Sortilin

Overview
NameSortilin
Smed IDSMED30009710
Length (bp)2635
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Sortilin (SMED30009710) t-SNE clustered cells

Violin plots show distribution of expression levels for Sortilin (SMED30009710) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Sortilin (SMED30009710) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Sortilin (SMED30009710) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30009710

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymal cellSMED30009710SMESG000061919.1 dd_Smed_v4_1666_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30009710SMESG000061919.1 dd_Smed_v4_1666_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30009710SMESG000061919.1 dd_Smed_v4_1666_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Sortilin vs. Ensembl Human
Match: SORT1 (sortilin 1 [Source:HGNC Symbol;Acc:HGNC:11186])

HSP 1 Score: 421.779 bits (1083), Expect = 7.613e-134
Identity = 236/678 (34.81%), Postives = 382/678 (56.34%), Query Frame = 1
Query:   94 DQVCDSQKEVIGNAFKNNNPISKFVFTNDTKTSVQVTWAGDNSGKIILVTTKEIQIILTYADLSDIYFSDNNGKSFKRITESLPIKKVIVRKENGLQRNILDHQNIFLVCYDTVERSA------LLITKDGGETWKKVELNFILDREIKFHPFEKSWMITVNKARNLYKSIDGGLTWEFLLSDVLQYQWTTDKNYPQDIFVKTGKILETSIFEKIFGISNQKAPV--MNLKKSTDAGKSWKIIKKNIFAFFLRDKFLYISELITGNR-RRLMVSIDNGNTFNKVYLPTIANNQFFSILHIEEDSVYIHVDNADTRGDGILFTSDSDGQVFSQSLMNHFYPSAELTSDFYKVESMRGTYIASQLNPDRSIQSLITFNRGAEWKRIKKPVNETCH--NKDKTECFVQVTGAYSLMN--NVPSSLPLSTPTAIGIVLVHAHLANSLKNSVSDVYITSDGGYNWIKALDGPHDYVIADHGGLLVAMGSNKK---FIKFSTDEGRCWHEHQYTTEDIRVTGLLTEPGNKAMTVAIWGYSNN--DTQWIIHVVDLSQLLSRECDDSDYEKWYAHSEMMHPNGENYA-GCLLGKKEEFLRLKKDSLCKNGYSHKVTKTEKICPCTKDDFECEYGYFRTVNSKNCIKNELIKEN---LCVKGIVEKIITQGYKKIPSDVCEGGFSP 2061
            D+ C   ++ +     N +   + VF +D + SV ++W GD++G I+++TT  + +++     S +Y S++ GK+FK IT+   I    +R E G+     +   + L    T E S       +  + D  + + + +L F    ++ + P    +++ ++    L+ S + G  WE +   V   +W +D                 +IF   +   + KA +  + L +++D GKS+K I   I++F L  +FL+ S +   +  RR+ VS D G+T++   LP++   QF+SIL   +D V++HVD     G G +FTSD  G V+S+SL  H Y +    +DF  V S+RG YI S L+ D SIQ++ITF++G  W  ++KP N  C    K+K EC + +  +YS+    NVP + PLS P A+GIV+ H  + +++   V DVYI+ DGGY+W K L+GPH Y I D GG++VA+  + +    IKFSTDEG+CW  + +T + I  TGL +EPG ++M ++IWG++ +   +QW+ + +D   +L R C++ DY  W AHS     + E+Y  GC+LG KE+FLRL+K S+C+NG  + VTK   IC C+ +DF C++GY+R  N   C++   +K +    C+ G  E + T GY+KIP D C+GG +P
