5-aminolevulinate synthase

Overview
Name5-aminolevulinate synthase
Smed IDSMED30009717
Length (bp)1712
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of 5-aminolevulinate synthase (SMED30009717) t-SNE clustered cells

Violin plots show distribution of expression levels for 5-aminolevulinate synthase (SMED30009717) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of 5-aminolevulinate synthase (SMED30009717) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for 5-aminolevulinate synthase (SMED30009717) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30009717

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30009717SMESG000078664.1 SMED30009717smed_20140614PMID:27551436
Wang et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymaSMED30009717SMESG000078664.1 SMED30009717smed_20140614PMID:27551436
Wang et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
pigment cellSMED30009717SMESG000078664.1 SmedASXL_012985SmedAsxl_ww_GCZZ01PMID:29158443
He et al., 2017
whole organism asexual adult colorimetric in situ hybridization evidence
pigment cellSMED30009717SMESG000078664.1 SmedASXL_012985SmedAsxl_ww_GCZZ01PMID:29158443
He et al., 2017
whole organism asexual adult RNA-sequencing evidence
parenchymal cellSMED30009717SMESG000078664.1 dd_Smed_v4_1226_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30009717SMESG000078664.1 dd_Smed_v4_1226_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
pigment cellSMED30009717SMESG000078664.1 SMU15001551SMUPMID:27240733
Stubenhaus et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
pigment cellSMED30009717SMESG000078664.1 dd_Smed_v6_1226_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of 5-aminolevulinate synthase vs. Ensembl Human
Match: ALAS2 (5'-aminolevulinate synthase 2 [Source:HGNC Symbol;Acc:HGNC:397])

HSP 1 Score: 489.574 bits (1259), Expect = 8.004e-168
Identity = 227/394 (57.61%), Postives = 303/394 (76.90%), Query Frame = 1
Query:  388 EFFQSEIDKKKQDNTYRVFKKVLRRADNFPYAK---EKSILNKDVAVWCSNDYLGMSWHPSVMEAAINAIRKHGTGSGGTRNISGNTILHESLEEDLAKLHGKEAALVFTSCYVANEASLHTLGTRLPFVEIFSDSGNHASMIHGIRTSRARKIIYRHNDTKHLDQLLSKTSAGVPKLVAFETVHSMSGNICPVDELLDICEKHGAFSFVDEVHAVGLYGDHGAGVAERDGVMDRIDMISGTLGKAFGNVGGYIAGDKAVVDMIRNYASGFIFTTSLPPHVLAGARKAVDILASDEGRQLRNQHQDVVRTVKSYLQHEGIPVIDCPSHIIPVHVGHAGLCTHLSNEMLQKYNIYVQAINHPTVAVGEERLRIAPSPHHTLPMINELVSAMISLW 1560
            +FF+ +I +KKQD+TYRVFK V R AD +P+A+   E S+ +KDV+VWCSNDYLGMS HP V++A    +++HG G+GGTRNISG +  H  LE++LA+LH K++AL+F+SC+VAN+++L TL   LP  EI+SD+GNHASMI GIR S A K ++RHND  HL +LL K++  +PK+VAFETVHSM G ICP++EL D+  ++GA +FVDEVHAVGLYG  GAG+ ERDG+M +ID+ISGTLGKAFG VGGYIA  + +VDM+R+YA+GFIFTTSLPP VL+GA ++V +L  +EG+ LR  HQ  V+ ++  L   G+PVI CPSHIIP+ VG+A L + L + +L K+ IYVQAIN+PTV  GEE LR+APSPHH+  M+ + V  ++  W
Sbjct:  110 QFFRDKIMEKKQDHTYRVFKTVNRWADAYPFAQHFSEASVASKDVSVWCSNDYLGMSRHPQVLQATQETLQRHGAGAGGTRNISGTSKFHVELEQELAELHQKDSALLFSSCFVANDSTLFTLAKILPGCEIYSDAGNHASMIQGIRNSGAAKFVFRHNDPDHLKKLLEKSNPKIPKIVAFETVHSMDGAICPLEELCDVSHQYGALTFVDEVHAVGLYGSRGAGIGERDGIMHKIDIISGTLGKAFGCVGGYIASTRDLVDMVRSYAAGFIFTTSLPPMVLSGALESVRLLKGEEGQALRRAHQRNVKHMRQLLMDRGLPVIPCPSHIIPIRVGNAALNSKLCDLLLSKHGIYVQAINYPTVPRGEELLRLAPSPHHSPQMMEDFVEKLLLAW 503          
BLAST of 5-aminolevulinate synthase vs. Ensembl Human
Match: ALAS2 (5'-aminolevulinate synthase 2 [Source:HGNC Symbol;Acc:HGNC:397])

HSP 1 Score: 489.96 bits (1260), Expect = 1.502e-167
Identity = 227/394 (57.61%), Postives = 303/394 (76.90%), Query Frame = 1
Query:  388 EFFQSEIDKKKQDNTYRVFKKVLRRADNFPYAK---EKSILNKDVAVWCSNDYLGMSWHPSVMEAAINAIRKHGTGSGGTRNISGNTILHESLEEDLAKLHGKEAALVFTSCYVANEASLHTLGTRLPFVEIFSDSGNHASMIHGIRTSRARKIIYRHNDTKHLDQLLSKTSAGVPKLVAFETVHSMSGNICPVDELLDICEKHGAFSFVDEVHAVGLYGDHGAGVAERDGVMDRIDMISGTLGKAFGNVGGYIAGDKAVVDMIRNYASGFIFTTSLPPHVLAGARKAVDILASDEGRQLRNQHQDVVRTVKSYLQHEGIPVIDCPSHIIPVHVGHAGLCTHLSNEMLQKYNIYVQAINHPTVAVGEERLRIAPSPHHTLPMINELVSAMISLW 1560
            +FF+ +I +KKQD+TYRVFK V R AD +P+A+   E S+ +KDV+VWCSNDYLGMS HP V++A    +++HG G+GGTRNISG +  H  LE++LA+LH K++AL+F+SC+VAN+++L TL   LP  EI+SD+GNHASMI GIR S A K ++RHND  HL +LL K++  +PK+VAFETVHSM G ICP++EL D+  ++GA +FVDEVHAVGLYG  GAG+ ERDG+M +ID+ISGTLGKAFG VGGYIA  + +VDM+R+YA+GFIFTTSLPP VL+GA ++V +L  +EG+ LR  HQ  V+ ++  L   G+PVI CPSHIIP+ VG+A L + L + +L K+ IYVQAIN+PTV  GEE LR+APSPHH+  M+ + V  ++  W
Sbjct:  147 QFFRDKIMEKKQDHTYRVFKTVNRWADAYPFAQHFSEASVASKDVSVWCSNDYLGMSRHPQVLQATQETLQRHGAGAGGTRNISGTSKFHVELEQELAELHQKDSALLFSSCFVANDSTLFTLAKILPGCEIYSDAGNHASMIQGIRNSGAAKFVFRHNDPDHLKKLLEKSNPKIPKIVAFETVHSMDGAICPLEELCDVSHQYGALTFVDEVHAVGLYGSRGAGIGERDGIMHKIDIISGTLGKAFGCVGGYIASTRDLVDMVRSYAAGFIFTTSLPPMVLSGALESVRLLKGEEGQALRRAHQRNVKHMRQLLMDRGLPVIPCPSHIIPIRVGNAALNSKLCDLLLSKHGIYVQAINYPTVPRGEELLRLAPSPHHSPQMMEDFVEKLLLAW 540          
BLAST of 5-aminolevulinate synthase vs. Ensembl Human
Match: ALAS2 (5'-aminolevulinate synthase 2 [Source:HGNC Symbol;Acc:HGNC:397])

HSP 1 Score: 489.189 bits (1258), Expect = 2.078e-167
Identity = 227/394 (57.61%), Postives = 303/394 (76.90%), Query Frame = 1
Query:  388 EFFQSEIDKKKQDNTYRVFKKVLRRADNFPYAK---EKSILNKDVAVWCSNDYLGMSWHPSVMEAAINAIRKHGTGSGGTRNISGNTILHESLEEDLAKLHGKEAALVFTSCYVANEASLHTLGTRLPFVEIFSDSGNHASMIHGIRTSRARKIIYRHNDTKHLDQLLSKTSAGVPKLVAFETVHSMSGNICPVDELLDICEKHGAFSFVDEVHAVGLYGDHGAGVAERDGVMDRIDMISGTLGKAFGNVGGYIAGDKAVVDMIRNYASGFIFTTSLPPHVLAGARKAVDILASDEGRQLRNQHQDVVRTVKSYLQHEGIPVIDCPSHIIPVHVGHAGLCTHLSNEMLQKYNIYVQAINHPTVAVGEERLRIAPSPHHTLPMINELVSAMISLW 1560
            +FF+ +I +KKQD+TYRVFK V R AD +P+A+   E S+ +KDV+VWCSNDYLGMS HP V++A    +++HG G+GGTRNISG +  H  LE++LA+LH K++AL+F+SC+VAN+++L TL   LP  EI+SD+GNHASMI GIR S A K ++RHND  HL +LL K++  +PK+VAFETVHSM G ICP++EL D+  ++GA +FVDEVHAVGLYG  GAG+ ERDG+M +ID+ISGTLGKAFG VGGYIA  + +VDM+R+YA+GFIFTTSLPP VL+GA ++V +L  +EG+ LR  HQ  V+ ++  L   G+PVI CPSHIIP+ VG+A L + L + +L K+ IYVQAIN+PTV  GEE LR+APSPHH+  M+ + V  ++  W
Sbjct:  134 QFFRDKIMEKKQDHTYRVFKTVNRWADAYPFAQHFSEASVASKDVSVWCSNDYLGMSRHPQVLQATQETLQRHGAGAGGTRNISGTSKFHVELEQELAELHQKDSALLFSSCFVANDSTLFTLAKILPGCEIYSDAGNHASMIQGIRNSGAAKFVFRHNDPDHLKKLLEKSNPKIPKIVAFETVHSMDGAICPLEELCDVSHQYGALTFVDEVHAVGLYGSRGAGIGERDGIMHKIDIISGTLGKAFGCVGGYIASTRDLVDMVRSYAAGFIFTTSLPPMVLSGALESVRLLKGEEGQALRRAHQRNVKHMRQLLMDRGLPVIPCPSHIIPIRVGNAALNSKLCDLLLSKHGIYVQAINYPTVPRGEELLRLAPSPHHSPQMMEDFVEKLLLAW 527          
BLAST of 5-aminolevulinate synthase vs. Ensembl Human
Match: ALAS1 (5'-aminolevulinate synthase 1 [Source:HGNC Symbol;Acc:HGNC:396])

HSP 1 Score: 474.552 bits (1220), Expect = 8.911e-161
Identity = 230/400 (57.50%), Postives = 296/400 (74.00%), Query Frame = 1
Query:  391 FFQSEIDKKKQDNTYRVFKKVLRRADNFPYAKEKS---ILNKDVAVWCSNDYLGMSWHPSVMEAAINAIRKHGTGSGGTRNISGNTILHESLEEDLAKLHGKEAALVFTSCYVANEASLHTLGTRLPFVEIFSDSGNHASMIHGIRTSRARKIIYRHNDTKHLDQLLSKTSAGVPKLVAFETVHSMSGNICPVDELLDICEKHGAFSFVDEVHAVGLYGDHGAGVAERDGVMDRIDMISGTLGKAFGNVGGYIAGDKAVVDMIRNYASGFIFTTSLPPHVLAGARKAVDILASDEGRQLRNQHQDVVRTVKSYLQHEGIPVIDCPSHIIPVHVGHAGLCTHLSNEMLQKYNIYVQAINHPTVAVGEERLRIAPSPHHTLPMINELVSAMISLWKENKLSF 1581
            FF+ +ID+KK D+TYRVFK V RRA  FP A + S   I  K V+VWCSNDYLGMS HP V  A ++ +++HG G+GGTRNISG +  H  LE +LA LHGK+AAL+F+SC+VAN+++L TL   +P  EI+SDSGNHASMI GIR SR  K I+RHND  HL +LL ++   VPK+VAFETVHSM G +CP++EL D+  + GA +FVDEVHAVGLYG  G G+ +RDGVM ++D+ISGTLGKAFG VGGYIA   +++D +R+YA+GFIFTTSLPP +LAGA ++V IL S EGR LR QHQ  V+ ++  L   G+PV+ CPSHIIPV V  A   T + +E++ ++NIYVQAIN+PTV  GEE LRIAP+PHHT  M+N  +  ++  WK+  L  
Sbjct:  202 FFEKKIDEKKNDHTYRVFKTVNRRAHIFPMADDYSDSLITKKQVSVWCSNDYLGMSRHPRVCGAVMDTLKQHGAGAGGTRNISGTSKFHVDLERELADLHGKDAALLFSSCFVANDSTLFTLAKMMPGCEIYSDSGNHASMIQGIRNSRVPKYIFRHNDVSHLRELLQRSDPSVPKIVAFETVHSMDGAVCPLEELCDVAHEFGAITFVDEVHAVGLYGARGGGIGDRDGVMPKMDIISGTLGKAFGCVGGYIASTSSLIDTVRSYAAGFIFTTSLPPMLLAGALESVRILKSAEGRVLRRQHQRNVKLMRQMLMDAGLPVVHCPSHIIPVRVADAAKNTEVCDELMSRHNIYVQAINYPTVPRGEELLRIAPTPHHTPQMMNYFLENLLVTWKQVGLEL 601          
BLAST of 5-aminolevulinate synthase vs. Ensembl Human
Match: ALAS1 (5'-aminolevulinate synthase 1 [Source:HGNC Symbol;Acc:HGNC:396])

HSP 1 Score: 474.552 bits (1220), Expect = 8.911e-161
Identity = 230/400 (57.50%), Postives = 296/400 (74.00%), Query Frame = 1
Query:  391 FFQSEIDKKKQDNTYRVFKKVLRRADNFPYAKEKS---ILNKDVAVWCSNDYLGMSWHPSVMEAAINAIRKHGTGSGGTRNISGNTILHESLEEDLAKLHGKEAALVFTSCYVANEASLHTLGTRLPFVEIFSDSGNHASMIHGIRTSRARKIIYRHNDTKHLDQLLSKTSAGVPKLVAFETVHSMSGNICPVDELLDICEKHGAFSFVDEVHAVGLYGDHGAGVAERDGVMDRIDMISGTLGKAFGNVGGYIAGDKAVVDMIRNYASGFIFTTSLPPHVLAGARKAVDILASDEGRQLRNQHQDVVRTVKSYLQHEGIPVIDCPSHIIPVHVGHAGLCTHLSNEMLQKYNIYVQAINHPTVAVGEERLRIAPSPHHTLPMINELVSAMISLWKENKLSF 1581
            FF+ +ID+KK D+TYRVFK V RRA  FP A + S   I  K V+VWCSNDYLGMS HP V  A ++ +++HG G+GGTRNISG +  H  LE +LA LHGK+AAL+F+SC+VAN+++L TL   +P  EI+SDSGNHASMI GIR SR  K I+RHND  HL +LL ++   VPK+VAFETVHSM G +CP++EL D+  + GA +FVDEVHAVGLYG  G G+ +RDGVM ++D+ISGTLGKAFG VGGYIA   +++D +R+YA+GFIFTTSLPP +LAGA ++V IL S EGR LR QHQ  V+ ++  L   G+PV+ CPSHIIPV V  A   T + +E++ ++NIYVQAIN+PTV  GEE LRIAP+PHHT  M+N  +  ++  WK+  L  
Sbjct:  202 FFEKKIDEKKNDHTYRVFKTVNRRAHIFPMADDYSDSLITKKQVSVWCSNDYLGMSRHPRVCGAVMDTLKQHGAGAGGTRNISGTSKFHVDLERELADLHGKDAALLFSSCFVANDSTLFTLAKMMPGCEIYSDSGNHASMIQGIRNSRVPKYIFRHNDVSHLRELLQRSDPSVPKIVAFETVHSMDGAVCPLEELCDVAHEFGAITFVDEVHAVGLYGARGGGIGDRDGVMPKMDIISGTLGKAFGCVGGYIASTSSLIDTVRSYAAGFIFTTSLPPMLLAGALESVRILKSAEGRVLRRQHQRNVKLMRQMLMDAGLPVVHCPSHIIPVRVADAAKNTEVCDELMSRHNIYVQAINYPTVPRGEELLRIAPTPHHTPQMMNYFLENLLVTWKQVGLEL 601          
BLAST of 5-aminolevulinate synthase vs. Ensembl Celegans
Match: T25B9.1 (pep chromosome:WBcel235:IV:10748385:10750141:-1 gene:WBGene00012007.1 transcript:T25B9.1.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:T25B9.1)

HSP 1 Score: 211.075 bits (536), Expect = 2.058e-62
Identity = 120/358 (33.52%), Postives = 197/358 (55.03%), Query Frame = 1
Query:  502 NKDVAVWCSNDYLGMSWHPSVMEAAINAIRKHGTGSGGTRNISGNTILHESLEEDLAKLHGKEAALVFTSCYVANEASLHTLGTRLPFVEIFSDSGNHASMIHGIRTSRARKIIYRHNDTKHLDQLLSKTSAGVPKLVAFETVHSMSGNICPVDELLDICEKHGAFSFVDEVHAVGLYGDHGAGVAERDGVMDRIDMISGTLGKAF-GNVGGYIAGDKAVVDMIRNYASGFIFTTSLPPHVLAGARKAVDILASDEGRQLRNQHQDVVRTVKSYLQHEGIPVI-DCPSH-IIPVHVGHAGLCTHLSNEMLQKYNIYVQAINHPTVAVGEERLRIAPSPHHTLPMINELVSAMISLWKE 1566
            +K V  +C+N+YLG+S HP V+ A   A+  HG G    R I G   +H+ LE+ +A+ HG E  +++ +C+ AN      +        I SD  NHAS+I GIR S+A+++ Y+H D   L+  L +      +L+  + V SM G++ P+ ++  + EK+ A  F+DE HA G +G  G G AE   V  R D+I+ TLGKA  G++GGY  G K ++D++R  +  ++F+ SL P ++  + K  D+L +D         Q  V   +  +   G  ++ + P+H I PV +G A L   +++E+L K  IYV   + P V  G+ R+R+  S  H+   I++L+ A  ++ K+
Sbjct:   49 DKPVINFCANNYLGLSSHPEVIAAGQKALETHGAGLSSVRFICGTQDIHKELEQKIAQFHGTEDTILYAACFDANGGIFEVMTGEQD--SIISDELNHASIIDGIRLSKAKRLRYKHLDLGDLESKLKEAEDSRFRLIVTDGVFSMDGDVAPLGDITSLAEKYNALLFIDECHATGFFGKTGRGTAE--AVGGRPDVINSTLGKALGGSMGGYTTGPKPLIDLLRQRSRPYLFSNSLAPSIVGSSIKVFDLLMNDS--SFIGSLQTNVSHFRKSMAANGFTILGNDPTHPICPVLLGDAKLAATMADELL-KMGIYVIGFSFPVVPKGKARIRVQISAAHSKQHIDQLIEAFATVGKK 399          
BLAST of 5-aminolevulinate synthase vs. Ensembl Celegans
Match: sptl-3 (Serine palmitoyltransferase 3 [Source:UniProtKB/Swiss-Prot;Acc:Q9XVI6])

HSP 1 Score: 173.326 bits (438), Expect = 2.881e-47
Identity = 132/441 (29.93%), Postives = 212/441 (48.07%), Query Frame = 1
Query:  385 MEFFQ---SEIDKKKQDNTYRVFKKVLRR----------------ADNFPYAKEKSILNKDVAVWCSNDYLGMSWHPSV-MEAAINAIRKHGTGSGGTRNISGNTILHESLEEDLAKLHGKEAALVFTSCYVANEASLHTLGTRLPFVEIFSDSGNHASMIHGIRTSRARKIIYRHNDTKHLDQLLSKTSAGV-PK--------LVAFETVHSMSGNICPVDELLDICEKHGAFSFVDEVHAVGLYGDHGAGVAERDGVMDR-IDMISGTLGKAFGNVGGYIAGDKAVVDMIRNYASGFIFTTSLPPHVLAGARKAVDILA----SDEGRQLRNQHQDVVRTVKSYLQHEGIPVI---DCPSHIIPVHVGHAGLCTHLSNEMLQKYNIYVQAINHPTVAVGEERLRIAPSPHHTLPMINELVSAMISLWKENKLSFYNQDL 1596
            ME FQ   +  D    D+ YR    V+ R                 D+  + ++ +    +V    S +YLG S    V  EAA   I K+G   GG+R   GN + H+S+E  +A+    E A+VF   +  N  ++ +L  +     I SD  NHAS++ G R S A  +++RHND    ++ L     GV PK        L+  E ++SM G I  +   + + +K+  + F+DE H++G  G  G GVAE  G   R ID++ GTL K+F + GGY+ G K V+D IR Y++G  +  ++ P ++A   +AV I++    +D GRQ   Q  +  R  +  L+  G  V    D P  ++P+   +       S  ML K+NI + A+ +P   + E R+R   S  HT   ++ ++ A+  +  E   +FY   +
Sbjct:   75 MESFQPLGNSFDATYTDHIYRQSTDVVNRPISGVPGAIVRLKDRYTDDHGWTQKYTGTESEVINLGSYNYLGFSHRSGVCAEAAAAHIDKYGINCGGSRQEIGNHVAHKSVESTIAQYLNVEDAIVFPMGFATNSMNIPSLVDKGSL--ILSDRLNHASLVTGCRLSGAHTVVFRHNDASDCERKLRDALCGVSPKTGEKYNKVLIIIEGIYSMEGTIVNLPAFIAVKKKYNCYLFLDEAHSIGAVGPSGRGVAEYWGCNPRDIDIMMGTLTKSFASAGGYMGGSKKVIDHIRRYSAGTCYGVTMSPPLIAQVERAVLIMSGKDGTDIGRQKAIQLLENSRYFRKELRKRGFLVYGNNDSP--VVPLMTFYITKVVEFSRRML-KHNIGIVAVGYPATPLLEARVRFCLSADHTKEHLDYILEAVEQVGMETG-TFYGTKI 509          
BLAST of 5-aminolevulinate synthase vs. Ensembl Celegans
Match: sptl-3 (Serine palmitoyltransferase 3 [Source:UniProtKB/Swiss-Prot;Acc:Q9XVI6])

HSP 1 Score: 173.326 bits (438), Expect = 2.881e-47
Identity = 132/441 (29.93%), Postives = 212/441 (48.07%), Query Frame = 1
Query:  385 MEFFQ---SEIDKKKQDNTYRVFKKVLRR----------------ADNFPYAKEKSILNKDVAVWCSNDYLGMSWHPSV-MEAAINAIRKHGTGSGGTRNISGNTILHESLEEDLAKLHGKEAALVFTSCYVANEASLHTLGTRLPFVEIFSDSGNHASMIHGIRTSRARKIIYRHNDTKHLDQLLSKTSAGV-PK--------LVAFETVHSMSGNICPVDELLDICEKHGAFSFVDEVHAVGLYGDHGAGVAERDGVMDR-IDMISGTLGKAFGNVGGYIAGDKAVVDMIRNYASGFIFTTSLPPHVLAGARKAVDILA----SDEGRQLRNQHQDVVRTVKSYLQHEGIPVI---DCPSHIIPVHVGHAGLCTHLSNEMLQKYNIYVQAINHPTVAVGEERLRIAPSPHHTLPMINELVSAMISLWKENKLSFYNQDL 1596
            ME FQ   +  D    D+ YR    V+ R                 D+  + ++ +    +V    S +YLG S    V  EAA   I K+G   GG+R   GN + H+S+E  +A+    E A+VF   +  N  ++ +L  +     I SD  NHAS++ G R S A  +++RHND    ++ L     GV PK        L+  E ++SM G I  +   + + +K+  + F+DE H++G  G  G GVAE  G   R ID++ GTL K+F + GGY+ G K V+D IR Y++G  +  ++ P ++A   +AV I++    +D GRQ   Q  +  R  +  L+  G  V    D P  ++P+   +       S  ML K+NI + A+ +P   + E R+R   S  HT   ++ ++ A+  +  E   +FY   +
Sbjct:   75 MESFQPLGNSFDATYTDHIYRQSTDVVNRPISGVPGAIVRLKDRYTDDHGWTQKYTGTESEVINLGSYNYLGFSHRSGVCAEAAAAHIDKYGINCGGSRQEIGNHVAHKSVESTIAQYLNVEDAIVFPMGFATNSMNIPSLVDKGSL--ILSDRLNHASLVTGCRLSGAHTVVFRHNDASDCERKLRDALCGVSPKTGEKYNKVLIIIEGIYSMEGTIVNLPAFIAVKKKYNCYLFLDEAHSIGAVGPSGRGVAEYWGCNPRDIDIMMGTLTKSFASAGGYMGGSKKVIDHIRRYSAGTCYGVTMSPPLIAQVERAVLIMSGKDGTDIGRQKAIQLLENSRYFRKELRKRGFLVYGNNDSP--VVPLMTFYITKVVEFSRRML-KHNIGIVAVGYPATPLLEARVRFCLSADHTKEHLDYILEAVEQVGMETG-TFYGTKI 509          
BLAST of 5-aminolevulinate synthase vs. Ensembl Celegans
Match: sptl-3 (Serine palmitoyltransferase 3 [Source:UniProtKB/Swiss-Prot;Acc:Q9XVI6])

