLPLTARTYNYFDSKSVNVTIYPQYREVYFKKKGLNVTCVVKPDYVLNASIINDIEFTADNANAVK-ADRYYYIIPIDCTVKICFICKNKIFSSENKCYDYF 1180          

HSP 22 Score: 76.2554 bits (186), Expect = 3.052e-13
Identity = 49/170 (28.82%), Postives = 84/170 (49.41%), Query Frame = 3
Query: 4845 DNMSR-RTYRMTNHTSLKISINVTTGEK----MCFICGNEMFISQMRCYEFFDKEIKLSILPNDTKIFIFNQRLFVQCMVDPIEVVNRGLITNISFNFNNASSVMVNNTYIIVRGNDTKIICFKCGHITLTNVGKCYN-------VYYHKIKLTILPNDTL--VYMRNLS 5312
            D +SR R Y + N  +  +S  +  G K    +CF CG    +S ++CY+++D  I + I+P    ++   + + ++C+V P E++   +   + F FNN++  +VN   I V  +     C KC H  L    KCY         +YH+ K   + N+T+  VY R+L 
Sbjct: 1994 DLLSRIRLYSLNNTDASDVSFEIIIGGKDMGRLCFRCGYTFLMSPIKCYDYYDLNITIRIIPFQRVLYFHREYVDIECVVFPKEIMKTDMKDGLEFTFNNSTFNLVNKRTIRVYDSKIYKFCLKCSHPLLVERAKCYYNFKSVKFHWYHENKNVYMINETIGCVYPRDLD 2163          

HSP 23 Score: 72.4034 bits (176), Expect = 3.805e-12
Identity = 59/209 (28.23%), Postives = 102/209 (48.80%), Query Frame = 3
Query: 4875 TNHTSLK------ISINVTTGEKMCFICGNEMFISQMRCYEFFDKEIKLSILPNDTKIFIFNQRLFVQCMVDPIEVVNRGLITNISFNFNNASSVMVNNTYIIVRGNDTKIICFKCGHITLTNVGKCYN-VYYHKIKLTILPNDTLVYMRNLSMNVICRVDPLEVIXXXXXXXIRFIEYNRSVTEVSERQMFVNGVDKGKLCFTCGHRL 5480
            +N TS++      IS+N   GE  CFICG+ +     +CY +FD   ++ I PN T ++ +++++                   I F FNN++ V V    I + G++ + ICF CGH+ L    +CY+ +    + + ILPN  +V++ N +M+V C   P E   +     I F   N +   V + ++ +NG D+ K      H++
Sbjct:  126 SNSTSIQVVDQFHISLN-GKGETACFICGSSIVRIVKKCYTYFDNPFQIIIQPNYT-LYYYSKKIV------------------IDFIFNNSTYVPVALRVITIYGHNKQRICFSCGHVLLAIDFRCYDYIDIANLNIQILPN-YIVFLENQNMDVTCVFTPYEKFKDPSFEII-FQWTNATGNWVDKWKITINGSDRIKEMSDAFHQI 312          

HSP 24 Score: 67.0106 bits (162), Expect = 1.579e-10
Identity = 42/130 (32.31%), Postives = 72/130 (55.38%), Query Frame = 3
Query: 5127 NASSVMVNNTYIIVRGNDTKIICFKCGHITLTNVGKCYNVYYHKIKLTILPNDTLVYMRNLSMNVICRVDPLEVIXXXXXXXIRFIEYNRSVTEVSERQMFVNGVDKGK-LCFTCGHRLLVPVTRCYIYY 5513
            NA+ V  +   ++++G DT+ ICF+CG+       KCY      ++L I P+D  +Y+ N  ++V C   P  V + +L+ NI+F   + S+  V +  + +NG  KG+  CF CG  ++  V +CY Y+
Sbjct:   40 NATVVFKSILSLLIQGKDTRTICFQCGNPDFKVTIKCYVFSNIAMRLEIAPSDVDIYLPNKQLDVSCEKFPENVTDKDLINNIKFDSNSTSIQVVDQFHISLNG--KGETACFICGSSIVRIVKKCYTYF 167          
BLAST of SMED30009724 vs. Planmine SMEST
Match: SMESG000045326.1 (SMESG000045326.1)

HSP 1 Score: 441.81 bits (1135), Expect = 1.840e-150
Identity = 402/1540 (26.10%), Postives = 682/1540 (44.29%), Query Frame = 1
Query:  532 LYVFPVENYYIIGLP---PNVSCELTPEDARDCYKNIELSFKDKSTTG------NLNGQDSQKLCFQCTHSDFIKVIKCYEPKKRIIKNSMFHALSPKKLNFFFDQISMKISCEPENNLIKLQVNEKYIKRISQSRVKIGNSSSNITMIYAFCVMGRYTF-----------PRRRFNKFRGPVEFYFNIAGNS-YPIGRPLNVLCNIRPPDAIINKALVKLISNG-------KVHSGQLNGKNISEICFECYSICEGCFSIPKIKRCL---SPGINSFLYPSSHTAYFTEKRIDIVCDPYTADSGLRVRSDEIKWNDFRFISIGG----FYSMSNRSICVYCFSSLYVNPLICFTHLPNYYLLPKRM---NEYFINMEMFIYCFPLDDFILLTVDSYEIDKK---NSSIAGIGGLPNKSNLTLCAYCYTLVKVYPL---RC---FTPKVLIIAILPENTEYYEFAKSFDVYCILKTKTHLFNGSSLGLKLTANNTSIQNVNATYFVLSGVDDGTVCFSCNSILSNTVTKCYKFKPLNVVISIEPSDTKIYLPNKSLSIKCSVNPD--IFNNKKDIIQFLYYNGSYSKVYPQNLVTSRKNTQTICVICGN-RIITNFSCY-FCFKEKIILKIEPNFTDVFVNNIKMVVRCTVEPEKVIKENLFKNIYFYMENYNISSNN-REITISGTFTEKLCFVCGHLMLRSVRRCYLY--AEYVQLEVMPNDIQIYIARKMSIITCQINPEYIENLEMLRNINFIENNSSCKPNDDGIILYDGVNRGTICFRCGNLLFKSPQKCYKYYNKPISVEIEPSFLKIYRVPIPMSITCVVKPEEIIHKDLISNIHFFKNNSTMNESPIRTVLYDGLDRGEICFTCGYFSLIQASRCYMPFKKVITLSISPVNMEIYFYMKPFTISCIIDPKIVFT--LITDFVFLINNSTIPADSQLQIKYDGKKRGTICFQCGNSMLFTPLKCFLFFGIKVDLEIRPLDTIVYIHKKEMNITCEIISNETIDEKLLPPIHFFTNNLNITPWSPRVIIYDGINRGLICFECGNQYFRSKKRCYSFYSYRMNITIFPD---LTKIFFPNMLMIVYCDVQPVEVITMKFVTDIDFNYCNSTFVNQTDRIYLIDGKSFGTICFRCGSIMIDNVTRCYTRFEKKIRLYIVPNDTEIYMPNKTEIVKCLVDPEIVD--SLMDDIEFINYTLPLRRISKSIAVVTGINLGKIVFYCGNFLLGIVSRSYNYYDIPITLRILPNITKIYIANQRMNIICDVSPIEVVIKKMLYNVGFKFNNSTFKPKTPRLIMIDGRDVGRFCVECGHRNLESVQRCYNYYD----------------------------PPGIL--NYVSDIDFNENNSPFISTIPRVIEITGTNVSRISLKCGNLLKNTS-KFYDYYDKDVSLNINPNYTKIYLPNKILFITCNSNPPELIDENKLLN-VSFIFNNSTFPLINERTLRISGKDVGRFCVLCGHRLLRTVRKCYMYYGQNVVINILPSNTKIYFPNTVIEIICHVEPTE 4872
            L++ P  NY  I  P    +V C++ P D      +I ++    +          + G   + +C  C +     + KCY+      K+   H + P   + +     + + C      I      + I  I  ++  I N S    M+     +G+  F            +R ++ F G +        +S YP GR +++ C + P  AI     ++ I N        K+H  Q+ G N   IC  C           +  RC          ++ P+    Y+T + ++I+C  Y  D   RV   +  +N+  F++ G      +  +   IC  C + +      C+ ++    L  K M     YF N+EM I C    +F  L  +++ ID +    ++I     L   S   +   C+T    Y L   +C   F+ KV   +I P  T+ Y   K  DV C +     +       +   A+   + N+      + G D GT+CF C   L   V +CY +   ++ I I P DT  Y    +++I+C+V PD    N+   I+ F+Y N + + V P+ +     +   IC  CG+  ++ +  CY F  + K+ + I P    V+ +N++M V C V P+    E+    I F   N +++S   + I   G  T+ + FVCG+  L    R Y Y  ++ V + + P   ++Y  +K   +TC + P+Y+ N  ++ +I F  +N++    D    +        ICF C N +F S  KCY Y++  I V+I P+  +IY      ++ CV+ PE +I  +++ N  F  NN+ +   P     + G     +CFTCG+  +I  SRCY  F   ++  I P  ++++  ++   ++C + P  + T  LITD     ++S +      ++      +  ICF CG+S+     KCFL++G  V   I P  T +Y+    M + C +     +    +    F+ N   I      +    G + G +CF CG+Q F    RCY +Y   +N++I P+     ++F P   + V C V+P E++    +  IDF   NST++++T R  ++  K  G ICF CG ++I   +RCY   E++I+++I P+    Y+      V C V        S + D+E  +  + L R  +    + G ++G + F C N  +    + + ++   +   I P+ T+IY+    MNI CDV+P     +  + ++GF +NNST    T  LI+ DGR+ G  C ECGH  L    +CY Y++                            PP I+    +  IDF  NNS F  +  R I I G+NV  I  +CG    N   + Y+Y+D D+   I P+  +IYL +  + I C+  P   ++   L+N +SF F N+T        +RIS  +    C  CGH+  R   KCY  + + + ++I+P++ KIY+      + C+V P E
Sbjct:   97 LFIHP--NYTSIYFPNYLMDVYCQVVPNDLISLMTDITITANSTNIISLGQRHLQITGAGKELICITCGNPVLKPIQKCYQ---YFGKDVALH-IEPNNTDIYVAHQGLNVFCNVHPKEIDTNSLIQDIILIGDNKELIQNDSRR--MMIPGKNLGKVCFQCSSKMVLNVPAKRCYDYFEGSISLEIMPNTSSIYPQGRLMDLYCKVLPQSAIDKIRNIEFIGNSSNLRVISKLHL-QILGDNEGTICLRCQHPIAN-----ESTRCYEYYGEPYGIYITPNDTLYYYTFREMEILCLFYPNDLINRVTEIDFIFNNSTFVNSGPRRIVLFGNNMGYICFSCGNDVLGGNTRCYNYIDIRDLEMKIMPLYKIYFANIEMDIECLVKPEF--LQNETFGIDFRFWNATTIRVSQRLIRISGTDMALICFTCGNKYILIIRKCYEYFSAKVQF-SIHPNYTKIYLPQKKMDVECSVDPVQIITLYKVRDIDFQADKKGVTNIVYLKMRIPGDDLGTICFKCGHKLFPYVDRCYSYYSKSISIHILPDDTLYYYSMLTMNIECNVLPDEIYLNSLVVIVDFIYQNATGADVSPRLIKIDGTDVGRICFTCGHIFLVIDNRCYDFIDRSKLNITILPARL-VYFSNVEMEVECVVYPKFFNNESF--EIRFLFANASLASRTYKLIRTKGIDTDTIGFVCGNKYLPLTARTYNYFDSKSVNVTIYPQYREVYFKKKGLNVTCVVKPDYVLNASIINDIEFTADNANAVKADRYYYIIPIDCTVKICFICKNKIFSSENKCYDYFDDDIYVDIRPNNTQIYLPRRIFNVRCVILPEILITNNIVKNFFFSLNNTIL---PGFDYSFSGSISDLMCFTCGHSEMITVSRCYKSFDLNVSFYIKPDGVKLHTKLRSLKVTCHVLPLSIITDDLITDIELTTSSSDVLRIGPREMVIPPSNKDDICFFCGSSLFEKVTKCFLYYGEDVYFWIEPNFTDIYLRGVNMKVACLVYPQTLLTLNYINSTEFYMNGTRIHSGEKELT---GEDLGTLCFSCGHQLFSLVWRCYFYYDKIINVSILPENITFYRLFTP---LTVQCSVKPDEILKNNLIRGIDFYEFNSTYISKTVREIIVKTKDIGLICFSCGHVLIQPGSRCY---EEQIKVFIEPSFMNAYLDKVAFDVTCNVPANKAHRTSELVDLELTS-DVTLERNDRLSLQMPGKDIGTVCFNCTNNFVYFGFKCFQFFGYGVEFIINPDYTEIYLPGVVMNITCDVNP-PTFKRDNIKDIGFTYNNSTVNLTTLNLIIHDGRNDGTICFECGHPFLSVTTKCYEYFEKEVVSIIEPEYKKYYLRNRKLTFRCKIEPPEIITNGLIEGIDFFYNNSTFKPSGVREITIDGSNVGTICFRCGREFFNPPLRCYEYFDDDLKFVILPD-VEIYLVHSEMEIQCSVTPS--LELYLLVNSISFTFYNATVIYKTNVLIRISDTNDQIICFKCGHKFFRFAEKCYQPFDKTIRLSIVPNHLKIYYEKITTNVTCNVSPEE 1599          

HSP 2 Score: 113.235 bits (282), Expect = 1.840e-150
Identity = 68/196 (34.69%), Postives = 105/196 (53.57%), Query Frame = 3
Query: 4926 MCFICGNEMFISQMRCYEFFDKEIKLSILPNDTKIFIFNQRLFVQCMVDPIEVVNRGLITNI---SFNFNNASSVMVNNTYIIVRGNDTKIICFKCGHITLTNVGKCYNVYYHKIKLTILPNDTLVYMRNLSMNVICRVDPLEVIXXXXXXXIRFIEYNRSVTEVSERQMFVNGVDKGKLCFTCGHRLLVPVTRCY 5504
            +CF CGNE+  +   CYEF+DK+I L I PN T I++ N+ L + C V P E++ R L++ I   S N  +AS V      II+ G D   +CF+CG+  L +  KCY+ Y   I + I+P   ++Y     +++ C V P E++  ++   + F   N +   V++R + V      K C  C H LLV   +CY
Sbjct: 1634 ICFKCGNEIVSNVKMCYEFYDKKINLIIQPNYTDIYVNNKSLSISCEVQPSELITRDLLSRIRLYSLNNTDASDVSFE---IIIGGKDMGRLCFRCGYTFLMSPIKCYDYYDLNITIRIIPFQRVLYFHREYVDIECVVFPKEIMKTDMKDGLEFTFNNSTFNLVNKRTIRVYDSKIYKFCLKCSHPLLVERAKCY 1826          