Sbjct:   83 DEECGRVRDFVAKLANNTH---QHVF-DDLRGSVSLSWVGDSTGVILVLTTFHVPLVIMTFGQSKLYRSEDYGKNFKDITDL--INNTFIRTEFGMAIGPENSGKVVL----TAEVSGGSRGGRIFRSSDFAKNFVQTDLPFHPLTQMMYSPQNSDYLLALSTENGLWVSKNFGGKWEEIHKAVCLAKWGSDN----------------TIFFTTYANGSCKADLGALELWRTSDLGKSFKTIGVKIYSFGLGGRFLFASVMADKDTTRRIHVSTDQGDTWSMAQLPSVGQEQFYSILAANDDMVFMHVDEPGDTGFGTIFTSDDRGIVYSKSLDRHLYTTTGGETDFTNVTSLRGVYITSVLSEDNSIQTMITFDQGGRWTHLRKPENSECDATAKNKNECSLHIHASYSISQKLNVPMA-PLSEPNAVGIVIAHGSVGDAISVMVPDVYISDDGGYSWTKMLEGPHYYTILDSGGIIVAIEHSSRPINVIKFSTDEGQCWQTYTFTRDPIYFTGLASEPGARSMNISIWGFTESFLTSQWVSYTIDFKDILERNCEEKDYTIWLAHST----DPEDYEDGCILGYKEQFLRLRKSSVCQNGRDYVVTKQPSICLCSLEDFLCDFGYYRPENDSKCVEQPELKGHDLEFCLYGREEHLTTNGYRKIPGDKCQGGVNP 729          
BLAST of Sortilin vs. Ensembl Human
Match: SORT1 (sortilin 1 [Source:HGNC Symbol;Acc:HGNC:11186])

HSP 1 Score: 396.741 bits (1018), Expect = 5.773e-126
Identity = 220/613 (35.89%), Postives = 343/613 (55.95%), Query Frame = 1
Query:  283 SDIYFSDNNGKSFKRITESLPIKKVIVRKENGLQRNILDHQNIFLVCYDTVERSA------LLITKDGGETWKKVELNFILDREIKFHPFEKSWMITVNKARNLYKSIDGGLTWEFLLSDVLQYQWTTDKNYPQDIFVKTGKILETSIFEKIFGISNQKAPVMNLKKSTDAGKSWKIIKKNIFAFFLRDKFLYISELITGNR-RRLMVSIDNGNTFNKVYLPTIANNQFFSILHIEEDSVYIHVDNADTRGDGILFTSDSDGQVFSQSLMNHFYPSAELTSDFYKVESMRGTYIASQLNPDRSIQSLITFNRGAEWKRIKKPVNETCH--NKDKTECFVQVTGAYSLMN--NVPSSLPLSTPTAIGIVLVHAHLANSLKNSVSDVYITSDGGYNWIKALDGPHDYVIADHGGLLVAMGSNKK---FIKFSTDEGRCWHEHQYTTEDIRVTGLLTEPGNKAMTVAIWGYSNN--DTQWIIHVVDLSQLLSRECDDSDYEKWYAHSEMMHPNGENYA-GCLLGKKEEFLRLKKDSLCKNGYSHKVTKTEKICPCTKDDFECEYGYFRTVNSKNCIKNELIKEN---LCVKGIVEKIITQGYKKIPSDVCEGGFSP 2061
            S +Y S++ GK+FK IT+   I    +R E G+     +   + L    T E S       +  + D  + + + +L F    ++ + P    +++ ++    L+ S + G  WE +   V   +W +D                T  F      S      + L +++D GKS+K I   I++F L  +FL+ S +   +  RR+ VS D G+T++   LP++   QF+SIL   +D V++HVD     G G +FTSD  G V+S+SL  H Y +    +DF  V S+RG YI S L+ D SIQ++ITF++G  W  ++KP N  C    K+K EC + +  +YS+    NVP + PLS P A+GIV+ H  + +++   V DVYI+ DGGY+W K L+GPH Y I D GG++VA+  + +    IKFSTDEG+CW  + +T + I  TGL +EPG ++M ++IWG++ +   +QW+ + +D   +L R C++ DY  W AHS     + E+Y  GC+LG KE+FLRL+K S+C+NG  + VTK   IC C+ +DF C++GY+R  N   C++   +K +    C+ G  E + T GY+KIP D C+GG +P
Sbjct:    6 SKLYRSEDYGKNFKDITDL--INNTFIRTEFGMAIGPENSGKVVL----TAEVSGGSRGGRIFRSSDFAKNFVQTDLPFHPLTQMMYSPQNSDYLLALSTENGLWVSKNFGGKWEEIHKAVCLAKWGSDN---------------TIFFTTYANGSCTDLGALELWRTSDLGKSFKTIGVKIYSFGLGGRFLFASVMADKDTTRRIHVSTDQGDTWSMAQLPSVGQEQFYSILAANDDMVFMHVDEPGDTGFGTIFTSDDRGIVYSKSLDRHLYTTTGGETDFTNVTSLRGVYITSVLSEDNSIQTMITFDQGGRWTHLRKPENSECDATAKNKNECSLHIHASYSISQKLNVPMA-PLSEPNAVGIVIAHGSVGDAISVMVPDVYISDDGGYSWTKMLEGPHYYTILDSGGIIVAIEHSSRPINVIKFSTDEGQCWQTYTFTRDPIYFTGLASEPGARSMNISIWGFTESFLTSQWVSYTIDFKDILERNCEEKDYTIWLAHST----DPEDYEDGCILGYKEQFLRLRKSSVCQNGRDYVVTKQPSICLCSLEDFLCDFGYYRPENDSKCVEQPELKGHDLEFCLYGREEHLTTNGYRKIPGDKCQGGVNP 592          