HSP 1 Score: 173.326 bits (438), Expect = 3.137e-47
Identity = 123/398 (30.90%), Postives = 200/398 (50.25%), Query Frame = 1
Query:  457 RRADNFPYAKEKSILNKDVAVWCSNDYLGMSWHPSVM-EAAINAIRKHGTGSGGTRNISGNTILHESLEEDLAKLHGKEAALVFTSCYVANEASLHTLGTRLPFVEIFSDSGNHASMIHGIRTSRARKIIYRHNDTKHLDQLLSKTSAGV-PK--------LVAFETVHSMSGNICPVDELLDICEKHGAFSFVDEVHAVGLYGDHGAGVAERDGVMDR-IDMISGTLGKAFGNVGGYIAGDKAVVDMIRNYASGFIFTTSLPPHVLAGARKAVDILA----SDEGRQLRNQHQDVVRTVKSYLQHEGIPVI---DCPSHIIPVHVGHAGLCTHLSNEMLQKYNIYVQAINHPTVAVGEERLRIAPSPHHTLPMINELVSAMISLWKENKLSFYNQDL 1596
            R  D+  + ++ +    +V    S +YLG S    V  EAA   I K+G   GG+R   GN + H+S+E  +A+    E A+VF   +  N  ++ +L  +     I SD  NHAS++ G R S A  +++RHND    ++ L     GV PK        L+  E ++SM G I  +   + + +K+  + F+DE H++G  G  G GVAE  G   R ID++ GTL K+F + GGY+ G K V+D IR Y++G  +  ++ P ++A   +AV I++    +D GRQ   Q  +  R  +  L+  G  V    D P  ++P+   +       S  ML K+NI + A+ +P   + E R+R   S  HT   ++ ++ A+  +  E   +FY   +
Sbjct:  127 RYTDDHGWTQKYTGTESEVINLGSYNYLGFSHRSGVCAEAAAAHIDKYGINCGGSRQEIGNHVAHKSVESTIAQYLNVEDAIVFPMGFATNSMNIPSLVDKGSL--ILSDRLNHASLVTGCRLSGAHTVVFRHNDASDCERKLRDALCGVSPKTGEKYNKVLIIIEGIYSMEGTIVNLPAFIAVKKKYNCYLFLDEAHSIGAVGPSGRGVAEYWGCNPRDIDIMMGTLTKSFASAGGYMGGSKKVIDHIRRYSAGTCYGVTMSPPLIAQVERAVLIMSGKDGTDIGRQKAIQLLENSRYFRKELRKRGFLVYGNNDSP--VVPLMTFYITKVVEFSRRML-KHNIGIVAVGYPATPLLEARVRFCLSADHTKEHLDYILEAVEQVGMETG-TFYGTKI 518          
BLAST of 5-aminolevulinate synthase vs. Ensembl Celegans
Match: sptl-2 (Serine palmitoyltransferase 2 [Source:UniProtKB/Swiss-Prot;Acc:Q20375])

HSP 1 Score: 135.576 bits (340), Expect = 1.027e-33
Identity = 101/364 (27.75%), Postives = 173/364 (47.53%), Query Frame = 1
Query:  526 SNDYLGMSWHPS-VMEAAINAIRKHGTGSGGTRNISGNTILHESLEEDLAKLHGKEAALVFTSCYVANEASLHTLGTRLPFVEIFSDSGNHASMIHGIRTSRARKIIYRHNDTKHLDQLLSKTSA-GVPK--------LVAFETVHSMSGNICPVDELLDICEKHGAFSFVDEVHAVGLYGDHGAGVAERDGVMDR-IDMISGTLGKAFGNVGGYIAGDKAVVDMIRNYASGFIFTTSLPPHVLAGARKAVDILASDEG---------RQLRNQHQDVVRTVKSYLQHEGIPVI---DCPSHIIPVHVGHAGLCTHLSNEMLQKYNIYVQAINHPTVAVGEERLRIAPSPHHTLPMINELVSAM 1548
            S +YLG +       E + ++I + G     T +  G ++    LE+ +A+  G E A+ F+  +  N  +   L  +     I SD  NHAS+I G R S A   ++ HND + L+++L    A G PK        L+  E ++SM G+IC +  ++ + +K+ A+ ++DE H++G  G  G GV E  G   + +D++ GT  K+FG  GGYIAG K  VD +R  +    +++ + P +      ++ I+   +G         R  RN H       +  L+  G  V    D P  ++P+ +    +C     EML + NI    ++ P   + E R+R   S  HT   ++E++  +
Sbjct:  180 SYNYLGFAQSAGPCAEQSASSIDREGLSCCTTVHERGRSVSQAKLEKLVAEFLGVEDAICFSMGFATNSMNAPCLVDKHSL--IISDKYNHASLILGCRLSGASTKVFEHNDMESLERILRDAIAYGNPKTHRPYKKILIIVEGIYSMEGSICNLPGIIALKKKYQAYLYLDEAHSIGAMGKTGKGVVEYWGCDPKDVDILMGTFTKSFGAAGGYIAGSKRTVDHLRAASPTGYYSSPMSPPIAQQIYTSMSIIMGKDGTKDGAQRIERLARNSHY-----FRMKLKQNGFIVYGSNDSP--VVPMLIYFPTMCGFYGREMLAR-NIGCVVVSFPATHMTEGRVRFCISAAHTKEQLDEVLETV 533          
BLAST of 5-aminolevulinate synthase vs. Ensembl Fly
Match: Alas (gene:FBgn0020764 transcript:FBtr0072151)

HSP 1 Score: 513.457 bits (1321), Expect = 9.280e-178
Identity = 265/507 (52.27%), Postives = 352/507 (69.43%), Query Frame = 1
Query:   67 LACPFLLKLPLNLVKNEAQRVIVKSGPKCPVFSRYLSNDLTNNKKDEVNSSSLNENIVESSVNLSNQMNVCPHPTQNTDKYDVEPAKFLPAKQIXXXXXXXXXXXXMEFFQSEIDKKKQDNTYRVFKKVLRRADN--FPYAKEKS-ILNKDVAVWCSNDYLGMSWHPSVMEAAINAIRKHGTGSGGTRNISGNTILHESLEEDLAKLHGKEAALVFTSCYVANEASLHTLGTRLPFVEIFSDSGNHASMIHGIRTSRARKIIYRHNDTKHLDQLLSKTSAGVPKLVAFETVHSMSGNICPVDELLDICEKHGAFSFVDEVHAVGLYGDHGAGVAERDGVMDRIDMISGTLGKAFGNVGGYIAGDKAVVDMIRNYASGFIFTTSLPPHVLAGARKAVDILASDEGRQLRNQHQDVVRTVKSYLQHEGIPVIDCPSHIIPVHVGHAGLCTHLSNEMLQKYNIYVQAINHPTVAVGEERLRIAPSPHHTLPMINELVSAMISLWKENKLS 1578
            + CPFL +   + ++N A+ +    G  CPV  + L   ++  KK  + ++S+  +    S   +   N     T N       PA   P K     + +  ++ Y  FF  +I KKK+D++YRVFKKV R A +  FP+A E S    K + VWCSNDYLGMS HP V  A  +A+ +HG+G+GGTRNISGN++ HE LE  LA+LH KEAAL+FTSC+VAN+++L TL   LP  EIFSD+GNHASMI GIR S   K I+RHND  HL QLL +T   VPK+VAFETVHSM+G ICP++ELLD+  +HGA +F+DEVHAVGLYGDHGAGV ERDGV+ ++D+ISGTLGKAFGN+GGYIAG   +VDMIR+YA+GFIFTTSLPP VL GA +AV+ILAS+EGRQLR+ HQ  V  +KS L+ EG PV + PSHIIP+ +G     + +SN +++++  Y+Q+IN+PTVA G+E+LR+AP+P HT  M+N LV+ +  +W+   LS
Sbjct:    1 MQCPFLNRFTASFIRNYAETLCQSYGSHCPVVGKTL---VSGEKKLSLVAASVTRS---HSTGANAHANAGGPATANATAPVSAPASADPGK-----ASAKETFPYERFFNEQIMKKKRDHSYRVFKKVNRLAGDGLFPHALEYSERTEKPITVWCSNDYLGMSAHPGVKRAVQDALNRHGSGAGGTRNISGNSLHHERLESKLAELHQKEAALLFTSCFVANDSTLFTLAKLLPGCEIFSDAGNHASMIMGIRNSGVPKHIFRHNDVDHLHQLLKQTDKSVPKIVAFETVHSMTGAICPLEELLDVAHEHGAITFIDEVHAVGLYGDHGAGVGERDGVLHKMDIISGTLGKAFGNIGGYIAGTHNLVDMIRSYAAGFIFTTSLPPTVLCGALEAVNILASEEGRQLRHLHQRNVSYLKSLLKREGFPVEETPSHIIPIKIGDPLKSSQISNVLIEQFGHYLQSINYPTVARGQEKLRLAPTPFHTFEMMNALVTDLKKVWEMVDLS 496          
BLAST of 5-aminolevulinate synthase vs. Ensembl Fly
Match: CG10361 (gene:FBgn0036208 transcript:FBtr0076084)

HSP 1 Score: 224.172 bits (570), Expect = 5.401e-67
Identity = 124/364 (34.07%), Postives = 202/364 (55.49%), Query Frame = 1
Query:  487 EKSILNKDVAVWCSNDYLGMSWHPSVMEAAINAIRKHGTGSGGTRNISGNTILHESLEEDLAKLHGKEAALVFTSCYVANEASLHTLGTRLPFVEIFSDSGNHASMIHGIRTSRARKIIYRHNDTKHLDQLLSKTSAGVPKLVAFETVHSMSGNICPVDELLDICEKHGAFSFVDEVHAVGLYGDHGAGVAERDGVMDRIDMISGTLGKAFGNV-GGYIAGDKAVVDMIRNYASGFIFTTSLPPHVLAGARKAVDILASDEGRQLRNQHQDVVRTVKSYLQHEGIPVIDCPSHIIPVHVGHAGLCTHLSNEMLQKYNIYVQAINHPTVAVGEERLRIAPSPHHTLPMINELVSAMISLWKENKL 1575
            +K ILN     +C+N+YLG++ +P ++E +   + ++G G    R I G   +H+ LE+ +A+ HG+E  +++ SC+ AN      + T  P   +FSD  NHAS+I GIR  +A+K  YRH D   L++ L  + A + KL+A + V SM GNI P+  ++++  K+ A  FVDE HA G +G  G G  E D VM  +D+I+ TLGKA G   GGY  G   ++  +R  +  ++F+ +LPP V+A   K +D+L   +  +L  + Q   +  +  +   G  +      I PV +G A L +  ++EML +  IYV   ++P V  G+ R+R+  S  HT   I+  ++A I + +  K+
Sbjct:   63 DKKILN-----FCANNYLGLANNPEIVEHSQKLLEQYGAGLSSVRFICGTQDIHKQLEKKIAQFHGREDTILYASCFDANAGIFEAILT--PEDAVFSDELNHASIIDGIRLCKAKKQRYRHRDLGDLEEQLKASDARL-KLIATDGVFSMDGNIAPLARIVELARKYNALVFVDECHATGFFGATGRGTEEYDNVMGEVDIINSTLGKALGGASGGYTTGPAELISFLRQKSRPYLFSNTLPPAVVAVGLKVMDMLL--QSSELTQRVQSNTQRFRQAMTKAGFTIAGENHPICPVMLGDARLASQFADEMLTR-GIYVIGFSYPVVPQGKARIRVQISAAHTEAEIDRAINAFIEVGRSLKV 415          
BLAST of 5-aminolevulinate synthase vs. Ensembl Fly
Match: Spt-I (gene:FBgn0086532 transcript:FBtr0087731)

HSP 1 Score: 124.405 bits (311), Expect = 3.490e-30
Identity = 74/252 (29.37%), Postives = 127/252 (50.40%), Query Frame = 1
Query:  526 SNDYLGMSWHPSVMEAAINAIRKHGTGSGGTRNISGNTILHESLEEDLAKLHGKEAALVFTSCYVANEASLHTLGTRLPFVEIFSDSGNHASMIHGIRTSRARKIIYRHNDTKHLDQLL----------SKTSAGVPKLVAFETVHSMSGNICPVDELLDICEKHGAFSFVDEVHAVGLYGDHGAGVAERDGV-MDRIDMISGTLGKAFGNVGGYIAGDKAVVDMIRNYASGFIFTTSLPPHVLAGARKAVD 1248
            S++YLG      ++E A  ++RK+G GS G R   G   +H  LE+ +AK  G E A+V++  +    +++     R     IF D   + ++  G+  SR+  + ++HND + L++LL           K +A   + +  E ++  +G ICP+ +L+ + +K+    F+DE  + G  G  G GV E   V  D +D+IS  +  +   VGG+  G   + +  R    G+IF+ SLPP +   A  A+D
Sbjct:  101 SHNYLGFLEDQEILEEACKSLRKYGVGSCGPRGFYGTMDVHLDLEDRIAKFMGLEEAIVYSYGFSTVASAIPAYAKRGDL--IFVDEAVNFAIQKGLDASRSTIVFFKHNDVEDLERLLIEQEKRDQKNPKKAAKTRRFLVAEGIYMNTGEICPLPDLVALRQKYKLRLFIDESISFGTLGQGGHGVTEHFNVDRDEVDLISAGMEGSMATVGGFCVGSHFIAEHQRLSGLGYIFSASLPPMLTQAAISALD 350          
BLAST of 5-aminolevulinate synthase vs. Ensembl Fly
Match: Spt-I (gene:FBgn0086532 transcript:FBtr0087729)

HSP 1 Score: 124.405 bits (311), Expect = 3.490e-30
Identity = 74/252 (29.37%), Postives = 127/252 (50.40%), Query Frame = 1
Query:  526 SNDYLGMSWHPSVMEAAINAIRKHGTGSGGTRNISGNTILHESLEEDLAKLHGKEAALVFTSCYVANEASLHTLGTRLPFVEIFSDSGNHASMIHGIRTSRARKIIYRHNDTKHLDQLL----------SKTSAGVPKLVAFETVHSMSGNICPVDELLDICEKHGAFSFVDEVHAVGLYGDHGAGVAERDGV-MDRIDMISGTLGKAFGNVGGYIAGDKAVVDMIRNYASGFIFTTSLPPHVLAGARKAVD 1248
            S++YLG      ++E A  ++RK+G GS G R   G   +H  LE+ +AK  G E A+V++  +    +++     R     IF D   + ++  G+  SR+  + ++HND + L++LL           K +A   + +  E ++  +G ICP+ +L+ + +K+    F+DE  + G  G  G GV E   V  D +D+IS  +  +   VGG+  G   + +  R    G+IF+ SLPP +   A  A+D
Sbjct:  101 SHNYLGFLEDQEILEEACKSLRKYGVGSCGPRGFYGTMDVHLDLEDRIAKFMGLEEAIVYSYGFSTVASAIPAYAKRGDL--IFVDEAVNFAIQKGLDASRSTIVFFKHNDVEDLERLLIEQEKRDQKNPKKAAKTRRFLVAEGIYMNTGEICPLPDLVALRQKYKLRLFIDESISFGTLGQGGHGVTEHFNVDRDEVDLISAGMEGSMATVGGFCVGSHFIAEHQRLSGLGYIFSASLPPMLTQAAISALD 350          
BLAST of 5-aminolevulinate synthase vs. Ensembl Fly
Match: Spt-I (gene:FBgn0086532 transcript:FBtr0087730)

HSP 1 Score: 124.405 bits (311), Expect = 3.490e-30
Identity = 74/252 (29.37%), Postives = 127/252 (50.40%), Query Frame = 1
Query:  526 SNDYLGMSWHPSVMEAAINAIRKHGTGSGGTRNISGNTILHESLEEDLAKLHGKEAALVFTSCYVANEASLHTLGTRLPFVEIFSDSGNHASMIHGIRTSRARKIIYRHNDTKHLDQLL----------SKTSAGVPKLVAFETVHSMSGNICPVDELLDICEKHGAFSFVDEVHAVGLYGDHGAGVAERDGV-MDRIDMISGTLGKAFGNVGGYIAGDKAVVDMIRNYASGFIFTTSLPPHVLAGARKAVD 1248
            S++YLG      ++E A  ++RK+G GS G R   G   +H  LE+ +AK  G E A+V++  +    +++     R     IF D   + ++  G+  SR+  + ++HND + L++LL           K +A   + +  E ++  +G ICP+ +L+ + +K+    F+DE  + G  G  G GV E   V  D +D+IS  +  +   VGG+  G   + +  R    G+IF+ SLPP +   A  A+D
Sbjct:  101 SHNYLGFLEDQEILEEACKSLRKYGVGSCGPRGFYGTMDVHLDLEDRIAKFMGLEEAIVYSYGFSTVASAIPAYAKRGDL--IFVDEAVNFAIQKGLDASRSTIVFFKHNDVEDLERLLIEQEKRDQKNPKKAAKTRRFLVAEGIYMNTGEICPLPDLVALRQKYKLRLFIDESISFGTLGQGGHGVTEHFNVDRDEVDLISAGMEGSMATVGGFCVGSHFIAEHQRLSGLGYIFSASLPPMLTQAAISALD 350          
BLAST of 5-aminolevulinate synthase vs. Ensembl Zebrafish
Match: alas1 (aminolevulinate, delta-, synthase 1 [Source:ZFIN;Acc:ZDB-GENE-001229-2])

HSP 1 Score: 491.5 bits (1264), Expect = 8.062e-168
Identity = 231/399 (57.89%), Postives = 295/399 (73.93%), Query Frame = 1
Query:  388 EFFQSEIDKKKQDNTYRVFKKVLRRADNFPYA---KEKSILNKDVAVWCSNDYLGMSWHPSVMEAAINAIRKHGTGSGGTRNISGNTILHESLEEDLAKLHGKEAALVFTSCYVANEASLHTLGTRLPFVEIFSDSGNHASMIHGIRTSRARKIIYRHNDTKHLDQLLSKTSAGVPKLVAFETVHSMSGNICPVDELLDICEKHGAFSFVDEVHAVGLYGDHGAGVAERDGVMDRIDMISGTLGKAFGNVGGYIAGDKAVVDMIRNYASGFIFTTSLPPHVLAGARKAVDILASDEGRQLRNQHQDVVRTVKSYLQHEGIPVIDCPSHIIPVHVGHAGLCTHLSNEMLQKYNIYVQAINHPTVAVGEERLRIAPSPHHTLPMINELVSAMISLWKENKL 1575
            EFF+ +I++KK D+TYRVFK V RRA  FP A    E     ++V+VWCSNDYLGMS HP V++  ++ + KHG+G+GGTRNISG +  H  LE +LA LHGK+AAL+FTSC+VAN+++L TL   +P  EI+SD+GNHASMI GIR S A+K I+RHND KHL +LL K+    PK+VAFETVHSM G +CP+++L D+  + GA +FVDEVHAVGLYG  G G+ +RD VM ++D+ISGTLGKAFG VGGYIA   A+VD +R+YA+GFIFTTSLPP +L+GAR++V IL S+EGR LR +HQ  V  ++  L   G+PVI CPSHIIPV V  A   T + + M+ +YNIYVQAIN+PTVA GEE LRIAP+PHHT  M+   V  +   W E  L
Sbjct:  182 EFFEKKIEEKKSDHTYRVFKTVNRRATEFPMADDYTESLSFKRNVSVWCSNDYLGMSRHPRVVQTIMDTLGKHGSGAGGTRNISGTSKFHVDLEHELADLHGKDAALLFTSCFVANDSTLFTLAKMMPGCEIYSDAGNHASMIQGIRNSGAKKFIFRHNDAKHLRELLEKSDPSTPKIVAFETVHSMDGAVCPLEQLCDVAHEFGAVTFVDEVHAVGLYGPRGGGIGDRDSVMHKMDIISGTLGKAFGCVGGYIASTHALVDTVRSYAAGFIFTTSLPPMLLSGARQSVQILKSEEGRTLRRKHQRNVTLLRQMLMDSGLPVIHCPSHIIPVRVADAEKNTEVCDIMMSRYNIYVQAINYPTVARGEELLRIAPTPHHTPQMMKYFVDKLTQTWTEVGL 580          
BLAST of 5-aminolevulinate synthase vs. Ensembl Zebrafish
Match: alas2 (aminolevulinate, delta-, synthase 2 [Source:NCBI gene;Acc:64607])

HSP 1 Score: 488.804 bits (1257), Expect = 3.259e-167
Identity = 231/399 (57.89%), Postives = 304/399 (76.19%), Query Frame = 1
Query:  388 EFFQSEIDKKKQDNTYRVFKKVLRRADNFPYAKEKSI---LNKDVAVWCSNDYLGMSWHPSVMEAAINAIRKHGTGSGGTRNISGNTILHESLEEDLAKLHGKEAALVFTSCYVANEASLHTLGTRLPFVEIFSDSGNHASMIHGIRTSRARKIIYRHNDTKHLDQLLSKTSAGVPKLVAFETVHSMSGNICPVDELLDICEKHGAFSFVDEVHAVGLYGDHGAGVAERDGVMDRIDMISGTLGKAFGNVGGYIAGDKAVVDMIRNYASGFIFTTSLPPHVLAGARKAVDILASDEGRQLRNQHQDVVRTVKSYLQHEGIPVIDCPSHIIPVHVGHAGLCTHLSNEMLQKYNIYVQAINHPTVAVGEERLRIAPSPHHTLPMINELVSAMISLWKENKL 1575
            EFF  +I +KK+D+TYR+FK V R A+ FP+A++ SI   L   V+VWCSNDYLGMS HP V++A  +A++KHG G+GGTRNISG +  H +LE +LA+LH K+ ALVF+SC+VAN+++L TL   LP  EI+SD GNHASMI GIR S A++ I+RHND  HL++LLS++    PK+VAFETVHSM G ICP++EL D+  K+GA +FVDEVHAVGLYG HGAGV ERD VM +ID++SGTLGKAFG VGGYIA   A+VD +R++A+GFIFTTSLPP VLAGA ++V +L SDEG+ LR  HQ  V+ ++  L   G+PV++CPSHIIP+ VG+A   + + + +L+K+NIYVQAIN+PTV  GEE LR+APSP H   M+N     ++ +W+E  L
Sbjct:  142 EFFTQKIVEKKKDHTYRIFKTVNRFAEVFPFAEDYSIAGRLGSQVSVWCSNDYLGMSRHPRVVKAIGDALKKHGAGAGGTRNISGTSNYHVALENELARLHQKDGALVFSSCFVANDSTLFTLAKMLPGCEIYSDMGNHASMIQGIRNSGAKRFIFRHNDASHLEELLSRSDPLTPKIVAFETVHSMDGAICPLEELCDVAHKYGALTFVDEVHAVGLYGAHGAGVGERDNVMHKIDIVSGTLGKAFGCVGGYIASTAALVDTVRSFAAGFIFTTSLPPMVLAGALESVRVLKSDEGQALRRAHQRNVKHMRQLLLDAGLPVVNCPSHIIPIRVGNAAKNSEVCDILLEKHNIYVQAINYPTVPRGEELLRLAPSPFHNPIMMNYFAEKLLDVWQEVGL 540          
BLAST of 5-aminolevulinate synthase vs. Ensembl Zebrafish
Match: alas2 (aminolevulinate, delta-, synthase 2 [Source:NCBI gene;Acc:64607])

HSP 1 Score: 488.419 bits (1256), Expect = 3.294e-167
Identity = 231/399 (57.89%), Postives = 304/399 (76.19%), Query Frame = 1
Query:  388 EFFQSEIDKKKQDNTYRVFKKVLRRADNFPYAKEKSI---LNKDVAVWCSNDYLGMSWHPSVMEAAINAIRKHGTGSGGTRNISGNTILHESLEEDLAKLHGKEAALVFTSCYVANEASLHTLGTRLPFVEIFSDSGNHASMIHGIRTSRARKIIYRHNDTKHLDQLLSKTSAGVPKLVAFETVHSMSGNICPVDELLDICEKHGAFSFVDEVHAVGLYGDHGAGVAERDGVMDRIDMISGTLGKAFGNVGGYIAGDKAVVDMIRNYASGFIFTTSLPPHVLAGARKAVDILASDEGRQLRNQHQDVVRTVKSYLQHEGIPVIDCPSHIIPVHVGHAGLCTHLSNEMLQKYNIYVQAINHPTVAVGEERLRIAPSPHHTLPMINELVSAMISLWKENKL 1575
            EFF  +I +KK+D+TYR+FK V R A+ FP+A++ SI   L   V+VWCSNDYLGMS HP V++A  +A++KHG G+GGTRNISG +  H +LE +LA+LH K+ ALVF+SC+VAN+++L TL   LP  EI+SD GNHASMI GIR S A++ I+RHND  HL++LLS++    PK+VAFETVHSM G ICP++EL D+  K+GA +FVDEVHAVGLYG HGAGV ERD VM +ID++SGTLGKAFG VGGYIA   A+VD +R++A+GFIFTTSLPP VLAGA ++V +L SDEG+ LR  HQ  V+ ++  L   G+PV++CPSHIIP+ VG+A   + + + +L+K+NIYVQAIN+PTV  GEE LR+APSP H   M+N     ++ +W+E  L
Sbjct:  142 EFFTQKIVEKKKDHTYRIFKTVNRFAEVFPFAEDYSIAGRLGSQVSVWCSNDYLGMSRHPRVVKAIGDALKKHGAGAGGTRNISGTSNYHVALENELARLHQKDGALVFSSCFVANDSTLFTLAKMLPGCEIYSDMGNHASMIQGIRNSGAKRFIFRHNDASHLEELLSRSDPLTPKIVAFETVHSMDGAICPLEELCDVAHKYGALTFVDEVHAVGLYGAHGAGVGERDNVMHKIDIVSGTLGKAFGCVGGYIASTAALVDTVRSFAAGFIFTTSLPPMVLAGALESVRVLKSDEGQALRRAHQRNVKHMRQLLLDAGLPVVNCPSHIIPIRVGNAAKNSEVCDILLEKHNIYVQAINYPTVPRGEELLRLAPSPFHNPIMMNYFAEKLLDVWQEVGL 540          
BLAST of 5-aminolevulinate synthase vs. Ensembl Zebrafish
Match: gcat (glycine C-acetyltransferase [Source:ZFIN;Acc:ZDB-GENE-060518-3])