HSP 3 Score: 463.766 bits (1192), Expect = 1.344e-133
Identity = 432/1666 (25.93%), Postives = 737/1666 (44.24%), Query Frame = 1
Query:  145 DHLNLLIPINSTWKVNGCL-CKCQLVKNVSKIVCENCQLIIHNQTNDYF-------IEPKTTFCYYSDVVSLISCKKSLPKGYTLELDTQDFVKLSPG---VSQIGGKFSKSNQ-TICAWCEYYGMKTPKHCFHYFERKPSLYVFPVEN-YYIIGLPPNVSCELTPEDARDCYKNIELSFKDKSTTGN------LNGQDSQKLCFQCTHSDFIKVIKCYEPKKRIIKNSMFHALSPKKLNFFFDQISMKISC-------EPENNLIKLQVNEKYIKRISQSRVKIGNSSSNITMIYAFCVMGRYTFPRRRFNKFRGPVEFYFNIAGNSYPIGRP---LNVLCNIRPPDAII--------NKALVKLISNGKVHSGQLNGKNISEICFECYSICEGCFSIPKIKRCLS---PGINSFLYPSSHTAYFTEKRIDIVCDPYTAD---SGLRVRSDEIKWNDF------RFISIGGFYSMSNRSICVYCFSSLYVNPLICFTHLP----NYYLLPKRMNEYFINMEMFIYCFPLDDFILLTVDSYEIDK--KNSSIAG-------IGGLPNKSNLTLCAYCYTLVKVYPLRCFTPKVLIIAILPENTEYYEFAKSFDVYCILKTKTHLFNGSSLG-LKLTANNTSIQNVNATYFVLSGVDDGTVCFSCNSILSNTVTKCYKFKPLNVVISIEPSDTKIYLPNKSLSIKCSVNPDIFNNKKDIIQFLYYNGSYSKVYPQNLVTSRKNTQTICVICGN-RIITNFSCYFCFKEKIILKIEPNFTDVFVNNIKMVVRCTVEPEKVIKENLFKNIYFYMENYNISS-NNREITISGTFTEKLCFVCGHLMLRSVRRCYLY-AEYVQLEVMPNDIQIYIARKMSIITCQINPEYIENLEMLRNINFIENNSSCKPNDDGIILYDGVNRGTICFRCGNLLFKSPQKCYKYYNKPISVEIEPSFLKIYRVPIPMSITCVVKPEEIIHKDLISNIHFFKNNSTMNESPIRTVLYDGLDRGEICFTCGYFSLIQASRCYMPFKKVITLSISPVNMEIYFYMKPFTISCIIDPKIVFTLITDFV--FLINNSTIPADSQLQIKYDGKKRGTICFQCGNSMLFTPLKCFLFFGIKVDLEIRPLDTIVYIHKKEMNITCEIISNETIDEKLLPPIHFFTNNLNITPWSPRVIIYDGINRGLICFECGNQYFRSKKRCYSFYSYRMNITIFPDLTKIFFPNMLMIVYCDVQPVEVITMKFVTDIDFNYCNSTFVNQTDRIYLIDGKSFGTICFRCGSIMIDNVTRCYTRFEKKIRLYIVPNDTEIYMPNKTEIVKCLVDPEI-VDSLMDDIEFINYTLPLRRISKSIAVVTGINLGKIVFYCGNFLLGIVSRSYNYYDIPITLRILPNITKIYIANQRMNIICDVSPIEVVIKKMLYNVGFKFNNSTFKPKTPRLIMIDGRDVGRFCVECGHRNLESVQRCYNYYD----------------------------PPGIL--NYVSDIDFNENNSPFISTIPRVIEITGTNVSRISLKCG-NLLKNTSKFYDYYDKDVSLNINPNYTKIYLPNKILFITCNSNPPELIDENKLLNVSFIFNNSTFPLINERTLRISGKDVGRFCVLCGHRLLRTVRKCYMYYGQNVVINILPSNTKIYFPNTVI 4842
            D   ++IP  +  KV  C  C  ++V NV    C            DYF       I P T+  Y    +  + CK  LP+    ++   +F+  S     +S++  +    N+ TIC  C++        C+ Y+     +Y+ P +  YY       + C   P D  +    I+  F + +   +      L G +   +CF C +       +CY      I++     +   K+  +F  I M I C       + E   I  +       R+SQ  ++I  S +++ +I   C        R+ +  F   V+F  +I  N   I  P   ++V C++ P   I          +A  K ++N      ++ G ++  ICF+C     G    P + RC S     I+  + P     Y++   ++I C+    +   + L V  D I  N        R I I G        IC  C     V    C+  +     N  +LP R+  YF N+EM + C     F     +S+EI     N+S+A          G+   +   +C   Y  +       F  K + + I P+  E Y   K  +V C++K   ++ N S +  ++ TA+N +    +  Y+++       +CF C + + ++  KCY +   ++ + I P++T+IYLP +  +++C + P+I     +I++  +++ + + +   +   S   +  +C  CG+  +IT   CY  F   +   I+P+   +      + V C V P  +I ++L  +I     + ++     RE+ I  +  + +CF CG  +   V +C+LY  E V   + PN   IY+      + C + P+ +  L  + +  F  N +     +  +    G + GT+CF CG+ LF    +CY YY+K I+V I P  +  YR+  P+++ C VKP+EI+  +LI  I F++ NST     +R ++    D G ICF+CG+  +   SRCY   ++ I + I P  M  Y     F ++C + P       ++ V   L ++ T+  + +L ++  GK  GT+CF C N+ ++   KCF FFG  V+  I P  T +Y+    MNITC++ +  T     +  I F  NN  +   +  +II+DG N G ICFECG+ +     +CY ++   +   I P+  K +  N  +   C ++P E+IT   +  IDF Y NSTF     R   IDG + GTICFRCG    +   RCY  F+  ++  I+P D EIY+ +    ++C V P + +  L++ I F  Y   +   +  +  ++  N   I F CG+       + Y  +D  I L I+PN  KIY      N+ C+VSP E + K  + ++    +N            +   ++G  C +CG+  + +V+ CY +YD                            P  ++  + +S I     N+   S +   I I G ++ R+  +CG   L +  K YDYYD ++++ I P    +Y   + + I C   P E++  +    + F FNNSTF L+N+RT+R+    + +FC+ C H LL    KCY Y  ++V  +    N  +Y  N  I
Sbjct:  232 DSRRMMIPGKNLGKV--CFQCSSKMVLNVPAKRCY-----------DYFEGSISLEIMPNTSSIYPQGRLMDLYCK-VLPQSAIDKIRNIEFIGNSSNLRVISKLHLQILGDNEGTICLRCQHPIANESTRCYEYYGEPYGIYITPNDTLYYYTFREMEILCLFYPNDLINRVTEIDFIFNNSTFVNSGPRRIVLFGNNMGYICFSCGNDVLGGNTRCYNYID--IRDLEMKIMPLYKI--YFANIEMDIECLVKPEFLQNETFGIDFRFWNATTIRVSQRLIRI--SGTDMALICFTCGNKYILIIRKCYEYFSAKVQF--SIHPNYTKIYLPQKKMDVECSVDPVQIITLYKVRDIDFQADKKGVTNIVYLKMRIPGDDLGTICFKC-----GHKLFPYVDRCYSYYSKSISIHILPDDTLYYYSMLTMNIECNVLPDEIYLNSLVVIVDFIYQNATGADVSPRLIKIDG---TDVGRICFTCGHIFLVIDNRCYDFIDRSKLNITILPARL-VYFSNVEMEVECVVYPKF--FNNESFEIRFLFANASLASRTYKLIRTKGIDTDTIGFVCGNKYLPLTARTYNYFDSKSVNVTIYPQYREVYFKKKGLNVTCVVKPD-YVLNASIINDIEFTADNANAVKADRYYYIIPIDCTVKICFICKNKIFSSENKCYDYFDDDIYVDIRPNNTQIYLPRRIFNVRCVILPEILITN-NIVKNFFFSLNNTILPGFDYSFSGSISDLMCFTCGHSEMITVSRCYKSFDLNVSFYIKPDGVKLHTKLRSLKVTCHVLPLSIITDDLITDIELTTSSSDVLRIGPREMVIPPSNKDDICFFCGSSLFEKVTKCFLYYGEDVYFWIEPNFTDIYLRGVNMKVACLVYPQTLLTLNYINSTEFYMNGTRIHSGEKELT---GEDLGTLCFSCGHQLFSLVWRCYFYYDKIINVSILPENITFYRLFTPLTVQCSVKPDEILKNNLIRGIDFYEFNSTYISKTVREIIVKTKDIGLICFSCGHVLIQPGSRCY---EEQIKVFIEPSFMNAYLDKVAFDVTCNV-PANKAHRTSELVDLELTSDVTLERNDRLSLQMPGKDIGTVCFNCTNNFVYFGFKCFQFFGYGVEFIINPDYTEIYLPGVVMNITCDV-NPPTFKRDNIKDIGFTYNNSTVNLTTLNLIIHDGRNDGTICFECGHPFLSVTTKCYEYFEKEVVSIIEPEYKKYYLRNRKLTFRCKIEPPEIITNGLIEGIDFFYNNSTFKPSGVREITIDGSNVGTICFRCGREFFNPPLRCYEYFDDDLKFVILP-DVEIYLVHSEMEIQCSVTPSLELYLLVNSISFTFYNATVIYKTNVLIRISDTNDQIICFKCGHKFFRFAEKCYQPFDKTIRLSIVPNHLKIYYEKITTNVTCNVSPEEALNK--MKDILLTVDNPLVSRINSMTFAMPQYNLGTICFKCGNEIVSNVKMCYEFYDKKINLIIQPNYTDIYVNNKSLSISCEVQPSELITRDLLSRIRLYSLNNTDASDVSFEIIIGGKDMGRLCFRCGYTFLMSPIKCYDYYDLNITIRIIPFQRVLYFHREYVDIECVVFPKEIMKTDMKDGLEFTFNNSTFNLVNKRTIRVYDSKIYKFCLKCSHPLLVERAKCY-YNFKSVKFHWYHENKNVYMINETI 1850          

HSP 4 Score: 428.713 bits (1101), Expect = 5.101e-122
Identity = 417/1670 (24.97%), Postives = 732/1670 (43.83%), Query Frame = 1
Query:  205 KCQLVKNVSKIVCENCQLIIHNQTND----------YFIEPKTTFCYYSDVVSLISCKK------SLPKGYTLELDTQDFVKLSPGVSQIGGKFSKSNQTICAWCEYYGMKTPKHCFHYFERKPSLYVFPVE-NYYIIGLPPNVSCELTPE--DARDCYKNIELSFKDKSTTGN------LNGQDSQKLCFQCTHSDFIKVIKCYEPKKR---IIKNSMFHALSPKKLNFFFDQISMKISCE--PENNLIKLQ-----VNEKYIKRISQSRVKI-GNSSSNITMIYAFCVMGRYTFPRRRFNKFRGPVEFYFNIAGNS---YPIGRPLNVLCNIRPPDAIINKALVKLISNGK--VHSGQ----LNGKNISEICFECYSICEG----CFSIPKIKRCLSPGINSFLYPSSHTAYFTEKRIDIVC---DPYTADSGLRVRSDEIKWN------DFRFISIGGF------YSMSNRSICVYCFSSLYVNPLICFTHLPNY---YLLPKRMN-EYFINMEMFIYCFPLDDFILLTVDSYEIDKKNSS--IAGIGGLPNKSNLTLCAYCYTLVKVYPLRCFT--PKVLIIAILPENTEYYEFAKSFDVYCILKTKTHLFNGSSLGLKLTANNTSIQNVNATYFVLSGVDDGTVCFSCNSILSNTVTKCYKF---KPLNVVISIEPSDTKIYLPNKSLSIKCSVNPDIFNNKKDIIQFLYYNGSYSKVYPQNLVTSRKNTQTICVICGNRII-TNFSCYFCFKEKII-LKIEPNFTDVFVNNIKMVVRCTVEPEKVIKENLFKNIYFYMENYNISSNNR-EITISGTFTEKLCFVCGHLMLRSVRRCYLY-AEYVQLEVMPNDIQIYIARKMSIITCQINPEYIENLEMLRNINFIENNSSCKPNDDGIILYDGVNRGTICFRCGNLLFKSPQKCYKYYNKPISVEIEPSFLKIYRVPIPMSITCVVKPEEIIHKDLISNIHFFKNNSTMNESPIRTVLYDGLDRGEICFTCGYFSLIQASRCYMPFKKVITLSISPVNMEIYFYMKPFTISCIIDPKIVFTL--ITDFVFLINNSTIPADSQLQIKYDGKKRGTICFQCGNSMLFTPLKCFLFFGIKVDLEIRPLDTIVYIHKKEMNITCEIISNETIDEKLLPPIHFFTNNLNITPWSPRVIIYDGINRGLICFECGNQYFRSKKRCYSFYSYRMNITIFPDLTKIFFPNMLMIVYCDVQPVEVITMKFVTDIDFNYCNSTFVNQTDRIYL-IDGKSFGTICFRCGSIMIDNVTRCYTRFEKKIRLYIVPNDTEIYMPNKTEIVKCLVDPEIVDSLMDDIEFINYTL---PLRRISKSIAVVTGINLGKIVFYCGNFLLGIVSRSYNYYDIPITLRILPNITKIYIANQRMNIICDVSPIEVVIKKMLYNVGFKFNNSTFKPKTPRLIMIDGRDVGRFCVECGHRNLESVQRCYNYYD--------------------------PPGILNY--VSDIDFNENNSPFISTIPRVIEITGTNVSRISLKCGN-LLKNTSKFYDYYDKDVSLNINPNYTKIYLPNKILFITCNSNPPELIDENKLLNVSFIFNNSTFPLINERTLRISGKDVGRFCVLCGHRLLRTVRKCYMYYGQNVVINILPSNTKIYFPNTVIEIICHVEPTE 4872
            K ++  +VS+    +C L+I    +D           FI P  T  Y+ + +  + C+       SL    T+  ++ + + L     QI G      + IC  C    +K  + C+ YF +  +L++ P   + Y+     NV C + P+  D     ++I L   +K    N      + G++  K+CFQC+    + V     P KR     + S+   + P   + +     M + C+  P++ + K++      N   ++ IS+  ++I G++   I +     +    T   R +  +  P   Y  I  N    Y   R + +LC   P D I     +  I N    V+SG     L G N+  ICF C +   G    C++   I R L   I        +  YF    +DI C     +  +    +  D   WN        R I I G       ++  N+ I +      Y +  + F+  PNY   YL  K+M+ E  ++    I  + + D        ++ DKK  +  +     +P     T+C  C   +  Y  RC++   K + I ILP++T YY    + ++ C +       N   + +     N +  +V+     + G D G +CF+C  I      +CY F     LN  I+I P+   +Y  N  + ++C V P  FNN+   I+FL+ N S +    + + T   +T TI  +CGN+ +      Y  F  K + + I P + +V+     + V C V+P+ V+  ++  +I F  +N N    +R    I    T K+CF+C + +  S  +CY Y  + + +++ PN+ QIY+ R++  + C I PE +    +++N  F  NN+     D     + G     +CF CG+    +  +CYK ++  +S  I+P  +K++     + +TC V P  II  DLI++I    ++S +     R ++    ++ +ICF CG     + ++C++ + + +   I P   +IY       ++C++ P+ + TL  I    F +N + I +  +   +  G+  GT+CF CG+ +     +C+ ++   +++ I P +   Y     + + C +  +E +   L+  I F+  N      + R II    + GLICF CG+   +   RC   Y  ++ + I P     +   +   V C+V   +      + D++    +   + + DR+ L + GK  GT+CF C +  +    +C+  F   +   I P+ TEIY+P     + C V+P       D+I+ I +T     +   + ++ +  G N G I F CG+  L + ++ Y Y++  +   I P   K Y+ N+++   C + P E++   ++  + F +NNSTFKP   R I IDG +VG  C  CG        RCY Y+D                           P +  Y  V+ I F   N+  I     +I I+ TN   I  KCG+   +   K Y  +DK + L+I PN+ KIY       +TCN +P E +  NK+ ++    +N     IN  T  +   ++G  C  CG+ ++  V+ CY +Y + + + I P+ T IY  N  + I C V+P+E
Sbjct:   61 KTRIGYSVSEDNAMDCSLVISKHDDDTKITLSGDVKLFIHPNYTSIYFPNYLMDVYCQVVPNDLISLMTDITITANSTNIISLGQRHLQITGA---GKELICITCGNPVLKPIQKCYQYFGKDVALHIEPNNTDIYVAHQGLNVFCNVHPKEIDTNSLIQDIILIGDNKELIQNDSRRMMIPGKNLGKVCFQCSSKMVLNV-----PAKRCYDYFEGSISLEIMPNTSSIYPQGRLMDLYCKVLPQSAIDKIRNIEFIGNSSNLRVISKLHLQILGDNEGTICLRCQHPIANEST---RCYEYYGEPYGIY--ITPNDTLYYYTFREMEILCLFYPNDLINRVTEIDFIFNNSTFVNSGPRRIVLFGNNMGYICFSCGNDVLGGNTRCYNYIDI-RDLEMKIMPL-----YKIYFANIEMDIECLVKPEFLQNETFGI--DFRFWNATTIRVSQRLIRISGTDMALICFTCGNKYILIIRKCYEYFSAKVQFSIHPNYTKIYLPQKKMDVECSVDPVQIITLYKVRDI------DFQADKKGVTNIVYLKMRIPGDDLGTICFKCGHKLFPYVDRCYSYYSKSISIHILPDDTLYYYSMLTMNIECNVLPDEIYLNSLVVIVDFIYQNATGADVSPRLIKIDGTDVGRICFTCGHIFLVIDNRCYDFIDRSKLN--ITILPARL-VYFSNVEMEVECVVYPKFFNNESFEIRFLFANASLASRTYKLIRTKGIDTDTIGFVCGNKYLPLTARTYNYFDSKSVNVTIYPQYREVYFKKKGLNVTCVVKPDYVLNASIINDIEFTADNANAVKADRYYYIIPIDCTVKICFICKNKIFSSENKCYDYFDDDIYVDIRPNNTQIYLPRRIFNVRCVILPEILITNNIVKNFFFSLNNTILPGFDYS---FSGSISDLMCFTCGHSEMITVSRCYKSFDLNVSFYIKPDGVKLHTKLRSLKVTCHVLPLSIITDDLITDIELTTSSSDVLRIGPREMVIPPSNKDDICFFCGSSLFEKVTKCFLYYGEDVYFWIEPNFTDIYLRGVNMKVACLVYPQTLLTLNYINSTEFYMNGTRIHSGEK---ELTGEDLGTLCFSCGHQLFSLVWRCYFYYDKIINVSILPENITFYRLFTPLTVQCSVKPDEILKNNLIRGIDFYEFNSTYISKTVREIIVKTKDIGLICFSCGHVLIQPGSRC---YEEQIKVFIEPSFMNAYLDKVAFDVTCNVPANKAHRTSELVDLELT--SDVTLERNDRLSLQMPGKDIGTVCFNCTNNFVYFGFKCFQFFGYGVEFIINPDYTEIYLPGVVMNITCDVNPPTFKR--DNIKDIGFTYNNSTVNLTTLNLIIHDGRNDGTICFECGHPFLSVTTKCYEYFEKEVVSIIEPEYKKYYLRNRKLTFRCKIEPPEIITNGLIEGIDFFYNNSTFKPSGVREITIDGSNVGTICFRCGREFFNPPLRCYEYFDDDLKFVILPDVEIYLVHSEMEIQCSVTPSLELYLLVNSISFTFYNATVIYKTNVLIRISDTNDQIICFKCGHKFFRFAEKCYQPFDKTIRLSIVPNHLKIYYEKITTNVTCNVSPEEAL--NKMKDILLTVDNPLVSRINSMTFAMPQYNLGTICFKCGNEIVSNVKMCYEFYDKKINLIIQPNYTDIYVNNKSLSISCEVQPSE 1685          