BLAST of Sortilin vs. Ensembl Human
Match: SORCS1 (sortilin related VPS10 domain containing receptor 1 [Source:HGNC Symbol;Acc:HGNC:16697])

HSP 1 Score: 206.453 bits (524), Expect = 2.939e-54
Identity = 160/652 (24.54%), Postives = 313/652 (48.01%), Query Frame = 1
Query:  157 SKFVFTNDTK-TSVQVTWAGDNSGKIILVTTKEIQIILTYADLSDIYFSDNNGKSFKRITESLPIKKVIVRKENGLQRNILDHQNIFLVCYDTVERSALLITKDGGETWKKVELNFILDREIKFHPFEKSWMITVNKARNLYKSIDGGLTWEFLLSDVL--QYQWTTDKNYPQDIFVKTGKILETSIFEKIFGISNQKAPVMNLKKSTDAGKSWKIIKK-NIFAFFLRDKFLYISELITGNRRRLMVSIDNGNTFNKVYLPTIANNQFFSILHIEEDSVYIHVDNADTRGDGILFTSDSDGQVFSQSLMN---HFYPSAELTSDFYKVESMRGTYIASQLNPDRSIQSLITFNRGAEWKRIKKPVNETCHNKDKTECFVQVTGAYSLM----NNVPSSLPLSTPTAIGIVLVHAHLANSLKNSVSDVYITSDGGYNWIKALDGPHDYVIADHGGLLVAMGSNKKFIK---FSTDEGRCWHEHQYTTEDIRVTGLLTEPGNKAMTVAIWGYSNNDTQWIIHVVDLSQLLSRECDDSDYEKWYAHSEMMHPNGENYAGCLLGKKEEFLRLKKDSLCKNGYSHKVTKTEKICPCTKDDFECEYGYFRTVNSKNCI------KNELIKENLCVKGIVEKIITQGYKKIPSDVCEGG 2052
            + F  T D+      V W+G NS  +IL+ TK     L     S ++ S + G +++++ + + +K ++    + L     + + I L+    +E S+LLI+ D G T++K  LNF + + + FHP ++ W++  ++ + LY S + G  W+ +   V+  ++ W+   +  +   V     LE    +      +       ++  T+A ++       +  +  ++D ++++ +L +G R    VS    N F ++ LP  A  +   ++  +E+ V+  V   +      L+ SD+ G  F+ +L N      P   +  D Y+V  ++G ++A++   D  +++ IT+N+G +W+ ++ P  +T    D   C +     +  +    N   S +  S  TA  I++   ++ + L ++   ++++SD G  W +  +  H  +  D GG+LVAM      I+    S DEGR W ++ +T+  + V G+L EPG + + + ++G+ ++ ++W +  VD   +  R C + DY  W  HS+     GE    C++G K  + + K +  C  G      ++E  C CT+ DF+C+YGY R  N + C+       + L K+  C  G    + + GY+K+ S+ C  G
Sbjct:  163 TTFALTGDSAHNQAMVHWSGHNS-SVILILTKLYDYNLGSITESSLWRSTDYGTTYEKLNDKVGLKTIL----SYLYVCPTNKRKIMLLTDPEIE-SSLLISSDEGATYQKYRLNFYI-QSLLFHPKQEDWILAYSQDQKLYSSAEFGRRWQLIQEGVVPNRFYWSVMGSNKEPDLVH----LEARTVD-----GHSHYLTCRMQNCTEANRNQPFPGYIDPDSLIVQDHYVFV-QLTSGGRPHYYVSYRR-NAFAQMKLPKYALPKDMHVISTDENQVFAAVQEWNQNDTYNLYISDTRGVYFTLALENVQSSRGPEGNIMIDLYEVAGIKGMFLANK-KIDNQVKTFITYNKGRDWRLLQAP--DTDLRGDPVHCLLPYCSLHLHLKVSENPYTSGIIASKDTAPSIIVASGNIGSELSDTDISMFVSSDAGNTWRQIFEEEHSVLYLDQGGVLVAMKHTSLPIRHLWLSFDEGRSWSKYSFTSIPLFVDGVLGEPGEETLIMTVFGHFSHRSEWQLVKVDYKSIFDRRCAEEDYRPWQLHSQ-----GE---ACIMGAKRIYKKRKSERKCMQGKYAGAMESEP-CVCTEADFDCDYGYERHSNGQ-CLPAFWFNPSSLSKD--CSLG-QSYLNSTGYRKVVSNNCTDG 780          
BLAST of Sortilin vs. Ensembl Human
Match: SORL1 (sortilin related receptor 1 [Source:HGNC Symbol;Acc:HGNC:11185])

HSP 1 Score: 204.142 bits (518), Expect = 3.139e-53
Identity = 184/682 (26.98%), Postives = 318/682 (46.63%), Query Frame = 1