HSP 1 Score: 211.846 bits (538), Expect = 4.810e-62
Identity = 123/355 (34.65%), Postives = 202/355 (56.90%), Query Frame = 1
Query:  508 DVAVWCSNDYLGMSWHPSVMEAAINAIRKHGTGSGGTRNISGNTILHESLEEDLAKLHGKEAALVFTSCYVANEASLHTLGTRLPFVEIFSDSGNHASMIHGIRTSRARKIIYRHNDTKHLDQLLSKTSAGVPKLVAFETVHSMSGNICPVDELLDICEKHGAFSFVDEVHAVGLYGDHGAGVAERDGVMDRIDMISGT-LGKAFGNVGGYIAGDKAVVDMIRNYASGFIFTTSLPPHVLAGARKAVD-ILASDEGRQLRNQHQDVVRTVKSYLQHEGIPVIDCPSHIIPVHVGHAGLCTHLSNEMLQKYNIYVQAINHPTVAVGEERLRIAPSPHHTLPMINELVSAMISLWKE 1566
            D+  +C+N+YLG+S HP V++A + A++K+G G    R I G   +H++LEE LA+ H +E  +++ SC+ AN      L    P   + SD  NHAS+I GIR  RA++  Y+H D   L++ L ++ +   +LV  + V SM G++ P+  + D+ E++GA  F+DE HA G  G  G G  E  GVMDR+ +++ T      G  GGY  G KA+++++R  +  ++F+ SLPP V+  A +AV+ +LAS+E  Q  +     +R  ++ +   G  +      I PV +G A L + ++++ML K  +YV   ++P V  G+ R+R+  S  HT   I+  V A I   ++
Sbjct:   78 DILNFCANNYLGLSSHPEVVKAGVEALQKYGAGLSSVRFICGTQDIHKNLEEKLAQFHEREDCILYASCFDANAGLFEVLLG--PDDAVLSDELNHASIIDGIRLCRAKRFRYKHMDLNDLEEKLKESQSSRLRLVVTDGVFSMDGDVAPLKGICDLAEQYGAMVFIDECHATGFMGARGRGTDELLGVMDRVQIVNSTLGKALGGAAGGYTVGPKALIELLRQRSRPYLFSNSLPPPVVGCATRAVELLLASNEIAQ--SMAAKTMR-FRNNMTQAGFTISGSAHPICPVMLGDARLASLMADDML-KLGVYVIGFSYPVVPKGKARIRVQISAAHTDEDIDRTVDAFIQTGRK 426          
BLAST of 5-aminolevulinate synthase vs. Ensembl Zebrafish
Match: sptlc3 (serine palmitoyltransferase, long chain base subunit 3 [Source:ZFIN;Acc:ZDB-GENE-041210-281])

HSP 1 Score: 154.836 bits (390), Expect = 2.811e-40
Identity = 118/426 (27.70%), Postives = 210/426 (49.30%), Query Frame = 1
Query:  391 FFQSEIDKKKQDNTYR--------VFKKVLRRADNFPYAKE---KSILNKDVAVWCSNDYLGMSWH-PSVMEAAINAIRKHGTGSGGTRNISGNTILHESLEEDLAKLHGKEAALVFTSCYVANEASLHTLGTRLPFVEIFSDSGNHASMIHGIRTSRARKIIYRHNDTKHLDQLLSKT-SAGVPK--------LVAFETVHSMSGNICPVDELLDICEKHGAFSFVDEVHAVGLYGDHGAGVAERDGVMDR-IDMISGTLGKAFGNVGGYIAGDKAVVDMIRNYASGFIFTTSLPPHVLAGARKAVDIL----ASDEGRQLRNQHQDVVRTVKSYLQHEGIPVI---DCPSHIIPVHVGHAGLCTHLSNEMLQKYNIYVQAINHPTVAVGEERLRIAPSPHHTLPMINELVSAMISLWKENKLSF 1581
            F++  +  + +DN  R        VF  + R +D++ +      ++I N  V    S +YLG + +    ++      R++G G   TR   GN  +HE LE  +A   G E+A+ F   +  N  ++  L  +     I SD  NH S+I G R S A   +++HN+ + L++LL +   +G P+        L+  E ++SM G++  + E++ + +K+ A+ ++DE H++G  G  G GV E  GV  + ID++ GT  K+FG  GGYIAG K +VD +R ++   ++ T++ P V+    +A+  +     + EG++   Q  +     +S L+  G  +    D P  +IP+ +   G     S  ML++  I V  +  P   + E R R   S  HT  M+N+++ ++  L    ++ F
Sbjct:  114 FYKRNLYMRVRDNWNRPICSLPGPVFDLMERVSDDYNWTFRLTGRTIEN--VINMGSYNYLGFAENNVDFLKTVAEKTRQYGVGVCSTRQELGNFSIHEELEHLVADFLGVESAMAFGMGFATNSMNIPALVGKGCL--ILSDELNHTSLILGARLSGATIRVFKHNNMQSLEKLLKEAICSGQPRTHRSWKKILIMVEGIYSMEGSLVRLPEIIALKKKYKAYLYLDEAHSIGAVGPTGRGVTEHFGVDPKEIDVLMGTFTKSFGATGGYIAGKKELVDYLRCHSHSAVYATAMSPPVVEQIIRAIKCIMGVDGTTEGQRRVRQLAENTHYFRSRLKEMGFIIYGNKDSP--VIPLLLYQPGKVGAFSRAMLKR-KIGVVVVGFPATTITEARARFCVSAAHTRDMLNKVLQSLDELGDYIRVKF 532          
BLAST of 5-aminolevulinate synthase vs. Ensembl Xenopus
Match: alas2 (5'-aminolevulinate synthase 2 [Source:NCBI gene;Acc:448773])

HSP 1 Score: 497.278 bits (1279), Expect = 3.513e-170
Identity = 232/396 (58.59%), Postives = 304/396 (76.77%), Query Frame = 1
Query:  388 EFFQSEIDKKKQDNTYRVFKKVLRRADNFPYAKEKSILN---KDVAVWCSNDYLGMSWHPSVMEAAINAIRKHGTGSGGTRNISGNTILHESLEEDLAKLHGKEAALVFTSCYVANEASLHTLGTRLPFVEIFSDSGNHASMIHGIRTSRARKIIYRHNDTKHLDQLLSKTSAGVPKLVAFETVHSMSGNICPVDELLDICEKHGAFSFVDEVHAVGLYGDHGAGVAERDGVMDRIDMISGTLGKAFGNVGGYIAGDKAVVDMIRNYASGFIFTTSLPPHVLAGARKAVDILASDEGRQLRNQHQDVVRTVKSYLQHEGIPVIDCPSHIIPVHVGHAGLCTHLSNEMLQKYNIYVQAINHPTVAVGEERLRIAPSPHHTLPMINELVSAMISLWKE 1566
            +FF   I++KK D+TYR+FK V RRAD +P+A++ S L+   K+V+VWCSNDYLGMS HP V++A   A+ +HG G+GGTRNISG +  H  LE +LA LH K+AAL+F+SC+VAN+++L TL   LP  EI+SD+GNHASMI GIR S   K ++RHND  HL++LL K +   PK+VAFETVHSM G ICP++E+ DI  K+GA +FVDEVHAVGLYG HGAGV ERD VM ++D+ISGTLGKAFG VGGY+A   +++D +R+YA+GFIFTTSLPP VLAGA ++V +L S+EG+ LR  HQ  V+ ++  L   G+PVI+CPSHIIP+ VG+A + T + + +L +YNIYVQAIN+PTV  GEE LR+APSPHHT  M+N  V +++S WKE
Sbjct:  168 DFFSRRIEEKKSDHTYRLFKTVNRRADAYPFAEDYSDLHGEKKEVSVWCSNDYLGMSRHPKVLKAIAEALEEHGAGAGGTRNISGTSKYHVDLECELADLHNKDAALLFSSCFVANDSTLFTLAKMLPGCEIYSDAGNHASMIQGIRNSGVTKFVFRHNDPAHLEELLQKANPKTPKIVAFETVHSMDGAICPLEEVCDIAHKYGALTFVDEVHAVGLYGTHGAGVGERDSVMHKMDIISGTLGKAFGCVGGYVASTASLIDTVRSYAAGFIFTTSLPPMVLAGAVESVRVLKSEEGQALRRAHQRNVKHMRQLLMDAGLPVINCPSHIIPIRVGNAAINTRICDVLLSQYNIYVQAINYPTVPRGEELLRLAPSPHHTPDMMNYFVESLVSAWKE 563          
BLAST of 5-aminolevulinate synthase vs. Ensembl Xenopus
Match: alas1 (5'-aminolevulinate synthase 1 [Source:NCBI gene;Acc:493434])

HSP 1 Score: 471.47 bits (1212), Expect = 6.926e-160
Identity = 224/401 (55.86%), Postives = 298/401 (74.31%), Query Frame = 1
Query:  388 EFFQSEIDKKKQDNTYRVFKKVLRRADNFPYAKEKS---ILNKDVAVWCSNDYLGMSWHPSVMEAAINAIRKHGTGSGGTRNISGNTILHESLEEDLAKLHGKEAALVFTSCYVANEASLHTLGTRLPFVEIFSDSGNHASMIHGIRTSRARKIIYRHNDTKHLDQLLSKTSAGVPKLVAFETVHSMSGNICPVDELLDICEKHGAFSFVDEVHAVGLYGDHGAGVAERDGVMDRIDMISGTLGKAFGNVGGYIAGDKAVVDMIRNYASGFIFTTSLPPHVLAGARKAVDILASDEGRQLRNQHQDVVRTVKSYLQHEGIPVIDCPSHIIPVHVGHAGLCTHLSNEMLQKYNIYVQAINHPTVAVGEERLRIAPSPHHTLPMINELVSAMISLWKENKLSF 1581
            +FF+ +ID+KK D+TYRVFK V RRA+ FP A + S   I  K V+VWCSNDYLGMS HP V+ A +  +++HG G+GGTRNISG +  H  LE +LA LHGK+AAL+F+SC+VAN+++L TL   LP  EI+SD+GNHASMI GIR SRA K ++RHND  HL +LL  +    PK+VAFETVHSM G +CP++E+ D+  ++GA +FVDEVHAVGLYG  G G+ +RDGVM ++D+ISGTLGKAFG VGGYIA   A++D +R+YA+GFIFTTSLPP +L+GA  +V +L S+EG+ LR QHQ  V+ ++  L   G+PV+ CPSHIIP+ V  A   T + +++++ YNIYVQAIN+PTVA GEE LRIAP+PHH   M++  +  +++ WK   L  
Sbjct:  174 KFFEKKIDEKKNDHTYRVFKTVNRRAEVFPMADDYSDTLISKKTVSVWCSNDYLGMSRHPKVVGAVMETLKQHGAGAGGTRNISGTSKFHVELEHELADLHGKDAALLFSSCFVANDSTLFTLAKMLPGCEIYSDAGNHASMIQGIRNSRAPKYVFRHNDVGHLRELLKNSDPSTPKIVAFETVHSMDGAVCPLEEMCDVAHEYGAITFVDEVHAVGLYGARGGGIGDRDGVMTKMDIISGTLGKAFGCVGGYIASTSALIDTVRSYAAGFIFTTSLPPMLLSGAIASVRVLKSEEGQALRRQHQRNVKLMRQMLMDSGLPVVHCPSHIIPIRVSDAAKNTEICDKLMRDYNIYVQAINYPTVARGEELLRIAPTPHHNPQMMSYFLDKLLTTWKSVDLEL 574          
BLAST of 5-aminolevulinate synthase vs. Ensembl Xenopus
Match: alas1 (5'-aminolevulinate synthase 1 [Source:NCBI gene;Acc:493434])

HSP 1 Score: 470.7 bits (1210), Expect = 1.698e-159
Identity = 224/401 (55.86%), Postives = 298/401 (74.31%), Query Frame = 1
Query:  388 EFFQSEIDKKKQDNTYRVFKKVLRRADNFPYAKEKS---ILNKDVAVWCSNDYLGMSWHPSVMEAAINAIRKHGTGSGGTRNISGNTILHESLEEDLAKLHGKEAALVFTSCYVANEASLHTLGTRLPFVEIFSDSGNHASMIHGIRTSRARKIIYRHNDTKHLDQLLSKTSAGVPKLVAFETVHSMSGNICPVDELLDICEKHGAFSFVDEVHAVGLYGDHGAGVAERDGVMDRIDMISGTLGKAFGNVGGYIAGDKAVVDMIRNYASGFIFTTSLPPHVLAGARKAVDILASDEGRQLRNQHQDVVRTVKSYLQHEGIPVIDCPSHIIPVHVGHAGLCTHLSNEMLQKYNIYVQAINHPTVAVGEERLRIAPSPHHTLPMINELVSAMISLWKENKLSF 1581
            +FF+ +ID+KK D+TYRVFK V RRA+ FP A + S   I  K V+VWCSNDYLGMS HP V+ A +  +++HG G+GGTRNISG +  H  LE +LA LHGK+AAL+F+SC+VAN+++L TL   LP  EI+SD+GNHASMI GIR SRA K ++RHND  HL +LL  +    PK+VAFETVHSM G +CP++E+ D+  ++GA +FVDEVHAVGLYG  G G+ +RDGVM ++D+ISGTLGKAFG VGGYIA   A++D +R+YA+GFIFTTSLPP +L+GA  +V +L S+EG+ LR QHQ  V+ ++  L   G+PV+ CPSHIIP+ V  A   T + +++++ YNIYVQAIN+PTVA GEE LRIAP+PHH   M++  +  +++ WK   L  
Sbjct:  189 KFFEKKIDEKKNDHTYRVFKTVNRRAEVFPMADDYSDTLISKKTVSVWCSNDYLGMSRHPKVVGAVMETLKQHGAGAGGTRNISGTSKFHVELEHELADLHGKDAALLFSSCFVANDSTLFTLAKMLPGCEIYSDAGNHASMIQGIRNSRAPKYVFRHNDVGHLRELLKNSDPSTPKIVAFETVHSMDGAVCPLEEMCDVAHEYGAITFVDEVHAVGLYGARGGGIGDRDGVMTKMDIISGTLGKAFGCVGGYIASTSALIDTVRSYAAGFIFTTSLPPMLLSGAIASVRVLKSEEGQALRRQHQRNVKLMRQMLMDSGLPVVHCPSHIIPIRVSDAAKNTEICDKLMRDYNIYVQAINYPTVARGEELLRIAPTPHHNPQMMSYFLDKLLTTWKSVDLEL 589          
BLAST of 5-aminolevulinate synthase vs. Ensembl Xenopus
Match: alas1 (5'-aminolevulinate synthase 1 [Source:NCBI gene;Acc:493434])

HSP 1 Score: 461.84 bits (1187), Expect = 2.182e-157
Identity = 221/387 (57.11%), Postives = 292/387 (75.45%), Query Frame = 1
Query:  388 EFFQSEIDKKKQDNTYRVFKKVLRRADNFPYAKEKS---ILNKDVAVWCSNDYLGMSWHPSVMEAAINAIRKHGTGSGGTRNISGNTILHESLEEDLAKLHGKEAALVFTSCYVANEASLHTLGTRLPFVEIFSDSGNHASMIHGIRTSRARKIIYRHNDTKHLDQLLSKTSAGVPKLVAFETVHSMSGNICPVDELLDICEKHGAFSFVDEVHAVGLYGDHGAGVAERDGVMDRIDMISGTLGKAFGNVGGYIAGDKAVVDMIRNYASGFIFTTSLPPHVLAGARKAVDILASDEGRQLRNQHQDVVRTVKSYLQHEGIPVIDCPSHIIPVHVGHAGLCTHLSNEMLQKYNIYVQAINHPTVAVGEERLRIAPSPHHTLPMINELV 1539
            +FF+ +ID+KK D+TYRVFK V RRA+ FP A + S   I  K V+VWCSNDYLGMS HP V+ A +  +++HG G+GGTRNISG +  H  LE +LA LHGK+AAL+F+SC+VAN+++L TL   LP  EI+SD+GNHASMI GIR SRA K ++RHND  HL +LL  +    PK+VAFETVHSM G +CP++E+ D+  ++GA +FVDEVHAVGLYG  G G+ +RDGVM ++D+ISGTLGKAFG VGGYIA   A++D +R+YA+GFIFTTSLPP +L+GA  +V +L S+EG+ LR QHQ  V+ ++  L   G+PV+ CPSHIIP+ V  A   T + +++++ YNIYVQAIN+PTVA GEE LRIAP+PHH   M++  +
Sbjct:  128 KFFEKKIDEKKNDHTYRVFKTVNRRAEVFPMADDYSDTLISKKTVSVWCSNDYLGMSRHPKVVGAVMETLKQHGAGAGGTRNISGTSKFHVELEHELADLHGKDAALLFSSCFVANDSTLFTLAKMLPGCEIYSDAGNHASMIQGIRNSRAPKYVFRHNDVGHLRELLKNSDPSTPKIVAFETVHSMDGAVCPLEEMCDVAHEYGAITFVDEVHAVGLYGARGGGIGDRDGVMTKMDIISGTLGKAFGCVGGYIASTSALIDTVRSYAAGFIFTTSLPPMLLSGAIASVRVLKSEEGQALRRQHQRNVKLMRQMLMDSGLPVVHCPSHIIPIRVSDAAKNTEICDKLMRDYNIYVQAINYPTVARGEELLRIAPTPHHNPQMMSYFL 514          
BLAST of 5-aminolevulinate synthase vs. Ensembl Xenopus
Match: alas2 (5'-aminolevulinate synthase 2 [Source:NCBI gene;Acc:448773])

HSP 1 Score: 381.333 bits (978), Expect = 1.179e-125
Identity = 192/396 (48.48%), Postives = 256/396 (64.65%), Query Frame = 1
Query:  388 EFFQSEIDKKKQDNTYRVFKKVLRRADNFPYAKEKSILN---KDVAVWCSNDYLGMSWHPSVMEAAINAIRKHGTGSGGTRNISGNTILHESLEEDLAKLHGKEAALVFTSCYVANEASLHTLGTRLPFVEIFSDSGNHASMIHGIRTSRARKIIYRHNDTKHLDQLLSKTSAGVPKLVAFETVHSMSGNICPVDELLDICEKHGAFSFVDEVHAVGLYGDHGAGVAERDGVMDRIDMISGTLGKAFGNVGGYIAGDKAVVDMIRNYASGFIFTTSLPPHVLAGARKAVDILASDEGRQLRNQHQDVVRTVKSYLQHEGIPVIDCPSHIIPVHVGHAGLCTHLSNEMLQKYNIYVQAINHPTVAVGEERLRIAPSPHHTLPMINELVSAMISLWKE 1566
            +FF   I++KK D+TYR+FK V RRAD +P+A++ S L+   K+V+VWCSNDYLGMS HP V++A   A+ +HG G+GGTRNISG +  H  LE +LA LH K+AAL+F+SC+VAN+++L TL   LP  EI+SD+GNHASMI GIR S   K ++RHND  HL++LL K +   PK+VAFETVHSM G                AF  V                                        GGY+A   +++D +R+YA+GFIFTTSLPP VLAGA ++V +L S+EG+ LR  HQ  V+ ++  L   G+PVI+CPSHIIP+ VG+A + T + + +L +YNIYVQAIN+PTV  GEE LR+APSPHHT  M+N  V +++S WKE
Sbjct:  168 DFFSRRIEEKKSDHTYRLFKTVNRRADAYPFAEDYSDLHGEKKEVSVWCSNDYLGMSRHPKVLKAIAEALEEHGAGAGGTRNISGTSKYHVDLECELADLHNKDAALLFSSCFVANDSTLFTLAKMLPGCEIYSDAGNHASMIQGIRNSGVTKFVFRHNDPAHLEELLQKANPKTPKIVAFETVHSMDGK---------------AFGCV----------------------------------------GGYVASTASLIDTVRSYAAGFIFTTSLPPMVLAGAVESVRVLKSEEGQALRRAHQRNVKHMRQLLMDAGLPVINCPSHIIPIRVGNAAINTRICDVLLSQYNIYVQAINYPTVPRGEELLRLAPSPHHTPDMMNYFVESLVSAWKE 508          
BLAST of 5-aminolevulinate synthase vs. Ensembl Mouse
Match: Alas2 (aminolevulinic acid synthase 2, erythroid [Source:MGI Symbol;Acc:MGI:87990])

HSP 1 Score: 482.256 bits (1240), Expect = 8.625e-165
Identity = 225/399 (56.39%), Postives = 301/399 (75.44%), Query Frame = 1
Query:  388 EFFQSEIDKKKQDNTYRVFKKVLRRADNFPYAK---EKSILNKDVAVWCSNDYLGMSWHPSVMEAAINAIRKHGTGSGGTRNISGNTILHESLEEDLAKLHGKEAALVFTSCYVANEASLHTLGTRLPFVEIFSDSGNHASMIHGIRTSRARKIIYRHNDTKHLDQLLSKTSAGVPKLVAFETVHSMSGNICPVDELLDICEKHGAFSFVDEVHAVGLYGDHGAGVAERDGVMDRIDMISGTLGKAFGNVGGYIAGDKAVVDMIRNYASGFIFTTSLPPHVLAGARKAVDILASDEGRQLRNQHQDVVRTVKSYLQHEGIPVIDCPSHIIPVHVGHAGLCTHLSNEMLQKYNIYVQAINHPTVAVGEERLRIAPSPHHTLPMINELVSAMISLWKENKL 1575
            +FF+ +I +KKQD+TYRVFK V R A+ +P+A+   E S+ +KDV+VWCSNDYLG+S HP V++A    ++ HG G+GGTRNISG +  H  LE++LA+LH K++AL+F+SC+VAN+++L TL   LP  EI+SD+GNHASMI GIR S A K ++RHND  HL +LL K+    PK+VAFETVHSM G ICP++EL D+  ++GA +FVDEVHAVGLYG  GAG+ ERDG+M ++D+ISGTLGKAFG VGGYIA  + +VDM+R+YA+GFIFTTSLPP VL+GA ++V +L  +EG+ LR  HQ  V+ ++  L   G PVI CPSHIIP+ VG+A L + + + +L K++IYVQAIN+PTV  GEE LR+APSPHH+  M+   V  ++  W E  L
Sbjct:  132 QFFRDKIMEKKQDHTYRVFKTVNRWANAYPFAQHFSEASMASKDVSVWCSNDYLGISRHPRVLQAIEETLKNHGAGAGGTRNISGTSKFHVELEQELAELHQKDSALLFSSCFVANDSTLFTLAKLLPGCEIYSDAGNHASMIQGIRNSGAAKFVFRHNDPGHLKKLLEKSDPKTPKIVAFETVHSMDGAICPLEELCDVAHQYGALTFVDEVHAVGLYGARGAGIGERDGIMHKLDIISGTLGKAFGCVGGYIASTRDLVDMVRSYAAGFIFTTSLPPMVLSGALESVRLLKGEEGQALRRAHQRNVKHMRQLLMDRGFPVIPCPSHIIPIRVGNAALNSKICDLLLSKHSIYVQAINYPTVPRGEELLRLAPSPHHSPQMMENFVEKLLLAWTEVGL 530          
BLAST of 5-aminolevulinate synthase vs. Ensembl Mouse
Match: Alas2 (aminolevulinic acid synthase 2, erythroid [Source:MGI Symbol;Acc:MGI:87990])

HSP 1 Score: 482.256 bits (1240), Expect = 1.405e-164
Identity = 225/399 (56.39%), Postives = 301/399 (75.44%), Query Frame = 1
Query:  388 EFFQSEIDKKKQDNTYRVFKKVLRRADNFPYAK---EKSILNKDVAVWCSNDYLGMSWHPSVMEAAINAIRKHGTGSGGTRNISGNTILHESLEEDLAKLHGKEAALVFTSCYVANEASLHTLGTRLPFVEIFSDSGNHASMIHGIRTSRARKIIYRHNDTKHLDQLLSKTSAGVPKLVAFETVHSMSGNICPVDELLDICEKHGAFSFVDEVHAVGLYGDHGAGVAERDGVMDRIDMISGTLGKAFGNVGGYIAGDKAVVDMIRNYASGFIFTTSLPPHVLAGARKAVDILASDEGRQLRNQHQDVVRTVKSYLQHEGIPVIDCPSHIIPVHVGHAGLCTHLSNEMLQKYNIYVQAINHPTVAVGEERLRIAPSPHHTLPMINELVSAMISLWKENKL 1575
            +FF+ +I +KKQD+TYRVFK V R A+ +P+A+   E S+ +KDV+VWCSNDYLG+S HP V++A    ++ HG G+GGTRNISG +  H  LE++LA+LH K++AL+F+SC+VAN+++L TL   LP  EI+SD+GNHASMI GIR S A K ++RHND  HL +LL K+    PK+VAFETVHSM G ICP++EL D+  ++GA +FVDEVHAVGLYG  GAG+ ERDG+M ++D+ISGTLGKAFG VGGYIA  + +VDM+R+YA+GFIFTTSLPP VL+GA ++V +L  +EG+ LR  HQ  V+ ++  L   G PVI CPSHIIP+ VG+A L + + + +L K++IYVQAIN+PTV  GEE LR+APSPHH+  M+   V  ++  W E  L
Sbjct:  147 QFFRDKIMEKKQDHTYRVFKTVNRWANAYPFAQHFSEASMASKDVSVWCSNDYLGISRHPRVLQAIEETLKNHGAGAGGTRNISGTSKFHVELEQELAELHQKDSALLFSSCFVANDSTLFTLAKLLPGCEIYSDAGNHASMIQGIRNSGAAKFVFRHNDPGHLKKLLEKSDPKTPKIVAFETVHSMDGAICPLEELCDVAHQYGALTFVDEVHAVGLYGARGAGIGERDGIMHKLDIISGTLGKAFGCVGGYIASTRDLVDMVRSYAAGFIFTTSLPPMVLSGALESVRLLKGEEGQALRRAHQRNVKHMRQLLMDRGFPVIPCPSHIIPIRVGNAALNSKICDLLLSKHSIYVQAINYPTVPRGEELLRLAPSPHHSPQMMENFVEKLLLAWTEVGL 545          
BLAST of 5-aminolevulinate synthase vs. Ensembl Mouse
Match: Alas1 (aminolevulinic acid synthase 1 [Source:MGI Symbol;Acc:MGI:87989])