HSP 5 Score: 150.599 bits (379), Expect = 6.432e-36
Identity = 79/218 (36.24%), Postives = 128/218 (58.72%), Query Frame = 3
Query: 4866 YRMTNHTSLKIS-----INVTTGEKMCFICGNEMFISQMRCYEFFDKEIKLSILPNDTKIFIFNQRLFVQCMVDPIEVVNRGLITNISFNFNNASSVMVNNTYIIVRGNDTKIICFKCGHITLTNVGKCYNVYYHKIKLTILPNDTLVYMRNLSMNVICRVDPLEVIXXXXXXXIRFIEYNRSVTEVSERQMFVNGVDKGKLCFTCGHRLLVPVTRCY 5504
            +R  N T++++S     I+ T    +CF CGN+  +   +CYE+F  +++ SI PN TKI++  +++ V+C VDP++++    + +I F  +      +    + + G+D   ICFKCGH     V +CY+ Y   I + ILP+DTL Y   L+MN+ C V P E+  N+L++ + FI  N +  +VS R + ++G D G++CFTCGH  LV   RCY
Sbjct:  481 FRFWNATTIRVSQRLIRISGTDMALICFTCGNKYILIIRKCYEYFSAKVQFSIHPNYTKIYLPQKKMDVECSVDPVQIITLYKVRDIDFQADKKGVTNIVYLKMRIPGDDLGTICFKCGHKLFPYVDRCYSYYSKSISIHILPDDTLYYYSMLTMNIECNVLPDEIYLNSLVVIVDFIYQNATGADVSPRLIKIDGTDVGRICFTCGHIFLVIDNRCY 698          

HSP 6 Score: 128.642 bits (322), Expect = 3.290e-29
Identity = 68/197 (34.52%), Postives = 111/197 (56.35%), Query Frame = 3
Query: 4926 MCFICGNEMFISQMRCYEFFD-KEIKLSILPNDTKIFIFNQRLFVQCMVDPIEVVNRGLITNISFNFNNASSVMVNNTYIIVRGNDTKIICFKCGHITLTNVGKCYNVYYHKIKLTILPNDTLVYMRNLSMNVICRVDPLEVIXXXXXXXIRFIEYNRSVTEVSERQMFVNGVDKGKLCFTCGHRLLVPVTRCYIYY 5513
            +CF CGN++     RCY + D +++++ I+P   KI+  N  + ++C+V P  + N      I F F NA+++ V+   I + G D  +ICF CG+  +  + KCY  +  K++ +I PN T +Y+    M+V C VDP+++I    + +I F    + VT +   +M + G D G +CF CGH+L   V RCY YY
Sbjct:  420 ICFSCGNDVLGGNTRCYNYIDIRDLEMKIMPL-YKIYFANIEMDIECLVKPEFLQNETF--GIDFRFWNATTIRVSQRLIRISGTDMALICFTCGNKYILIIRKCYEYFSAKVQFSIHPNYTKIYLPQKKMDVECSVDPVQIITLYKVRDIDFQADKKGVTNIVYLKMRIPGDDLGTICFKCGHKLFPYVDRCYSYY 613          

HSP 7 Score: 126.716 bits (317), Expect = 1.225e-28
Identity = 75/210 (35.71%), Postives = 114/210 (54.29%), Query Frame = 3
Query: 4884 TSLKISINVTTGEKMCFICGNEMFISQMRCYEFFDKEIKLSILPNDTKIFIFNQRLFVQCMVDPIEVVNRGLITNISFNFNNASSVMVNNTYIIVRGNDTKIICFKCGHITLTNVGKCYNVYYHKIKLTILPNDTLVYMRNLSMNVICRVDPLEVIXXXXXXXIRFIEYNRSVTEVSERQMFVNGVDKGKLCFTCGHRLLVPVTRCYIYY 5513
            T++ I I+ T  + +CF CG++ F    +CY+ FDK I+LSI+PN  KI+       V C V P E +N+  + +I    +N     +N+    +   +   ICFKCG+  ++NV  CY  Y  KI L I PN T +Y+ N S+++ C V P E+I  +LL  IR    N +       ++ + G D G+LCF CG+  L+   +CY YY
Sbjct: 1534 TNVLIRISDTNDQIICFKCGHKFFRFAEKCYQPFDKTIRLSIVPNHLKIYYEKITTNVTCNVSPEEALNK--MKDILLTVDNPLVSRINSMTFAMPQYNLGTICFKCGNEIVSNVKMCYEFYDKKINLIIQPNYTDIYVNNKSLSISCEVQPSELITRDLLSRIRLYSLNNTDASDVSFEIIIGGKDMGRLCFRCGYTFLMSPIKCYDYY 1741          

HSP 8 Score: 118.627 bits (296), Expect = 3.243e-26
Identity = 70/208 (33.65%), Postives = 114/208 (54.81%), Query Frame = 3
Query: 4893 KISINVTTGEKMCFICGNEMFISQMRCYEFFDKEIKLSILPNDTKIFIFNQRLFVQCMVDP-IEVVNRGLITNISFNFNNASSVMVNNTYIIVRGNDTKIICFKCGHITLTNVGKCYNVYYHKIKLTILPNDTLVYMRNLSMNVICRVDPLEVIXXXXXXXIRFIEYNRSVTEVSERQMFVNGVDKGKLCFTCGHRLLVPVTRCYIYY 5513
            +I+I+ +    +CF CG E F   +RCYE+FD ++K  ILP D +I++ +  + +QC V P +E+    L+ +ISF F NA+ +   N  I +   + +IICFKCGH       KCY  +   I+L+I+PN   +Y   ++ NV C V P E +  N + +I     N  V+ ++     +   + G +CF CG+ ++  V  CY +Y
Sbjct: 1451 EITIDGSNVGTICFRCGREFFNPPLRCYEYFDDDLKFVILP-DVEIYLVHSEMEIQCSVTPSLELY--LLVNSISFTFYNATVIYKTNVLIRISDTNDQIICFKCGHKFFRFAEKCYQPFDKTIRLSIVPNHLKIYYEKITTNVTCNVSPEEAL--NKMKDILLTVDNPLVSRINSMTFAMPQYNLGTICFKCGNEIVSNVKMCYEFY 1653          

HSP 9 Score: 111.694 bits (278), Expect = 5.085e-24
Identity = 64/205 (31.22%), Postives = 103/205 (50.24%), Query Frame = 3
Query: 4899 SINVTTGEKMCFICGNEMFISQMRCYEFFDKEIKLSILPNDTKIFIFNQRLFVQCMVDPIEVVNRGLITNISFNFNNASSVMVNNTYIIVRGNDTKIICFKCGHITLTNVGKCYNVYYHKIKLTILPNDTLVYMRNLSMNVICRVDPLEVIXXXXXXXIRFIEYNRSVTEVSERQMFVNGVDKGKLCFTCGHRLLVPVTRCYIYY 5513
            S + +  + MCF CG+   I+  RCY+ FD  +   I P+  K+    + L V C V P+ ++   LIT+I    +++  + +    +++  ++   ICF CG      V KC+  Y   +   I PN T +Y+R ++M V C V P  ++    L  I   E+  + T +   +  + G D G LCF+CGH+L   V RCY YY
Sbjct:  933 SFSGSISDLMCFTCGHSEMITVSRCYKSFDLNVSFYIKPDGVKLHTKLRSLKVTCHVLPLSIITDDLITDIELTTSSSDVLRIGPREMVIPPSNKDDICFFCGSSLFEKVTKCFLYYGEDVYFWIEPNFTDIYLRGVNMKVACLVYPQTLL---TLNYINSTEFYMNGTRIHSGEKELTGEDLGTLCFSCGHQLFSLVWRCYFYY 1134          

HSP 10 Score: 106.686 bits (265), Expect = 1.405e-22
Identity = 62/208 (29.81%), Postives = 110/208 (52.88%), Query Frame = 3
Query: 4896 ISINVTTGEKMCFICGNEMFISQMRCYEFFDKEIKLSILPNDTKIFIFNQRLFVQCMVDPIEVVNRGLITNISFNFNNASSVMVNNTYIIVRGNDTKIICFKCGHITLTNVG--KCYNVYYHKIKLTILPNDTLVYMRNLSMNVICRVDPLEVIXXXXXXXIRFIEYNRSVTEVSERQMFVNGVDKGKLCFTCGHRLLVPVTRCYIYY 5513
            + I     E +C  CGN +     +CY++F K++ L I PN+T I++ +Q L V C V P E+    LI +I    +N   +  ++  +++ G +   +CF+C    + NV   +CY+ +   I L I+PN + +Y +   M++ C+V P   I  + + NI FI  + ++  +S+  + + G ++G +C  C H +    TRCY YY
Sbjct:  148 LQITGAGKELICITCGNPVLKPIQKCYQYFGKDVALHIEPNNTDIYVAHQGLNVFCNVHPKEIDTNSLIQDIILIGDNKELIQNDSRRMMIPGKNLGKVCFQCSSKMVLNVPAKRCYDYFEGSISLEIMPNTSSIYPQGRLMDLYCKVLPQSAI--DKIRNIEFIGNSSNLRVISKLHLQILGDNEGTICLRCQHPIANESTRCYEYY 353          

HSP 11 Score: 106.301 bits (264), Expect = 1.734e-22
Identity = 72/215 (33.49%), Postives = 109/215 (50.70%), Query Frame = 3
Query: 4872 MTNHTSLKISINVTTGEKMCFICGNEMFISQMRCYEFFDKEIKLSILPNDTKIFIFNQRLFVQCMVDPIEVVNRGLITNISFNFNNASSVMVNNTYIIVRGNDTKIICFKCGHITLTNVGKCYN-VYYHKIKLTILPNDTLVYMRNLSMNVICRVDPLEVIXXXXXXXIRFIEYNRSVTEVSERQMFVNGVDKGKLCFTCGHRLLVPVTRCYIYY 5513
            +TN   LK+ I       +CF CG+++F    RCY ++ K I + ILP+DT  +     + ++C V P E+    L+  + F + NA+   V+   I + G D   ICF CGHI L    +CY+ +   K+ +TILP   LVY  N+ M V C V P     NN    IRF+  N S+   + + +   G+D   + F CG++ L    R Y Y+
Sbjct:  576 VTNIVYLKMRIPGDDLGTICFKCGHKLFPYVDRCYSYYSKSISIHILPDDTLYYYSMLTMNIECNVLPDEIYLNSLVVIVDFIYQNATGADVSPRLIKIDGTDVGRICFTCGHIFLVIDNRCYDFIDRSKLNITILPA-RLVYFSNVEMEVECVVYP--KFFNNESFEIRFLFANASLASRTYKLIRTKGIDTDTIGFVCGNKYLPLTARTYNYF 787          

HSP 12 Score: 103.219 bits (256), Expect = 1.643e-21
Identity = 59/196 (30.10%), Postives = 98/196 (50.00%), Query Frame = 3
Query: 4926 MCFICGNEMFISQMRCYEFFDKEIKLSILPNDTKIFIFNQRLFVQCMVDPIEVVNRGLITNISFNFNNASSVMVNNTYIIVRGNDTKIICFKCGHITLTNVGKCYNVYYHKIKLTILPNDTLVYMRNLSMNVICRVDPLEVIXXXXXXXIRFIEYNRSVTEVSERQMFVNGVDKGKLCFTCGHRLLVPVTRCYIYY 5513
            +CF C N       +C++FF   ++  I P+ T+I++    + + C V+P     R  I +I F +NN++  +     II  G +   ICF+CGH  L+   KCY  +  ++   I P     Y+RN  +   C+++P E+I N L+  I F   N +      R++ ++G + G +CF CG     P  RCY Y+
Sbjct: 1287 VCFNCTNNFVYFGFKCFQFFGYGVEFIINPDYTEIYLPGVVMNITCDVNP-PTFKRDNIKDIGFTYNNSTVNLTTLNLIIHDGRNDGTICFECGHPFLSVTTKCYEYFEKEVVSIIEPEYKKYYLRNRKLTFRCKIEPPEIITNGLIEGIDFFYNNSTFKPSGVREITIDGSNVGTICFRCGREFFNPPLRCYEYF 1481          

HSP 13 Score: 101.679 bits (252), Expect = 5.666e-21
Identity = 59/194 (30.41%), Postives = 100/194 (51.55%), Query Frame = 3
Query: 4926 MCFICGNEMFISQMRCYEFFDKEIKLSILPNDTKIFIFNQRLFVQCMVDPIEVVNRGLITNISFNFNNASSVMVNNTYIIVRGNDTKIICFKCGHITLTNVGKCYNVYYHKIKLTILPNDTLVYMRNLSMNVICRVDP-LEVIXXXXXXXIRFIEYNRSVTEVSERQMFVNGVDKGKLCFTCGHRLLVPVTRCY 5504
            +CF CG+       +CYE+F+KE+   I P   K ++ N++L  +C ++P E++  GLI  I F +NN++        I + G++   ICF+CG        +CY  +   +K  ILP D  +Y+ +  M + C V P LE+    L+ +I F  YN +V   +   + ++  +   +CF CGH+      +CY
Sbjct: 1374 ICFECGHPFLSVTTKCYEYFEKEVVSIIEPEYKKYYLRNRKLTFRCKIEPPEIITNGLIEGIDFFYNNSTFKPSGVREITIDGSNVGTICFRCGREFFNPPLRCYEYFDDDLKFVILP-DVEIYLVHSEMEIQCSVTPSLEL--YLLVNSISFTFYNATVIYKTNVLIRISDTNDQIICFKCGHKFFRFAEKCY 1564          

HSP 14 Score: 98.9821 bits (245), Expect = 2.977e-20
Identity = 60/198 (30.30%), Postives = 104/198 (52.53%), Query Frame = 3
Query: 4923 KMCFICGNEMF--ISQMRCYEFFDKEIKLSILPNDTKIFIFNQRLFVQCMVDPIEVVNRGLITNISFNFNNASSVMVNNTYIIVRGNDTKIICFKCGHITLTNVGKCYNVYYHKIKLTILPNDTLVYMRNLSMNVICRVDPLEVIXXXXXXXIRFIEYNRSVTEVSERQMFVNGVDKGKLCFTCGHRLLVPVTRCYIY 5510
            K+CF C ++M   +   RCY++F+  I L I+PN + I+   + + + C V P   +++  I NI F  N+++  +++  ++ + G++   IC +C H       +CY  Y     + I PNDTL Y     M ++C   P ++I  N +  I FI  N +      R++ + G + G +CF+CG+ +L   TRCY Y
Sbjct:  245 KVCFQCSSKMVLNVPAKRCYDYFEGSISLEIMPNTSSIYPQGRLMDLYCKVLPQSAIDK--IRNIEFIGNSSNLRVISKLHLQILGDNEGTICLRCQHPIANESTRCYEYYGEPYGIYITPNDTLYYYTFREMEILCLFYPNDLI--NRVTEIDFIFNNSTFVNSGPRRIVLFGNNMGYICFSCGNDVLGGNTRCYNY 438          

HSP 15 Score: 98.2117 bits (243), Expect = 5.278e-20
Identity = 56/176 (31.82%), Postives = 100/176 (56.82%), Query Frame = 3
Query: 4992 EIKLSILPNDTKIFIFNQRLFVQCMVDPIEVVNRGLITNISFNFNNASSVMVNNTYIIVRGNDTKIICFKCGHITLTNVGKCYNVYYHKIKLTILPNDTLVYMRNLSMNVICRVDPLEVIXXXXXXXIRFIEYNRSVTEVSERQMFVNGVDKGKLCFTCGHRLL--VPVTRCYIYY 5513
            ++KL I PN T I+  N  + V C V P ++++  L+T+I+   N+ + + +   ++ + G   ++IC  CG+  L  + KCY  +   + L I PN+T +Y+ +  +NV C V P E+  N+L+ +I  I  N+ + +   R+M + G + GK+CF C  +++  VP  RCY Y+
Sbjct:   94 DVKLFIHPNYTSIYFPNYLMDVYCQVVPNDLIS--LMTDITITANSTNIISLGQRHLQITGAGKELICITCGNPVLKPIQKCYQYFGKDVALHIEPNNTDIYVAHQGLNVFCNVHPKEIDTNSLIQDIILIGDNKELIQNDSRRMMIPGKNLGKVCFQCSSKMVLNVPAKRCYDYF 267          