Query:  166 VFTNDTKTSVQVTWAGDNSGKIILVTTKEIQIILTYADLSDIYFSDNNGKSFKRITESLPI------KKVIVRKENGLQRNILDHQNIFLVCYDTVERSALLITKDGGETWKKVELNFILDREIKFHPFEKSWMITVNKA---RNLYKSIDGGLTWEFLLSDVLQYQWTTDK-NYPQDIFVKTGKILETSIFEKIFGISNQKAPVMNLKKSTDAGKS---WKIIKKNIFAFFLRDKFLYISELI--TGNRRR----LMVSIDNGNTFNKVYLPTIANNQFFSILHIEEDSVYIHVDNADTRGDGILFTSDSDGQVFSQSLMNHFYPSA--------------ELTSDFYKVESMRGTYIASQLNP---DRSIQSLITFNRGAEWKRIKKPVNETCHNKDKTE----CFVQVTGAYS-LMNNVPSSLP-LSTPTAIGIVLVHAHLANSLKNSVSDVYITSDGGYNWIKALDGPHDYVIADHGGLL--VAMGSNKKFIKFSTDEGRCWHEHQYTTEDIRVTGLLTEPGNKAMTVAIWGYSNNDTQ-WIIHVVDLSQLLSRECDDSDYEKWYAHSEMMHPNGENYAGCLLGKKEEFLRLKKDSLCKNGYSHKVTKTEKICPCTKDDFECEYGYFRT--VNSKNCIKNELIKEN------LCVKGIVEKIITQGYKKIPSDVCEGG 2052
            V  ND+   + V WAG+ S   ++V      + L     SD+Y S + GKSFK+I++ L        + VI +  +    N    + IF   Y       L IT D   T +   + F    ++  H    + ++  +++   + L+KS D G TW  +   V  + W  D  + P  I+++     E S +  +F             +STD  +S    ++I + +  F LRDK+++ ++++   G+ ++    L VS          ++     N+++ I    ED V++ V +++ R +  L+ S+++G  FS SL N  Y S               E  +DF++VE ++G YIA+ +N    + +++S+ITF++G  W+ ++ P       K   E    C + +    S L+N     +P LS  +A G+++    +  +L  S ++VYI+S  G  W +AL GPH Y   DHGG++  +A G     +K+ST+EG  W    ++ + + V GLLTEPG K+    I+G +  +   W+I  V+ +  L   C ++DY+ W        P+ E    CLLG K  F R    + C NG           C CT++D+EC++G+  +  ++ + C+ +             C  G   +  T+GY+KI  D C GG
Sbjct:   96 VSLNDSHNQMVVHWAGEKSN--VIVALARDSLALARPKSSDVYVSYDYGKSFKKISDKLNFGLGNRSEAVIAQFYHSPADN---KRYIFADAY----AQYLWITFDFCNTLQGFSIPFRA-ADLLLHSKASNLLLGFDRSHPNKQLWKSDDFGQTWIMIQEHVKSFSWGIDPYDKPNTIYIERH---EPSGYSTVF-------------RSTDFFQSRENQEVILEEVRDFQLRDKYMFATKVVHLLGSEQQSSVQLWVSFGRKPMRAAQFVTRHPINEYY-IADASEDQVFVCVSHSNNRTN--LYISEAEGLKFSLSLENVLYYSPGGAGSDTLVRYFANEPFADFHRVEGLQGVYIATLINGSMNEENMRSVITFDKGGTWEFLQAPAFTGYGEKINCELSQGCSLHLAQRLSQLLNLQLRRMPILSKESAPGLIIATGSVGKNLA-SKTNVYISSSAGARWREALPGPHYYTWGDHGGIITAIAQGMETNELKYSTNEGETWKTFIFSEKPVFVYGLLTEPGEKSTVFTIFGSNKENVHSWLILQVNATDALGVPCTENDYKLW-------SPSDERGNECLLGHKTVFKRRTPHATCFNGEDFDRPVVVSNCSCTREDYECDFGFKMSEDLSLEVCVPDPEFSGKSYSPPVPCPVGSTYR-RTRGYRKISGDTCSGG 739          
BLAST of Sortilin vs. Ensembl Human
Match: SORCS2 (sortilin related VPS10 domain containing receptor 2 [Source:HGNC Symbol;Acc:HGNC:16698])

HSP 1 Score: 195.282 bits (495), Expect = 1.276e-50
Identity = 166/669 (24.81%), Postives = 299/669 (44.69%), Query Frame = 1
Query:  157 SKFVFTND-TKTSVQVTWAGDNSGKIILVTTKEIQIILTYADLSDIYFSDNNGKSFKRITESLPIKKVIVRKENGLQRNILDHQNIFLVCYDTVER-SALLITKDGGETWKKVELNFILDREIKFHPFEKSWMITVNKARNLYKSIDGGLTWEFLLSDVLQYQWTTDKNYPQDIFVKTGKILETSIFEKIFGISNQKAPVMNLKKSTDAGKSWKII--------KKNIFAFF----------LRDKFLYISELITGNRRRLMVSIDNGNTFNKVYLPTIANNQFFSILHIEEDSVYIHVDNADTRGDGILFTSDSDGQVFS---QSLMNHFYPSAELTSDFYKVESMRGTYIASQLNPDRSIQSLITFNRGAEWKRIKKP---VNETCHNKDKTECFVQVTGAYSLMNNVPSSLPLSTPTAIGIVLVHAHLANSLKNSVSDVYITSDGGYNWIKALDGPHDYVIADHGGLLVAMGSNK---KFIKFSTDEGRCWHEHQYTTEDIRVTGLLTEPGNKAMTVAIWGYSNNDTQWIIHVVDLSQLLSRECDDSDYEKWYAHSEMMHPNGENYAGCLLGKKEEFLRLKKDSLCKNGYSHKVTKTEKICPCTKDDFECEYGYFRTVN--------SKNCIKNELIKENLCVKGIVEKIITQGYKKIPSDVCEGG 2052