HSP 1 Score: 475.707 bits (1223), Expect = 2.623e-161
Identity = 231/400 (57.75%), Postives = 293/400 (73.25%), Query Frame = 1
Query:  391 FFQSEIDKKKQDNTYRVFKKVLRRADNFPYAKEKS---ILNKDVAVWCSNDYLGMSWHPSVMEAAINAIRKHGTGSGGTRNISGNTILHESLEEDLAKLHGKEAALVFTSCYVANEASLHTLGTRLPFVEIFSDSGNHASMIHGIRTSRARKIIYRHNDTKHLDQLLSKTSAGVPKLVAFETVHSMSGNICPVDELLDICEKHGAFSFVDEVHAVGLYGDHGAGVAERDGVMDRIDMISGTLGKAFGNVGGYIAGDKAVVDMIRNYASGFIFTTSLPPHVLAGARKAVDILASDEGRQLRNQHQDVVRTVKSYLQHEGIPVIDCPSHIIPVHVGHAGLCTHLSNEMLQKYNIYVQAINHPTVAVGEERLRIAPSPHHTLPMINELVSAMISLWKENKLSF 1581
            FF+ +ID+KK D+TYRVFK V RRA  FP A + +   I  K V+VWCSNDYLGMS HP V  A +  +++HG G+GGTRNISG +  H  LE+ LA LHGK+AAL+F+SC+VAN+++L TL   +P  EI+SDSGNHASMI GIR SR  K I+RHND  HL +LL ++   VPK+VAFETVHSM G +CP++EL D+  + GA +FVDEVHAVGLYG  G G+ +RDGVM ++D+ISGTLGKAFG VGGYIA    ++D +R+YA+GFIFTTSLPP +LAGA ++V IL S EGR LR QHQ  V+ ++  L   G+PVI CPSHIIPV V  A   T + +E++ ++NIYVQAIN+PTV  GEE LRIAP+PHHT  M+N  V  ++  WK   L  
Sbjct:  204 FFEKKIDEKKNDHTYRVFKTVNRRAQIFPMADDYTDSLITKKQVSVWCSNDYLGMSRHPRVCGAVMETVKQHGAGAGGTRNISGTSKFHVELEQALADLHGKDAALLFSSCFVANDSTLFTLAKMMPGCEIYSDSGNHASMIQGIRNSRVPKYIFRHNDVNHLRELLQRSDPSVPKIVAFETVHSMDGAVCPLEELCDVAHEFGAITFVDEVHAVGLYGARGGGIGDRDGVMPKMDIISGTLGKAFGCVGGYIASTSLLIDTVRSYAAGFIFTTSLPPMLLAGALESVRILKSSEGRALRRQHQRNVKLLRQMLMDAGLPVIHCPSHIIPVRVADAAKNTEICDELMTRHNIYVQAINYPTVPRGEELLRIAPTPHHTPQMMNFFVEKLLVTWKRVGLEL 603          
BLAST of 5-aminolevulinate synthase vs. Ensembl Mouse
Match: Alas1 (aminolevulinic acid synthase 1 [Source:MGI Symbol;Acc:MGI:87989])

HSP 1 Score: 475.707 bits (1223), Expect = 2.623e-161
Identity = 231/400 (57.75%), Postives = 293/400 (73.25%), Query Frame = 1
Query:  391 FFQSEIDKKKQDNTYRVFKKVLRRADNFPYAKEKS---ILNKDVAVWCSNDYLGMSWHPSVMEAAINAIRKHGTGSGGTRNISGNTILHESLEEDLAKLHGKEAALVFTSCYVANEASLHTLGTRLPFVEIFSDSGNHASMIHGIRTSRARKIIYRHNDTKHLDQLLSKTSAGVPKLVAFETVHSMSGNICPVDELLDICEKHGAFSFVDEVHAVGLYGDHGAGVAERDGVMDRIDMISGTLGKAFGNVGGYIAGDKAVVDMIRNYASGFIFTTSLPPHVLAGARKAVDILASDEGRQLRNQHQDVVRTVKSYLQHEGIPVIDCPSHIIPVHVGHAGLCTHLSNEMLQKYNIYVQAINHPTVAVGEERLRIAPSPHHTLPMINELVSAMISLWKENKLSF 1581
            FF+ +ID+KK D+TYRVFK V RRA  FP A + +   I  K V+VWCSNDYLGMS HP V  A +  +++HG G+GGTRNISG +  H  LE+ LA LHGK+AAL+F+SC+VAN+++L TL   +P  EI+SDSGNHASMI GIR SR  K I+RHND  HL +LL ++   VPK+VAFETVHSM G +CP++EL D+  + GA +FVDEVHAVGLYG  G G+ +RDGVM ++D+ISGTLGKAFG VGGYIA    ++D +R+YA+GFIFTTSLPP +LAGA ++V IL S EGR LR QHQ  V+ ++  L   G+PVI CPSHIIPV V  A   T + +E++ ++NIYVQAIN+PTV  GEE LRIAP+PHHT  M+N  V  ++  WK   L  
Sbjct:  204 FFEKKIDEKKNDHTYRVFKTVNRRAQIFPMADDYTDSLITKKQVSVWCSNDYLGMSRHPRVCGAVMETVKQHGAGAGGTRNISGTSKFHVELEQALADLHGKDAALLFSSCFVANDSTLFTLAKMMPGCEIYSDSGNHASMIQGIRNSRVPKYIFRHNDVNHLRELLQRSDPSVPKIVAFETVHSMDGAVCPLEELCDVAHEFGAITFVDEVHAVGLYGARGGGIGDRDGVMPKMDIISGTLGKAFGCVGGYIASTSLLIDTVRSYAAGFIFTTSLPPMLLAGALESVRILKSSEGRALRRQHQRNVKLLRQMLMDAGLPVIHCPSHIIPVRVADAAKNTEICDELMTRHNIYVQAINYPTVPRGEELLRIAPTPHHTPQMMNFFVEKLLVTWKRVGLEL 603          
BLAST of 5-aminolevulinate synthase vs. Ensembl Mouse
Match: Alas1 (aminolevulinic acid synthase 1 [Source:MGI Symbol;Acc:MGI:87989])

HSP 1 Score: 469.544 bits (1207), Expect = 6.361e-159
Identity = 230/400 (57.50%), Postives = 292/400 (73.00%), Query Frame = 1
Query:  391 FFQSEIDKKKQDNTYRVFKKVLRRADNFPYAKEKS---ILNKDVAVWCSNDYLGMSWHPSVMEAAINAIRKHGTGSGGTRNISGNTILHESLEEDLAKLHGKEAALVFTSCYVANEASLHTLGTRLPFVEIFSDSGNHASMIHGIRTSRARKIIYRHNDTKHLDQLLSKTSAGVPKLVAFETVHSMSGNICPVDELLDICEKHGAFSFVDEVHAVGLYGDHGAGVAERDGVMDRIDMISGTLGKAFGNVGGYIAGDKAVVDMIRNYASGFIFTTSLPPHVLAGARKAVDILASDEGRQLRNQHQDVVRTVKSYLQHEGIPVIDCPSHIIPVHVGHAGLCTHLSNEMLQKYNIYVQAINHPTVAVGEERLRIAPSPHHTLPMINELVSAMISLWKENKLSF 1581
            FF+ +ID+KK D+TYRVFK V RRA  FP A + +   I  K V+VWCSNDYLGMS HP V  A +  +++HG G+GGTRNISG +  H  LE+ LA LHGK+AAL+F+SC+VAN+++L TL   +P  EI+SDSGNHASMI GIR SR  K I+RHND  HL +LL ++   VPK+VAFETVHSM   +CP++EL D+  + GA +FVDEVHAVGLYG  G G+ +RDGVM ++D+ISGTLGKAFG VGGYIA    ++D +R+YA+GFIFTTSLPP +LAGA ++V IL S EGR LR QHQ  V+ ++  L   G+PVI CPSHIIPV V  A   T + +E++ ++NIYVQAIN+PTV  GEE LRIAP+PHHT  M+N  V  ++  WK   L  
Sbjct:  204 FFEKKIDEKKNDHTYRVFKTVNRRAQIFPMADDYTDSLITKKQVSVWCSNDYLGMSRHPRVCGAVMETVKQHGAGAGGTRNISGTSKFHVELEQALADLHGKDAALLFSSCFVANDSTLFTLAKMMPGCEIYSDSGNHASMIQGIRNSRVPKYIFRHNDVNHLRELLQRSDPSVPKIVAFETVHSMDA-VCPLEELCDVAHEFGAITFVDEVHAVGLYGARGGGIGDRDGVMPKMDIISGTLGKAFGCVGGYIASTSLLIDTVRSYAAGFIFTTSLPPMLLAGALESVRILKSSEGRALRRQHQRNVKLLRQMLMDAGLPVIHCPSHIIPVRVADAAKNTEICDELMTRHNIYVQAINYPTVPRGEELLRIAPTPHHTPQMMNFFVEKLLVTWKRVGLEL 602          
BLAST of 5-aminolevulinate synthase vs. UniProt/SwissProt
Match: sp|Q9XS79|HEM1_DELLE (5-aminolevulinate synthase, nonspecific, mitochondrial OS=Delphinapterus leucas OX=9749 GN=ALAS1 PE=2 SV=1)

HSP 1 Score: 494.197 bits (1271), Expect = 1.017e-167
Identity = 232/400 (58.00%), Postives = 296/400 (74.00%), Query Frame = 1
Query:  391 FFQSEIDKKKQDNTYRVFKKVLRRADNFPYAKEKS---ILNKDVAVWCSNDYLGMSWHPSVMEAAINAIRKHGTGSGGTRNISGNTILHESLEEDLAKLHGKEAALVFTSCYVANEASLHTLGTRLPFVEIFSDSGNHASMIHGIRTSRARKIIYRHNDTKHLDQLLSKTSAGVPKLVAFETVHSMSGNICPVDELLDICEKHGAFSFVDEVHAVGLYGDHGAGVAERDGVMDRIDMISGTLGKAFGNVGGYIAGDKAVVDMIRNYASGFIFTTSLPPHVLAGARKAVDILASDEGRQLRNQHQDVVRTVKSYLQHEGIPVIDCPSHIIPVHVGHAGLCTHLSNEMLQKYNIYVQAINHPTVAVGEERLRIAPSPHHTLPMINELVSAMISLWKENKLSF 1581
            FF+ +ID+KK D+TYRVFK V RRA  FP A + S   +  K V+VWCSNDYLGMS HP V  A ++ +++HGTG+GGTRNISG +  H  LE++LA LHGK+AAL+F+SC+VAN+++L TL   +P  EI+SDSGNHASMI GI  SR  K IYRHND  HL +LL ++   VPK+VAFETVHSM G +CP++EL D+  + GA +FVDEVHAVGLYG  G G+ +RDGVM ++D+ISGTLGKAFG VGGYIA   +++D IR+YA+GFIFTTSLPP +LAGA ++V IL S EGR LR QHQ  V+ ++  L    +PV+ CPSHIIPV V  A   T + NE++ ++NIYVQAIN+PTV  GEE LRIAP+PHHT  M+N  V  +++ WK   L  
Sbjct:  202 FFEKKIDEKKNDHTYRVFKTVNRRAQFFPMADDYSDSLVTKKQVSVWCSNDYLGMSCHPRVCGAVMDTLKQHGTGAGGTRNISGTSKFHVDLEQELADLHGKDAALLFSSCFVANDSTLFTLAKMMPGCEIYSDSGNHASMIQGIWNSRVPKYIYRHNDVDHLRELLQRSDPAVPKIVAFETVHSMDGAVCPLEELCDVAHEFGAITFVDEVHAVGLYGAQGGGIGDRDGVMPKMDIISGTLGKAFGCVGGYIASTSSLIDTIRSYAAGFIFTTSLPPMLLAGALESVRILKSTEGRVLRRQHQRNVKLMRQMLMDASLPVVHCPSHIIPVRVADAAKNTEVCNELMSRHNIYVQAINYPTVRRGEELLRIAPTPHHTPQMMNYFVENLLATWKRVGLEL 601          
BLAST of 5-aminolevulinate synthase vs. UniProt/SwissProt
Match: sp|Q3ZC31|HEM0_BOVIN (5-aminolevulinate synthase, erythroid-specific, mitochondrial OS=Bos taurus OX=9913 GN=ALAS2 PE=2 SV=1)

HSP 1 Score: 491.5 bits (1264), Expect = 1.741e-167
Identity = 232/406 (57.14%), Postives = 306/406 (75.37%), Query Frame = 1
Query:  388 EFFQSEIDKKKQDNTYRVFKKVLRRADNFPYAK---EKSILNKDVAVWCSNDYLGMSWHPSVMEAAINAIRKHGTGSGGTRNISGNTILHESLEEDLAKLHGKEAALVFTSCYVANEASLHTLGTRLPFVEIFSDSGNHASMIHGIRTSRARKIIYRHNDTKHLDQLLSKTSAGVPKLVAFETVHSMSGNICPVDELLDICEKHGAFSFVDEVHAVGLYGDHGAGVAERDGVMDRIDMISGTLGKAFGNVGGYIAGDKAVVDMIRNYASGFIFTTSLPPHVLAGARKAVDILASDEGRQLRNQHQDVVRTVKSYLQHEGIPVIDCPSHIIPVHVGHAGLCTHLSNEMLQKYNIYVQAINHPTVAVGEERLRIAPSPHHTLPMINELVSAMISLWKENKLSFYNQDL 1596
            +FF+ +I +KKQD+TYRVFK V R AD +P+A+   E S+ +KDV+VWCSNDYLGMS HP V++A    +++HG G+GGTRNISG +  H  LE++LA+LH K++AL+F+SC+VAN+++L TL   LP  EI+SD+GNHASMI GIR S A K ++RHND  HL +LL K++   PK+VAFETVHSM G ICP++EL D+  ++GA +FVDEVHAVGLYG  GAG+ ERDG+M +ID+ISGTLGKAFG VGGYIA  + +VDM+R+YA+GFIFTTSLPP VL+GA ++V +L  +EG+ LR  HQ  V+ ++  L   G+PVI CPSHIIP+ VG A L T + + +L KY IYVQAIN+PTV  GEE LR+APSPHH+  M+ + V  ++  W E  L    QD+
Sbjct:  147 QFFRDKIMEKKQDHTYRVFKTVNRWADAYPFAEHFFEASVASKDVSVWCSNDYLGMSRHPRVLQATQEILQRHGAGAGGTRNISGTSKFHVELEQELAELHQKDSALLFSSCFVANDSTLFTLAKILPGCEIYSDAGNHASMIQGIRNSGAAKFVFRHNDPDHLKKLLKKSNPETPKIVAFETVHSMDGAICPLEELCDVAHQYGALTFVDEVHAVGLYGSRGAGIGERDGIMHKIDIISGTLGKAFGCVGGYIASTRDLVDMVRSYAAGFIFTTSLPPMVLSGALESVRLLKGEEGQALRRAHQRNVKHMRQLLMDRGLPVIPCPSHIIPIRVGDAMLNTRICDLLLSKYGIYVQAINYPTVPRGEELLRLAPSPHHSPQMMEDFVEKLLEAWTEVGLPL--QDI 550          
BLAST of 5-aminolevulinate synthase vs. UniProt/SwissProt
Match: sp|P13195|HEM1_RAT (5-aminolevulinate synthase, nonspecific, mitochondrial OS=Rattus norvegicus OX=10116 GN=Alas1 PE=2 SV=2)

HSP 1 Score: 493.426 bits (1269), Expect = 2.099e-167
Identity = 231/400 (57.75%), Postives = 295/400 (73.75%), Query Frame = 1
Query:  391 FFQSEIDKKKQDNTYRVFKKVLRRADNFPYAKEKS---ILNKDVAVWCSNDYLGMSWHPSVMEAAINAIRKHGTGSGGTRNISGNTILHESLEEDLAKLHGKEAALVFTSCYVANEASLHTLGTRLPFVEIFSDSGNHASMIHGIRTSRARKIIYRHNDTKHLDQLLSKTSAGVPKLVAFETVHSMSGNICPVDELLDICEKHGAFSFVDEVHAVGLYGDHGAGVAERDGVMDRIDMISGTLGKAFGNVGGYIAGDKAVVDMIRNYASGFIFTTSLPPHVLAGARKAVDILASDEGRQLRNQHQDVVRTVKSYLQHEGIPVIDCPSHIIPVHVGHAGLCTHLSNEMLQKYNIYVQAINHPTVAVGEERLRIAPSPHHTLPMINELVSAMISLWKENKLSF 1581
            FF+ +ID+KK D+TYRVFK V RRA  FP A + +   I  K V+VWCSNDYLGMS HP V  A I  +++HG G+GGTRNISG +  H  LE++LA LHGK+AAL+F+SC+VAN+++L TL   +P  EI+SDSGNHASMI GIR SR  K I+RHND  HL +LL ++   VPK+VAFETVHSM G +CP++EL D+  + GA +FVDEVHAVGLYG  G G+ +RDGVM ++D+ISGTLGKAFG VGGYIA    ++D +R+YA+GFIFTTSLPP +LAGA ++V IL S+EGR LR QHQ  V+ ++  L   G+PVI CPSHIIPV V  A   T + +E++ ++NIYVQAIN+PTV  GEE LRIAP+PHHT  M+N  +  ++  WK   L  
Sbjct:  204 FFEKKIDEKKNDHTYRVFKTVNRRAQIFPMADDYTDSLITKKQVSVWCSNDYLGMSRHPRVCGAVIETVKQHGAGAGGTRNISGTSKFHVELEQELADLHGKDAALLFSSCFVANDSTLFTLAKMMPGCEIYSDSGNHASMIQGIRNSRVPKYIFRHNDVNHLRELLQRSDPSVPKIVAFETVHSMDGAVCPLEELCDVAHEFGAITFVDEVHAVGLYGASGGGIGDRDGVMPKMDIISGTLGKAFGCVGGYIASTSLLIDTVRSYAAGFIFTTSLPPMLLAGALESVRILKSNEGRALRRQHQRNVKLMRQMLMDAGLPVIHCPSHIIPVRVADAAKNTEICDELMTRHNIYVQAINYPTVPRGEELLRIAPTPHHTPQMMNFFLEKLLLTWKRVGLEL 603          
BLAST of 5-aminolevulinate synthase vs. UniProt/SwissProt
Match: sp|Q9XT75|HEM0_DELLE (5-aminolevulinate synthase, erythroid-specific, mitochondrial OS=Delphinapterus leucas OX=9749 GN=ALAS2 PE=2 SV=1)

HSP 1 Score: 490.345 bits (1261), Expect = 4.724e-167
Identity = 228/399 (57.14%), Postives = 305/399 (76.44%), Query Frame = 1
Query:  388 EFFQSEIDKKKQDNTYRVFKKVLRRADNFPYAK---EKSILNKDVAVWCSNDYLGMSWHPSVMEAAINAIRKHGTGSGGTRNISGNTILHESLEEDLAKLHGKEAALVFTSCYVANEASLHTLGTRLPFVEIFSDSGNHASMIHGIRTSRARKIIYRHNDTKHLDQLLSKTSAGVPKLVAFETVHSMSGNICPVDELLDICEKHGAFSFVDEVHAVGLYGDHGAGVAERDGVMDRIDMISGTLGKAFGNVGGYIAGDKAVVDMIRNYASGFIFTTSLPPHVLAGARKAVDILASDEGRQLRNQHQDVVRTVKSYLQHEGIPVIDCPSHIIPVHVGHAGLCTHLSNEMLQKYNIYVQAINHPTVAVGEERLRIAPSPHHTLPMINELVSAMISLWKENKL 1575
            +FF+++I +KKQD+TYRVFK V R AD +P+A+   E S+ +KDV+VWCSNDYLGMS HP V++A    +++HG G+GGTRNISG +  H  LE++LA+LH K++AL+F+SC+VAN+++L TL   LP  EI+SD+GNHASMI GIR S A K ++RHND  HL +LL K++   PK+VAFETVHSM G ICP++EL D+  ++GA +FVDEVHAVGLYG  GAG+ ERDG+M +ID+ISGTLGKAFG VGGYIA  + +VDM+R+YA+GFIFTTSLPP VL+GA ++V +L  +EG+ LR  HQ  V+ ++  L   G+PVI CPSHIIP+ VG A L + + + +L K+ IYVQAIN+PTV  GEE LR+APSPHH+  M+ + V  +++ W E  L
Sbjct:  142 QFFRNKIMEKKQDHTYRVFKTVNRWADAYPFAEHFFEASVASKDVSVWCSNDYLGMSRHPRVLQATQETLQRHGAGAGGTRNISGTSRFHVELEQELAELHQKDSALLFSSCFVANDSTLFTLAKILPGCEIYSDAGNHASMIQGIRNSGAAKFVFRHNDPDHLKKLLKKSNPETPKIVAFETVHSMDGAICPLEELCDVAHQYGALTFVDEVHAVGLYGSRGAGIGERDGIMHKIDIISGTLGKAFGCVGGYIASTRDLVDMVRSYAAGFIFTTSLPPMVLSGALESVRLLKGEEGQALRRAHQRNVKHMRQLLMDRGLPVIPCPSHIIPIRVGDAALNSRICDLLLSKHGIYVQAINYPTVPRGEELLRLAPSPHHSPQMMEDFVEKLLAAWTEVGL 540          
BLAST of 5-aminolevulinate synthase vs. UniProt/SwissProt
Match: sp|P22557|HEM0_HUMAN (5-aminolevulinate synthase, erythroid-specific, mitochondrial OS=Homo sapiens OX=9606 GN=ALAS2 PE=1 SV=2)

HSP 1 Score: 489.96 bits (1260), Expect = 7.215e-167
Identity = 227/394 (57.61%), Postives = 303/394 (76.90%), Query Frame = 1
Query:  388 EFFQSEIDKKKQDNTYRVFKKVLRRADNFPYAK---EKSILNKDVAVWCSNDYLGMSWHPSVMEAAINAIRKHGTGSGGTRNISGNTILHESLEEDLAKLHGKEAALVFTSCYVANEASLHTLGTRLPFVEIFSDSGNHASMIHGIRTSRARKIIYRHNDTKHLDQLLSKTSAGVPKLVAFETVHSMSGNICPVDELLDICEKHGAFSFVDEVHAVGLYGDHGAGVAERDGVMDRIDMISGTLGKAFGNVGGYIAGDKAVVDMIRNYASGFIFTTSLPPHVLAGARKAVDILASDEGRQLRNQHQDVVRTVKSYLQHEGIPVIDCPSHIIPVHVGHAGLCTHLSNEMLQKYNIYVQAINHPTVAVGEERLRIAPSPHHTLPMINELVSAMISLW 1560
            +FF+ +I +KKQD+TYRVFK V R AD +P+A+   E S+ +KDV+VWCSNDYLGMS HP V++A    +++HG G+GGTRNISG +  H  LE++LA+LH K++AL+F+SC+VAN+++L TL   LP  EI+SD+GNHASMI GIR S A K ++RHND  HL +LL K++  +PK+VAFETVHSM G ICP++EL D+  ++GA +FVDEVHAVGLYG  GAG+ ERDG+M +ID+ISGTLGKAFG VGGYIA  + +VDM+R+YA+GFIFTTSLPP VL+GA ++V +L  +EG+ LR  HQ  V+ ++  L   G+PVI CPSHIIP+ VG+A L + L + +L K+ IYVQAIN+PTV  GEE LR+APSPHH+  M+ + V  ++  W
Sbjct:  147 QFFRDKIMEKKQDHTYRVFKTVNRWADAYPFAQHFSEASVASKDVSVWCSNDYLGMSRHPQVLQATQETLQRHGAGAGGTRNISGTSKFHVELEQELAELHQKDSALLFSSCFVANDSTLFTLAKILPGCEIYSDAGNHASMIQGIRNSGAAKFVFRHNDPDHLKKLLEKSNPKIPKIVAFETVHSMDGAICPLEELCDVSHQYGALTFVDEVHAVGLYGSRGAGIGERDGIMHKIDIISGTLGKAFGCVGGYIASTRDLVDMVRSYAAGFIFTTSLPPMVLSGALESVRLLKGEEGQALRRAHQRNVKHMRQLLMDRGLPVIPCPSHIIPIRVGNAALNSKLCDLLLSKHGIYVQAINYPTVPRGEELLRLAPSPHHSPQMMEDFVEKLLLAW 540          
BLAST of 5-aminolevulinate synthase vs. TrEMBL
Match: A0A430QIB1 (5-aminolevulinate synthase OS=Schistosoma bovis OX=6184 GN=DC041_0012313 PE=3 SV=1)