HSP 16 Score: 94.7449 bits (234), Expect = 5.719e-19
Identity = 66/235 (28.09%), Postives = 119/235 (50.64%), Query Frame = 3
Query: 4803 TFKHQDLFSKYSN*DNMSRRTYRMTNHTSLKISINVTTGEKMCFICGNEMFISQMRCYEFFD-KEIKLSILPNDTKIFIFNQRLFVQCMVDPIEVVNRGLITNISFNFNNASSVMVNNTYIIVRGNDTKIICFKCGHITLTNVGKCYNVYYHKIKLTILPNDTLVYMRNLSMNVICRVDPLEVIXXXXXXXIRFIEYNRSVTEVSERQMFVNGVDKGKLCFTCGHRLLVPVTRCY 5504
            +F+ + LF+  S    ++ RTY++     +         + + F+CGN+      R Y +FD K + ++I P   +++   + L V C+V P  V+N  +I +I F  +NA++V  +  Y I+  + T  ICF C +   ++  KCY+ +   I + I PN+T +Y+     NV C + P E++  N ++   F   N ++    +     +G     +CFTCGH  ++ V+RCY
Sbjct:  738 SFEIRFLFANAS----LASRTYKLIRTKGIDT-------DTIGFVCGNKYLPLTARTYNYFDSKSVNVTIYPQYREVYFKKKGLNVTCVVKPDYVLNASIINDIEFTADNANAVKADRYYYIIPIDCTVKICFICKNKIFSSENKCYDYFDDDIYVDIRPNNTQIYLPRRIFNVRCVILP-EILITNNIVKNFFFSLNNTILPGFDYSF--SGSISDLMCFTCGHSEMITVSRCY 958          

HSP 17 Score: 90.5077 bits (223), Expect = 1.089e-17
Identity = 62/205 (30.24%), Postives = 103/205 (50.24%), Query Frame = 3
Query: 4914 TGEKM---CFICGNEMFISQMRCYEFFDKEIKLSILPNDTKIFIFNQRLFVQCMVDPIEVVNRGLITNISFNFNNASSVMVNNTYIIVRGNDTKIICFKCGHITLTNVGKCYNVYYHKIKLTILPNDTLVYMRNLSMNVICRVDPLEVIXXXXXXXIRFIEYNRSVT-EVSER-QMFVNGVDKGKLCFTCGHRLLVPVTRCYIYY 5513
            TGE +   CF CG+++F    RCY ++DK I +SILP +   +     L VQC V P E++   LI  I F   N++ +      IIV+  D  +ICF CGH+ +    +CY     +IK+ I P+    Y+  ++ +V C V   +    +    +  +E    VT E ++R  + + G D G +CF C +  +    +C+ ++
Sbjct: 1108 TGEDLGTLCFSCGHQLFSLVWRCYFYYDKIINVSILPENITFYRLFTPLTVQCSVKPDEILKNNLIRGIDFYEFNSTYISKTVREIIVKTKDIGLICFSCGHVLIQPGSRCYE---EQIKVFIEPSFMNAYLDKVAFDVTCNVPANKA---HRTSELVDLELTSDVTLERNDRLSLQMPGKDIGTVCFNCTNNFVYFGFKCFQFF 1306          

HSP 18 Score: 83.1889 bits (204), Expect = 2.117e-15
Identity = 65/211 (30.81%), Postives = 110/211 (52.13%), Query Frame = 3
Query: 4896 ISINVTTGEKMCFICGNEMFISQMRCYEFFDK-EIKLSILPNDTKIFIFNQRLFVQCMVDPIEVVNRGLITNISFNFNNASSVMVNNTYIIVR--GNDTKIICFKCGHITLTNVGKCYNVYYHK-IKLTILPNDTLVYMRNLSMNVICRVDPLEVIXXXXXXXIRFIEYNRSVTEVSERQMFVNGVD-KGKLCFTCGHRLLVPVTRCYIYY 5513
            I I+ T   ++CF CG+   +   RCY+F D+ ++ ++ILP    ++  N  + V+C+V P    N      I F F NAS  + + TY ++R  G DT  I F CG+  L    + YN +  K + +TI P    VY +   +NV C V P  V+N +++ +I F   N +  + ++R  ++  +D   K+CF C +++     +CY Y+
Sbjct:  672 IKIDGTDVGRICFTCGHIFLVIDNRCYDFIDRSKLNITILPARL-VYFSNVEMEVECVVYPKFFNNESF--EIRFLFANAS--LASRTYKLIRTKGIDTDTIGFVCGNKYLPLTARTYNYFDSKSVNVTIYPQYREVYFKKKGLNVTCVVKPDYVLNASIINDIEFTADNANAVK-ADRYYYIIPIDCTVKICFICKNKIFSSENKCYDYF 876          

HSP 19 Score: 75.8702 bits (185), Expect = 3.035e-13
Identity = 49/170 (28.82%), Postives = 84/170 (49.41%), Query Frame = 3
Query: 4845 DNMSR-RTYRMTNHTSLKISINVTTGEK----MCFICGNEMFISQMRCYEFFDKEIKLSILPNDTKIFIFNQRLFVQCMVDPIEVVNRGLITNISFNFNNASSVMVNNTYIIVRGNDTKIICFKCGHITLTNVGKCYN-------VYYHKIKLTILPNDTL--VYMRNLS 5312
            D +SR R Y + N  +  +S  +  G K    +CF CG    +S ++CY+++D  I + I+P    ++   + + ++C+V P E++   +   + F FNN++  +VN   I V  +     C KC H  L    KCY         +YH+ K   + N+T+  VY R+L 
Sbjct: 1690 DLLSRIRLYSLNNTDASDVSFEIIIGGKDMGRLCFRCGYTFLMSPIKCYDYYDLNITIRIIPFQRVLYFHREYVDIECVVFPKEIMKTDMKDGLEFTFNNSTFNLVNKRTIRVYDSKIYKFCLKCSHPLLVERAKCYYNFKSVKFHWYHENKNVYMINETIGCVYPRDLD 1859          
BLAST of SMED30009724 vs. Planmine SMEST
Match: SMESG000045326.1 (SMESG000045326.1)

HSP 1 Score: 440.269 bits (1131), Expect = 5.080e-150
Identity = 391/1486 (26.31%), Postives = 662/1486 (44.55%), Query Frame = 1
Query:  667 NLNGQDSQKLCFQCTHSDFIKVIKCYEPKKRIIKNSMFHALSPKKLNFFFDQISMKISCEPENNLIKLQVNEKYIKRISQSRVKIGNSSSNITMIYAFCVMGRYTF-----------PRRRFNKFRGPVEFYFNIAGNS-YPIGRPLNVLCNIRPPDAIINKALVKLISNG-------KVHSGQLNGKNISEICFECYSICEGCFSIPKIKRCL---SPGINSFLYPSSHTAYFTEKRIDIVCDPYTADSGLRVRSDEIKWNDFRFISIGG----FYSMSNRSICVYCFSSLYVNPLICFTHLPNYYLLPKRM---NEYFINMEMFIYCFPLDDFILLTVDSYEIDKK---NSSIAGIGGLPNKSNLTLCAYCYTLVKVYPL---RC---FTPKVLIIAILPENTEYYEFAKSFDVYCILKTKTHLFNGSSLGLKLTANNTSIQNVNATYFVLSGVDDGTVCFSCNSILSNTVTKCYKFKPLNVVISIEPSDTKIYLPNKSLSIKCSVNPD--IFNNKKDIIQFLYYNGSYSKVYPQNLVTSRKNTQTICVICGN-RIITNFSCY-FCFKEKIILKIEPNFTDVFVNNIKMVVRCTVEPEKVIKENLFKNIYFYMENYNISSNN-REITISGTFTEKLCFVCGHLMLRSVRRCYLY--AEYVQLEVMPNDIQIYIARKMSIITCQINPEYIENLEMLRNINFIENNSSCKPNDDGIILYDGVNRGTICFRCGNLLFKSPQKCYKYYNKPISVEIEPSFLKIYRVPIPMSITCVVKPEEIIHKDLISNIHFFKNNSTMNESPIRTVLYDGLDRGEICFTCGYFSLIQASRCYMPFKKVITLSISPVNMEIYFYMKPFTISCIIDPKIVFT--LITDFVFLINNSTIPADSQLQIKYDGKKRGTICFQCGNSMLFTPLKCFLFFGIKVDLEIRPLDTIVYIHKKEMNITCEIISNETIDEKLLPPIHFFTNNLNITPWSPRVIIYDGINRGLICFECGNQYFRSKKRCYSFYSYRMNITIFPD---LTKIFFPNMLMIVYCDVQPVEVITMKFVTDIDFNYCNSTFVNQTDRIYLIDGKSFGTICFRCGSIMIDNVTRCYTRFEKKIRLYIVPNDTEIYMPNKTEIVKCLVDPEIVD--SLMDDIEFINYTLPLRRISKSIAVVTGINLGKIVFYCGNFLLGIVSRSYNYYDIPITLRILPNITKIYIANQRMNIICDVSPIEVVIKKMLYNVGFKFNNSTFKPKTPRLIMIDGRDVGRFCVECGHRNLESVQRCYNYYD----------------------------PPGIL--NYVSDIDFNENNSPFISTIPRVIEITGTNVSRISLKCGNLLKNTS-KFYDYYDKDVSLNINPNYTKIYLPNKILFITCNSNPPELIDENKLLN-VSFIFNNSTFPLINERTLRISGKDVGRFCVLCGHRLLRTVRKCYMYYGQNVVINILPSNTKIYFPNTVIEIICHVEPTE 4872
             + G   + +C  C +     + KCY+      K+   H + P   + +     + + C      I      + I  I  ++  I N S    M+     +G+  F            +R ++ F G +        +S YP GR +++ C + P  AI     ++ I N        K+H  Q+ G N   IC  C           +  RC          ++ P+    Y+T + ++I+C  Y  D   RV   +  +N+  F++ G      +  +   IC  C + +      C+ ++    L  K M     YF N+EM I C    +F  L  +++ ID +    ++I     L   S   +   C+T    Y L   +C   F+ KV   +I P  T+ Y   K  DV C +     +       +   A+   + N+      + G D GT+CF C   L   V +CY +   ++ I I P DT  Y    +++I+C+V PD    N+   I+ F+Y N + + V P+ +     +   IC  CG+  ++ +  CY F  + K+ + I P    V+ +N++M V C V P+    E+    I F   N +++S   + I   G  T+ + FVCG+  L    R Y Y  ++ V + + P   ++Y  +K   +TC + P+Y+ N  ++ +I F  +N++    D    +        ICF C N +F S  KCY Y++  I V+I P+  +IY      ++ CV+ PE +I  +++ N  F  NN+ +   P     + G     +CFTCG+  +I  SRCY  F   ++  I P  ++++  ++   ++C + P  + T  LITD     ++S +      ++      +  ICF CG+S+     KCFL++G  V   I P  T +Y+    M + C +     +    +    F+ N   I      +    G + G +CF CG+Q F    RCY +Y   +N++I P+     ++F P   + V C V+P E++    +  IDF   NST++++T R  ++  K  G ICF CG ++I   +RCY   E++I+++I P+    Y+      V C V        S + D+E  +  + L R  +    + G ++G + F C N  +    + + ++   +   I P+ T+IY+    MNI CDV+P     +  + ++GF +NNST    T  LI+ DGR+ G  C ECGH  L    +CY Y++                            PP I+    +  IDF  NNS F  +  R I I G+NV  I  +CG    N   + Y+Y+D D+   I P+  +IYL +  + I C+  P   ++   L+N +SF F N+T        +RIS  +    C  CGH+  R   KCY  + + + ++I+P++ KIY+      + C+V P E
Sbjct:   22 QITGAGKELICITCGNPVLKPIQKCYQ---YFGKDVALH-IEPNNTDIYVAHQGLNVFCNVHPKEIDTNSLIQDIILIGDNKELIQNDSRR--MMIPGKNLGKVCFQCSSKMVLNVPAKRCYDYFEGSISLEIMPNTSSIYPQGRLMDLYCKVLPQSAIDKIRNIEFIGNSSNLRVISKLHL-QILGDNEGTICLRCQHPIAN-----ESTRCYEYYGEPYGIYITPNDTLYYYTFREMEILCLFYPNDLINRVTEIDFIFNNSTFVNSGPRRIVLFGNNMGYICFSCGNDVLGGNTRCYNYIDIRDLEMKIMPLYKIYFANIEMDIECLVKPEF--LQNETFGIDFRFWNATTIRVSQRLIRISGTDMALICFTCGNKYILIIRKCYEYFSAKVQF-SIHPNYTKIYLPQKKMDVECSVDPVQIITLYKVRDIDFQADKKGVTNIVYLKMRIPGDDLGTICFKCGHKLFPYVDRCYSYYSKSISIHILPDDTLYYYSMLTMNIECNVLPDEIYLNSLVVIVDFIYQNATGADVSPRLIKIDGTDVGRICFTCGHIFLVIDNRCYDFIDRSKLNITILPARL-VYFSNVEMEVECVVYPKFFNNESF--EIRFLFANASLASRTYKLIRTKGIDTDTIGFVCGNKYLPLTARTYNYFDSKSVNVTIYPQYREVYFKKKGLNVTCVVKPDYVLNASIINDIEFTADNANAVKADRYYYIIPIDCTVKICFICKNKIFSSENKCYDYFDDDIYVDIRPNNTQIYLPRRIFNVRCVILPEILITNNIVKNFFFSLNNTIL---PGFDYSFSGSISDLMCFTCGHSEMITVSRCYKSFDLNVSFYIKPDGVKLHTKLRSLKVTCHVLPLSIITDDLITDIELTTSSSDVLRIGPREMVIPPSNKDDICFFCGSSLFEKVTKCFLYYGEDVYFWIEPNFTDIYLRGVNMKVACLVYPQTLLTLNYINSTEFYMNGTRIHSGEKELT---GEDLGTLCFSCGHQLFSLVWRCYFYYDKIINVSILPENITFYRLFTP---LTVQCSVKPDEILKNNLIRGIDFYEFNSTYISKTVREIIVKTKDIGLICFSCGHVLIQPGSRCY---EEQIKVFIEPSFMNAYLDKVAFDVTCNVPANKAHRTSELVDLELTS-DVTLERNDRLSLQMPGKDIGTVCFNCTNNFVYFGFKCFQFFGYGVEFIINPDYTEIYLPGVVMNITCDVNP-PTFKRDNIKDIGFTYNNSTVNLTTLNLIIHDGRNDGTICFECGHPFLSVTTKCYEYFEKEVVSIIEPEYKKYYLRNRKLTFRCKIEPPEIITNGLIEGIDFFYNNSTFKPSGVREITIDGSNVGTICFRCGREFFNPPLRCYEYFDDDLKFVILPD-VEIYLVHSEMEIQCSVTPS--LELYLLVNSISFTFYNATVIYKTNVLIRISDTNDQIICFKCGHKFFRFAEKCYQPFDKTIRLSIVPNHLKIYYEKITTNVTCNVSPEE 1472          

HSP 2 Score: 113.62 bits (283), Expect = 5.080e-150
Identity = 68/196 (34.69%), Postives = 105/196 (53.57%), Query Frame = 3
Query: 4926 MCFICGNEMFISQMRCYEFFDKEIKLSILPNDTKIFIFNQRLFVQCMVDPIEVVNRGLITNI---SFNFNNASSVMVNNTYIIVRGNDTKIICFKCGHITLTNVGKCYNVYYHKIKLTILPNDTLVYMRNLSMNVICRVDPLEVIXXXXXXXIRFIEYNRSVTEVSERQMFVNGVDKGKLCFTCGHRLLVPVTRCY 5504
            +CF CGNE+  +   CYEF+DK+I L I PN T I++ N+ L + C V P E++ R L++ I   S N  +AS V      II+ G D   +CF+CG+  L +  KCY+ Y   I + I+P   ++Y     +++ C V P E++  ++   + F   N +   V++R + V      K C  C H LLV   +CY
Sbjct: 1507 ICFKCGNEIVSNVKMCYEFYDKKINLIIQPNYTDIYVNNKSLSISCEVQPSELITRDLLSRIRLYSLNNTDASDVSFE---IIIGGKDMGRLCFRCGYTFLMSPIKCYDYYDLNITIRIIPFQRVLYFHREYVDIECVVFPKEIMKTDMKDGLEFTFNNSTFNLVNKRTIRVYDSKIYKFCLKCSHPLLVERAKCY 1699          