            + FV   D T     V W G+NS  +IL+ TK     +     S ++ S + G S+ ++T    +  VI    +       + + + LV     +R  +L ++ D G T++K  + F ++  I FHP E+  ++   K   LY S D G  W  L                        ++ +  +F  + G+     P +   ++ D G  ++ +        +K + A F          ++D +++  +  + N+ +  VS    N F  + LP  A  +   I+  +E  V++ V          L+ SD  G  ++   Q + +       +  D  +V  ++G ++A+Q   D  + +LIT+N+G +W  ++ P   +N    N    +C + +   ++  N   S    +  TA G+++   +L + L     ++YITSD G+ W +  +  H  +  DHGG++VA+       K +KFS DEG  W  H +T+  + V GLL+EPG++ + + ++G+ +  + W +  VD     SR+C + DY  W    E+ +  G+    C++G++  F + K  S C  G S     T ++C C   DF C+YG+ R+ +        S N   N L   + C  G      + GY+K+ S+VCEGG
Sbjct:  137 TSFVLKGDATHNQAMVHWTGENS-SVILILTKYYHADMGKVLESSLWRSSDFGTSYTKLTLQPGVTTVI----DNFYICPTNKRKVILVSSSLSDRDQSLFLSADEGATFQKQPIPFFVETLI-FHPKEEDKVLAYTKESKLYVSSDLGKKWTLLQE----------------------RVTKDHVFWSVSGVDAD--PDLVHVEAQDLGGDFRYVTCAIHNCSEKMLTAPFAGPIDHGSLTVQDDYIFF-KATSANQTKYYVSYRR-NEFVLMKLPKYALPKDLQIISTDESQVFVAVQEWYQMDTYNLYQSDPRGVRYALVLQDVRSSRQAEESVLIDILEVRGVKGVFLANQ-KIDGKVMTLITYNKGRDWDYLRPPSMDMNGKPTNCKPPDCHLHLHLRWA-DNPYVSGTVHTKDTAPGLIMGAGNLGSQLVEYKEEMYITSDCGHTWRQVFEEEHHILYLDHGGVIVAIKDTSIPLKILKFSVDEGLTWSTHNFTSTSVFVDGLLSEPGDETLVMTVFGHISFRSDWELVKVDFRPSFSRQCGEEDYSSW----ELSNLQGDR---CIMGQQRSFRKRKSTSWCIKGRSFTSALTSRVCECRDSDFLCDYGFERSSSSESSTNKCSANFWFNPLSPPDDCALGQT-YTSSLGYRKVVSNVCEGG 763          
BLAST of Sortilin vs. Ensembl Zebrafish
Match: sort1a (sortilin 1a [Source:NCBI gene;Acc:406511])

HSP 1 Score: 418.698 bits (1075), Expect = 4.243e-133
Identity = 241/663 (36.35%), Postives = 375/663 (56.56%), Query Frame = 1
Query:  175 NDTKTSVQVTWAGDNSGKIILVTTKEIQIILTYADLSDIYFSDNNGKSFKRITESLPIKKVIVRKENGLQRNILDHQNIFLVCYDTVERSALLITK--DGGETWKKVELNFILDREIKFHPFEKSWMITVNKARNLYKSIDGGLTWEFLLSDVLQYQWTTDKNYPQDIFVKTGKILETSIFEKIFGISNQKAPVMNLKKSTDAGKSWKIIKKNIFAFFLRDKFLYISELI-TGNRRRLMVSIDNGNTFNKVYLPTIANNQFFSILHIEEDSVYIHVDNADTRGDGILFTSDSDGQVFSQSLMNHFYPSAELTSDFYKVESMRGTYIASQLNPDRSIQSLITFNRGAEWKRIKKPVNETCHN--KDKTECFVQVTGAYSLMN--NVPSSLPLSTPTAIGIVLVHAHLANSLKNSVSDVYITSDGGYNWIKALDGPHDYVIADHGGLLVAMGSNKKF----IKFSTDEGRCWHEHQYTTEDIRVTGLLTEPGNKAMTVAIWGYSNN--DTQWIIHVVDLSQLLSRECDDSDYEKWYAHSEMMHPNGENYAGCLLGKKEEFLRLKKDSLCKNGYSHKVTKTEKICPCTKDDFECEYGYFRTVNSKNCIKN-ELIKENL--CVKGIVEKIITQGYKKIPSDVCEGGFSPDKTKQKWLNQTCVEDEFK 2115