HSP 1 Score: 574.318 bits (1479), Expect = 0.000e+0
Identity = 287/520 (55.19%), Postives = 367/520 (70.58%), Query Frame = 1
Query:   64 MLACPFLLKLPLNLVKNEAQRVIVKSGPKCPVFSRYLSNDLTNNKKDEVNSSSLNENIVESSVNLSNQMNVCP---------------HPTQNTDKYDVEPAKFLPAKQIXXXXXXXXXXXXMEFFQSEIDKKKQDNTYRVFKKVLRRADNFPYAKE-KSILNKDVAVWCSNDYLGMSWHPSVMEAAINAIRKHGTGSGGTRNISGNTILHESLEEDLAKLHGKEAALVFTSCYVANEASLHTLGTRLPFVEIFSDSGNHASMIHGIRTSRARKIIYRHNDTKHLDQLLSKTSAGVPKLVAFETVHSMSGNICPVDELLDICEKHGAFSFVDEVHAVGLYGDHGAGVAERDGVMDRIDMISGTLGKAFGNVGGYIAGDKAVVDMIRNYASGFIFTTSLPPHVLAGARKAVDILASDEGRQLRNQHQDVVRTVKSYLQHEGIPVIDCPSHIIPVHVGHAGLCTHLSNEMLQKYNIYVQAINHPTVAVGEERLRIAPSPHHTLPMINELVSAMISLWKENKL 1575
            M +CPFL KL   +++ + Q++I +  P+CP F+R L +    +     +  ++     ESSV      N C                 PT +    + +P        + +   S   + Y +FF SE+++KK+D+TYRVF+++LR A  FP+A +  S + + VAVWCSNDYLGMSWHP V EAAI+ IRKHG GSGGTRNISGN++LHESLE +L+ LHGK AALVFTSCYVANEA LHTLGTR+P + I SD+GNHASMIHGIRTSR  KIIYRHND KHL  LL+      PKL+AFETVHSMSG++CP+  LLD+ E + A SFVDEVHAVGLYG HGAGVAERDG M RID I+GTLGKAF ++GGY+AG   +VDMIR+YASGFIFTTSLPPH LA A+ ++ IL S EG++LR +HQ  V  V+  L+  G+PVI+ PSHIIP+HVG A LCT +S E+L ++NIYVQ+IN+PTV +G+ERLRIAP+PHHT  +  ELV ++  +WK+  L
Sbjct:    1 MTSCPFLRKLSPTVIQRDIQQLI-QLIPRCP-FARRLFDGTPLSSPRMYSDVAMERQSDESSVCNICIPNTCALFAGWQKSIVARKSLQPTTDITIKNADPGHSQTIDSVRNDGDSCLGFNYNKFFVSEVERKKRDSTYRVFRRILRDASEFPFADDYSSGMKRRVAVWCSNDYLGMSWHPKVQEAAISTIRKHGVGSGGTRNISGNSLLHESLEAELSDLHGKPAALVFTSCYVANEAVLHTLGTRIPELTIISDAGNHASMIHGIRTSRCPKIIYRHNDVKHLTSLLANIPKDSPKLIAFETVHSMSGDVCPLKNLLDVAEANKALSFVDEVHAVGLYGAHGAGVAERDGQMHRIDAITGTLGKAFASIGGYLAGSSELVDMIRSYASGFIFTTSLPPHSLAAAQTSIQILKSSEGKELRAEHQKRVSIVRQSLRQAGLPVIEAPSHIIPLHVGEAKLCTKISEELLSEHNIYVQSINYPTVDIGDERLRIAPTPHHTDKLTEELVDSLCMVWKKYNL 518          
BLAST of 5-aminolevulinate synthase vs. TrEMBL
Match: A0A504Y9P9 (5-aminolevulinate synthase OS=Fasciola gigantica OX=46835 GN=FGIG_07384 PE=3 SV=1)

HSP 1 Score: 572.392 bits (1474), Expect = 0.000e+0
Identity = 268/402 (66.67%), Postives = 325/402 (80.85%), Query Frame = 1
Query:  391 FFQSEIDKKKQDNTYRVFKKVLRRADNFPYAKEKSI-LNKDVAVWCSNDYLGMSWHPSVMEAAINAIRKHGTGSGGTRNISGNTILHESLEEDLAKLHGKEAALVFTSCYVANEASLHTLGTRLPFVEIFSDSGNHASMIHGIRTSRARKIIYRHNDTKHLDQLLSKTSAGVPKLVAFETVHSMSGNICPVDELLDICEKHGAFSFVDEVHAVGLYGDHGAGVAERDGVMDRIDMISGTLGKAFGNVGGYIAGDKAVVDMIRNYASGFIFTTSLPPHVLAGARKAVDILASDEGRQLRNQHQDVVRTVKSYLQHEGIPVIDCPSHIIPVHVGHAGLCTHLSNEMLQKYNIYVQAINHPTVAVGEERLRIAPSPHHTLPMINELVSAMISLWKENKLSFYNQD 1593
            FF SEI KKKQD+TYRVFK+VLR AD+FP+A + S    + VA+WCSNDYLGMSWHP V EAA+ AI+KHG GSGGTRNISGN++LHE+LE +LA+LHGK +AL+FTSCYVANEA+LHTLGTRLP V I SD+GNHASMIHGIRTSRA K IYRHND + L  +L+      PKLVAFETVHSM+G++CP+  LLD+ E+H A +FVDEVHAVGLYGDHGAGVAERDG+M RID ISGTLGKAF +VGGYIAG   +VDMIR+YASGFIFTTSLPP VLA AR ++ IL + EGR+LR +HQ  V  V+  LQ EG+PV++ PSHI+P+HVG A LCT +S E+L ++NIYVQ+IN+PTV  G+ERLRIAP+PHHT  + ++LV A+ S+W +  L     D
Sbjct:  163 FFHSEIHKKKQDSTYRVFKRVLRDADHFPFADDYSTGAKRRVAIWCSNDYLGMSWHPKVREAAVTAIQKHGVGSGGTRNISGNSVLHEALESELAQLHGKPSALIFTSCYVANEATLHTLGTRLPGVTIVSDAGNHASMIHGIRTSRAPKRIYRHNDVEGLRSILTSLPREAPKLVAFETVHSMTGDVCPLKSLLDVSEEHNALTFVDEVHAVGLYGDHGAGVAERDGLMHRIDAISGTLGKAFASVGGYIAGSHELVDMIRSYASGFIFTTSLPPPVLAAARASIAILKTTEGRELRAEHQRRVEIVRKRLQQEGLPVLEAPSHILPLHVGDAELCTRISTELLTEHNIYVQSINYPTVDRGDERLRIAPTPHHTDELTDQLVDALCSIWGKYDLPLTKSD 564          
BLAST of 5-aminolevulinate synthase vs. TrEMBL
Match: A0A4E0RML2 (5-aminolevulinate synthase OS=Fasciola hepatica OX=6192 GN=D915_006603 PE=3 SV=1)

HSP 1 Score: 572.007 bits (1473), Expect = 0.000e+0
Identity = 267/402 (66.42%), Postives = 326/402 (81.09%), Query Frame = 1
Query:  391 FFQSEIDKKKQDNTYRVFKKVLRRADNFPYAKEKSI-LNKDVAVWCSNDYLGMSWHPSVMEAAINAIRKHGTGSGGTRNISGNTILHESLEEDLAKLHGKEAALVFTSCYVANEASLHTLGTRLPFVEIFSDSGNHASMIHGIRTSRARKIIYRHNDTKHLDQLLSKTSAGVPKLVAFETVHSMSGNICPVDELLDICEKHGAFSFVDEVHAVGLYGDHGAGVAERDGVMDRIDMISGTLGKAFGNVGGYIAGDKAVVDMIRNYASGFIFTTSLPPHVLAGARKAVDILASDEGRQLRNQHQDVVRTVKSYLQHEGIPVIDCPSHIIPVHVGHAGLCTHLSNEMLQKYNIYVQAINHPTVAVGEERLRIAPSPHHTLPMINELVSAMISLWKENKLSFYNQD 1593
            FF SEI KKKQD+TYRVFK+VLR AD+FP+A + S    + VA+WCSNDYLGMSWHP V EAA+ AI+KHG GSGGTRNISGN++LHE+LE +LA+LHGK +AL+FTSCYVANEA+LHTLGTRLP V I SD+GNHASMIHGIRTSRA K IYRHND + L  +L+      PKLVAFETVHSM+G++CP+  LLD+ E+H A +FVDEVHAVGLYGDHGAGVAERDG+M RID ISGTLGKAF +VGGYIAG   +VDMIR+YASGFIFTTSLPP VLA AR ++ +L + EGR+LR +HQ  V+ V+  LQ EG+PV++ PSHI+P+HVG A LCT +S E+L ++NIYVQ+IN+PTV  G+ERLRIAP+PHHT  + ++LV A+ S+W +  L     D
Sbjct:  163 FFHSEIHKKKQDSTYRVFKRVLRDADHFPFADDYSTGAKRRVAIWCSNDYLGMSWHPKVREAAVTAIQKHGVGSGGTRNISGNSVLHEALESELAQLHGKPSALIFTSCYVANEATLHTLGTRLPGVTIVSDAGNHASMIHGIRTSRAPKRIYRHNDVEGLRSILTSLPREAPKLVAFETVHSMTGDVCPLKSLLDVSEEHNALTFVDEVHAVGLYGDHGAGVAERDGLMHRIDAISGTLGKAFASVGGYIAGSHELVDMIRSYASGFIFTTSLPPPVLAAARASIALLKTTEGRELRAEHQRRVKIVRKRLQQEGLPVLEAPSHILPLHVGDAELCTRISTELLMEHNIYVQSINYPTVDRGDERLRIAPTPHHTDELTDQLVDALCSIWGKYDLPLTKSD 564          
BLAST of 5-aminolevulinate synthase vs. TrEMBL
Match: A0A183P5J9 (5-aminolevulinate synthase OS=Schistosoma mattheei OX=31246 GN=SMTD_LOCUS9636 PE=3 SV=1)

HSP 1 Score: 569.696 bits (1467), Expect = 0.000e+0
Identity = 285/516 (55.23%), Postives = 369/516 (71.51%), Query Frame = 1
Query:   64 MLACPFLLKLPLNLVKNEAQRVIVKSGPKCPVFSRYLSNDLTNNKKDEVNSSSLNENIVESSV--NLSN-QMNVCPHPTQNTDKYDVEPAKFLPAKQIXXXXXXXXXXXXMEFFQ------SEIDKKKQDNTYRVFKKVLRRADNFPYAKE-KSILNKDVAVWCSNDYLGMSWHPSVMEAAINAIRKHGTGSGGTRNISGNTILHESLEEDLAKLHGKEAALVFTSCYVANEASLHTLGTRLPFVEIFSDSGNHASMIHGIRTSRARKIIYRHNDTKHLDQLLSKTSAGVPKLVAFETVHSMSGNICPVDELLDICEKHGAFSFVDEVHAVGLYGDHGAGVAERDGVMDRIDMISGTLGKAFGNVGGYIAGDKAVVDMIRNYASGFIFTTSLPPHVLAGARKAVDILASDEGRQLRNQHQDVVRTVKSYLQHEGIPVIDCPSHIIPVHVGHAGLCTHLSNEMLQKYNIYVQAINHPTVAVGEERLRIAPSPHHTLPMINELVSAMISLWKENKLSF 1581
            M +CPFL KL   +++ + Q++I +  P+CP F+R L +    +     +  ++   + ESSV  N+S   +  CP      + Y+   +      Q  +  ++       E +Q      S++++KK+D+TYRVF+++LR A  FP+A +  S + + VAVWCSNDYLGMSWHP V EAAI+ IRKHG GSGGTRNISGN++LHESLE +L+ LHGK AALVFTSCYVANEA LHTLGTR+P + I SD+GNHASMIHGIRTSR  KIIYRHND KHL  LL+      PKL+AFETVHSMSG++CP+  LLD+ E + A SFVDEVHAVGLYG HGAGVAERDG M RID I+GTLGKAF ++GGY+AG   +VDMIR+YASGFIFTTSLPPH LA A+ ++ IL S EG++LR +HQ  V  V+  L+  G+PVI+ PSHIIP+HVG A LCT +S E+L ++NIYVQ+IN+PTV +G+ERLRIAP+PHHT  +  ELV ++  +WK+  L  
Sbjct:    1 MTSCPFLRKLSPTVIQRDIQQLI-QLIPRCP-FARRLFDGTPLSSPRMYSDVAMERQLDESSVCKNVSECLLKKCPF---TVNSYESTCSNDYLCAQTSNNHEN-------EMYQNQLCGISDVERKKRDSTYRVFRRILRDASEFPFADDYSSGMKRRVAVWCSNDYLGMSWHPKVQEAAISTIRKHGVGSGGTRNISGNSLLHESLEAELSDLHGKPAALVFTSCYVANEAVLHTLGTRIPELTIISDAGNHASMIHGIRTSRCPKIIYRHNDVKHLTSLLANIPKDSPKLIAFETVHSMSGDVCPLKNLLDVAEANKALSFVDEVHAVGLYGAHGAGVAERDGQMHRIDAITGTLGKAFASIGGYLAGSSELVDMIRSYASGFIFTTSLPPHSLAAAQTSIQILKSSEGKELRAEHQKRVSIVRQSLRQAGLPVIEAPSHIIPLHVGEAKLCTKISEELLSEHNIYVQSINYPTVDIGDERLRIAPTPHHTDKLTEELVDSLCMVWKKYNLPL 504          
BLAST of 5-aminolevulinate synthase vs. TrEMBL
Match: A0A095AFG9 (5-aminolevulinate synthase OS=Schistosoma haematobium OX=6185 GN=MS3_00729 PE=3 SV=1)

HSP 1 Score: 563.533 bits (1451), Expect = 0.000e+0
Identity = 260/397 (65.49%), Postives = 320/397 (80.60%), Query Frame = 1
Query:  388 EFFQSEIDKKKQDNTYRVFKKVLRRADNFPYAKE-KSILNKDVAVWCSNDYLGMSWHPSVMEAAINAIRKHGTGSGGTRNISGNTILHESLEEDLAKLHGKEAALVFTSCYVANEASLHTLGTRLPFVEIFSDSGNHASMIHGIRTSRARKIIYRHNDTKHLDQLLSKTSAGVPKLVAFETVHSMSGNICPVDELLDICEKHGAFSFVDEVHAVGLYGDHGAGVAERDGVMDRIDMISGTLGKAFGNVGGYIAGDKAVVDMIRNYASGFIFTTSLPPHVLAGARKAVDILASDEGRQLRNQHQDVVRTVKSYLQHEGIPVIDCPSHIIPVHVGHAGLCTHLSNEMLQKYNIYVQAINHPTVAVGEERLRIAPSPHHTLPMINELVSAMISLWKENKL 1575
            +FF SE+++KK+D+TYRVF+++LR A  FP+A +  S + + VAVWCSNDYLGMSWHP V EAAI+ IRKHG GSGGTRNISGN++LHESLE +L+ LHGK AALVFTSCYVANEA LHTLGTR+P + + SD+GNHASMIHGIRTSR  KIIYRHND KHL  LL+      PKL+AFETVHSMSG++CP+  LLD+ E + A SFVDEVHAVGLYG HGAGVAERDG M RID I+GTLGKAF ++GGY+AG   +VDMIR+YASGFIFTTSLPPH LA A+ ++ IL S EG++LR +HQ  V  V+  L+  G+PVI+ PSHIIP+HVG A LCT +S E+L ++NIYVQ+IN+PTV +G+ERLRIAP+PHHT  +  ELV ++  +WK+  L
Sbjct:  171 KFFVSEVERKKRDSTYRVFRRILRDASEFPFADDYSSGMKRSVAVWCSNDYLGMSWHPKVQEAAISTIRKHGVGSGGTRNISGNSLLHESLEAELSDLHGKPAALVFTSCYVANEAVLHTLGTRIPELTMISDAGNHASMIHGIRTSRCSKIIYRHNDVKHLTSLLANIPKDSPKLIAFETVHSMSGDVCPLKNLLDVAEANKALSFVDEVHAVGLYGAHGAGVAERDGQMHRIDAITGTLGKAFASIGGYLAGSSELVDMIRSYASGFIFTTSLPPHSLAAAQTSIQILKSSEGKELRAEHQKRVSIVRQSLRQAGLPVIEAPSHIIPLHVGEAKLCTKISEELLSEHNIYVQSINYPTVDIGDERLRIAPTPHHTDKLTEELVDSLCMVWKKYNL 567          
BLAST of 5-aminolevulinate synthase vs. Ensembl Cavefish
Match: alas1 (5'-aminolevulinate synthase 1 [Source:NCBI gene;Acc:103038356])

HSP 1 Score: 474.937 bits (1221), Expect = 1.740e-161
Identity = 224/396 (56.57%), Postives = 300/396 (75.76%), Query Frame = 1
Query:  388 EFFQSEIDKKKQDNTYRVFKKVLRRADNFPYAKEKS---ILNKDVAVWCSNDYLGMSWHPSVMEAAINAIRKHGTGSGGTRNISGNTILHESLEEDLAKLHGKEAALVFTSCYVANEASLHTLGTRLPFVEIFSDSGNHASMIHGIRTSRARKIIYRHNDTKHLDQLLSKTSAGVPKLVAFETVHSMSGNICPVDELLDICEKHGAFSFVDEVHAVGLYGDHGAGVAERDGVMDRIDMISGTLGKAFGNVGGYIAGDKAVVDMIRNYASGFIFTTSLPPHVLAGARKAVDILASDEGRQLRNQHQDVVRTVKSYLQHEGIPVIDCPSHIIPVHVGHAGLCTHLSNEMLQKYNIYVQAINHPTVAVGEERLRIAPSPHHTLPMINELVSAMISLWKE 1566
            +FF+ +I+ KK D+TYRVFK V RRA  FP A + S      +DV+VWCSNDYLGMS HP V+++ ++ +R+HG+G+GGTRNISG +  H +LE +LA LHGK+AAL+FTSC+VAN+++L TL   LP  EI+SD+GNHASMI GI+ S A+K I+RHND +HL +LL K+    PK+VAFETVHSM G +CP++E+ D+  + GA +FVDEVHAVGLYG  G G+ +RDGVM ++D+ISGTLG+  G VGGYIA   A+VD +R+YA+GFIFTTSLPP +L+GAR+++ +L S+EGR LR +HQ  V+ ++  L   G+PV+ CPSHIIPV V +A   T + + M+ ++NIYVQAIN+PTVA GEE LRIAP+PHHT  M+   V  ++  WKE
Sbjct:  174 QFFEKKIEAKKNDHTYRVFKTVNRRATEFPMADDYSESLSSRRDVSVWCSNDYLGMSRHPRVVQSVMDTLRRHGSGAGGTRNISGTSKFHVALEHELADLHGKDAALLFTSCFVANDSTLFTLAKMLPGCEIYSDAGNHASMIQGIKNSGAKKFIFRHNDVQHLRELLEKSDPSTPKIVAFETVHSMDGAVCPLEEMCDVAHEFGAITFVDEVHAVGLYGARGGGIGDRDGVMHKMDIISGTLGERLGCVGGYIASTSALVDTVRSYAAGFIFTTSLPPMLLSGARESIQVLKSEEGRMLRRKHQRNVKLLRQMLMDSGLPVVHCPSHIIPVRVSNAEKNTEICDIMMSRHNIYVQAINYPTVARGEELLRIAPTPHHTPQMMQYFVDKLLQTWKE 569          
BLAST of 5-aminolevulinate synthase vs. Ensembl Cavefish
Match: gcat (glycine C-acetyltransferase [Source:NCBI gene;Acc:103043864])

HSP 1 Score: 212.231 bits (539), Expect = 2.877e-62
Identity = 124/358 (34.64%), Postives = 202/358 (56.42%), Query Frame = 1
Query:  502 NKDVAVWCSNDYLGMSWHPSVMEAAINAIRKHGTGSGGTRNISGNTILHESLEEDLAKLHGKEAALVFTSCYVANEASLHTLGTRLPFVEIFSDSGNHASMIHGIRTSRARKIIYRHNDTKHLDQLLSKTSAGVPKLVAFETVHSMSGNICPVDELLDICEKHGAFSFVDEVHAVGLYGDHGAGVAERDGVMDRIDMISGT-LGKAFGNVGGYIAGDKAVVDMIRNYASGFIFTTSLPPHVLAGARKAVD-ILASDEGRQLRNQHQDVVRTVKSYLQHEGIPVIDCPSHIIPVHVGHAGLCTHLSNEMLQKYNIYVQAINHPTVAVGEERLRIAPSPHHTLPMINELVSAMISLWKEN 1569
            + D+  +C+N+YLG+S HP V++A I A++K+G G    R I G   LH+ LE+ LA+ H +E  +++ SC+ AN      L    P   + SD  NHAS+I GIR  RA+++ Y+H D   L+  L ++ +   +LV  + V SM G++ P+  + D+ E++GA  F+DE HA G  G  G G  E  GVMDR+ +++ T      G  GGY  G K ++D++R  +  ++F+ SLPP V+  A +AV+ +LAS+E  Q  +     +R  ++ +   G  +      I PV +G A L + ++++ML K  +YV   ++P V  G+ R+R+  S  HT   I+  V A I   +++
Sbjct:   75 SADILNFCANNYLGLSSHPEVIQAGIEALQKYGAGLSSVRFICGTQDLHKKLEQKLAQFHEREDCILYASCFDANAGLFEVLLG--PEDAVLSDELNHASIIDGIRLCRAKRLRYKHMDLNDLEDKLKESQSSRLRLVVTDGVFSMDGDVAPLVGICDLAEQYGALVFIDECHATGFLGIRGRGTDELLGVMDRVHIVNSTLGKALGGAAGGYTVGPKPLIDLLRQRSRPYLFSNSLPPPVVGSATRAVELLLASNEIAQ--SMAAKTMR-FRNGMTQAGFTIAGAAHPICPVMLGDARLASLMADDML-KLGVYVIGFSYPVVPKGKARIRVQISAAHTDSDIDRTVDAFIQTGRKH 426          
BLAST of 5-aminolevulinate synthase vs. Ensembl Cavefish
Match: sptlc2a (serine palmitoyltransferase, long chain base subunit 2a [Source:ZFIN;Acc:ZDB-GENE-050522-23])

HSP 1 Score: 146.747 bits (369), Expect = 3.679e-37
Identity = 105/366 (28.69%), Postives = 184/366 (50.27%), Query Frame = 1
Query:  505 KDVAVWCSNDYLGMSWHP-SVMEAAINAIRKHGTGSGGTRNISGNTILHESLEEDLAKLHGKEAALVFTSCYVANEASLHTLGTRLPFVEIFSDSGNHASMIHGIRTSRARKIIYRHNDTKHLDQLLSKTSA-GVPK--------LVAFETVHSMSGNICPVDELLDICEKHGAFSFVDEVHAVGLYGDHGAGVAERDGV-MDRIDMISGTLGKAFGNVGGYIAGDKAVVDMIRNYASGFIFTTSLPPHVLAGARKAVDILASDE----GRQLRNQHQDVVRTVKSYLQHEGIPVI---DCPSHIIPVHVGHAGLCTHLSNEMLQKYNIYVQAINHPTVAVGEERLRIAPSPHHTLPMINELVSAM 1548
            KDV    S +YLG + +  S  EAA     K+G G   TR   GN   HE +E+ +A+  G E+A+ F   +  N  ++  L  +     I SD  NHAS++ G R S +   +++HN+ + L++LL      G P+        L+  E ++SM G+I  + E++ + +K+ A+ ++DE H++G  G  G GV E  G+    +D++ GT  K+FG  GGYI G K ++D +R+++   ++ TS+ P V+     ++  +  ++    GR+   Q  +     +  L+  G  +    D P  ++P+ +           EML++ NI V  +  P   + E R R   S  HT  M+++ ++A+
Sbjct:  239 KDVINMGSYNYLGFAENTGSCAEAAAEVTVKYGVGVSSTRQEMGNLDRHEEMEKLVARFLGVESAMAFGMGFATNSMNIPALTGKGCL--ILSDELNHASLVLGARLSGSTIRVFKHNNMQSLEKLLRDAIVHGQPRTHRPWKKILILVEGIYSMEGSIIRLPEVIALKKKYKAYLYLDEAHSIGALGPSGRGVVEYFGLDPTDVDIMMGTFTKSFGAAGGYIGGKKELIDYLRSHSHSAVYATSMSPPVVEQIITSMKCIMGEDGTTIGRERVQQLAENTVYFRRRLREIGFIIYGNNDSP--VVPLMLYLPAKIGAFGREMLKR-NIGVVVVGFPATPIIESRARFCVSASHTKEMLDQALNAI 599          
BLAST of 5-aminolevulinate synthase vs. Ensembl Cavefish
Match: sptlc2a (serine palmitoyltransferase, long chain base subunit 2a [Source:ZFIN;Acc:ZDB-GENE-050522-23])

HSP 1 Score: 147.132 bits (370), Expect = 3.696e-37
Identity = 105/366 (28.69%), Postives = 184/366 (50.27%), Query Frame = 1
Query:  505 KDVAVWCSNDYLGMSWHP-SVMEAAINAIRKHGTGSGGTRNISGNTILHESLEEDLAKLHGKEAALVFTSCYVANEASLHTLGTRLPFVEIFSDSGNHASMIHGIRTSRARKIIYRHNDTKHLDQLLSKTSA-GVPK--------LVAFETVHSMSGNICPVDELLDICEKHGAFSFVDEVHAVGLYGDHGAGVAERDGV-MDRIDMISGTLGKAFGNVGGYIAGDKAVVDMIRNYASGFIFTTSLPPHVLAGARKAVDILASDE----GRQLRNQHQDVVRTVKSYLQHEGIPVI---DCPSHIIPVHVGHAGLCTHLSNEMLQKYNIYVQAINHPTVAVGEERLRIAPSPHHTLPMINELVSAM 1548
            KDV    S +YLG + +  S  EAA     K+G G   TR   GN   HE +E+ +A+  G E+A+ F   +  N  ++  L  +     I SD  NHAS++ G R S +   +++HN+ + L++LL      G P+        L+  E ++SM G+I  + E++ + +K+ A+ ++DE H++G  G  G GV E  G+    +D++ GT  K+FG  GGYI G K ++D +R+++   ++ TS+ P V+     ++  +  ++    GR+   Q  +     +  L+  G  +    D P  ++P+ +           EML++ NI V  +  P   + E R R   S  HT  M+++ ++A+
Sbjct:  260 KDVINMGSYNYLGFAENTGSCAEAAAEVTVKYGVGVSSTRQEMGNLDRHEEMEKLVARFLGVESAMAFGMGFATNSMNIPALTGKGCL--ILSDELNHASLVLGARLSGSTIRVFKHNNMQSLEKLLRDAIVHGQPRTHRPWKKILILVEGIYSMEGSIIRLPEVIALKKKYKAYLYLDEAHSIGALGPSGRGVVEYFGLDPTDVDIMMGTFTKSFGAAGGYIGGKKELIDYLRSHSHSAVYATSMSPPVVEQIITSMKCIMGEDGTTIGRERVQQLAENTVYFRRRLREIGFIIYGNNDSP--VVPLMLYLPAKIGAFGREMLKR-NIGVVVVGFPATPIIESRARFCVSASHTKEMLDQALNAI 620          
BLAST of 5-aminolevulinate synthase vs. Ensembl Cavefish
Match: sptlc2a (serine palmitoyltransferase, long chain base subunit 2a [Source:ZFIN;Acc:ZDB-GENE-050522-23])