HSP 3 Score: 464.151 bits (1193), Expect = 4.783e-134
Identity = 432/1666 (25.93%), Postives = 737/1666 (44.24%), Query Frame = 1
Query:  145 DHLNLLIPINSTWKVNGCL-CKCQLVKNVSKIVCENCQLIIHNQTNDYF-------IEPKTTFCYYSDVVSLISCKKSLPKGYTLELDTQDFVKLSPG---VSQIGGKFSKSNQ-TICAWCEYYGMKTPKHCFHYFERKPSLYVFPVEN-YYIIGLPPNVSCELTPEDARDCYKNIELSFKDKSTTGN------LNGQDSQKLCFQCTHSDFIKVIKCYEPKKRIIKNSMFHALSPKKLNFFFDQISMKISC-------EPENNLIKLQVNEKYIKRISQSRVKIGNSSSNITMIYAFCVMGRYTFPRRRFNKFRGPVEFYFNIAGNSYPIGRP---LNVLCNIRPPDAII--------NKALVKLISNGKVHSGQLNGKNISEICFECYSICEGCFSIPKIKRCLS---PGINSFLYPSSHTAYFTEKRIDIVCDPYTAD---SGLRVRSDEIKWNDF------RFISIGGFYSMSNRSICVYCFSSLYVNPLICFTHLP----NYYLLPKRMNEYFINMEMFIYCFPLDDFILLTVDSYEIDK--KNSSIAG-------IGGLPNKSNLTLCAYCYTLVKVYPLRCFTPKVLIIAILPENTEYYEFAKSFDVYCILKTKTHLFNGSSLG-LKLTANNTSIQNVNATYFVLSGVDDGTVCFSCNSILSNTVTKCYKFKPLNVVISIEPSDTKIYLPNKSLSIKCSVNPDIFNNKKDIIQFLYYNGSYSKVYPQNLVTSRKNTQTICVICGN-RIITNFSCYFCFKEKIILKIEPNFTDVFVNNIKMVVRCTVEPEKVIKENLFKNIYFYMENYNISS-NNREITISGTFTEKLCFVCGHLMLRSVRRCYLY-AEYVQLEVMPNDIQIYIARKMSIITCQINPEYIENLEMLRNINFIENNSSCKPNDDGIILYDGVNRGTICFRCGNLLFKSPQKCYKYYNKPISVEIEPSFLKIYRVPIPMSITCVVKPEEIIHKDLISNIHFFKNNSTMNESPIRTVLYDGLDRGEICFTCGYFSLIQASRCYMPFKKVITLSISPVNMEIYFYMKPFTISCIIDPKIVFTLITDFV--FLINNSTIPADSQLQIKYDGKKRGTICFQCGNSMLFTPLKCFLFFGIKVDLEIRPLDTIVYIHKKEMNITCEIISNETIDEKLLPPIHFFTNNLNITPWSPRVIIYDGINRGLICFECGNQYFRSKKRCYSFYSYRMNITIFPDLTKIFFPNMLMIVYCDVQPVEVITMKFVTDIDFNYCNSTFVNQTDRIYLIDGKSFGTICFRCGSIMIDNVTRCYTRFEKKIRLYIVPNDTEIYMPNKTEIVKCLVDPEI-VDSLMDDIEFINYTLPLRRISKSIAVVTGINLGKIVFYCGNFLLGIVSRSYNYYDIPITLRILPNITKIYIANQRMNIICDVSPIEVVIKKMLYNVGFKFNNSTFKPKTPRLIMIDGRDVGRFCVECGHRNLESVQRCYNYYD----------------------------PPGIL--NYVSDIDFNENNSPFISTIPRVIEITGTNVSRISLKCG-NLLKNTSKFYDYYDKDVSLNINPNYTKIYLPNKILFITCNSNPPELIDENKLLNVSFIFNNSTFPLINERTLRISGKDVGRFCVLCGHRLLRTVRKCYMYYGQNVVINILPSNTKIYFPNTVI 4842
            D   ++IP  +  KV  C  C  ++V NV    C            DYF       I P T+  Y    +  + CK  LP+    ++   +F+  S     +S++  +    N+ TIC  C++        C+ Y+     +Y+ P +  YY       + C   P D  +    I+  F + +   +      L G +   +CF C +       +CY      I++     +   K+  +F  I M I C       + E   I  +       R+SQ  ++I  S +++ +I   C        R+ +  F   V+F  +I  N   I  P   ++V C++ P   I          +A  K ++N      ++ G ++  ICF+C     G    P + RC S     I+  + P     Y++   ++I C+    +   + L V  D I  N        R I I G        IC  C     V    C+  +     N  +LP R+  YF N+EM + C     F     +S+EI     N+S+A          G+   +   +C   Y  +       F  K + + I P+  E Y   K  +V C++K   ++ N S +  ++ TA+N +    +  Y+++       +CF C + + ++  KCY +   ++ + I P++T+IYLP +  +++C + P+I     +I++  +++ + + +   +   S   +  +C  CG+  +IT   CY  F   +   I+P+   +      + V C V P  +I ++L  +I     + ++     RE+ I  +  + +CF CG  +   V +C+LY  E V   + PN   IY+      + C + P+ +  L  + +  F  N +     +  +    G + GT+CF CG+ LF    +CY YY+K I+V I P  +  YR+  P+++ C VKP+EI+  +LI  I F++ NST     +R ++    D G ICF+CG+  +   SRCY   ++ I + I P  M  Y     F ++C + P       ++ V   L ++ T+  + +L ++  GK  GT+CF C N+ ++   KCF FFG  V+  I P  T +Y+    MNITC++ +  T     +  I F  NN  +   +  +II+DG N G ICFECG+ +     +CY ++   +   I P+  K +  N  +   C ++P E+IT   +  IDF Y NSTF     R   IDG + GTICFRCG    +   RCY  F+  ++  I+P D EIY+ +    ++C V P + +  L++ I F  Y   +   +  +  ++  N   I F CG+       + Y  +D  I L I+PN  KIY      N+ C+VSP E + K  + ++    +N            +   ++G  C +CG+  + +V+ CY +YD                            P  ++  + +S I     N+   S +   I I G ++ R+  +CG   L +  K YDYYD ++++ I P    +Y   + + I C   P E++  +    + F FNNSTF L+N+RT+R+    + +FC+ C H LL    KCY Y  ++V  +    N  +Y  N  I
Sbjct:  105 DSRRMMIPGKNLGKV--CFQCSSKMVLNVPAKRCY-----------DYFEGSISLEIMPNTSSIYPQGRLMDLYCK-VLPQSAIDKIRNIEFIGNSSNLRVISKLHLQILGDNEGTICLRCQHPIANESTRCYEYYGEPYGIYITPNDTLYYYTFREMEILCLFYPNDLINRVTEIDFIFNNSTFVNSGPRRIVLFGNNMGYICFSCGNDVLGGNTRCYNYID--IRDLEMKIMPLYKI--YFANIEMDIECLVKPEFLQNETFGIDFRFWNATTIRVSQRLIRI--SGTDMALICFTCGNKYILIIRKCYEYFSAKVQF--SIHPNYTKIYLPQKKMDVECSVDPVQIITLYKVRDIDFQADKKGVTNIVYLKMRIPGDDLGTICFKC-----GHKLFPYVDRCYSYYSKSISIHILPDDTLYYYSMLTMNIECNVLPDEIYLNSLVVIVDFIYQNATGADVSPRLIKIDG---TDVGRICFTCGHIFLVIDNRCYDFIDRSKLNITILPARL-VYFSNVEMEVECVVYPKF--FNNESFEIRFLFANASLASRTYKLIRTKGIDTDTIGFVCGNKYLPLTARTYNYFDSKSVNVTIYPQYREVYFKKKGLNVTCVVKPD-YVLNASIINDIEFTADNANAVKADRYYYIIPIDCTVKICFICKNKIFSSENKCYDYFDDDIYVDIRPNNTQIYLPRRIFNVRCVILPEILITN-NIVKNFFFSLNNTILPGFDYSFSGSISDLMCFTCGHSEMITVSRCYKSFDLNVSFYIKPDGVKLHTKLRSLKVTCHVLPLSIITDDLITDIELTTSSSDVLRIGPREMVIPPSNKDDICFFCGSSLFEKVTKCFLYYGEDVYFWIEPNFTDIYLRGVNMKVACLVYPQTLLTLNYINSTEFYMNGTRIHSGEKELT---GEDLGTLCFSCGHQLFSLVWRCYFYYDKIINVSILPENITFYRLFTPLTVQCSVKPDEILKNNLIRGIDFYEFNSTYISKTVREIIVKTKDIGLICFSCGHVLIQPGSRCY---EEQIKVFIEPSFMNAYLDKVAFDVTCNV-PANKAHRTSELVDLELTSDVTLERNDRLSLQMPGKDIGTVCFNCTNNFVYFGFKCFQFFGYGVEFIINPDYTEIYLPGVVMNITCDV-NPPTFKRDNIKDIGFTYNNSTVNLTTLNLIIHDGRNDGTICFECGHPFLSVTTKCYEYFEKEVVSIIEPEYKKYYLRNRKLTFRCKIEPPEIITNGLIEGIDFFYNNSTFKPSGVREITIDGSNVGTICFRCGREFFNPPLRCYEYFDDDLKFVILP-DVEIYLVHSEMEIQCSVTPSLELYLLVNSISFTFYNATVIYKTNVLIRISDTNDQIICFKCGHKFFRFAEKCYQPFDKTIRLSIVPNHLKIYYEKITTNVTCNVSPEEALNK--MKDILLTVDNPLVSRINSMTFAMPQYNLGTICFKCGNEIVSNVKMCYEFYDKKINLIIQPNYTDIYVNNKSLSISCEVQPSELITRDLLSRIRLYSLNNTDASDVSFEIIIGGKDMGRLCFRCGYTFLMSPIKCYDYYDLNITIRIIPFQRVLYFHREYVDIECVVFPKEIMKTDMKDGLEFTFNNSTFNLVNKRTIRVYDSKIYKFCLKCSHPLLVERAKCY-YNFKSVKFHWYHENKNVYMINETI 1723          

HSP 4 Score: 421.394 bits (1082), Expect = 7.072e-120
Identity = 402/1599 (25.14%), Postives = 705/1599 (44.09%), Query Frame = 1
Query:  370 TLELDTQDFVKLSPGVSQIGGKFSKSNQTICAWCEYYGMKTPKHCFHYFERKPSLYVFPVE-NYYIIGLPPNVSCELTPE--DARDCYKNIELSFKDKSTTGN------LNGQDSQKLCFQCTHSDFIKVIKCYEPKKR---IIKNSMFHALSPKKLNFFFDQISMKISCE--PENNLIKLQ-----VNEKYIKRISQSRVKI-GNSSSNITMIYAFCVMGRYTFPRRRFNKFRGPVEFYFNIAGNS---YPIGRPLNVLCNIRPPDAIINKALVKLISNGK--VHSGQ----LNGKNISEICFECYSICEG----CFSIPKIKRCLSPGINSFLYPSSHTAYFTEKRIDIVC---DPYTADSGLRVRSDEIKWN------DFRFISIGGF------YSMSNRSICVYCFSSLYVNPLICFTHLPNY---YLLPKRMN-EYFINMEMFIYCFPLDDFILLTVDSYEIDKKNSS--IAGIGGLPNKSNLTLCAYCYTLVKVYPLRCFT--PKVLIIAILPENTEYYEFAKSFDVYCILKTKTHLFNGSSLGLKLTANNTSIQNVNATYFVLSGVDDGTVCFSCNSILSNTVTKCYKF---KPLNVVISIEPSDTKIYLPNKSLSIKCSVNPDIFNNKKDIIQFLYYNGSYSKVYPQNLVTSRKNTQTICVICGNRII-TNFSCYFCFKEKII-LKIEPNFTDVFVNNIKMVVRCTVEPEKVIKENLFKNIYFYMENYNISSNNR-EITISGTFTEKLCFVCGHLMLRSVRRCYLY-AEYVQLEVMPNDIQIYIARKMSIITCQINPEYIENLEMLRNINFIENNSSCKPNDDGIILYDGVNRGTICFRCGNLLFKSPQKCYKYYNKPISVEIEPSFLKIYRVPIPMSITCVVKPEEIIHKDLISNIHFFKNNSTMNESPIRTVLYDGLDRGEICFTCGYFSLIQASRCYMPFKKVITLSISPVNMEIYFYMKPFTISCIIDPKIVFTL--ITDFVFLINNSTIPADSQLQIKYDGKKRGTICFQCGNSMLFTPLKCFLFFGIKVDLEIRPLDTIVYIHKKEMNITCEIISNETIDEKLLPPIHFFTNNLNITPWSPRVIIYDGINRGLICFECGNQYFRSKKRCYSFYSYRMNITIFPDLTKIFFPNMLMIVYCDVQPVEVITMKFVTDIDFNYCNSTFVNQTDRIYL-IDGKSFGTICFRCGSIMIDNVTRCYTRFEKKIRLYIVPNDTEIYMPNKTEIVKCLVDPEIVDSLMDDIEFINYTL---PLRRISKSIAVVTGINLGKIVFYCGNFLLGIVSRSYNYYDIPITLRILPNITKIYIANQRMNIICDVSPIEVVIKKMLYNVGFKFNNSTFKPKTPRLIMIDGRDVGRFCVECGHRNLESVQRCYNYYD--------------------------PPGILNY--VSDIDFNENNSPFISTIPRVIEITGTNVSRISLKCGN-LLKNTSKFYDYYDKDVSLNINPNYTKIYLPNKILFITCNSNPPELIDENKLLNVSFIFNNSTFPLINERTLRISGKDVGRFCVLCGHRLLRTVRKCYMYYGQNVVINILPSNTKIYFPNTVIEIICHVEPTE 4872
            T+  ++ + + L     QI G      + IC  C    +K  + C+ YF +  +L++ P   + Y+     NV C + P+  D     ++I L   +K    N      + G++  K+CFQC+    + V     P KR     + S+   + P   + +     M + C+  P++ + K++      N   ++ IS+  ++I G++   I +     +    T   R +  +  P   Y  I  N    Y   R + +LC   P D I     +  I N    V+SG     L G N+  ICF C +   G    C++   I R L   I        +  YF    +DI C     +  +    +  D   WN        R I I G       ++  N+ I +      Y +  + F+  PNY   YL  K+M+ E  ++    I  + + D        ++ DKK  +  +     +P     T+C  C   +  Y  RC++   K + I ILP++T YY    + ++ C +       N   + +     N +  +V+     + G D G +CF+C  I      +CY F     LN  I+I P+   +Y  N  + ++C V P  FNN+   I+FL+ N S +    + + T   +T TI  +CGN+ +      Y  F  K + + I P + +V+     + V C V+P+ V+  ++  +I F  +N N    +R    I    T K+CF+C + +  S  +CY Y  + + +++ PN+ QIY+ R++  + C I PE +    +++N  F  NN+     D     + G     +CF CG+    +  +CYK ++  +S  I+P  +K++     + +TC V P  II  DLI++I    ++S +     R ++    ++ +ICF CG     + ++C++ + + +   I P   +IY       ++C++ P+ + TL  I    F +N + I +  +   +  G+  GT+CF CG+ +     +C+ ++   +++ I P +   Y     + + C +  +E +   L+  I F+  N      + R II    + GLICF CG+   +   RC   Y  ++ + I P     +   +   V C+V   +      + D++    +   + + DR+ L + GK  GT+CF C +  +    +C+  F   +   I P+ TEIY+P     + C V+P       D+I+ I +T     +   + ++ +  G N G I F CG+  L + ++ Y Y++  +   I P   K Y+ N+++   C + P E++   ++  + F +NNSTFKP   R I IDG +VG  C  CG        RCY Y+D                           P +  Y  V+ I F   N+  I     +I I+ TN   I  KCG+   +   K Y  +DK + L+I PN+ KIY       +TCN +P E +  NK+ ++    +N     IN  T  +   ++G  C  CG+ ++  V+ CY +Y + + + I P+ T IY  N  + I C V+P+E
Sbjct:    5 TITANSTNIISLGQRHLQITGA---GKELICITCGNPVLKPIQKCYQYFGKDVALHIEPNNTDIYVAHQGLNVFCNVHPKEIDTNSLIQDIILIGDNKELIQNDSRRMMIPGKNLGKVCFQCSSKMVLNV-----PAKRCYDYFEGSISLEIMPNTSSIYPQGRLMDLYCKVLPQSAIDKIRNIEFIGNSSNLRVISKLHLQILGDNEGTICLRCQHPIANEST---RCYEYYGEPYGIY--ITPNDTLYYYTFREMEILCLFYPNDLINRVTEIDFIFNNSTFVNSGPRRIVLFGNNMGYICFSCGNDVLGGNTRCYNYIDI-RDLEMKIMPL-----YKIYFANIEMDIECLVKPEFLQNETFGI--DFRFWNATTIRVSQRLIRISGTDMALICFTCGNKYILIIRKCYEYFSAKVQFSIHPNYTKIYLPQKKMDVECSVDPVQIITLYKVRDI------DFQADKKGVTNIVYLKMRIPGDDLGTICFKCGHKLFPYVDRCYSYYSKSISIHILPDDTLYYYSMLTMNIECNVLPDEIYLNSLVVIVDFIYQNATGADVSPRLIKIDGTDVGRICFTCGHIFLVIDNRCYDFIDRSKLN--ITILPARL-VYFSNVEMEVECVVYPKFFNNESFEIRFLFANASLASRTYKLIRTKGIDTDTIGFVCGNKYLPLTARTYNYFDSKSVNVTIYPQYREVYFKKKGLNVTCVVKPDYVLNASIINDIEFTADNANAVKADRYYYIIPIDCTVKICFICKNKIFSSENKCYDYFDDDIYVDIRPNNTQIYLPRRIFNVRCVILPEILITNNIVKNFFFSLNNTILPGFDYS---FSGSISDLMCFTCGHSEMITVSRCYKSFDLNVSFYIKPDGVKLHTKLRSLKVTCHVLPLSIITDDLITDIELTTSSSDVLRIGPREMVIPPSNKDDICFFCGSSLFEKVTKCFLYYGEDVYFWIEPNFTDIYLRGVNMKVACLVYPQTLLTLNYINSTEFYMNGTRIHSGEK---ELTGEDLGTLCFSCGHQLFSLVWRCYFYYDKIINVSILPENITFYRLFTPLTVQCSVKPDEILKNNLIRGIDFYEFNSTYISKTVREIIVKTKDIGLICFSCGHVLIQPGSRC---YEEQIKVFIEPSFMNAYLDKVAFDVTCNVPANKAHRTSELVDLELT--SDVTLERNDRLSLQMPGKDIGTVCFNCTNNFVYFGFKCFQFFGYGVEFIINPDYTEIYLPGVVMNITCDVNPPTFKR--DNIKDIGFTYNNSTVNLTTLNLIIHDGRNDGTICFECGHPFLSVTTKCYEYFEKEVVSIIEPEYKKYYLRNRKLTFRCKIEPPEIITNGLIEGIDFFYNNSTFKPSGVREITIDGSNVGTICFRCGREFFNPPLRCYEYFDDDLKFVILPDVEIYLVHSEMEIQCSVTPSLELYLLVNSISFTFYNATVIYKTNVLIRISDTNDQIICFKCGHKFFRFAEKCYQPFDKTIRLSIVPNHLKIYYEKITTNVTCNVSPEEAL--NKMKDILLTVDNPLVSRINSMTFAMPQYNLGTICFKCGNEIVSNVKMCYEFYDKKINLIIQPNYTDIYVNNKSLSISCEVQPSE 1558          