            ND   SV + W GD +G ++++TT ++ + +     S +Y S++ GK+F+ IT+   I    ++ E G+     D+    ++  D  E     I +  D G+++   EL F    +I ++P + + ++  +   +L+ S D G  W+ +   V   +W  D      IF+ T               S      + L+KS D GK++K I   I++F L  +F++ S +  +G+ R + VS+D G T++   LPT+ + QF+SIL    D V++HVD     G G ++ SD  G VFS+SL  H Y +    +DF  + S+RG YI S L  D S++++ITFN+G EW+ + KP N  C +  K  +EC + +  +YS+    NVP   PLS   A+G+VL H  +  ++     DVY++ DGGY W +AL GPH Y I D GGLLVA+  N       IKFSTDEG+CWH H +T + I  TGL +EPG ++M V++WGY +   +  W+   VD  QLLSR+C ++DY +W AHS  ++   +   GC+LG KE FLRL++DS+C NG  +KVTK    CPCT  DF+C++G++   NS  C++  +LI  +L  C+ G  E++ T GY+KIP D CE G +P++ K+  L++ CV +  +
Sbjct:   90 NDLSGSVSLAWVGDGTGVLLVLTTFQVPLFIMRFGQSKLYRSEDYGKTFQDITDL--INNTFIQTEFGIAIGP-DNSGKVILTGDLAEEKVTKIFRSVDFGKSFVTSELPFHPLMQITYNPKDSNILMVYSINYDLWLSKDFGANWKKIHESVCLVKWGIDDT----IFLTTNP-----------NGSCSDRGTLELRKSLDYGKTFKTIGNRIYSFGLGGRFVFASIMTDSGSTRMIHVSVDQGETWDMAQLPTVGHEQFYSILAANNDMVFMHVDEPGDSGIGTIYISDDRGIVFSKSLERHLYTTTGGDTDFTNITSLRGVYITSVLAEDGSVRTVITFNQGGEWRPLMKPWNGVCDSTAKHPSECSLHIHASYSISMKLNVPMQ-PLSETNAVGLVLAHGSVGGAVSVLSPDVYVSDDGGYTWFQALKGPHHYAILDSGGLLVAVEHNPTHPISQIKFSTDEGQCWHTHNFTDDPIYFTGLASEPGARSMNVSLWGYRDTILNQYWVSVTVDFRQLLSRDCQENDYIQWLAHSSDINSPTD---GCVLGYKERFLRLRRDSVCWNGRDYKVTKEPTTCPCTLTDFQCDFGFYHEENSSVCVEQPDLIGHSLEFCLHGRKEQLQTSGYRKIPGDHCEEGITPER-KEIDLSKKCVSNLLR 729          
BLAST of Sortilin vs. Ensembl Zebrafish
Match: sort1a (sortilin 1a [Source:NCBI gene;Acc:406511])

HSP 1 Score: 418.313 bits (1074), Expect = 6.079e-133
Identity = 241/663 (36.35%), Postives = 375/663 (56.56%), Query Frame = 1
Query:  175 NDTKTSVQVTWAGDNSGKIILVTTKEIQIILTYADLSDIYFSDNNGKSFKRITESLPIKKVIVRKENGLQRNILDHQNIFLVCYDTVERSALLITK--DGGETWKKVELNFILDREIKFHPFEKSWMITVNKARNLYKSIDGGLTWEFLLSDVLQYQWTTDKNYPQDIFVKTGKILETSIFEKIFGISNQKAPVMNLKKSTDAGKSWKIIKKNIFAFFLRDKFLYISELI-TGNRRRLMVSIDNGNTFNKVYLPTIANNQFFSILHIEEDSVYIHVDNADTRGDGILFTSDSDGQVFSQSLMNHFYPSAELTSDFYKVESMRGTYIASQLNPDRSIQSLITFNRGAEWKRIKKPVNETCHN--KDKTECFVQVTGAYSLMN--NVPSSLPLSTPTAIGIVLVHAHLANSLKNSVSDVYITSDGGYNWIKALDGPHDYVIADHGGLLVAMGSNKKF----IKFSTDEGRCWHEHQYTTEDIRVTGLLTEPGNKAMTVAIWGYSNN--DTQWIIHVVDLSQLLSRECDDSDYEKWYAHSEMMHPNGENYAGCLLGKKEEFLRLKKDSLCKNGYSHKVTKTEKICPCTKDDFECEYGYFRTVNSKNCIKN-ELIKENL--CVKGIVEKIITQGYKKIPSDVCEGGFSPDKTKQKWLNQTCVEDEFK 2115
            ND   SV + W GD +G ++++TT ++ + +     S +Y S++ GK+F+ IT+   I    ++ E G+     D+    ++  D  E     I +  D G+++   EL F    +I ++P + + ++  +   +L+ S D G  W+ +   V   +W  D      IF+ T               S      + L+KS D GK++K I   I++F L  +F++ S +  +G+ R + VS+D G T++   LPT+ + QF+SIL    D V++HVD     G G ++ SD  G VFS+SL  H Y +    +DF  + S+RG YI S L  D S++++ITFN+G EW+ + KP N  C +  K  +EC + +  +YS+    NVP   PLS   A+G+VL H  +  ++     DVY++ DGGY W +AL GPH Y I D GGLLVA+  N       IKFSTDEG+CWH H +T + I  TGL +EPG ++M V++WGY +   +  W+   VD  QLLSR+C ++DY +W AHS  ++   +   GC+LG KE FLRL++DS+C NG  +KVTK    CPCT  DF+C++G++   NS  C++  +LI  +L  C+ G  E++ T GY+KIP D CE G +P++ K+  L++ CV +  +