HSP 1 Score: 147.132 bits (370), Expect = 3.696e-37
Identity = 105/366 (28.69%), Postives = 184/366 (50.27%), Query Frame = 1
Query:  505 KDVAVWCSNDYLGMSWHP-SVMEAAINAIRKHGTGSGGTRNISGNTILHESLEEDLAKLHGKEAALVFTSCYVANEASLHTLGTRLPFVEIFSDSGNHASMIHGIRTSRARKIIYRHNDTKHLDQLLSKTSA-GVPK--------LVAFETVHSMSGNICPVDELLDICEKHGAFSFVDEVHAVGLYGDHGAGVAERDGV-MDRIDMISGTLGKAFGNVGGYIAGDKAVVDMIRNYASGFIFTTSLPPHVLAGARKAVDILASDE----GRQLRNQHQDVVRTVKSYLQHEGIPVI---DCPSHIIPVHVGHAGLCTHLSNEMLQKYNIYVQAINHPTVAVGEERLRIAPSPHHTLPMINELVSAM 1548
            KDV    S +YLG + +  S  EAA     K+G G   TR   GN   HE +E+ +A+  G E+A+ F   +  N  ++  L  +     I SD  NHAS++ G R S +   +++HN+ + L++LL      G P+        L+  E ++SM G+I  + E++ + +K+ A+ ++DE H++G  G  G GV E  G+    +D++ GT  K+FG  GGYI G K ++D +R+++   ++ TS+ P V+     ++  +  ++    GR+   Q  +     +  L+  G  +    D P  ++P+ +           EML++ NI V  +  P   + E R R   S  HT  M+++ ++A+
Sbjct:  260 KDVINMGSYNYLGFAENTGSCAEAAAEVTVKYGVGVSSTRQEMGNLDRHEEMEKLVARFLGVESAMAFGMGFATNSMNIPALTGKGCL--ILSDELNHASLVLGARLSGSTIRVFKHNNMQSLEKLLRDAIVHGQPRTHRPWKKILILVEGIYSMEGSIIRLPEVIALKKKYKAYLYLDEAHSIGALGPSGRGVVEYFGLDPTDVDIMMGTFTKSFGAAGGYIGGKKELIDYLRSHSHSAVYATSMSPPVVEQIITSMKCIMGEDGTTIGRERVQQLAENTVYFRRRLREIGFIIYGNNDSP--VVPLMLYLPAKIGAFGREMLKR-NIGVVVVGFPATPIIESRARFCVSASHTKEMLDQALNAI 620          
BLAST of 5-aminolevulinate synthase vs. Ensembl Sea Lamprey
Match: alas2 (aminolevulinate, delta-, synthase 2 [Source:NCBI gene;Acc:64607])

HSP 1 Score: 353.599 bits (906), Expect = 2.939e-119
Identity = 165/295 (55.93%), Postives = 223/295 (75.59%), Query Frame = 1
Query:  586 IRKHGTGSGGTRNISGNTILHESLEEDLAKLHGKEAALVFTSCYVANEASLHTLGTRLPFV------EIFSDSGNHASMIHGIRTSRARKIIYRHNDTKHLDQLLSKTSAGVPKLVAFETVHSMSGNICPVDELLDICEKHGAFSFVDEVHAVGLYGDHGAGVAERDGVMDRIDMISGTLGKAFGNVGGYIAGDKAVVDMIRNYASGFIFTTSLPPHVLAGARKAVDILASDEGRQLRNQHQDVVRTVKSYLQHEGIPVIDCPSHIIPVHVGHAGLCTHLSNEMLQKYNIYVQAI 1452
            ++ HG G+GGTRNISG +  H  LE++LA LHGK+AAL+FTSC+VAN+++L TL   LP +      EI+SD+GNHASMI GIR S   K ++RHND  HL+++L ++    PK+VAFETVHSM G +CP++E+ DI  K+GA +FVDEVHAVGLYG +G G+ +RD VM ++D+I+GTLGKAFG VGGY+A   +++D +R+YA+GFIFTT+LPP VLAGA ++V +L S EG+ LR  HQ  V+ ++  L   G+PVI CPSHIIPV V +A   T +SNE++ ++NIYVQAI
Sbjct:    4 LKMHGAGAGGTRNISGTSRFHVELEKELASLHGKDAALLFTSCFVANDSTLFTLAKMLPVLPHVKGCEIYSDAGNHASMIMGIRNSHVPKFVFRHNDPAHLEEVLKRSDPSTPKIVAFETVHSMDGAVCPLEEMCDIAHKYGAITFVDEVHAVGLYGTNGGGIGDRDNVMHKMDIITGTLGKAFGCVGGYVASTASLIDTVRSYAAGFIFTTALPPMVLAGALESVRVLRSAEGQALRRSHQRNVKYMRQLLMDAGLPVIHCPSHIIPVLVANAAKNTEISNELMAQHNIYVQAI 298          
BLAST of 5-aminolevulinate synthase vs. Ensembl Sea Lamprey
Match: sptlc2a (serine palmitoyltransferase, long chain base subunit 2a [Source:ZFIN;Acc:ZDB-GENE-050522-23])

HSP 1 Score: 155.606 bits (392), Expect = 1.613e-41
Identity = 112/385 (29.09%), Postives = 193/385 (50.13%), Query Frame = 1
Query:  442 FKKVLRRADNFPYAKEKSILNKDVAVWCSNDYLGMSWHPS-VMEAAINAIRKHGTGSGGTRNISGNTILHESLEEDLAKLHGKEAALVFTSCYVANEASLHTLGTRLPFVEIFSDSGNHASMIHGIRTSRARKIIYRHNDTKHLDQLLSKTSA-GVPK--------LVAFETVHSMSGNICPVDELLDICEKHGAFSFVDEVHAVGLYGDHGAGVAERDGVMDR-IDMISGTLGKAFGNVGGYIAGDKAVVDMIRNYASGFIFTTSLPPHVLAGARKAVDILASDEGRQLRNQH----QDVVRTVKSYLQHEG-IPVIDCPSHIIPVHVGHAGLCTHLSNEMLQKYNIYVQAINHPTVAVGEERLRIAPSPHHTLPMINELVSAM 1548
            FK + R  D++ +    +   KDV    S +YLG + +     EAA    +K+G G   TR   GN   HE LE+ +A+  G EAA+ F   +  N  ++  L  +     I SD  NHAS++ G R S A   +++HND  +L++LL      G P+        L+  E ++SM G+I  + E++ + +++ A+ ++DE H++G  G  G GV E  G+  + +D++ GT  K+FG  GGYI G K +VD +R  +   ++ TS+ P ++    +++  +  ++G  L  Q      +  R  +  ++  G I   +  S ++PV +           EM+++ NI V  +  P   + E R R   S  HT  M++E ++A+
Sbjct:   94 FKVMERVTDDYNWNFRFTGRVKDVINMGSYNYLGFAENVGPCTEAAAQVAQKYGVGVCSTRQEMGNLDKHEELEKLVARFLGVEAAMAFGMGFATNSMNIPALVGKGCL--ILSDELNHASLVLGARLSTATIRVFKHNDMVNLEKLLRDAIVNGQPRTHRPWKKILILVEGIYSMEGSIVRLPEVVALKKRYKAYLYLDEAHSIGAVGPTGRGVVEYFGLHPQDVDVLMGTFTKSFGACGGYIGGRKDLVDYLRMNSHSAVYATSMSPPIIEQILQSMKCIMGEDGTTLGAQRIRQLAENTRYFRRRIREMGFITYGNEDSPVVPVMLYMPAKIGAFGREMMKR-NIGVVVVGFPATPIIESRARFCISAAHTREMLDETLAAV 475          
BLAST of 5-aminolevulinate synthase vs. Ensembl Sea Lamprey
Match: sptlc1 (serine palmitoyltransferase, long chain base subunit 1 [Source:ZFIN;Acc:ZDB-GENE-050522-61])

HSP 1 Score: 104.375 bits (259), Expect = 4.291e-24
Identity = 66/249 (26.51%), Postives = 127/249 (51.00%), Query Frame = 1
Query:  502 NKDVAVWCSNDYLGMSWHPSVMEAAINAIRKHGTGSGGTRNISGNTILHESLEEDLAKLHGKEAALVFTSCYVANEASLHTLGTRLPFVEIFSDSGNHASMIHGIRTSRARKIIYRHNDTKHLDQLLS----------KTSAGVPKLVAFETVHSMSGNICPVDELLDICEKHGAFSFVDEVHAVGLYGDHGAGVAERDGV-MDRIDMISGTLGKAFGNVGGYIAGDKAVVDMIRNYASGFIFTTSLPP 1215
            +K+     S ++LG+  +  V + A+ ++ K+G G+ G R   G   +H  LEE +A+    E A+++   +    +++     R     I+       ++  G++ SR+    +RHND   L++LL           K ++ V + +  E +++ +G++CP+ +L+ +  ++    F++E  + G+ G+ G GV E  GV +D ID+IS  +  A  ++GG+  G   V+D  R    G+ F+ SLPP
Sbjct:   98 DKECINLASFNFLGLLSNKRVKKVALESLAKYGVGTCGPRGFYGTFDVHLELEEQIARFMRCEEAIIYAYGFSTIASAIPAYSKRGDI--IYVSKAVCFAIQKGLQASRSNVKYFRHNDVADLERLLQQQQQEDRKNPKKASVVRRFLVVEGLYTNTGDVCPLPDLVRLKYQYKVRIFLEESLSFGVLGETGRGVTEHFGVNIDDIDLISANMENALASIGGFCCGRSFVIDHQRLSGQGYCFSASLPP 344          
BLAST of 5-aminolevulinate synthase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010740.1 (pep scaffold:Pmarinus_7.0:GL476415:242415:246378:1 gene:ENSPMAG00000009729.1 transcript:ENSPMAT00000010740.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 74.3294 bits (181), Expect = 4.127e-15
Identity = 35/63 (55.56%), Postives = 47/63 (74.60%), Query Frame = 1
Query:  388 EFFQSEIDKKKQDNTYRVFKKVLRRADNFPYAKEKS---ILNKDVAVWCSNDYLGMSWHPSVM 567
            +FF  +I+ K +D+TYR+FK V RRAD+FPYA + +      K+V+VWCSNDYLGMS HP V+
Sbjct:  205 KFFTGKIEVKLRDHTYRMFKTVNRRADSFPYAHDFTDSLSEAKEVSVWCSNDYLGMSRHPRVV 267          
BLAST of 5-aminolevulinate synthase vs. Ensembl Yeast
Match: HEM1 (5-aminolevulinate synthase; catalyzes the first step in the heme biosynthetic pathway; an N-terminal signal sequence is required for localization to the mitochondrial matrix; expression is regulated by Hap2p-Hap3p; has a pyridoxal phosphate cofactor whose insertion is mediated by Mcx1p [Source:SGD;Acc:S000002640])

HSP 1 Score: 381.333 bits (978), Expect = 1.023e-126
Identity = 198/417 (47.48%), Postives = 268/417 (64.27%), Query Frame = 1
Query:  391 FFQSEIDKKKQDNTYRVFKKVLRRADNFPYAKEKSILNKDVAVWCSNDYLGMSWHPSVMEAAINAIRKHGTGSGGTRNISGNTILHESLEEDLAKLHGKEAALVFTSCYVANEASLHTLGTRLPFVEIFSDSGNHASMIHGIRTSRARKIIYRHNDTKHLDQLLSKTSAGVPKLVAFETVHSMSGNICPVDELLDICEKHGAFSFVDEVHAVGLYGDHGAGVAER----------------------DGVMDRIDMISGTLGKAFGNVGGYIAGDKAVVDMIRNYASGFIFTTSLPPHVLAGARKAVDILASDEGRQLRNQHQDVVRTVKSYLQHEGIPVIDCPSHIIPVHVGHAGLCTHLSNEMLQKYNIYVQAINHPTVAVGEERLRIAPSPHHTLPMINELVSAMISLWKENKL 1575
               SE+ KK+ D +YR F  + R A  FP A  +   +K V VWCSNDYL +S HP V++A    I K+G G+GGTRNI+G+ I   +LE +LA LH KE ALVF+SCYVAN+A L  LG ++  + IFSD  NHASMI GI+ +  +K I++HND   L+QLL      VPKL+AFE+V+SM+G++  ++++ D+ +K+GA +F+DEVHAVGLYG HGAGVAE                         VMDR+DMI+GTLGK+FG+VGGY+A  + ++D  R++A GFIFTT+LPP V+AGA  A+          LR   Q     VK      GIPVI  PSHI+PV +G+A L    S+ ++ K+ IYVQAIN PTVA G ERLRI P+P HT  + + L++A+  ++ E +L
Sbjct:   76 LIDSELQKKRLDKSYRYFNNINRLAKEFPLAHRQREADK-VTVWCSNDYLALSKHPEVLDAMHKTIDKYGCGAGGTRNIAGHNIPTLNLEAELATLHKKEGALVFSSCYVANDAVLSLLGQKMKDLVIFSDELNHASMIVGIKHANVKKHIFKHNDLNELEQLLQSYPKSVPKLIAFESVYSMAGSVADIEKICDLADKYGALTFLDEVHAVGLYGPHGAGVAEHCDFESHRASGIATPKTNDKGGAKTVMDRVDMITGTLGKSFGSVGGYVAASRKLIDWFRSFAPGFIFTTTLPPSVMAGATAAIRYQRCH--IDLRTSQQKHTMYVKKAFHELGIPVIPNPSHIVPVLIGNADLAKQASDILINKHQIYVQAINFPTVARGTERLRITPTPGHTNDLSDILINAVDDVFNELQL 489          
BLAST of 5-aminolevulinate synthase vs. Ensembl Yeast
Match: LCB2 (Component of serine palmitoyltransferase; responsible along with Lcb1p for the first committed step in sphingolipid synthesis, which is the condensation of serine with palmitoyl-CoA to form 3-ketosphinganine [Source:SGD;Acc:S000002469])

HSP 1 Score: 136.732 bits (343), Expect = 8.330e-35
Identity = 105/354 (29.66%), Postives = 173/354 (48.87%), Query Frame = 1
Query:  526 SNDYLGMSWHP-SVMEAAINAIRKHGTGSGGTRNISGNTILHESLEEDLAKLHGKEAALVFTSCYVANEASLHTLGTRLPFVEIFSDSGNHASMIHGIRTSRARKIIYRHNDTKHLDQLL-SKTSAGVPK--------LVAFETVHSMSGNICPVDELLDICEKHGAFSFVDEVHAVGLYGDHGAGVAERDGVMDR-IDMISGTLGKAFGNVGGYIAGDKAVVDMIRNYASGFIFTTSLPPHVLAGARKAVDILASD----EGRQLRNQHQDVVRTVKSYLQHEGIPVIDCP-SHIIPVHVGHAGLCTHLSNEMLQKYNIYVQAINHPTVAVGEERLRIAPSPHHTLPMINELV 1539
            S +YLG +       +AA+ ++ K+   SGG R   G T LH   E+ +A+  GKE ALVF+  Y  N    +    +   V   SD  NH S+  G+R S A    ++H D   L++L+  +   G PK        L+  E + SM G +C + +L+++ +K+  + F+DE H++G  G  G GV E  GV  + +D++ GT  K+FG  GGYIA D+ ++D +R   +   ++ S+P  VLA    ++  ++ +    +G +   +     R ++  LQ  G  V     S +IP+ +         S  MLQ+  I V  + +P   + E R+R   S   T   I+ L+
Sbjct:  162 SYNYLGFAQSKGQCTDAALESVDKYSIQSGGPRAQIGTTDLHIKAEKLVARFIGKEDALVFSMGYGTNANLFNAFLDKKCLV--ISDELNHTSIRTGVRLSGAAVRTFKHGDMVGLEKLIREQIVLGQPKTNRPWKKILICAEGLFSMEGTLCNLPKLVELKKKYKCYLFIDEAHSIGAMGPTGRGVCEIFGVDPKDVDILMGTFTKSFGAAGGYIAADQWIIDRLRLDLTTVSYSESMPAPVLAQTISSLQTISGEICPGQGTERLQRIAFNSRYLRLALQRLGFIVYGVADSPVIPLLLYCPSKMPAFSRMMLQR-RIAVVVVAYPATPLIESRVRFCMSASLTKEDIDYLL 512          
BLAST of 5-aminolevulinate synthase vs. Ensembl Yeast
Match: LCB1 (Component of serine palmitoyltransferase; responsible along with Lcb2p for the first committed step in sphingolipid synthesis, which is the condensation of serine with palmitoyl-CoA to form 3-ketosphinganine [Source:SGD;Acc:S000004911])

HSP 1 Score: 105.916 bits (263), Expect = 1.416e-24
Identity = 68/258 (26.36%), Postives = 125/258 (48.45%), Query Frame = 1
Query:  526 SNDYLGMSWHPSVMEAAINAIRKHGTGSGGTRNISGNTILHESLEEDLAKLHGKEAALVFTSCYVANEASLHTLGTRLPFVEIFSDSGNHASMIHGIRTSRARKIIYRHNDTKHLDQLLSKTS--------AGVP-KLVAFETVHSMSGNICPVDELLDICEKHGAFSFVDEVHAVGLYGDHGAGVAERDGVMDR---IDMISGTLGKAFGNVGGYIAGDKAVVDMIRNYASGFIFTTSLPPHVLAGARKAVDILASD 1263
            SN++L +S    V E     I+ +G G+ G     GN  +H +LE DLA+  G + ++++   + A  + L     R     I +D      + + ++ SR+    + HND   L+ LL++ +          +P K +  E +   SG++ P+ EL  +  K+    FVDE  ++G+ G  G G++E    MDR   ID+  G++  A G+ GG++ GD  +    R  ++ + F+  LP + +    K + ++ S+
Sbjct:  152 SNNFLQLSATEPVKEVVKTTIKNYGVGACGPAGFYGNQDVHYTLEYDLAQFFGTQGSVLYGQDFCAAPSVLPAFTKRGDV--IVADDQVSLPVQNALQLSRSTVYYFNHNDMNSLECLLNELTEQEKLEKLPAIPRKFIVTEGIFHNSGDLAPLPELTKLKNKYKFRLFVDETFSIGVLGATGRGLSEHFN-MDRATAIDITVGSMATALGSTGGFVLGDSVMCLHQRIGSNAYCFSACLPAYTVTSVSKVLKLMDSN 406          
BLAST of 5-aminolevulinate synthase vs. Ensembl Nematostella
Match: EDO46206 (5-aminolevulinate synthase [Source:UniProtKB/TrEMBL;Acc:A7RQQ4])

HSP 1 Score: 513.842 bits (1322), Expect = 2.363e-178
Identity = 261/507 (51.48%), Postives = 345/507 (68.05%), Query Frame = 1
Query:   73 CPFLLKLPLNLVKNEAQRVIVKSGPKCPVFSRYLSNDLTNNKKDEVNSSSLNENIVESSVNLSNQMNVCPHPTQNTDKYDVEPAKFLPAKQIXXXXXXXXXXXXMEFFQSEIDKKKQDNTYRVFKKVLRRADNFPYAKEKS-ILNKDVAVWCSNDYLGMSWHPSVMEAAINAIRKHGTGSGGTRNISGNTILHESLEEDLAKLHGKEAALVFTSCYVANEASLHTLGTRLPFVEIFSDSGNHASMIHGIRTSRARKIIYRHNDTKHLDQLLSKTSAGVPKLVAFETVHSMSGNICPVDELLDICEKHGAFSFVDEVHAVGLYGDHGAGVAERDGVMDRIDMISGTLGKAFGNVGGYIAGDKAVVDMIRNYASGFIFTTSLPPHVLAGARKAVDILASDEGRQLRNQHQDVVRTVKSYLQHEGIPVIDCPSHIIPVHVGHAGLCTHLSNEMLQKYNIYVQAINHPTVAVGEERLRIAPSPHHTLPMINELVSAMISLWKENKLSFYNQ 1590
            CPFL ++P   ++   + V++     CPV S+ L +++T N         LN  + +     S  +  C     +    +V  A F+  K         + ++Y +FF+ EI KKK D+TYRVFKKV R A  FP+A+E S   NKD++VWCSNDYLGMS HP V++ A   I  HG G+GGTRNISG +  HE LE+ LA+LH KEAAL+FTSCYVAN+ +L+TLG  LP   IFSD+GNHASMI GIR S A+K I+RHND +HL +LL+      PK+VAFETVHSM+G+I P+ +L D+  K+GA +FVDEVHAVGLYG HG GV ERDG++  +D+ISGTLGKAFG +GGYIAG  +++D IR+Y +GFIFTT+LPP  +  A K+++IL+ DEGR LR  HQ VV  +++ L   G+PV+  PSHIIP+HVG AG CT +SN+++ K+NIY QAIN+PTVA GEERLRIAP+P HT PM+      +  +W +N L   NQ
Sbjct:   10 CPFLARMPSTFIRKARESVLLSYAETCPVMSKVLDSNMTPN---------LNIPLAQFGSPGSIPVFRCTLKNIHCRADEVSIAIFVEKKM------HQAHFEYEKFFEGEIQKKKADDTYRVFKKVNRLAKAFPHAQEFSGAANKDISVWCSNDYLGMSRHPEVLKVARETIDVHGVGAGGTRNISGTSSYHEQLEKVLAQLHQKEAALLFTSCYVANDTTLYTLGKHLPGCLIFSDAGNHASMIQGIRNSGAKKFIFRHNDPEHLGKLLAAADPAAPKIVAFETVHSMTGDISPIKQLCDVAHKYGALTFVDEVHAVGLYGHHGGGVGERDGLLADMDIISGTLGKAFGVIGGYIAGTASLIDTIRSYGAGFIFTTALPPITVKSAIKSIEILSGDEGRDLRRVHQSVVARLRNKLVQRGLPVVYAPSHIIPIHVGDAGKCTQVSNDLMSKHNIYAQAINYPTVAKGEERLRIAPTPMHTEPMMEHFADVLTQVWLDNGLELLNQ 501          
BLAST of 5-aminolevulinate synthase vs. Ensembl Nematostella
Match: EDO27220 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T9V2])

HSP 1 Score: 207.608 bits (527), Expect = 1.544e-61
Identity = 119/355 (33.52%), Postives = 195/355 (54.93%), Query Frame = 1
Query:  520 WCSNDYLGMSWHPSVMEAAINAIRKHGTGSGGTRNISGNTILHESLEEDLAKLHGKEAALVFTSCYVANEASLHTLGTRLPFVEIFSDSGNHASMIHGIRTSRARKIIYRHNDTKHLD-QLLSKTSAG-VPKLVAFETVHSMSGNICPVDELLDICEKHGAFSFVDEVHAVGLYGDHGAGVAERDGVMDRIDMISGTLGKAFGN-VGGYIAGDKAVVDMIRNYASGFIFTTSLPPHVLAGARKAVDILASDEGRQLRNQHQDVVRTVKSYLQHEGIPVIDCPSHIIPVHVGHAGLCTHLSNEMLQKYNIYVQAINHPTVAVGEERLRIAPSPHHTLPMINELVSAMISLWKENKL 1575
            +C+N+YLG+S HP V++AA +A+  HG G    R I G   +H+ LE+ +A+ +G E  +++ + + AN      L        I SDS NHAS+I G+R  +A +  Y++ND   L+ QL+  T AG   KL+  + V SM G + P+D++ D+ +K+ A   VDE HA G  G  G G  E   VM R+D+I+GT GKA G  +GGY    K +++++R  +  ++F+ SL P ++  + K  ++L  D    LR++ +      K  ++  G  +ID  + I+PV +  A L   ++ E+L+K  IYV     P V   + R+R+  S  HT   ++  + A + + K  K+
Sbjct:   40 FCANNYLGLSSHPEVVQAAKDALDSHGFGMSSVRFICGTQDIHKELEQKVAQFYGTEDTILYAAAFDANGGVFEPLLGEQDC--IISDSLNHASIIDGVRLCKAARYRYQNNDMNDLEAQLIKATEAGHRFKLIVTDGVFSMDGLVAPLDKICDLADKYEAMVMVDECHAAGFIGATGKGTLEAKNVMGRVDIITGTFGKALGGAMGGYTTAKKEIIEILRQRSRPYLFSNSLAPSIVGASLKVFELLEKD--TSLRDKLEWNTNYFKEGMKKAGFDIIDGDAAIVPVMLYDAKLSQTMAEELLKK-GIYVIGFFFPVVPKEKARIRVQLSAAHTKEHLDIAIKAFVEVGKSLKI 389          
BLAST of 5-aminolevulinate synthase vs. Ensembl Nematostella
Match: EDO38490 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SCT4])