HSP 5 Score: 383.645 bits (984), Expect = 8.436e-108
Identity = 294/1053 (27.92%), Postives = 490/1053 (46.53%), Query Frame = 1
Query: 1852 LKLTANNTSIQNVNATYFVLSGVDDGTVCFSCNSILSNTVTKCYKFKPLNVVISIEPSDTKIYLPNKSLSIKCSVNPDIFNNK---KDIIQFLYYNGSYSKVYPQNLVTSRKNTQTICVICGNRIITNF---SCYFCFKEKIILKIEPNFTDVFVNNIKMVVRCTVEPEKVIKENLFKNIYFYMENYNISSNNR-EITISGTFTEKLCFVCGHLMLRSVRRCY-LYAEYVQLEVMPNDIQIYIARKMSIITCQINPEYIENLEMLRNINFIENNSSCKPNDDGIILYDGVNRGTICFRCGNLLFKSPQKCYKYYN-KPISVEIEPSFLKIYRVPIPMSITCVVKPEEIIHKDLISNIHFFKNNSTMNESPIRTVLYDGLDRGEICFTCGYFSLIQASRCYMPFKKVITLSISPVNMEIYFYMKPFTISCIIDPKIVFTL--ITDFVFLINNSTIPADSQLQIKYDGKKRGTICFQCGNSMLFTPLKCFLFFGIKVDLEIRPLDTIVYIHKKEMNITCEIISNETIDEKLLPPIHFFTNNLNITPWSPRVIIYDGINRGLICFECGNQYFRSKKRCYSFYSY-RMNITIFPDLTKIFFPNMLMIVYCDVQPVEVITMKFVTDIDFNYCNSTFVNQTDRIYLIDGKSFGTICFRCGSIMIDNVTRCYTRFE-KKIRLYIVPNDTEIYMPNKTEIVKCLVDPEIV--DSLMDDIEFINYTLPLRRISKSIAVVTGINLGKIVFYCGNFLLGIVSRSYNYYDIPITLRILPNITKIYIANQRMNIICDVSPIEVVIKKMLYNVGFKFNNSTFKPKTPRLIMIDGRDVGRFCVECGHRNLESVQRCYNYYD--------PPGIL----------------------NYVSDIDFNENNSPFISTIPRVIEITGTNVSRISLKCG-NLLKNTSKFYDYYDKDVSLNINPNYTKIYLPNKILFITCNSNPPELIDENKLLNVSFIFNNSTFPLINERTLRISGKDVGRFCVLCGHRLLRTVRKCYMYYGQNVVINILPSNTKIYFPNTVIEIICHVEPTE 4872
            + +TAN+T+I ++   +  ++G     +C +C + +   + KCY++   +V + IEP++T IY+ ++ L++ C+V+P   +     +DII  +  N    +   + ++   KN   +C  C ++++ N     CY  F+  I L+I PN + ++     M + C V P+  I +   +NI F   + N+   ++  + I G     +C  C H +     RCY  Y E   + + PND   Y   +   I C   P  + N   +  I+FI NNS+   +    I+  G N G ICF CGN +     +CY Y + + + ++I P + KIY   I M I C+VKPE + ++    +  F+  N+T      R +   G D   ICFTCG   ++   +CY  F   +  SI P   +IY   K   + C +DP  + TL  + D  F  +   +     L+++  G   GTICF+CG+ +     +C+ ++   + + I P DT+ Y     MNI C ++ +E     L+  + F   N      SPR+I  DG + G ICF CG+ +     RCY F    ++NITI P    ++F N+ M V C V P       F  +I F + N++  ++T ++    G    TI F CG+  +    R Y  F+ K + + I P   E+Y   K   V C+V P+ V   S+++DIEF        +  +   ++      KI F C N +    ++ Y+Y+D  I + I PN T+IY+  +  N+ C + P  ++   ++ N  F  NN+             G      C  CGH  + +V RCY  +D        P G+                       + ++DI+   ++S  +   PR + I  +N   I   CG +L +  +K + YY +DV   I PN+T IYL    + + C   P  L+  N + +  F  N +    I+     ++G+D+G  C  CGH+L   V +CY YY + + ++ILP N   Y   T + + C V+P E
Sbjct:    4 ITITANSTNIISLGQRHLQITGAGKELICITCGNPVLKPIQKCYQYFGKDVALHIEPNNTDIYVAHQGLNVFCNVHPKEIDTNSLIQDII-LIGDNKELIQNDSRRMMIPGKNLGKVCFQCSSKMVLNVPAKRCYDYFEGSISLEIMPNTSSIYPQGRLMDLYCKVLPQSAIDK--IRNIEFIGNSSNLRVISKLHLQILGDNEGTICLRCQHPIANESTRCYEYYGEPYGIYITPNDTLYYYTFREMEILCLFYPNDLIN--RVTEIDFIFNNSTFVNSGPRRIVLFGNNMGYICFSCGNDVLGGNTRCYNYIDIRDLEMKIMPLY-KIYFANIEMDIECLVKPEFLQNETFGIDFRFW--NATTIRVSQRLIRISGTDMALICFTCGNKYILIIRKCYEYFSAKVQFSIHPNYTKIYLPQKKMDVECSVDPVQIITLYKVRDIDFQADKKGVTNIVYLKMRIPGDDLGTICFKCGHKLFPYVDRCYSYYSKSISIHILPDDTLYYYSMLTMNIECNVLPDEIYLNSLVVIVDFIYQNATGADVSPRLIKIDGTDVGRICFTCGHIFLVIDNRCYDFIDRSKLNITILP-ARLVYFSNVEMEVECVVYPKFFNNESF--EIRFLFANASLASRTYKLIRTKGIDTDTIGFVCGNKYLPLTARTYNYFDSKSVNVTIYPQYREVYFKKKGLNVTCVVKPDYVLNASIINDIEFTADNANAVKADRYYYIIPIDCTVKICFICKNKIFSSENKCYDYFDDDIYVDIRPNNTQIYLPRRIFNVRCVILPEILITNNIVKNFFFSLNNTILPGFDYSF---SGSISDLMCFTCGHSEMITVSRCYKSFDLNVSFYIKPDGVKLHTKLRSLKVTCHVLPLSIITDDLITDIELTTSSSDVLRIGPREMVIPPSNKDDICFFCGSSLFEKVTKCFLYYGEDVYFWIEPNFTDIYLRGVNMKVACLVYPQTLLTLNYINSTEFYMNGTR---IHSGEKELTGEDLGTLCFSCGHQLFSLVWRCYFYYDKIINVSILPENITFYRLFTPLTVQCSVKPDE 1039          

HSP 6 Score: 266.544 bits (680), Expect = 2.097e-71
Identity = 192/699 (27.47%), Postives = 329/699 (47.07%), Query Frame = 1
Query: 2884 ISNIHFFKNNSTMNESPIRTVLYDGLDRGEICFTCGYFSLIQASRCYMPFKKVITLSISPVNMEIYFYMKPFTISCIIDPKIVFT--LITDFVFLINNSTIPADSQLQIKYDGKKRGTICFQCGNSMLF-TPLK-CFLFFGIKVDLEIRPLDTIVYIHKKEMNITCEIISNETIDEKLLPPIHFFTNNLNITPWSPRVIIYDGINRGLICFECGNQYFRSKKRCYSFYSYRMNITIFPDLTKIFFPNMLMIVYCDVQPVEVITMKFVTDIDFNYCNSTFVNQTDRIYLIDGKSFGTICFRCGSIMIDNVTRCYTRFE-KKIRLYIVPNDTEIYMPNKTEIVKCLVDPEIVDSLMDDIEFINYTLPLRRISKSIAVVTGINLGKIVFYCGNFLLGIVSRSYNYYDIPITLRILPNITKIYIANQRMNIICDVSPIEVVIKKMLYNVGFKFNNSTFKPKTPRLIMIDGRDVGRFCVECGHRNLESVQRCYNYYD--------PPGILNYVSD----------------------IDFNENNSPFISTIPRVIEITGTNVSRISLKCGNL-LKNTSKFYDYYDKD-VSLNINPNYTKIYLPNKILFITCNSNPPELIDENKLLNVSFIFNNSTFPLINERTLRISGKDVGRFCVLCGHRLLRTVRKCYMYY-GQNVVINILPSNTKIYFPNTVIEIICHVEP 4866
            +++I    N++ +     R +   G  +  IC TCG   L    +CY  F K + L I P N +IY   +   + C + PK + T  LI D + + +N  +  +   ++   GK  G +CFQC + M+   P K C+ +F   + LEI P  + +Y   + M++ C+++    ID+  +  I F  N+ N+   S   +   G N G IC  C +       RCY +Y     I I P+ T  ++    M + C   P ++I    VT+IDF + NSTFVN   R  ++ G + G ICF CG+ ++   TRCY   + + + + I+P   +IY  N    ++CLV PE + +    I+F  +     R+S+ +  ++G ++  I F CGN  + I+ + Y Y+   +   I PN TKIY+  ++M++ C V P++++    + ++ F+ +           + I G D+G  C +CGH+    V RCY+YY         P   L Y S                       +DF   N+      PR+I+I GT+V RI   CG++ L   ++ YD+ D+  +++ I P    +Y  N  + + C   P      N+   + F+F N++      + +R  G D      +CG++ L    + Y Y+  ++V + I P   ++YF    + + C V+P
Sbjct:    1 MTDITITANSTNIISLGQRHLQITGAGKELICITCGNPVLKPIQKCYQYFGKDVALHIEPNNTDIYVAHQGLNVFCNVHPKEIDTNSLIQDIILIGDNKELIQNDSRRMMIPGKNLGKVCFQCSSKMVLNVPAKRCYDYFEGSISLEIMPNTSSIYPQGRLMDLYCKVLPQSAIDK--IRNIEFIGNSSNLRVISKLHLQILGDNEGTICLRCQHPIANESTRCYEYYGEPYGIYITPNDTLYYYTFREMEILCLFYPNDLINR--VTEIDFIFNNSTFVNSGPRRIVLFGNNMGYICFSCGNDVLGGNTRCYNYIDIRDLEMKIMPL-YKIYFANIEMDIECLVKPEFLQNETFGIDFRFWNATTIRVSQRLIRISGTDMALICFTCGNKYILIIRKCYEYFSAKVQFSIHPNYTKIYLPQKKMDVECSVDPVQIITLYKVRDIDFQADKKGVTNIVYLKMRIPGDDLGTICFKCGHKLFPYVDRCYSYYSKSISIHILPDDTLYYYSMLTMNIECNVLPDEIYLNSLVVIVDFIYQNATGADVSPRLIKIDGTDVGRICFTCGHIFLVIDNRCYDFIDRSKLNITILPARL-VYFSNVEMEVECVVYPKFF--NNESFEIRFLFANASLASRTYKLIRTKGIDTDTIGFVCGNKYLPLTARTYNYFDSKSVNVTIYPQYREVYFKKKGLNVTCVVKP 691          

HSP 7 Score: 150.984 bits (380), Expect = 4.842e-36
Identity = 79/218 (36.24%), Postives = 128/218 (58.72%), Query Frame = 3
Query: 4866 YRMTNHTSLKIS-----INVTTGEKMCFICGNEMFISQMRCYEFFDKEIKLSILPNDTKIFIFNQRLFVQCMVDPIEVVNRGLITNISFNFNNASSVMVNNTYIIVRGNDTKIICFKCGHITLTNVGKCYNVYYHKIKLTILPNDTLVYMRNLSMNVICRVDPLEVIXXXXXXXIRFIEYNRSVTEVSERQMFVNGVDKGKLCFTCGHRLLVPVTRCY 5504
            +R  N T++++S     I+ T    +CF CGN+  +   +CYE+F  +++ SI PN TKI++  +++ V+C VDP++++    + +I F  +      +    + + G+D   ICFKCGH     V +CY+ Y   I + ILP+DTL Y   L+MN+ C V P E+  N+L++ + FI  N +  +VS R + ++G D G++CFTCGH  LV   RCY
Sbjct:  354 FRFWNATTIRVSQRLIRISGTDMALICFTCGNKYILIIRKCYEYFSAKVQFSIHPNYTKIYLPQKKMDVECSVDPVQIITLYKVRDIDFQADKKGVTNIVYLKMRIPGDDLGTICFKCGHKLFPYVDRCYSYYSKSISIHILPDDTLYYYSMLTMNIECNVLPDEIYLNSLVVIVDFIYQNATGADVSPRLIKIDGTDVGRICFTCGHIFLVIDNRCY 571          

HSP 8 Score: 99.3673 bits (246), Expect = 1.042e-32
Identity = 60/198 (30.30%), Postives = 104/198 (52.53%), Query Frame = 3
Query: 4923 KMCFICGNEMF--ISQMRCYEFFDKEIKLSILPNDTKIFIFNQRLFVQCMVDPIEVVNRGLITNISFNFNNASSVMVNNTYIIVRGNDTKIICFKCGHITLTNVGKCYNVYYHKIKLTILPNDTLVYMRNLSMNVICRVDPLEVIXXXXXXXIRFIEYNRSVTEVSERQMFVNGVDKGKLCFTCGHRLLVPVTRCYIY 5510
            K+CF C ++M   +   RCY++F+  I L I+PN + I+   + + + C V P   +++  I NI F  N+++  +++  ++ + G++   IC +C H       +CY  Y     + I PNDTL Y     M ++C   P ++I  N +  I FI  N +      R++ + G + G +CF+CG+ +L   TRCY Y
Sbjct:  118 KVCFQCSSKMVLNVPAKRCYDYFEGSISLEIMPNTSSIYPQGRLMDLYCKVLPQSAIDK--IRNIEFIGNSSNLRVISKLHLQILGDNEGTICLRCQHPIANESTRCYEYYGEPYGIYITPNDTLYYYTFREMEILCLFYPNDLI--NRVTEIDFIFNNSTFVNSGPRRIVLFGNNMGYICFSCGNDVLGGNTRCYNY 311          

HSP 9 Score: 62.3882 bits (150), Expect = 1.042e-32
Identity = 25/82 (30.49%), Postives = 51/82 (62.20%), Query Frame = 1
Query: 4627 LLNVSFIFNNSTFPLINERTLRISGKDVGRFCVLCGHRLLRTVRKCYMYYGQNVVINILPSNTKIYFPNTVIEIICHVEPTE 4872
            + +++   N++    + +R L+I+G      C+ CG+ +L+ ++KCY Y+G++V ++I P+NT IY  +  + + C+V P E
Sbjct:    1 MTDITITANSTNIISLGQRHLQITGAGKELICITCGNPVLKPIQKCYQYFGKDVALHIEPNNTDIYVAHQGLNVFCNVHPKE 82          

HSP 10 Score: 128.642 bits (322), Expect = 2.902e-29
Identity = 68/197 (34.52%), Postives = 111/197 (56.35%), Query Frame = 3
Query: 4926 MCFICGNEMFISQMRCYEFFD-KEIKLSILPNDTKIFIFNQRLFVQCMVDPIEVVNRGLITNISFNFNNASSVMVNNTYIIVRGNDTKIICFKCGHITLTNVGKCYNVYYHKIKLTILPNDTLVYMRNLSMNVICRVDPLEVIXXXXXXXIRFIEYNRSVTEVSERQMFVNGVDKGKLCFTCGHRLLVPVTRCYIYY 5513
            +CF CGN++     RCY + D +++++ I+P   KI+  N  + ++C+V P  + N      I F F NA+++ V+   I + G D  +ICF CG+  +  + KCY  +  K++ +I PN T +Y+    M+V C VDP+++I    + +I F    + VT +   +M + G D G +CF CGH+L   V RCY YY
Sbjct:  293 ICFSCGNDVLGGNTRCYNYIDIRDLEMKIMPL-YKIYFANIEMDIECLVKPEFLQNETF--GIDFRFWNATTIRVSQRLIRISGTDMALICFTCGNKYILIIRKCYEYFSAKVQFSIHPNYTKIYLPQKKMDVECSVDPVQIITLYKVRDIDFQADKKGVTNIVYLKMRIPGDDLGTICFKCGHKLFPYVDRCYSYY 486          