Sbjct:   90 NDLSGSVSLAWVGDGTGVLLVLTTFQVPLFIMRFGQSKLYRSEDYGKTFQDITDL--INNTFIQTEFGIAIGP-DNSGKVILTGDLAEEKVTKIFRSVDFGKSFVTSELPFHPLMQITYNPKDSNILMVYSINYDLWLSKDFGANWKKIHESVCLVKWGIDDT----IFLTTNP-----------NGSCSDRGTLELRKSLDYGKTFKTIGNRIYSFGLGGRFVFASIMTDSGSTRMIHVSVDQGETWDMAQLPTVGHEQFYSILAANNDMVFMHVDEPGDSGIGTIYISDDRGIVFSKSLERHLYTTTGGDTDFTNITSLRGVYITSVLAEDGSVRTVITFNQGGEWRPLMKPWNGVCDSTAKHPSECSLHIHASYSISMKLNVPMQ-PLSETNAVGLVLAHGSVGGAVSVLSPDVYVSDDGGYTWFQALKGPHHYAILDSGGLLVAVEHNPTHPISQIKFSTDEGQCWHVHNFTDDPIYFTGLASEPGARSMNVSLWGYRDTILNQYWVSVTVDFRQLLSRDCQENDYIQWLAHSSDINSPTD---GCVLGYKERFLRLRRDSVCWNGRDYKVTKEPTTCPCTLTDFQCDFGFYHEENSSVCVEQPDLIGHSLEFCLHGRKEQLQTSGYRKIPGDHCEEGITPER-KEIDLSKKCVSNLLR 729          
BLAST of Sortilin vs. Ensembl Zebrafish
Match: sort1b (sortilin 1b [Source:ZFIN;Acc:ZDB-GENE-030131-7447])

HSP 1 Score: 413.69 bits (1062), Expect = 5.963e-131
Identity = 239/688 (34.74%), Postives = 373/688 (54.22%), Query Frame = 1
Query:  175 NDTKTSVQVTWAGDNSGKIILVTTKEIQIILTYADLSDIYFSDNNGKSFKRITESLPIKKVIVRKENGLQRNILDHQNIFLVCYDTVERSALLI-TKDGGETWKKVELNFILDREIKFHPFEKSWMITVNKARNLYKSIDGGLTWEFLLSDVLQYQWTTDKNYPQDIFVKTGKILETSIFEKIFGISNQKAPVMNLKKSTDAGKSWKIIKKNIFAFFLRDKFLYISELI-TGN---------RRRLMVSIDNGNTFNKVYLPTIANNQFFSILHIEEDSVYIHVDNADTRGDGILFTSDSDGQVFSQSLMNHFYPSAELTSDFYKVESMRGTYIASQLNPDRSIQSLITFNRGAEWKRIKKPVNETCHN--KDKTECFVQVTGAYS--LMNNVPSSLPLSTPTAIGIVLVHAHLANSLKNSVSDVYITSDGGYNWIKALDGPHDYVIADHGGLLVAMGSNK----KFIKFSTDEGRCWHEHQYTTEDIRVTGLLTEPGNKAMTVAIWGYSNND-TQWIIHVVDLSQLLSRECDDSDYEKWYAHSEMMHPNGENYAGCLLGKKEEFLRLKKDSLCKNGYSHKVTKTEKICPCTKDDFECEYGYFRTVNSKNCIKNELIKEN---LCVKGIVEKIITQGYKKIPSDVCEGGFSPDKTKQKWLNQTCVEDEFKKIVVPISNTDSNTTAKHS 2169
             D   SV + W GD +G ++ +TT ++ ++      S +Y S+N GKSF+ ++E   I    +  + G+     +   + L    +    A +  ++D G+++   EL F    +I ++P     +  ++   +L+ S D G TW  +   V   +W  D      +F  T   L  S F+K          ++ L+KS D G + K + + I++F +  +FL+ S +  +GN          R + VS+D G T+N   LP +++ QF+SIL   +D V++HVD     G G ++ SD  G V+S+SL  H Y   E  +DF  V S+RG Y  S L  D S+Q++ITF++G EW  +KKP N  C +  KD   C + +  +YS  +  NVP   PLS P A+G++L H  + +++     DVY++ DGGY W++AL GPH Y I D GGLLVA+  N+      IKFSTDEG+CWH H +T   +  TGL +EPG +++ V++WGY +   + W+ + +D   LL R C+  DY +W AHS+ +    +   GC+LG KE FLR++KDS+C  G  + V K    C CT DDF C++GY+R   S  CI+   +K +   +C+ G  E++ T GY+KIP D CEGG  P++ K   L++ CV D       P++N  S  +  H+