HSP 1 Score: 207.994 bits (528), Expect = 2.391e-61
Identity = 129/365 (35.34%), Postives = 199/365 (54.52%), Query Frame = 1
Query:  481 AKEKSILNKDVAVWCSNDYLGMSWHPSVMEAAINAIRKHGTGSGGTRNISGNTILHESLEEDLAKLHGKEAALVFTSCYVANEASLHTLGTRLPFVEIFSDSGNHASMIHGIRTSRARKIIYRHNDTKHLDQLLSKTSAGVPKLVAFETVHSMSGNICPVDELLDICEKHGAFSFVDEVHAVGLYGDHGAGVAERDGVMDRIDMISGTLGKAFGNVGGYIAGDKA-VVDMIRNYASGFIFTTSLPPHVLAGARKAVDILASDEGRQLRNQHQDVVRTVKSYLQHEGIPVIDCPSH--IIPVHVGHAGLCTHLSNEMLQKYNIYVQAINHPTVAVGEERLRIAPSPHHTLPMINELVSAMISLWKE 1566
             +E  ILN     +C+N+YLG+S +  V+ AA  A+ K+G G    R I G   +H++LE  ++K HG E A+++  CY AN     +L T    V  FSD  NHASMI GIR  RA+K  Y+H D + L++ L +      KL+A + V SM G++ P+ E+ D+ +K+GA  F+DE HA G  GD G G  E  G   R+D+I+ TLGKA G   G      + +V M+R  +  ++++ +LPP V+  A K +D+L   +G +L  +  D     ++ +   G  +    +   I P+ +G + L    +NEML++  IYV  I +PTV  G  R+R+  S  H+   I+  V   I + K+
Sbjct:   53 GRESKILN-----FCANNYLGLSSNAEVVNAAKEALMKYGNGLSSVRFICGTQDIHKTLEAKISKFHGMEDAILYACCYDANTGLFESLLTAEDAV--FSDELNHASMIDGIRLCRAKKFKYKHIDVQDLEEKLKEADGARIKLIASDGVFSMDGSMAPLPEICDLADKYGALVFIDECHATGFLGDTGRGTDEYTGTRGRVDIINSTLGKALGGAAGGYTTGPSQLVQMLRQKSRPYLYSNTLPPAVVGSATKVLDMLM--DGSELSKKLADNTSYFRTKMTQAGFNIKGGANGHPITPIMLGDSKLAMDFANEMLER-GIYVVGIVYPTVPRGTGRIRVQLSAGHSKEEIDTCVQTFIDVGKD 407          
BLAST of 5-aminolevulinate synthase vs. Ensembl Nematostella
Match: EDO42990 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZR1])

HSP 1 Score: 139.813 bits (351), Expect = 1.388e-35
Identity = 101/357 (28.29%), Postives = 179/357 (50.14%), Query Frame = 1
Query:  526 SNDYLGMSWHPSV-MEAAINAIRKHGTGSGGTRNISGNTILHESLEEDLAKLHGKEAALVFTSCYVANEASLHTLGTRLPFVEIFSDSGNHASMIHGIRTSRARKIIYRHNDTKHLD-QLLSKTSAGVPK--------LVAFETVHSMSGNICPVDELLDICEKHGAFSFVDEVHAVGLYGDHGAGVAERDGVMDR-IDMISGTLGKAFGNVGGYIAGDKAVVDMIRNYASGFIFTTSLPPHVLAGARKAVDILASDEGRQLRNQHQDVV----RTVKSYLQHEGIPVID-CPSHIIPVHVGHAGLCTHLSNEMLQKYNIYVQAINHPTVAVGEERLRIAPSPHHTLPMINELVSAM 1548
            S +YLG + +  +  + A  ++ K+G      R+  G   +H  LE+ +A+  GKE+A+VF   +  N  ++  L ++     I SD  NH+S++ G R S A   +++HND K L+ +L +    G P+        L+  E V+SM G++  + E++ I +K+ A+ ++DE H++G  G  G GV+E  GV    ID++ GT  K+FG  GGYIA  K +++ IR  +    + +S+ P V      ++ I+  ++G  L  Q    +    R  +  L+  G  +     S ++P+ +           EML++  I V  +  P   + E R R   S  HT  M+++ ++A+
Sbjct:  157 SYNYLGFAENEGLCADEAEKSVHKNGIAVCSARHEFGTLDIHIELEKMVARFVGKESAMVFGMGFATNSTNIPVLVSKGDL--IISDELNHSSLVLGARLSGATIKVFKHNDIKSLENKLRTSVVQGQPRTHRPWRKILIIVEGVYSMEGSLVRLPEIVAIKKKYKAYLYLDEAHSIGAVGPTGRGVSEYFGVNPADIDIMMGTFTKSFGAAGGYIASSKEIINHIRGCSHSAAYASSMSPPVTLQIYTSMKIILGEDGTNLGKQRIQALAENTRYFRCRLKELGFIIYGHDESPVVPLLLYMPAKIAAFGREMLKR-KIGVVVVGFPATPIIESRARFCLSAAHTREMLDQALAAI 510          
BLAST of 5-aminolevulinate synthase vs. Ensembl Nematostella
Match: EDO36082 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJP9])

HSP 1 Score: 111.694 bits (278), Expect = 2.729e-26
Identity = 76/257 (29.57%), Postives = 132/257 (51.36%), Query Frame = 1
Query:  532 DYLGMSWHPSVMEAAINAIRKHGTGSGGTRNISGNTILHESLEEDLAKLHGKEAALVFTSCYVANEASLHTLGTRLPFVEIFSDSGNHASMIHGIRTSRARKIIYRHNDTKHLDQLLS----------KTSAGVPKLVAFETVHSMSGNICPVDELLDICEKHGAFSFVDEVHAVGLYGDHGAGVAER-DGVMDRIDMISGTLGKAFGNVGGYIAGDKAVVDMIRNYASGFIFTTSLPPHVLAGARKAVDILASDEG 1269
            ++LG   +P +  +AI+ +RK+G GS G R   G+  +H  LEE LAK    E A++++  +    +++     R     +F D G   ++  G+  SR+R + + HND   L++LL           K  +   + +  E ++   G I P+ +LL++ +K+     VDE  + G+ G  G GV E  D  +D +D+IS ++  +   +GG+  G   VVD  R   +G+ F+ SLPP +   A +A+DI+   +G
Sbjct:  102 NFLGFVGNPRIESSAIDTLRKYGVGSCGPRGFYGSIDVHLHLEERLAKFMHTEEAILYSYGFSTVASAIPAYSKRGDV--LFCDKGVCFAIQQGVTASRSRVMWFEHNDMDDLERLLKEQQEKDRKNPKKGSVTRRFLIVEGLYINHGTIAPLPKLLELKKKYKVRILVDESCSFGVLGKTGRGVTEYYDIPVDDVDLISVSMENSLATIGGFCCGTSFVVDHQRLSGAGYCFSASLPPMLATAAIEALDIMEEKDG 356          
BLAST of 5-aminolevulinate synthase vs. Ensembl Medaka
Match: alas2 (5-aminolevulinate synthase, erythroid-specific, mitochondrial [Source:NCBI gene;Acc:100049501])

HSP 1 Score: 505.368 bits (1300), Expect = 5.266e-174
Identity = 257/531 (48.40%), Postives = 349/531 (65.73%), Query Frame = 1
Query:   73 CPFLLKLPLNLVKNEAQRVIVKSGPKCPVFSRY------------LSNDLTNNKKDEVNSSSLNENIVESSVNLSNQMN-VCPHPTQNT--------------DKYDVEPAKFLPAKQIXXXXXXXXXXXXMEFFQSEIDKKKQDNTYRVFKKVLRRADNFPYAKEKSILNK---DVAVWCSNDYLGMSWHPSVMEAAINAIRKHGTGSGGTRNISGNTILHESLEEDLAKLHGKEAALVFTSCYVANEASLHTLGTRLPFVEIFSDSGNHASMIHGIRTSRARKIIYRHNDTKHLDQLLSKTSAGVPKLVAFETVHSMSGNICPVDELLDICEKHGAFSFVDEVHAVGLYGDHGAGVAERDGVMDRIDMISGTLGKAFGNVGGYIAGDKAVVDMIRNYASGFIFTTSLPPHVLAGARKAVDILASDEGRQLRNQHQDVVRTVKSYLQHEGIPVIDCPSHIIPVHVGHAGLCTHLSNEMLQKYNIYVQAINHPTVAVGEERLRIAPSPHHTLPMINELVSAMISLWKENKL 1575
            CPFL   P   ++     ++     KCP+ +R             LS+  T +K D+V +        +++ +++  M+  CP  +                 D Y      FL A +I S       Y    FF  +I +KK+D+TYRVFK V RRA+ FP+A++ SI  +    V+VWCSNDYLGMS HP V+ A   A+  +G G+GGTRNISG +  H +LE +LA+LHGK+AALVF+SC+VAN+++L TL   LP  EI+SD+GNHASMI GIR S A++ I+RHND +HL++LL ++    PK+VAFETVHSM G ICP++EL D   ++GA +FVDEVHAVGLYG HGAGV ERD +M +ID++SGTLGKAFG VGGY+A   A+VD +R+YA+GFIFTT+LPP VLAGA ++V IL S EG+ LR  HQ  V+ ++  L  +G+PV++CPSHIIP+ VG+A L T + + +L+KYNIYVQAIN+PTV  GEE LR+APSPHH   M+   V  ++ +W+E  L
Sbjct:    8 CPFLKSAPKPALRRTGASLL-SLAEKCPIITRQITVSSPASLDSKLSSHTTRSKSDQVFTVEQKRRFAQTATHVAASMSKACPFVSSQIGVVQASPEVQEDVKDAYGSSTCCFLTAVKILSSVGPSYDYD--HFFTEKISEKKKDHTYRVFKTVNRRANTFPFAEDYSIPERAGAQVSVWCSNDYLGMSRHPKVLGAIREALENYGAGAGGTRNISGTSNFHVALERELAQLHGKDAALVFSSCFVANDSTLFTLAKMLPGCEIYSDAGNHASMIQGIRNSGAKRFIFRHNDRRHLEELLQRSDPKTPKIVAFETVHSMDGAICPLEELCDAAHRYGALTFVDEVHAVGLYGAHGAGVGERDNIMHKIDIVSGTLGKAFGCVGGYVASSGALVDTVRSYAAGFIFTTALPPMVLAGALESVRILKSAEGQVLRRAHQRNVKHMRQLLMDKGLPVVNCPSHIIPIRVGNAELNTKVCDILLEKYNIYVQAINYPTVPRGEELLRLAPSPHHEPDMMEYFVGKLVEVWQEAGL 535          
BLAST of 5-aminolevulinate synthase vs. Ensembl Medaka
Match: alas2 (5-aminolevulinate synthase, erythroid-specific, mitochondrial [Source:NCBI gene;Acc:100049501])

HSP 1 Score: 498.049 bits (1281), Expect = 7.819e-171
Identity = 255/543 (46.96%), Postives = 349/543 (64.27%), Query Frame = 1
Query:   73 CPFLLKLPLNLVKNEAQRVIVKSGPKCPVFSRY------------LSNDLTNNKKDEVNSSSLNENIVESSVNLSNQMN-VCPHPTQNTDKYDVEPA--------------KFLPAKQIXXXXXXXXXXXXME------------FFQSEIDKKKQDNTYRVFKKVLRRADNFPYAKEKSILNK---DVAVWCSNDYLGMSWHPSVMEAAINAIRKHGTGSGGTRNISGNTILHESLEEDLAKLHGKEAALVFTSCYVANEASLHTLGTRLPFVEIFSDSGNHASMIHGIRTSRARKIIYRHNDTKHLDQLLSKTSAGVPKLVAFETVHSMSGNICPVDELLDICEKHGAFSFVDEVHAVGLYGDHGAGVAERDGVMDRIDMISGTLGKAFGNVGGYIAGDKAVVDMIRNYASGFIFTTSLPPHVLAGARKAVDILASDEGRQLRNQHQDVVRTVKSYLQHEGIPVIDCPSHIIPVHVGHAGLCTHLSNEMLQKYNIYVQAINHPTVAVGEERLRIAPSPHHTLPMINELVSAMISLWKENKL 1575
            CPFL   P   ++     ++     KCP+ +R             LS+  T +K D+V +        +++ +++  M+  CP  +         P               K L A   PS +   +    +             FF  +I +KK+D+TYRVFK V RRA+ FP+A++ SI  +    V+VWCSNDYLGMS HP V+ A   A+  +G G+GGTRNISG +  H +LE +LA+LHGK+AALVF+SC+VAN+++L TL   LP  EI+SD+GNHASMI GIR S A++ I+RHND +HL++LL ++    PK+VAFETVHSM G ICP++EL D   ++GA +FVDEVHAVGLYG HGAGV ERD +M +ID++SGTLGKAFG VGGY+A   A+VD +R+YA+GFIFTT+LPP VLAGA ++V IL S EG+ LR  HQ  V+ ++  L  +G+PV++CPSHIIP+ VG+A L T + + +L+KYNIYVQAIN+PTV  GEE LR+APSPHH   M+   V  ++ +W+E  L
Sbjct:    8 CPFLKSAPKPALRRTGASLL-SLAEKCPIITRQITVSSPASLDSKLSSHTTRSKSDQVFTVEQKRRFAQTATHVAASMSKACPFVSSQIGVVQASPEVQEDVKDGLMKSLLKGLKASMFPSGADLNTVTHLLRDNMVGPSYDYDHFFTEKISEKKKDHTYRVFKTVNRRANTFPFAEDYSIPERAGAQVSVWCSNDYLGMSRHPKVLGAIREALENYGAGAGGTRNISGTSNFHVALERELAQLHGKDAALVFSSCFVANDSTLFTLAKMLPGCEIYSDAGNHASMIQGIRNSGAKRFIFRHNDRRHLEELLQRSDPKTPKIVAFETVHSMDGAICPLEELCDAAHRYGALTFVDEVHAVGLYGAHGAGVGERDNIMHKIDIVSGTLGKAFGCVGGYVASSGALVDTVRSYAAGFIFTTALPPMVLAGALESVRILKSAEGQVLRRAHQRNVKHMRQLLMDKGLPVVNCPSHIIPIRVGNAELNTKVCDILLEKYNIYVQAINYPTVPRGEELLRLAPSPHHEPDMMEYFVGKLVEVWQEAGL 549          
BLAST of 5-aminolevulinate synthase vs. Ensembl Medaka
Match: alas2 (5-aminolevulinate synthase, erythroid-specific, mitochondrial [Source:NCBI gene;Acc:100049501])

HSP 1 Score: 493.041 bits (1268), Expect = 1.192e-169
Identity = 250/514 (48.64%), Postives = 340/514 (66.15%), Query Frame = 1
Query:   73 CPFLLKLPLNLVKNEAQRVIVKSGPKCPVFSRYL-------SNDLTNNKKDEVNSSSLNENIVESSVNLSNQMNVCPHPTQNT---DKYDVEPAKFLPAKQIXXXXXXXXXXXXMEFFQSEIDKKKQDNTYRVFKKVLRRADNFPYAKEKSILNK---DVAVWCSNDYLGMSWHPSVMEAAINAIRKHGTGSGGTRNISGNTILHESLEEDLAKLHGKEAALVFTSCYVANEASLHTLGTRLPFVEIFSDSGNHASMIHGIRTSRARKIIYRHNDTKHLDQLLSKTSAGVPKLVAFETVHSMSGNICPVDELLDICEKHGAFSFVDEVHAVGLYGDHGAGVAERDGVMDRIDMISGTLGKAFGNVGGYIAGDKAVVDMIRNYASGFIFTTSLPPHVLAGARKAVDILASDEGRQLRNQHQDVVRTVKSYLQHEGIPVIDCPSHIIPVHVGHAGLCTHLSNEMLQKYNIYVQAINHPTVAVGEERLRIAPSPHHTLPMINELVSAMISLWKENKL 1575
            CPFL   P   ++     ++     KCP+ +R +       S ++  + KD +  S L + +  S       +N   H  ++      YD +                        FF  +I +KK+D+TYRVFK V RRA+ FP+A++ SI  +    V+VWCSNDYLGMS HP V+ A   A+  +G G+GGTRNISG +  H +LE +LA+LHGK+AALVF+SC+VAN+++L TL   LP  EI+SD+GNHASMI GIR S A++ I+RHND +HL++LL ++    PK+VAFETVHSM G ICP++EL D   ++GA +FVDEVHAVGLYG HGAGV ERD +M +ID++SGTLGKAFG VGGY+A   A+VD +R+YA+GFIFTT+LPP VLAGA ++V IL S EG+ LR  HQ  V+ ++  L  +G+PV++CPSHIIP+ VG+A L T + + +L+KYNIYVQAIN+PTV  GEE LR+APSPHH   M+   V  ++ +W+E  L
Sbjct:    8 CPFLKSAPKPALRRTGASLL-SLAEKCPIITRQITIGVVQASPEVQEDVKDGLMKSLL-KGLKASMFPSGADLNTVTHLLRDNMVGPSYDYD-----------------------HFFTEKISEKKKDHTYRVFKTVNRRANTFPFAEDYSIPERAGAQVSVWCSNDYLGMSRHPKVLGAIREALENYGAGAGGTRNISGTSNFHVALERELAQLHGKDAALVFSSCFVANDSTLFTLAKMLPGCEIYSDAGNHASMIQGIRNSGAKRFIFRHNDRRHLEELLQRSDPKTPKIVAFETVHSMDGAICPLEELCDAAHRYGALTFVDEVHAVGLYGAHGAGVGERDNIMHKIDIVSGTLGKAFGCVGGYVASSGALVDTVRSYAAGFIFTTALPPMVLAGALESVRILKSAEGQVLRRAHQRNVKHMRQLLMDKGLPVVNCPSHIIPIRVGNAELNTKVCDILLEKYNIYVQAINYPTVPRGEELLRLAPSPHHEPDMMEYFVGKLVEVWQEAGL 496          
BLAST of 5-aminolevulinate synthase vs. Ensembl Medaka
Match: alas1 (5'-aminolevulinate synthase 1 [Source:NCBI gene;Acc:101158598])

HSP 1 Score: 467.618 bits (1202), Expect = 1.741e-158
Identity = 224/396 (56.57%), Postives = 299/396 (75.51%), Query Frame = 1
Query:  388 EFFQSEIDKKKQDNTYRVFKKVLRRADNFPYAKE--KSILNK-DVAVWCSNDYLGMSWHPSVMEAAINAIRKHGTGSGGTRNISGNTILHESLEEDLAKLHGKEAALVFTSCYVANEASLHTLGTRLPFVEIFSDSGNHASMIHGIRTSRARKIIYRHNDTKHLDQLLSKTSAGVPKLVAFETVHSMSGNICPVDELLDICEKHGAFSFVDEVHAVGLYGDHGAGVAERDGVMDRIDMISGTLGKAFGNVGGYIAGDKAVVDMIRNYASGFIFTTSLPPHVLAGARKAVDILASDEGRQLRNQHQDVVRTVKSYLQHEGIPVIDCPSHIIPVHVGHAGLCTHLSNEMLQKYNIYVQAINHPTVAVGEERLRIAPSPHHTLPMINELVSAMISLWKE 1566
            +FF+ +I++KK D+TYRVFK V R A  FP A +   S+ +K +V+VWCSNDYLGMS HP V+++ ++ ++KHG+G+GGTRNISG +  H  LE++LA LH K+AAL+FTSC+VAN+++L TL   LP  EI+SD GNHASMI GIR S A+K ++RHND  HL +LL K     PK+VAFETVHSM G +CP++E+ D+  + GA +FVDEVHAVGLYG  G G+ +RDG+M ++D+ISGTLGKAFG VGGYIA   A+VD +R+YA+GFIFTTSLPP +LAGAR+++ IL  +EGR LR +HQ  V+ ++  L   G+PV+ CPSHIIP+ V +A   T + + M+ ++NIYVQAIN+PTVA GEE LRIAP+PHHT  M+   V  ++  WKE
Sbjct:  184 DFFEKKIEEKKSDHTYRVFKTVNRLATEFPMADDFTGSLEDKREVSVWCSNDYLGMSRHPQVVQSIMDTLQKHGSGAGGTRNISGTSKFHVELEQELADLHKKDAALLFTSCFVANDSTLFTLAKMLPGCEIYSDGGNHASMIQGIRNSGAKKFVFRHNDVAHLRELLQKGDPSKPKIVAFETVHSMDGAVCPLEEMCDLAHEFGAITFVDEVHAVGLYGARGGGIGDRDGIMHKMDIISGTLGKAFGCVGGYIASTSALVDTVRSYAAGFIFTTSLPPMLLAGARQSIQILKGEEGRTLRRKHQRNVKLLRQMLMDSGLPVVHCPSHIIPIRVSNAEKNTEVCDIMMSRHNIYVQAINYPTVARGEELLRIAPTPHHTPEMMKYFVERLVQTWKE 579          
BLAST of 5-aminolevulinate synthase vs. Ensembl Medaka
Match: gcat (glycine C-acetyltransferase [Source:NCBI gene;Acc:101164655])

HSP 1 Score: 209.149 bits (531), Expect = 3.209e-61
Identity = 118/351 (33.62%), Postives = 194/351 (55.27%), Query Frame = 1
Query:  520 WCSNDYLGMSWHPSVMEAAINAIRKHGTGSGGTRNISGNTILHESLEEDLAKLHGKEAALVFTSCYVANEASLHTLGTRLPFVEIFSDSGNHASMIHGIRTSRARKIIYRHNDTKHLDQLLSKTSAGVPKLVAFETVHSMSGNICPVDELLDICEKHGAFSFVDEVHAVGLYGDHGAGVAERDGVMDRIDMISGT-LGKAFGNVGGYIAGDKAVVDMIRNYASGFIFTTSLPPHVLAGARKAVDILASDEGRQLRNQHQDVVRTVKSYLQHEGIPVIDCPSHIIPVHVGHAGLCTHLSNEMLQKYNIYVQAINHPTVAVGEERLRIAPSPHHTLPMINELVSAMISLWKEN 1569
            +C+N+YLG+S HP V++A I A++ HG G    R I G   LH+ LE+ LA+ H +E  +++ SC+ AN      L +  P   + SD  NHAS+I GIR  RA+++ Y+H D K L+  L ++ +   +L+  + V SM G++ P+  + D+ E++GA  F+DE HA G  G  G G  E  GVMDR+ +++ T      G  GGY  G K ++D++R  +  ++F+ +LPP V+  A  AV++L +    ++           ++ +   G  +      I PV +G A L + ++++ML K  IYV   ++P V  G+ R+R+  S  HT   I+  V A I   +++
Sbjct:   78 FCANNYLGLSSHPEVVQAGIEALKSHGAGLSSVRFICGTQDLHKHLEQKLAEFHEREDCILYASCFDANAGLFEVLLS--PEDAVLSDELNHASIIDGIRLCRAKRLRYKHMDLKDLESKLQESQSSRMRLIVTDGVFSMDGDVAPLRGICDLAEQYGAMVFIDECHATGFLGPRGRGTDELLGVMDRVHIVNSTLGKALGGAAGGYTVGPKPLIDLLRQRSRPYLFSNALPPPVVGSAISAVEMLLTSN--EIAQSMTAKTMRFRNKMTQVGFTIAGTSHPICPVMLGDARLASVMADDML-KLCIYVIGFSYPVVPKGKARIRVQISAAHTEEDIDRCVDAFIQTGRKH 423          
BLAST of 5-aminolevulinate synthase vs. Planmine SMEST
Match: SMESG000078664.1 (SMESG000078664.1)

HSP 1 Score: 1056.97 bits (2732), Expect = 0.000e+0
Identity = 520/522 (99.62%), Postives = 521/522 (99.81%), Query Frame = 1
Query:   64 MLACPFLLKLPLNLVKNEAQRVIVKSGPKCPVFSRYLSNDLTNNKKDEVNSSSLNENIVESSVNLSNQMNVCPHPTQNTDKYDVEPAKFLPAKQIXXXXXXXXXXXXMEFFQSEIDKKKQDNTYRVFKKVLRRADNFPYAKEKSILNKDVAVWCSNDYLGMSWHPSVMEAAINAIRKHGTGSGGTRNISGNTILHESLEEDLAKLHGKEAALVFTSCYVANEASLHTLGTRLPFVEIFSDSGNHASMIHGIRTSRARKIIYRHNDTKHLDQLLSKTSAGVPKLVAFETVHSMSGNICPVDELLDICEKHGAFSFVDEVHAVGLYGDHGAGVAERDGVMDRIDMISGTLGKAFGNVGGYIAGDKAVVDMIRNYASGFIFTTSLPPHVLAGARKAVDILASDEGRQLRNQHQDVVRTVKSYLQHEGIPVIDCPSHIIPVHVGHAGLCTHLSNEMLQKYNIYVQAINHPTVAVGEERLRIAPSPHHTLPMINELVSAMISLWKENKLSFYNQDLETTKVRADLKL 1629
            MLACPFLLKLPLNLVKNEAQRVIVKSGPKCPVFSRYLSNDLTNNKKDEVNSSS NENIVESSVNLSNQMNVCPHPTQNTDKYDVEPAKFLPAKQIPSRSKSPSSYKYMEFFQSEIDKKKQDNTYRVFKKVLRRADNFPYAKEKSILNKDVAVWCSNDYLGMSWHPSVMEAAINAIRKHGTGSGGTRNISGNTILHESLEEDLAKLHGKEAALVFTSCYVANEASLHTLGTRLPFVEIFSDSGNHASMIHGIRTSRARKIIYRHNDTKHLDQLLSKTSAGVPKLVAFETVHSMSGNICPVDELLDICEKHGAFSFVDEVHAVGLYGDHGAGVAERDGVMDRIDMISGTLGKAFGNVGGYIAGDKAVVDMIRNYASGFIFTTSLPPHVLAGARKAVDILASDEGRQLRNQHQDVVRTVKSYLQHEGIPVIDCPSHIIPVHVGHAGLCTHLSNE+LQKYNIYVQAINHPTVAVGEERLRIAPSPHHTLPMINELVSAMISLWKENKLSFYNQDLETTKVRADLKL
Sbjct:    1 MLACPFLLKLPLNLVKNEAQRVIVKSGPKCPVFSRYLSNDLTNNKKDEVNSSSFNENIVESSVNLSNQMNVCPHPTQNTDKYDVEPAKFLPAKQIPSRSKSPSSYKYMEFFQSEIDKKKQDNTYRVFKKVLRRADNFPYAKEKSILNKDVAVWCSNDYLGMSWHPSVMEAAINAIRKHGTGSGGTRNISGNTILHESLEEDLAKLHGKEAALVFTSCYVANEASLHTLGTRLPFVEIFSDSGNHASMIHGIRTSRARKIIYRHNDTKHLDQLLSKTSAGVPKLVAFETVHSMSGNICPVDELLDICEKHGAFSFVDEVHAVGLYGDHGAGVAERDGVMDRIDMISGTLGKAFGNVGGYIAGDKAVVDMIRNYASGFIFTTSLPPHVLAGARKAVDILASDEGRQLRNQHQDVVRTVKSYLQHEGIPVIDCPSHIIPVHVGHAGLCTHLSNELLQKYNIYVQAINHPTVAVGEERLRIAPSPHHTLPMINELVSAMISLWKENKLSFYNQDLETTKVRADLKL 522          
BLAST of 5-aminolevulinate synthase vs. Planmine SMEST
Match: SMESG000052979.1 (SMESG000052979.1)