HSP 11 Score: 127.102 bits (318), Expect = 1.019e-28
Identity = 75/210 (35.71%), Postives = 114/210 (54.29%), Query Frame = 3
Query: 4884 TSLKISINVTTGEKMCFICGNEMFISQMRCYEFFDKEIKLSILPNDTKIFIFNQRLFVQCMVDPIEVVNRGLITNISFNFNNASSVMVNNTYIIVRGNDTKIICFKCGHITLTNVGKCYNVYYHKIKLTILPNDTLVYMRNLSMNVICRVDPLEVIXXXXXXXIRFIEYNRSVTEVSERQMFVNGVDKGKLCFTCGHRLLVPVTRCYIYY 5513
            T++ I I+ T  + +CF CG++ F    +CY+ FDK I+LSI+PN  KI+       V C V P E +N+  + +I    +N     +N+    +   +   ICFKCG+  ++NV  CY  Y  KI L I PN T +Y+ N S+++ C V P E+I  +LL  IR    N +       ++ + G D G+LCF CG+  L+   +CY YY
Sbjct: 1407 TNVLIRISDTNDQIICFKCGHKFFRFAEKCYQPFDKTIRLSIVPNHLKIYYEKITTNVTCNVSPEEALNK--MKDILLTVDNPLVSRINSMTFAMPQYNLGTICFKCGNEIVSNVKMCYEFYDKKINLIIQPNYTDIYVNNKSLSISCEVQPSELITRDLLSRIRLYSLNNTDASDVSFEIIIGGKDMGRLCFRCGYTFLMSPIKCYDYY 1614          

HSP 12 Score: 119.013 bits (297), Expect = 2.845e-26
Identity = 69/207 (33.33%), Postives = 112/207 (54.11%), Query Frame = 3
Query: 4893 KISINVTTGEKMCFICGNEMFISQMRCYEFFDKEIKLSILPNDTKIFIFNQRLFVQCMVDPIEVVNRGLITNISFNFNNASSVMVNNTYIIVRGNDTKIICFKCGHITLTNVGKCYNVYYHKIKLTILPNDTLVYMRNLSMNVICRVDPLEVIXXXXXXXIRFIEYNRSVTEVSERQMFVNGVDKGKLCFTCGHRLLVPVTRCYIYY 5513
            +I+I+ +    +CF CG E F   +RCYE+FD ++K  ILP D +I++ +  + +QC V P  +    L+ +ISF F NA+ +   N  I +   + +IICFKCGH       KCY  +   I+L+I+PN   +Y   ++ NV C V P E +  N + +I     N  V+ ++     +   + G +CF CG+ ++  V  CY +Y
Sbjct: 1324 EITIDGSNVGTICFRCGREFFNPPLRCYEYFDDDLKFVILP-DVEIYLVHSEMEIQCSVTP-SLELYLLVNSISFTFYNATVIYKTNVLIRISDTNDQIICFKCGHKFFRFAEKCYQPFDKTIRLSIVPNHLKIYYEKITTNVTCNVSPEEAL--NKMKDILLTVDNPLVSRINSMTFAMPQYNLGTICFKCGNEIVSNVKMCYEFY 1526          

HSP 13 Score: 111.694 bits (278), Expect = 3.905e-24
Identity = 64/205 (31.22%), Postives = 103/205 (50.24%), Query Frame = 3
Query: 4899 SINVTTGEKMCFICGNEMFISQMRCYEFFDKEIKLSILPNDTKIFIFNQRLFVQCMVDPIEVVNRGLITNISFNFNNASSVMVNNTYIIVRGNDTKIICFKCGHITLTNVGKCYNVYYHKIKLTILPNDTLVYMRNLSMNVICRVDPLEVIXXXXXXXIRFIEYNRSVTEVSERQMFVNGVDKGKLCFTCGHRLLVPVTRCYIYY 5513
            S + +  + MCF CG+   I+  RCY+ FD  +   I P+  K+    + L V C V P+ ++   LIT+I    +++  + +    +++  ++   ICF CG      V KC+  Y   +   I PN T +Y+R ++M V C V P  ++    L  I   E+  + T +   +  + G D G LCF+CGH+L   V RCY YY
Sbjct:  806 SFSGSISDLMCFTCGHSEMITVSRCYKSFDLNVSFYIKPDGVKLHTKLRSLKVTCHVLPLSIITDDLITDIELTTSSSDVLRIGPREMVIPPSNKDDICFFCGSSLFEKVTKCFLYYGEDVYFWIEPNFTDIYLRGVNMKVACLVYPQTLL---TLNYINSTEFYMNGTRIHSGEKELTGEDLGTLCFSCGHQLFSLVWRCYFYY 1007          

HSP 14 Score: 107.071 bits (266), Expect = 1.215e-22
Identity = 62/208 (29.81%), Postives = 110/208 (52.88%), Query Frame = 3
Query: 4896 ISINVTTGEKMCFICGNEMFISQMRCYEFFDKEIKLSILPNDTKIFIFNQRLFVQCMVDPIEVVNRGLITNISFNFNNASSVMVNNTYIIVRGNDTKIICFKCGHITLTNVG--KCYNVYYHKIKLTILPNDTLVYMRNLSMNVICRVDPLEVIXXXXXXXIRFIEYNRSVTEVSERQMFVNGVDKGKLCFTCGHRLLVPVTRCYIYY 5513
            + I     E +C  CGN +     +CY++F K++ L I PN+T I++ +Q L V C V P E+    LI +I    +N   +  ++  +++ G +   +CF+C    + NV   +CY+ +   I L I+PN + +Y +   M++ C+V P   I  + + NI FI  + ++  +S+  + + G ++G +C  C H +    TRCY YY
Sbjct:   21 LQITGAGKELICITCGNPVLKPIQKCYQYFGKDVALHIEPNNTDIYVAHQGLNVFCNVHPKEIDTNSLIQDIILIGDNKELIQNDSRRMMIPGKNLGKVCFQCSSKMVLNVPAKRCYDYFEGSISLEIMPNTSSIYPQGRLMDLYCKVLPQSAI--DKIRNIEFIGNSSNLRVISKLHLQILGDNEGTICLRCQHPIANESTRCYEYY 226          

HSP 15 Score: 106.686 bits (265), Expect = 1.426e-22
Identity = 72/215 (33.49%), Postives = 109/215 (50.70%), Query Frame = 3
Query: 4872 MTNHTSLKISINVTTGEKMCFICGNEMFISQMRCYEFFDKEIKLSILPNDTKIFIFNQRLFVQCMVDPIEVVNRGLITNISFNFNNASSVMVNNTYIIVRGNDTKIICFKCGHITLTNVGKCYN-VYYHKIKLTILPNDTLVYMRNLSMNVICRVDPLEVIXXXXXXXIRFIEYNRSVTEVSERQMFVNGVDKGKLCFTCGHRLLVPVTRCYIYY 5513
            +TN   LK+ I       +CF CG+++F    RCY ++ K I + ILP+DT  +     + ++C V P E+    L+  + F + NA+   V+   I + G D   ICF CGHI L    +CY+ +   K+ +TILP   LVY  N+ M V C V P     NN    IRF+  N S+   + + +   G+D   + F CG++ L    R Y Y+
Sbjct:  449 VTNIVYLKMRIPGDDLGTICFKCGHKLFPYVDRCYSYYSKSISIHILPDDTLYYYSMLTMNIECNVLPDEIYLNSLVVIVDFIYQNATGADVSPRLIKIDGTDVGRICFTCGHIFLVIDNRCYDFIDRSKLNITILPA-RLVYFSNVEMEVECVVYP--KFFNNESFEIRFLFANASLASRTYKLIRTKGIDTDTIGFVCGNKYLPLTARTYNYF 660          

HSP 16 Score: 103.605 bits (257), Expect = 1.275e-21
Identity = 59/196 (30.10%), Postives = 98/196 (50.00%), Query Frame = 3
Query: 4926 MCFICGNEMFISQMRCYEFFDKEIKLSILPNDTKIFIFNQRLFVQCMVDPIEVVNRGLITNISFNFNNASSVMVNNTYIIVRGNDTKIICFKCGHITLTNVGKCYNVYYHKIKLTILPNDTLVYMRNLSMNVICRVDPLEVIXXXXXXXIRFIEYNRSVTEVSERQMFVNGVDKGKLCFTCGHRLLVPVTRCYIYY 5513
            +CF C N       +C++FF   ++  I P+ T+I++    + + C V+P     R  I +I F +NN++  +     II  G +   ICF+CGH  L+   KCY  +  ++   I P     Y+RN  +   C+++P E+I N L+  I F   N +      R++ ++G + G +CF CG     P  RCY Y+
Sbjct: 1160 VCFNCTNNFVYFGFKCFQFFGYGVEFIINPDYTEIYLPGVVMNITCDVNP-PTFKRDNIKDIGFTYNNSTVNLTTLNLIIHDGRNDGTICFECGHPFLSVTTKCYEYFEKEVVSIIEPEYKKYYLRNRKLTFRCKIEPPEIITNGLIEGIDFFYNNSTFKPSGVREITIDGSNVGTICFRCGREFFNPPLRCYEYF 1354          

HSP 17 Score: 101.679 bits (252), Expect = 4.746e-21
Identity = 59/194 (30.41%), Postives = 100/194 (51.55%), Query Frame = 3
Query: 4926 MCFICGNEMFISQMRCYEFFDKEIKLSILPNDTKIFIFNQRLFVQCMVDPIEVVNRGLITNISFNFNNASSVMVNNTYIIVRGNDTKIICFKCGHITLTNVGKCYNVYYHKIKLTILPNDTLVYMRNLSMNVICRVDP-LEVIXXXXXXXIRFIEYNRSVTEVSERQMFVNGVDKGKLCFTCGHRLLVPVTRCY 5504
            +CF CG+       +CYE+F+KE+   I P   K ++ N++L  +C ++P E++  GLI  I F +NN++        I + G++   ICF+CG        +CY  +   +K  ILP D  +Y+ +  M + C V P LE+    L+ +I F  YN +V   +   + ++  +   +CF CGH+      +CY
Sbjct: 1247 ICFECGHPFLSVTTKCYEYFEKEVVSIIEPEYKKYYLRNRKLTFRCKIEPPEIITNGLIEGIDFFYNNSTFKPSGVREITIDGSNVGTICFRCGREFFNPPLRCYEYFDDDLKFVILP-DVEIYLVHSEMEIQCSVTPSLEL--YLLVNSISFTFYNATVIYKTNVLIRISDTNDQIICFKCGHKFFRFAEKCY 1437          

HSP 18 Score: 95.5153 bits (236), Expect = 4.193e-19
Identity = 66/235 (28.09%), Postives = 119/235 (50.64%), Query Frame = 3
Query: 4803 TFKHQDLFSKYSN*DNMSRRTYRMTNHTSLKISINVTTGEKMCFICGNEMFISQMRCYEFFD-KEIKLSILPNDTKIFIFNQRLFVQCMVDPIEVVNRGLITNISFNFNNASSVMVNNTYIIVRGNDTKIICFKCGHITLTNVGKCYNVYYHKIKLTILPNDTLVYMRNLSMNVICRVDPLEVIXXXXXXXIRFIEYNRSVTEVSERQMFVNGVDKGKLCFTCGHRLLVPVTRCY 5504
            +F+ + LF+  S    ++ RTY++     +         + + F+CGN+      R Y +FD K + ++I P   +++   + L V C+V P  V+N  +I +I F  +NA++V  +  Y I+  + T  ICF C +   ++  KCY+ +   I + I PN+T +Y+     NV C + P E++  N ++   F   N ++    +     +G     +CFTCGH  ++ V+RCY
Sbjct:  611 SFEIRFLFANAS----LASRTYKLIRTKGIDT-------DTIGFVCGNKYLPLTARTYNYFDSKSVNVTIYPQYREVYFKKKGLNVTCVVKPDYVLNASIINDIEFTADNANAVKADRYYYIIPIDCTVKICFICKNKIFSSENKCYDYFDDDIYVDIRPNNTQIYLPRRIFNVRCVILP-EILITNNIVKNFFFSLNNTILPGFDYSF--SGSISDLMCFTCGHSEMITVSRCY 831          

HSP 19 Score: 90.8929 bits (224), Expect = 9.146e-18
Identity = 62/205 (30.24%), Postives = 103/205 (50.24%), Query Frame = 3
Query: 4914 TGEKM---CFICGNEMFISQMRCYEFFDKEIKLSILPNDTKIFIFNQRLFVQCMVDPIEVVNRGLITNISFNFNNASSVMVNNTYIIVRGNDTKIICFKCGHITLTNVGKCYNVYYHKIKLTILPNDTLVYMRNLSMNVICRVDPLEVIXXXXXXXIRFIEYNRSVT-EVSER-QMFVNGVDKGKLCFTCGHRLLVPVTRCYIYY 5513
            TGE +   CF CG+++F    RCY ++DK I +SILP +   +     L VQC V P E++   LI  I F   N++ +      IIV+  D  +ICF CGH+ +    +CY     +IK+ I P+    Y+  ++ +V C V   +    +    +  +E    VT E ++R  + + G D G +CF C +  +    +C+ ++
Sbjct:  981 TGEDLGTLCFSCGHQLFSLVWRCYFYYDKIINVSILPENITFYRLFTPLTVQCSVKPDEILKNNLIRGIDFYEFNSTYISKTVREIIVKTKDIGLICFSCGHVLIQPGSRCYE---EQIKVFIEPSFMNAYLDKVAFDVTCNVPANKA---HRTSELVDLELTSDVTLERNDRLSLQMPGKDIGTVCFNCTNNFVYFGFKCFQFF 1179          

HSP 20 Score: 83.5741 bits (205), Expect = 1.736e-15
Identity = 65/211 (30.81%), Postives = 110/211 (52.13%), Query Frame = 3
Query: 4896 ISINVTTGEKMCFICGNEMFISQMRCYEFFDK-EIKLSILPNDTKIFIFNQRLFVQCMVDPIEVVNRGLITNISFNFNNASSVMVNNTYIIVR--GNDTKIICFKCGHITLTNVGKCYNVYYHK-IKLTILPNDTLVYMRNLSMNVICRVDPLEVIXXXXXXXIRFIEYNRSVTEVSERQMFVNGVD-KGKLCFTCGHRLLVPVTRCYIYY 5513
            I I+ T   ++CF CG+   +   RCY+F D+ ++ ++ILP    ++  N  + V+C+V P    N      I F F NAS  + + TY ++R  G DT  I F CG+  L    + YN +  K + +TI P    VY +   +NV C V P  V+N +++ +I F   N +  + ++R  ++  +D   K+CF C +++     +CY Y+
Sbjct:  545 IKIDGTDVGRICFTCGHIFLVIDNRCYDFIDRSKLNITILPARL-VYFSNVEMEVECVVYPKFFNNESF--EIRFLFANAS--LASRTYKLIRTKGIDTDTIGFVCGNKYLPLTARTYNYFDSKSVNVTIYPQYREVYFKKKGLNVTCVVKPDYVLNASIINDIEFTADNANAVK-ADRYYYIIPIDCTVKICFICKNKIFSSENKCYDYF 749          

HSP 21 Score: 82.8037 bits (203), Expect = 2.735e-15
Identity = 43/140 (30.71%), Postives = 79/140 (56.43%), Query Frame = 3
Query: 5100 ITNISFNFNNASSVMVNNTYIIVRGNDTKIICFKCGHITLTNVGKCYNVYYHKIKLTILPNDTLVYMRNLSMNVICRVDPLEVIXXXXXXXIRFIEYNRSVTEVSERQMFVNGVDKGKLCFTCGHRLL--VPVTRCYIYY 5513
            +T+I+   N+ + + +   ++ + G   ++IC  CG+  L  + KCY  +   + L I PN+T +Y+ +  +NV C V P E+  N+L+ +I  I  N+ + +   R+M + G + GK+CF C  +++  VP  RCY Y+
Sbjct:    1 MTDITITANSTNIISLGQRHLQITGAGKELICITCGNPVLKPIQKCYQYFGKDVALHIEPNNTDIYVAHQGLNVFCNVHPKEIDTNSLIQDIILIGDNKELIQNDSRRMMIPGKNLGKVCFQCSSKMVLNVPAKRCYDYF 140          