HSP 1 Score: 202.216 bits (513), Expect = 9.502e-59
Identity = 121/353 (34.28%), Postives = 201/353 (56.94%), Query Frame = 1
Query:  499 LNKDVAVWCSNDYLGMSWHPSVMEAAINAIRKHGTGSGGTRNISGNTILHESLEEDLAKLHGKEAALVFTSCYVANEASLHTLGTRLPFVEIFSDSGNHASMIHGIRTSRARKIIYRHNDTKHLDQLLSKTSAGVPKLVAFETVHSMSGNICPVDELLDICEKHGAFSFVDEVHAVGLYGDHGAGVAERDGV-MDRIDMISGTLGKA-FGNVGGYIAGDKAVVDMIRNYASGFIFTTSLPPHVLAGARKAVDILASDEGRQLRNQHQDVVRTVKSYLQHEGIPVIDCPSH-IIPVHVGHAGLCTHLSNEMLQKYNIYVQAINHPTVAVGEERLRIAPSPHHTLPMINELVSAM 1548
            LN ++  +C+N+YLG+S HP ++EA+I+A++ HG G    R I G T LH +LEE LAK H +EA++++ SC+ AN      L ++     I SD  NHAS+I GIR  +A+K  Y++ D   L + L +  +   K++  + V SM G + P+ +++ +  ++   +F+DE HA G  G  G G  E   + +  +D+I+ TLGKA  G +GGY  G K +VDM+R  +  ++F+ +LPP V+A + +A+D++  D+   L     +  R  ++ + + G  +     H I PV +G A L +  + +ML K  IYV   ++P V   + R+R+  S  HT   I++ + A 
Sbjct:   68 LNDEILNFCANNYLGLSGHPKIIEASISALKSHGAGLSSVRFICGTTDLHVNLEEKLAKFHNREASILYASCFDANAGIFEALLSQDD--AIISDELNHASIIDGIRLCKAKKWRYKNGDINDLKRCLEEAKSYRLKMIVTDGVFSMDGKMAPLSDIISLSREYDCLTFIDECHATGFIGSTGRGSEEFWNLPVPCVDIINSTLGKAMGGTMGGYTTGSKRIVDMLRQKSRPYLFSNTLPPSVVAASIQALDLIMDDQDGLLDKIKANTQR-FRTEMTNLGFNISGDSCHPICPVMLGDARLASQFAEKMLTK-GIYVIGFSYPVVPKDKARIRVQISAVHTRQQIDKAILAF 416          
BLAST of 5-aminolevulinate synthase vs. Planmine SMEST
Match: SMESG000011189.1 (SMESG000011189.1)

HSP 1 Score: 140.584 bits (353), Expect = 1.381e-35
Identity = 108/371 (29.11%), Postives = 180/371 (48.52%), Query Frame = 1
Query:  526 SNDYLGMSWHPSVMEAAI-NAIRKHGTGSGGTRNISGNTILHESLEEDLAKLHGKEAALVFTSCYVANEASLHTLGTRLPFVEIFSDSGNHASMIHGIRTSRARKIIYRHNDTKHLDQLLSKTSA-GVPK--------LVAFETVHSMSGNICPVDELLDICEKHGAFSFVDEVHAVGLYGDHGAGVAERDGVMDR-IDMISGTLGKAFGNVGGYIAGDKAVVDMIRNYASGFIFTTSLPPHVLAGARKAVDILASDEGRQLRN-------QHQDVVRTVKSYLQHEGIPVI---DCPSHIIPVHVGHAGLCTHLSNEMLQKYNIYVQAINHPTVAVGEERLRIAPSPHHTLPMINEL------VSAMISL 1557
            S +YLG + +      A+ N+I K+G G G  R   GN   H  LE  +A   G+E+A+VF   +  N  +L  L  +     + SD  NH S+I GIR S A    ++HND  +L++ + K    G P+        LV  E ++SM G+I  + +++++ +K+  F ++DE H++G  G HG GV +   +  + ID+  GT  K+FG+ GGYIAGDK +++ +R  +   I+   +P       ++ +  ++  EG+Q  N       Q +  V   ++ L  +G  V    D P  ++P+ +         S E L +  I    +  P   +   R R   S  HT  MI++       VSA+I++
Sbjct:  136 SYNYLGFAQNTGACADAVENSISKYGLGVGSPRQECGNHTSHTELERLVATFTGQESAIVFPMGFATNSLNLPILVNKQ--CCVISDELNHTSLILGIRLSGAHIRRFKHNDMSNLEKQIRKAVIFGHPRTRRPFKKILVVVEGIYSMEGSIVHLPQIVELKKKYNFFIYLDEAHSIGALGPHGKGVIDYFNINPKDIDVAMGTFTKSFGSSGGYIAGDKRLIEFVRENSHSSIYGAPMPA---VCCQQIITSMSIIEGKQCGNEGIKKIKQLEWNVHYFRAALHKKGFIVFGNKDSP--VVPLIICTPTKLAAFSRECLSR-GIGTVVVGFPATTIILARARFCVSASHTKEMIDQTLKVIDEVSALINI 498          
BLAST of 5-aminolevulinate synthase vs. Planmine SMEST
Match: SMESG000080769.1 (SMESG000080769.1)

HSP 1 Score: 135.576 bits (340), Expect = 2.015e-34
Identity = 89/317 (28.08%), Postives = 157/317 (49.53%), Query Frame = 1
Query:  406 IDKKKQDNTYRVFKKVLRRADNFPYAKEKSILNKDVAVWCSNDYLGMSWHPSVMEAAINAIRKHGTGSGGTRNISGNTILHESLEEDLAKLHGKEAALVFTSCYVANEASLHTLGTRLPFVEIFSDSGNHASMIHGIRTSRARKIIYRHNDTKHLDQLLSKTSAGVPK----------LVAFETVHSMSGNICPVDELLDICEKHGAFSFVDEVHAVGLYGDHGAGVAERDGV-MDRIDMISGTLGKAFGNVGGYIAGDKAVVDMIRNYASGFIFTTSLPPHVLAGARKAVDILASDEGRQLRNQHQDVVRTVKSYL 1323
            I  K + +    F K++   +N    K K +LN       S ++  +  +  + E A  A+RK+G GS G R   G   +H  LE+++A     E ++V++  +    +++     R     IF+D G   ++  G+  SR++   ++HND  HL  LL + S    K           +  E ++   G+ICP+ +++++  K+    F+DE  + G+ GDHG GV +  GV +  ID+I+G+L  A    GG+  G K VVD  R    G+ F+ SLPP +  GA   ++++ ++EG   R +  ++ + + S L
Sbjct:   80 IQSKFEKSVISSFGKIVYFNEN----KTKPVLN-----LASFNFFNLIGNEKINETAQKALRKYGVGSCGPRGFYGTFDVHLKLEDEIANFMNCEESVVYSYGFSTVASAIPAYAKRGDV--IFADEGVSFAIQCGLLASRSKIKYFKHNDMDHLVSLLEEQSEEAIKNPAKARITRTFIVIEGLYMNYGDICPLPKIVELKYKYKVRIFLDETLSFGVLGDHGRGVTDHFGVDVTDIDLITGSLETALATCGGFSVGSKYVVDHQRLSGQGYCFSASLPPLLACGASVVLEMIRAEEGVAQRIRLNEISKKISSLL 385          
BLAST of 5-aminolevulinate synthase vs. Planmine SMEST
Match: SMESG000052311.1 (SMESG000052311.1)

HSP 1 Score: 135.576 bits (340), Expect = 2.015e-34
Identity = 89/317 (28.08%), Postives = 157/317 (49.53%), Query Frame = 1
Query:  406 IDKKKQDNTYRVFKKVLRRADNFPYAKEKSILNKDVAVWCSNDYLGMSWHPSVMEAAINAIRKHGTGSGGTRNISGNTILHESLEEDLAKLHGKEAALVFTSCYVANEASLHTLGTRLPFVEIFSDSGNHASMIHGIRTSRARKIIYRHNDTKHLDQLLSKTSAGVPK----------LVAFETVHSMSGNICPVDELLDICEKHGAFSFVDEVHAVGLYGDHGAGVAERDGV-MDRIDMISGTLGKAFGNVGGYIAGDKAVVDMIRNYASGFIFTTSLPPHVLAGARKAVDILASDEGRQLRNQHQDVVRTVKSYL 1323
            I  K + +    F K++   +N    K K +LN       S ++  +  +  + E A  A+RK+G GS G R   G   +H  LE+++A     E ++V++  +    +++     R     IF+D G   ++  G+  SR++   ++HND  HL  LL + S    K           +  E ++   G+ICP+ +++++  K+    F+DE  + G+ GDHG GV +  GV +  ID+I+G+L  A    GG+  G K VVD  R    G+ F+ SLPP +  GA   ++++ ++EG   R +  ++ + + S L
Sbjct:   80 IQSKFEKSVISSFGKIVYFNEN----KTKPVLN-----LASFNFFNLIGNEKINETAQKALRKYGVGSCGPRGFYGTFDVHLKLEDEIANFMNCEESVVYSYGFSTVASAIPAYAKRGDV--IFADEGVSFAIQCGLLASRSKIKYFKHNDMDHLVSLLEEQSEEAIKNPAKARITRTFIVIEGLYMNYGDICPLPKIVELKYKYKVRIFLDETLSFGVLGDHGRGVTDHFGVDVTDIDLITGSLETALATCGGFSVGSKYVVDHQRLSGQGYCFSASLPPLLACGASVVLEMIRAEEGVAQRIRLNEISKKISSLL 385          
The following BLAST results are available for this feature:
BLAST of 5-aminolevulinate synthase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ALAS28.004e-16857.615'-aminolevulinate synthase 2 [Source:HGNC Symbol;... [more]
ALAS21.502e-16757.615'-aminolevulinate synthase 2 [Source:HGNC Symbol;... [more]
ALAS22.078e-16757.615'-aminolevulinate synthase 2 [Source:HGNC Symbol;... [more]
ALAS18.911e-16157.505'-aminolevulinate synthase 1 [Source:HGNC Symbol;... [more]
ALAS18.911e-16157.505'-aminolevulinate synthase 1 [Source:HGNC Symbol;... [more]
back to top
BLAST of 5-aminolevulinate synthase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
T25B9.12.058e-6233.52pep chromosome:WBcel235:IV:10748385:10750141:-1 ge... [more]
sptl-32.881e-4729.93Serine palmitoyltransferase 3 [Source:UniProtKB/S... [more]
sptl-32.881e-4729.93Serine palmitoyltransferase 3 [Source:UniProtKB/S... [more]
sptl-33.137e-4730.90Serine palmitoyltransferase 3 [Source:UniProtKB/S... [more]
sptl-21.027e-3327.75Serine palmitoyltransferase 2 [Source:UniProtKB/S... [more]
back to top
BLAST of 5-aminolevulinate synthase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Alas9.280e-17852.27gene:FBgn0020764 transcript:FBtr0072151[more]
CG103615.401e-6734.07gene:FBgn0036208 transcript:FBtr0076084[more]
Spt-I3.490e-3029.37gene:FBgn0086532 transcript:FBtr0087731[more]
Spt-I3.490e-3029.37gene:FBgn0086532 transcript:FBtr0087729[more]
Spt-I3.490e-3029.37gene:FBgn0086532 transcript:FBtr0087730[more]
back to top
BLAST of 5-aminolevulinate synthase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
alas18.062e-16857.89aminolevulinate, delta-, synthase 1 [Source:ZFIN;A... [more]
alas23.259e-16757.89aminolevulinate, delta-, synthase 2 [Source:NCBI g... [more]
alas23.294e-16757.89aminolevulinate, delta-, synthase 2 [Source:NCBI g... [more]
gcat4.810e-6234.65glycine C-acetyltransferase [Source:ZFIN;Acc:ZDB-G... [more]
sptlc32.811e-4027.70serine palmitoyltransferase, long chain base subun... [more]
back to top
BLAST of 5-aminolevulinate synthase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
alas23.513e-17058.595'-aminolevulinate synthase 2 [Source:NCBI gene;Ac... [more]
alas16.926e-16055.865'-aminolevulinate synthase 1 [Source:NCBI gene;Ac... [more]
alas11.698e-15955.865'-aminolevulinate synthase 1 [Source:NCBI gene;Ac... [more]
alas12.182e-15757.115'-aminolevulinate synthase 1 [Source:NCBI gene;Ac... [more]
alas21.179e-12548.485'-aminolevulinate synthase 2 [Source:NCBI gene;Ac... [more]
back to top
BLAST of 5-aminolevulinate synthase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Alas28.625e-16556.39aminolevulinic acid synthase 2, erythroid [Source:... [more]
Alas21.405e-16456.39aminolevulinic acid synthase 2, erythroid [Source:... [more]
Alas12.623e-16157.75aminolevulinic acid synthase 1 [Source:MGI Symbol;... [more]
Alas12.623e-16157.75aminolevulinic acid synthase 1 [Source:MGI Symbol;... [more]
Alas16.361e-15957.50aminolevulinic acid synthase 1 [Source:MGI Symbol;... [more]
back to top
BLAST of 5-aminolevulinate synthase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9XS79|HEM1_DELLE1.017e-16758.005-aminolevulinate synthase, nonspecific, mitochond... [more]
sp|Q3ZC31|HEM0_BOVIN1.741e-16757.145-aminolevulinate synthase, erythroid-specific, mi... [more]
sp|P13195|HEM1_RAT2.099e-16757.755-aminolevulinate synthase, nonspecific, mitochond... [more]
sp|Q9XT75|HEM0_DELLE4.724e-16757.145-aminolevulinate synthase, erythroid-specific, mi... [more]
sp|P22557|HEM0_HUMAN7.215e-16757.615-aminolevulinate synthase, erythroid-specific, mi... [more]
back to top
BLAST of 5-aminolevulinate synthase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A430QIB10.000e+055.195-aminolevulinate synthase OS=Schistosoma bovis OX... [more]
A0A504Y9P90.000e+066.675-aminolevulinate synthase OS=Fasciola gigantica O... [more]
A0A4E0RML20.000e+066.425-aminolevulinate synthase OS=Fasciola hepatica OX... [more]
A0A183P5J90.000e+055.235-aminolevulinate synthase OS=Schistosoma mattheei... [more]
A0A095AFG90.000e+065.495-aminolevulinate synthase OS=Schistosoma haematob... [more]
back to top
BLAST of 5-aminolevulinate synthase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
alas11.740e-16156.575'-aminolevulinate synthase 1 [Source:NCBI gene;Ac... [more]
gcat2.877e-6234.64glycine C-acetyltransferase [Source:NCBI gene;Acc:... [more]
sptlc2a3.679e-3728.69serine palmitoyltransferase, long chain base subun... [more]
sptlc2a3.696e-3728.69serine palmitoyltransferase, long chain base subun... [more]
sptlc2a3.696e-3728.69serine palmitoyltransferase, long chain base subun... [more]
back to top
BLAST of 5-aminolevulinate synthase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
alas22.939e-11955.93aminolevulinate, delta-, synthase 2 [Source:NCBI g... [more]
sptlc2a1.613e-4129.09serine palmitoyltransferase, long chain base subun... [more]
sptlc14.291e-2426.51serine palmitoyltransferase, long chain base subun... [more]
ENSPMAT00000010740.14.127e-1555.56pep scaffold:Pmarinus_7.0:GL476415:242415:246378:1... [more]
back to top
BLAST of 5-aminolevulinate synthase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
HEM11.023e-12647.485-aminolevulinate synthase; catalyzes the first st... [more]
LCB28.330e-3529.66Component of serine palmitoyltransferase; responsi... [more]
LCB11.416e-2426.36Component of serine palmitoyltransferase; responsi... [more]
back to top
BLAST of 5-aminolevulinate synthase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO462062.363e-17851.485-aminolevulinate synthase [Source:UniProtKB/TrEM... [more]
EDO272201.544e-6133.52Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO384902.391e-6135.34Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO429901.388e-3528.29Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO360822.729e-2629.57Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of 5-aminolevulinate synthase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
alas25.266e-17448.405-aminolevulinate synthase, erythroid-specific, mi... [more]
alas27.819e-17146.965-aminolevulinate synthase, erythroid-specific, mi... [more]
alas21.192e-16948.645-aminolevulinate synthase, erythroid-specific, mi... [more]
alas11.741e-15856.575'-aminolevulinate synthase 1 [Source:NCBI gene;Ac... [more]
gcat3.209e-6133.62glycine C-acetyltransferase [Source:NCBI gene;Acc:... [more]
back to top
BLAST of 5-aminolevulinate synthase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000078664.10.000e+099.62SMESG000078664.1[more]
SMESG000052979.19.502e-5934.28SMESG000052979.1[more]
SMESG000011189.11.381e-3529.11SMESG000011189.1[more]
SMESG000080769.12.015e-3428.08SMESG000080769.1[more]
SMESG000052311.12.015e-3428.08SMESG000052311.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30009717 ID=SMED30009717|Name=5-aminolevulinate synthase|organism=Schmidtea mediterranea sexual|type=transcript|length=1712bp
AAAACGCTTTGCATTTTATGAAATTTACGTTTTTTCAAAAATATTTAAAT
TAAATATATTGAAATGCTTGCTTGTCCGTTTTTGCTTAAACTCCCTCTCA
ATCTAGTGAAAAATGAAGCTCAACGAGTGATTGTTAAGTCTGGACCTAAA
TGTCCCGTGTTTAGTCGATATTTATCTAATGATTTAACTAACAATAAGAA
AGATGAAGTTAATTCATCAAGTTTAAATGAAAATATTGTTGAAAGTTCAG
TTAATTTGAGCAACCAAATGAATGTCTGTCCACATCCAACTCAAAACACG
GATAAATATGATGTTGAACCTGCAAAATTTCTACCGGCCAAACAAATACC
ATCTCGGTCTAAATCGCCATCTAGTTACAAATATATGGAATTCTTTCAAT
CGGAAATCGACAAAAAGAAGCAAGACAATACATATCGAGTGTTTAAGAAG
GTTTTGCGGAGAGCTGATAATTTTCCATATGCCAAAGAAAAGTCTATTCT
AAACAAAGATGTTGCTGTTTGGTGTTCGAATGACTATCTAGGAATGAGTT
GGCATCCTTCGGTAATGGAGGCGGCAATAAATGCCATTCGAAAACATGGG
ACTGGTAGTGGAGGAACAAGAAATATATCAGGGAATACGATTCTCCATGA
GTCGCTAGAAGAGGATTTGGCTAAACTTCACGGAAAAGAGGCAGCTTTGG
TGTTTACAAGCTGTTATGTTGCCAATGAAGCCAGTTTACATACTCTTGGG
ACTCGATTGCCATTTGTGGAAATATTTTCTGATAGTGGTAATCATGCTAG
TATGATCCATGGTATCCGTACCAGCCGAGCACGGAAAATCATATATCGAC
ATAATGATACAAAACATCTTGATCAATTACTTTCAAAAACGTCAGCTGGT
GTTCCAAAGTTAGTAGCTTTCGAAACTGTTCATTCAATGTCTGGAAATAT
CTGTCCAGTTGATGAATTGTTAGACATATGTGAAAAACACGGAGCCTTTT
CATTTGTCGATGAAGTTCACGCAGTTGGTTTATATGGTGACCATGGAGCT
GGTGTCGCAGAGAGAGACGGTGTTATGGATCGTATCGATATGATTTCTGG
AACCTTGGGAAAAGCCTTTGGAAATGTTGGTGGTTACATAGCCGGTGACA
AAGCAGTAGTCGATATGATCCGTAACTATGCATCTGGATTTATTTTTACC
ACGAGTTTGCCTCCTCACGTACTAGCAGGAGCTAGAAAAGCAGTTGACAT
TTTGGCTAGTGATGAAGGTCGACAATTGCGAAATCAGCACCAGGATGTAG
TTCGGACTGTTAAATCCTATCTGCAGCACGAAGGAATCCCAGTAATCGAT
TGCCCAAGTCATATTATTCCAGTCCATGTCGGCCATGCTGGATTGTGTAC
GCATCTCAGTAACGAAATGCTCCAAAAATACAATATATATGTTCAAGCTA
TAAATCATCCGACTGTAGCAGTCGGAGAAGAACGATTGAGAATCGCACCG
TCGCCTCATCATACTTTACCAATGATAAATGAGCTAGTTTCAGCAATGAT
AAGCTTGTGGAAAGAGAATAAATTATCCTTCTACAATCAAGATCTAGAAA
CAACTAAAGTTAGAGCAGATTTGAAATTGTAAAAGTTCGCTTAATAATTG
TGATATTTATAGAAATATGATTATTCTGTTTTGATAATACAAATGATAAT
TTTAAAAAAAAA
back to top

protein sequence of SMED30009717-orf-1

>SMED30009717-orf-1 ID=SMED30009717-orf-1|Name=SMED30009717-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=523bp
MLACPFLLKLPLNLVKNEAQRVIVKSGPKCPVFSRYLSNDLTNNKKDEVN
SSSLNENIVESSVNLSNQMNVCPHPTQNTDKYDVEPAKFLPAKQIPSRSK
SPSSYKYMEFFQSEIDKKKQDNTYRVFKKVLRRADNFPYAKEKSILNKDV
AVWCSNDYLGMSWHPSVMEAAINAIRKHGTGSGGTRNISGNTILHESLEE
DLAKLHGKEAALVFTSCYVANEASLHTLGTRLPFVEIFSDSGNHASMIHG
IRTSRARKIIYRHNDTKHLDQLLSKTSAGVPKLVAFETVHSMSGNICPVD
ELLDICEKHGAFSFVDEVHAVGLYGDHGAGVAERDGVMDRIDMISGTLGK
AFGNVGGYIAGDKAVVDMIRNYASGFIFTTSLPPHVLAGARKAVDILASD
EGRQLRNQHQDVVRTVKSYLQHEGIPVIDCPSHIIPVHVGHAGLCTHLSN
EMLQKYNIYVQAINHPTVAVGEERLRIAPSPHHTLPMINELVSAMISLWK
ENKLSFYNQDLETTKVRADLKL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0002032epidermal cell
PLANA:0002075pigment cell
PLANA:0002142parenchyma
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR0109614pyrrol_synth_NH2levulA_synth
IPR015422PyrdxlP-dep_Trfase_dom1
IPR015421PyrdxlP-dep_Trfase_major
IPR004839Aminotransferase_I/II
IPR015424PyrdxlP-dep_Trfase
Vocabulary: molecular function
TermDefinition
GO:0003824catalytic activity
GO:0030170pyridoxal phosphate binding
GO:00038705-aminolevulinate synthase activity
GO:0016740transferase activity
GO:0016746transferase activity, transferring acyl groups
Vocabulary: biological process
TermDefinition
GO:0009058biosynthetic process
GO:0006782protoporphyrinogen IX biosynthetic process
GO:0006783heme biosynthetic process
GO:0008152metabolic process
GO:0033014tetrapyrrole biosynthetic process
Vocabulary: cellular component
TermDefinition
GO:0005739mitochondrion
GO:0005759mitochondrial matrix
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR004839Aminotransferase, class I/classIIPFAMPF00155Aminotran_1_2coord: 149..494
e-value: 1.6E-70
score: 238.1
IPR015422Pyridoxal phosphate-dependent transferase domain 1GENE3DG3DSA:3.90.1150.10coord: 117..492
e-value: 4.6E-161
score: 537.8
IPR015421Pyridoxal phosphate-dependent transferase, major domainGENE3DG3DSA:3.40.640.10coord: 165..400
e-value: 4.6E-161
score: 537.8
IPR010961Tetrapyrrole biosynthesis, 5-aminolevulinic acid synthaseTIGRFAMTIGR01821TIGR01821coord: 106..504
e-value: 7.3E-179
score: 592.7
NoneNo IPR availablePANTHERPTHR13693:SF575-AMINOLEVULINATE SYNTHASEcoord: 47..510
NoneNo IPR availablePANTHERPTHR13693CLASS II AMINOTRANSFERASE/8-AMINO-7-OXONONANOATE SYNTHASEcoord: 47..510
NoneNo IPR availableCDDcd06454KBL_likecoord: 148..499
e-value: 3.0457E-171
score: 485.142
IPR015424Pyridoxal phosphate-dependent transferaseSUPERFAMILYSSF53383PLP-dependent transferasescoord: 105..501