HSP 22 Score: 76.2554 bits (186), Expect = 2.431e-13
Identity = 49/170 (28.82%), Postives = 84/170 (49.41%), Query Frame = 3
Query: 4845 DNMSR-RTYRMTNHTSLKISINVTTGEK----MCFICGNEMFISQMRCYEFFDKEIKLSILPNDTKIFIFNQRLFVQCMVDPIEVVNRGLITNISFNFNNASSVMVNNTYIIVRGNDTKIICFKCGHITLTNVGKCYN-------VYYHKIKLTILPNDTL--VYMRNLS 5312
            D +SR R Y + N  +  +S  +  G K    +CF CG    +S ++CY+++D  I + I+P    ++   + + ++C+V P E++   +   + F FNN++  +VN   I V  +     C KC H  L    KCY         +YH+ K   + N+T+  VY R+L 
Sbjct: 1563 DLLSRIRLYSLNNTDASDVSFEIIIGGKDMGRLCFRCGYTFLMSPIKCYDYYDLNITIRIIPFQRVLYFHREYVDIECVVFPKEIMKTDMKDGLEFTFNNSTFNLVNKRTIRVYDSKIYKFCLKCSHPLLVERAKCYYNFKSVKFHWYHENKNVYMINETIGCVYPRDLD 1732          
The following BLAST results are available for this feature:
BLAST of SMED30009724 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30009724 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30009724 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30009724 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30009724 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30009724 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30009724 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30009724 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30009724 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30009724 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30009724 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30009724 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30009724 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30009724 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000001254.11.152e-3169.29SMESG000001254.1[more]
SMESG000001254.13.693e-11062.54SMESG000001254.1[more]
SMESG000045326.18.846e-15126.10SMESG000045326.1[more]
SMESG000045326.11.840e-15026.10SMESG000045326.1[more]
SMESG000045326.15.080e-15026.31SMESG000045326.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30009724 ID=SMED30009724|Name=SMED30009724|organism=Schmidtea mediterranea sexual|type=transcript|length=5513bp
CGAAATATTTTATGTTGTTTATACATGTAACCAATATTTAATTTGTAAAT
GAAATCTAAATTCAAATTCAAATTGTTTTTTAGCATTGAATCATTTGTTA
TTTTTTTCATTTTTCTAGTGGGTAAAGTAGAAAATCATTGCTATGATCAT
CTTAATTTACTCATTCCGATAAATTCTACCTGGAAAGTTAATGGCTGCCT
CTGCAAATGCCAGTTAGTTAAAAATGTTTCCAAGATTGTCTGTGAAAATT
GCCAGTTAATTATTCATAATCAAACAAATGATTATTTCATTGAACCAAAA
ACGACATTTTGTTATTATTCTGATGTGGTTTCATTGATTTCGTGTAAAAA
GTCCCTACCTAAGGGTTATACATTAGAATTAGATACGCAAGATTTTGTCA
AACTTTCCCCCGGGGTTTCTCAGATTGGTGGGAAATTTAGCAAATCAAAT
CAAACTATTTGCGCGTGGTGTGAATATTATGGAATGAAAACTCCAAAGCA
TTGTTTTCATTATTTTGAACGTAAACCATCATTATACGTATTTCCTGTCG
AAAACTATTATATAATCGGCTTACCGCCTAATGTTTCATGTGAACTGACG
CCTGAAGATGCTAGAGATTGTTATAAAAACATTGAACTATCGTTTAAAGA
TAAATCAACAACTGGAAATCTTAATGGACAAGATTCACAAAAATTGTGCT
TTCAATGTACTCATAGTGATTTTATTAAAGTGATAAAGTGCTATGAACCG
AAAAAAAGGATAATTAAGAATAGCATGTTTCATGCTTTATCACCCAAAAA
GTTAAATTTTTTCTTTGATCAAATTTCAATGAAAATTTCGTGTGAACCGG
AGAATAATCTTATAAAACTACAAGTTAATGAAAAATATATAAAACGCATC
AGCCAATCACGGGTGAAAATCGGCAACAGTTCCAGCAATATTACTATGAT
ATATGCATTTTGTGTAATGGGTCGCTATACGTTTCCTCGAAGGCGGTTTA
ACAAATTTAGAGGTCCTGTTGAATTTTATTTCAACATTGCCGGAAATTCA
TATCCTATTGGTAGACCATTGAATGTCTTGTGCAATATTCGACCACCCGA
TGCCATTATTAATAAAGCTTTAGTAAAGCTTATATCCAACGGAAAAGTCC
ATTCAGGACAATTAAATGGAAAAAATATTTCAGAAATTTGCTTTGAATGT
TACTCTATCTGCGAAGGTTGCTTTTCAATTCCTAAAATCAAAAGATGCTT
GAGCCCAGGAATAAATTCTTTTTTATACCCTTCCAGTCATACAGCTTATT
TTACAGAGAAAAGGATTGATATAGTATGTGACCCATACACAGCGGATAGT
GGCTTACGAGTTCGGTCAGATGAAATAAAGTGGAATGATTTTCGGTTTAT
AAGTATTGGTGGCTTTTATAGTATGAGCAATCGGTCCATTTGTGTTTACT
GTTTCTCTAGTCTCTACGTGAACCCATTAATTTGTTTCACTCATTTACCC
AATTATTATTTACTACCTAAAAGGATGAATGAATATTTTATCAATATGGA
AATGTTTATATATTGTTTCCCATTGGACGATTTCATTCTGTTAACCGTCG
ATTCCTATGAAATAGATAAGAAAAACTCCTCTATTGCTGGAATCGGTGGG
TTACCGAATAAAAGCAATTTAACCCTGTGCGCATATTGCTATACATTAGT
TAAAGTTTATCCATTGAGATGCTTCACTCCAAAAGTCTTGATAATCGCTA
TCTTACCGGAGAATACCGAATATTATGAGTTTGCCAAGTCTTTCGATGTT
TATTGCATATTGAAAACAAAAACTCATTTGTTCAATGGTAGCTCTCTCGG
CTTAAAATTGACTGCAAACAATACATCAATTCAAAATGTGAATGCAACGT
ATTTTGTGCTTAGCGGAGTTGATGATGGGACTGTATGTTTCTCCTGCAAC
AGTATTTTATCAAATACGGTGACAAAATGTTATAAATTTAAACCTTTAAA
TGTTGTCATTTCCATTGAACCTAGTGACACGAAAATCTATTTGCCCAATA
AATCACTGTCAATCAAATGTTCCGTTAATCCGGATATATTTAATAATAAA
AAAGACATAATTCAATTCCTATATTATAATGGTTCATATTCTAAGGTCTA
CCCTCAAAATTTAGTCACTAGTCGAAAGAATACTCAAACCATATGTGTTA
TTTGCGGAAACCGAATTATTACCAACTTTTCATGCTATTTCTGTTTTAAG
GAGAAAATAATACTGAAAATTGAACCAAATTTTACTGATGTCTTTGTCAA
TAATATTAAAATGGTCGTCAGATGCACCGTGGAGCCTGAGAAAGTGATCA
AAGAAAATTTATTTAAAAATATATATTTCTATATGGAGAATTATAATATA
TCTTCAAATAATAGAGAAATAACCATCAGTGGAACATTTACGGAAAAATT
ATGTTTTGTTTGTGGACATTTAATGTTAAGGAGTGTTCGTAGATGCTATT
TATATGCAGAATATGTTCAATTGGAAGTAATGCCAAATGATATACAAATA
TATATTGCGCGTAAAATGTCAATAATAACTTGTCAAATAAATCCAGAATA
TATTGAAAATTTAGAGATGTTAAGAAATATTAATTTTATAGAAAATAACT
CTTCTTGCAAACCCAATGATGATGGGATAATCTTGTATGATGGTGTCAAT
CGTGGGACAATATGTTTTAGATGTGGAAATCTTTTGTTTAAATCTCCACA
AAAATGTTACAAGTATTACAATAAGCCCATTTCCGTTGAAATTGAACCAA
GTTTCTTAAAGATTTATCGAGTTCCAATTCCAATGTCTATCACATGCGTT
GTGAAACCCGAGGAAATCATTCATAAAGATTTGATATCAAATATCCATTT
TTTTAAAAATAATTCTACGATGAATGAATCTCCAATAAGAACAGTGCTTT
ACGATGGGTTAGATCGAGGGGAAATTTGTTTTACATGTGGCTACTTTTCT
CTCATTCAAGCAAGCAGATGCTACATGCCTTTTAAAAAAGTCATAACTTT
GTCAATTTCCCCAGTTAATATGGAGATCTATTTCTATATGAAACCTTTCA
CTATTTCATGCATAATAGATCCGAAGATTGTTTTTACATTAATTACTGAT
TTTGTATTTTTAATCAACAATTCTACTATTCCTGCCGATTCGCAATTACA
AATTAAATATGATGGTAAAAAGAGAGGAACTATTTGCTTTCAGTGTGGCA
ATTCTATGTTGTTTACGCCCTTGAAATGCTTTTTATTTTTCGGTATCAAA
GTAGACCTTGAAATTCGACCTTTAGATACAATTGTTTACATACACAAAAA
GGAAATGAATATAACTTGTGAAATTATTTCCAATGAAACAATCGACGAGA
AGCTTTTGCCGCCAATACATTTTTTTACCAACAACTTAAACATAACTCCT
TGGAGTCCCAGGGTGATTATTTATGACGGTATTAATAGAGGGCTTATTTG
TTTTGAATGTGGAAATCAGTATTTCAGATCTAAAAAAAGATGCTATTCAT
TCTATAGTTACAGAATGAACATAACAATTTTTCCGGATTTAACAAAAATC
TTTTTTCCAAATATGTTAATGATCGTCTACTGTGACGTTCAACCTGTGGA
AGTCATTACGATGAAATTTGTCACTGACATTGATTTCAACTATTGTAATT
CTACGTTTGTTAATCAAACAGACAGAATTTATTTAATAGATGGGAAAAGT
TTTGGAACTATCTGTTTCCGGTGTGGCAGTATTATGATAGACAACGTTAC
TCGGTGTTACACAAGATTTGAAAAGAAAATTAGACTTTATATTGTCCCAA
ATGATACAGAAATTTACATGCCAAATAAGACTGAAATTGTCAAGTGTTTG
GTTGATCCTGAAATTGTGGACTCACTGATGGATGACATTGAATTCATTAA
CTACACATTGCCATTGCGTAGAATTTCCAAGAGTATTGCTGTGGTTACAG
GAATTAATCTCGGAAAAATAGTATTCTACTGTGGAAATTTTCTTTTGGGA
ATTGTTTCTCGATCTTACAATTACTATGATATTCCAATAACTTTGAGAAT
TCTGCCAAACATTACCAAAATATATATTGCAAATCAACGGATGAATATCA
TTTGTGATGTTTCACCAATTGAGGTTGTCATAAAAAAAATGTTATACAAC
GTTGGTTTCAAGTTTAATAACTCCACCTTTAAACCCAAGACACCAAGACT
TATAATGATTGATGGTAGAGATGTTGGCAGATTTTGTGTCGAATGTGGCC
ATAGAAATTTGGAATCTGTACAAAGGTGTTACAATTACTATGACCCACCT
GGGATACTCAACTATGTCAGTGACATAGATTTCAATGAAAATAATTCTCC
GTTTATTTCCACTATTCCAAGAGTTATTGAAATTACCGGTACTAATGTCT
CCAGAATAAGTTTGAAATGTGGGAATCTCCTTAAAAATACGTCTAAATTC
TACGATTATTACGACAAAGATGTAAGTTTGAACATAAATCCTAATTACAC
AAAAATTTATTTACCTAATAAAATATTGTTTATCACATGCAATTCAAATC
CGCCTGAACTTATTGATGAGAATAAATTGTTAAATGTTTCTTTTATCTTT
AACAATTCAACTTTTCCGTTGATCAACGAGAGAACACTTCGAATTTCGGG
AAAAGACGTTGGAAGGTTTTGTGTTTTATGTGGTCATCGGCTGCTAAGAA
CTGTTCGAAAATGTTATATGTATTATGGTCAAAATGTTGTTATTAATATA
TTACCTTCAAACACCAAGATTTATTTTCCAAATACAGTAATTGAGATAAT
ATGTCACGTAGAACCTACAGAATGACAAATCATACCTCTTTAAAGATTTC
AATTAATGTTACAACTGGGGAAAAGATGTGTTTTATTTGTGGCAATGAAA
TGTTCATAAGTCAAATGCGCTGCTATGAGTTCTTTGACAAGGAAATAAAA
CTCTCAATTCTTCCAAATGATACTAAAATCTTCATTTTTAATCAAAGGTT
ATTTGTCCAGTGTATGGTGGATCCAATAGAAGTTGTCAATCGAGGCCTCA
TAACCAATATCAGTTTTAATTTTAATAATGCTTCATCTGTAATGGTGAAT
AATACATATATTATCGTTAGAGGAAATGATACGAAAATAATTTGTTTTAA
ATGTGGTCATATCACTTTAACAAATGTTGGTAAATGCTATAACGTATACT
ATCATAAAATAAAACTGACGATTTTACCAAATGACACTTTAGTTTATATG
CGTAATCTGTCCATGAACGTTATTTGTCGTGTTGATCCATTAGAAGTCAT
TAACAACAATTTATTATTAAATATCCGATTCATAGAATACAATAGATCAG
TCACAGAAGTATCTGAAAGGCAAATGTTTGTAAATGGTGTTGATAAAGGA
AAATTATGTTTCACCTGTGGTCATAGACTTCTTGTCCCAGTAACAAGATG
CTACATATATTAC
back to top

protein sequence of SMED30009724-orf-1

>SMED30009724-orf-1 ID=SMED30009724-orf-1|Name=SMED30009724-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1609bp
MKSKFKFKLFFSIESFVIFFIFLVGKVENHCYDHLNLLIPINSTWKVNGC
LCKCQLVKNVSKIVCENCQLIIHNQTNDYFIEPKTTFCYYSDVVSLISCK
KSLPKGYTLELDTQDFVKLSPGVSQIGGKFSKSNQTICAWCEYYGMKTPK
HCFHYFERKPSLYVFPVENYYIIGLPPNVSCELTPEDARDCYKNIELSFK
DKSTTGNLNGQDSQKLCFQCTHSDFIKVIKCYEPKKRIIKNSMFHALSPK
KLNFFFDQISMKISCEPENNLIKLQVNEKYIKRISQSRVKIGNSSSNITM
IYAFCVMGRYTFPRRRFNKFRGPVEFYFNIAGNSYPIGRPLNVLCNIRPP
DAIINKALVKLISNGKVHSGQLNGKNISEICFECYSICEGCFSIPKIKRC
LSPGINSFLYPSSHTAYFTEKRIDIVCDPYTADSGLRVRSDEIKWNDFRF
ISIGGFYSMSNRSICVYCFSSLYVNPLICFTHLPNYYLLPKRMNEYFINM
EMFIYCFPLDDFILLTVDSYEIDKKNSSIAGIGGLPNKSNLTLCAYCYTL
VKVYPLRCFTPKVLIIAILPENTEYYEFAKSFDVYCILKTKTHLFNGSSL
GLKLTANNTSIQNVNATYFVLSGVDDGTVCFSCNSILSNTVTKCYKFKPL
NVVISIEPSDTKIYLPNKSLSIKCSVNPDIFNNKKDIIQFLYYNGSYSKV
YPQNLVTSRKNTQTICVICGNRIITNFSCYFCFKEKIILKIEPNFTDVFV
NNIKMVVRCTVEPEKVIKENLFKNIYFYMENYNISSNNREITISGTFTEK
LCFVCGHLMLRSVRRCYLYAEYVQLEVMPNDIQIYIARKMSIITCQINPE
YIENLEMLRNINFIENNSSCKPNDDGIILYDGVNRGTICFRCGNLLFKSP
QKCYKYYNKPISVEIEPSFLKIYRVPIPMSITCVVKPEEIIHKDLISNIH
FFKNNSTMNESPIRTVLYDGLDRGEICFTCGYFSLIQASRCYMPFKKVIT
LSISPVNMEIYFYMKPFTISCIIDPKIVFTLITDFVFLINNSTIPADSQL
QIKYDGKKRGTICFQCGNSMLFTPLKCFLFFGIKVDLEIRPLDTIVYIHK
KEMNITCEIISNETIDEKLLPPIHFFTNNLNITPWSPRVIIYDGINRGLI
CFECGNQYFRSKKRCYSFYSYRMNITIFPDLTKIFFPNMLMIVYCDVQPV
EVITMKFVTDIDFNYCNSTFVNQTDRIYLIDGKSFGTICFRCGSIMIDNV
TRCYTRFEKKIRLYIVPNDTEIYMPNKTEIVKCLVDPEIVDSLMDDIEFI
NYTLPLRRISKSIAVVTGINLGKIVFYCGNFLLGIVSRSYNYYDIPITLR
ILPNITKIYIANQRMNIICDVSPIEVVIKKMLYNVGFKFNNSTFKPKTPR
LIMIDGRDVGRFCVECGHRNLESVQRCYNYYDPPGILNYVSDIDFNENNS
PFISTIPRVIEITGTNVSRISLKCGNLLKNTSKFYDYYDKDVSLNINPNY
TKIYLPNKILFITCNSNPPELIDENKLLNVSFIFNNSTFPLINERTLRIS
GKDVGRFCVLCGHRLLRTVRKCYMYYGQNVVINILPSNTKIYFPNTVIEI
ICHVEPTE*
back to top

protein sequence of SMED30009724-orf-2

>SMED30009724-orf-2 ID=SMED30009724-orf-2|Name=SMED30009724-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=221bp
MSRRTYRMTNHTSLKISINVTTGEKMCFICGNEMFISQMRCYEFFDKEIK
LSILPNDTKIFIFNQRLFVQCMVDPIEVVNRGLITNISFNFNNASSVMVN
NTYIIVRGNDTKIICFKCGHITLTNVGKCYNVYYHKIKLTILPNDTLVYM
RNLSMNVICRVDPLEVINNNLLLNIRFIEYNRSVTEVSERQMFVNGVDKG
KLCFTCGHRLLVPVTRCYIYY
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002089reproductive organ