Sbjct:   94 QDISGSVSLAWVGDGTGVVLALTTFQMPLVFLRFGQSKLYRSENYGKSFEDVSEL--INNTFINTDFGIAIGPENSGKVILTGDASGGSGARIFRSRDFGKSFVHTELPFHPLMQIMYNPQTTDVLAAISTKHDLWISKDFGTTWTKIHEMVCVVKWGIDA-----LFFSTN--LNGSCFDK---------GMLVLRKSVDLGANIKTVAERIYSFGIGGRFLFASVMAASGNIIPSASEEIMRAIHVSVDLGETWNMAQLPPVSHEQFYSILAANDDMVFMHVDEPGDTGIGTIYVSDDRGTVYSKSLERHLYTGGE--TDFTNVTSLRGVYTTSVLAEDNSVQTVITFDQGGEWVPLKKPENTKCDSTAKDAEMCSLHIHASYSTSMKVNVPMP-PLSEPNAVGLILAHGSVGDAISMQTPDVYVSDDGGYTWLQALKGPHHYAILDSGGLLVAVEHNQAKPISEIKFSTDEGQCWHVHTFTQTPMYFTGLASEPGARSVNVSLWGYEDAMISHWVTYTIDFKDLLKRNCESDDYVQWLAHSDDI---SDPEDGCMLGYKERFLRVRKDSVCWIGREYVVNKQPTPCVCTLDDFLCDFGYYRKEKSSECIEQAELKGHDLEICIHGKKEQLQTSGYRKIPGDKCEGGKQPER-KVIDLSKRCVSDLLDP--QPLNNPQSEQSTSHT 754          
BLAST of Sortilin vs. Ensembl Zebrafish
Match: sort1a (sortilin 1a [Source:NCBI gene;Acc:406511])

HSP 1 Score: 410.223 bits (1053), Expect = 7.640e-130
Identity = 240/663 (36.20%), Postives = 373/663 (56.26%), Query Frame = 1
Query:  175 NDTKTSVQVTWAGDNSGKIILVTTKEIQIILTYADLSDIYFSDNNGKSFKRITESLPIKKVIVRKENGLQRNILDHQNIFLVCYDTVERSALLITK--DGGETWKKVELNFILDREIKFHPFEKSWMITVNKARNLYKSIDGGLTWEFLLSDVLQYQWTTDKNYPQDIFVKTGKILETSIFEKIFGISNQKAPVMNLKKSTDAGKSWKIIKKNIFAFFLRDKFLYISELI-TGNRRRLMVSIDNGNTFNKVYLPTIANNQFFSILHIEEDSVYIHVDNADTRGDGILFTSDSDGQVFSQSLMNHFYPSAELTSDFYKVESMRGTYIASQLNPDRSIQSLITFNRGAEWKRIKKPVNETCHN--KDKTECFVQVTGAYSLMN--NVPSSLPLSTPTAIGIVLVHAHLANSLKNSVSDVYITSDGGYNWIKALDGPHDYVIADHGGLLVAMGSNKKF----IKFSTDEGRCWHEHQYTTEDIRVTGLLTEPGNKAMTVAIWGYSNN--DTQWIIHVVDLSQLLSRECDDSDYEKWYAHSEMMHPNGENYAGCLLGKKEEFLRLKKDSLCKNGYSHKVTKTEKICPCTKDDFECEYGYFRTVNSKNCIKN-ELIKENL--CVKGIVEKIITQGYKKIPSDVCEGGFSPDKTKQKWLNQTCVEDEFK 2115
            ND   SV + W GD +G ++++TT ++ + +     S +Y S++ GK+F+ IT+   I    ++ E G+     D+    ++  D  E     I +  D G+++   EL F    +I ++P + + ++  +   +L+ S D G  W+ +   V   +W  D      IF+ T               S      + L+KS D GK++K I   I++F L  +F++ S +  +G+ R + VS+D G T++   LPT+ + QF+SIL    D V++HVD     G G ++ SD  G VFS+SL  H Y +    +DF  + S+RG YI S L  D S++++ITFN+G EW+ + KP N  C +  K  +EC + +  +YS+    NVP   PLS   A+G+VL H  +  ++     DVY++ DGGY W +AL GPH Y I D GGLLVA+  N       IKFSTDEG+CWH H +T + I  TGL +EPG ++M V++WGY +   +  W+   VD  QLLSR+C ++DY +W AHS  ++   +   GC+LG KE FLRL++DS+C NG  +KVTK    CPCT  DF  ++G++   NS  C++  +LI  +L  C+ G  E++ T GY+KIP D CE G +P++ K+  L++ CV +  +
Sbjct:   90 NDLSGSVSLAWVGDGTGVLLVLTTFQVPLFIMRFGQSKLYRSEDYGKTFQDITDL--INNTFIQTEFGIAIGP-DNSGKVILTGDLAEEKVTKIFRSVDFGKSFVTSELPFHPLMQITYNPKDSNILMVYSINYDLWLSKDFGANWKKIHESVCLVKWGIDDT----IFLTTNP-----------NGSCSDRGTLELRKSLDYGKTFKTIGNRIYSFGLGGRFVFASIMTDSGSTRMIHVSVDQGETWDMAQLPTVGHEQFYSILAANNDMVFMHVDEPGDSGIGTIYISDDRGIVFSKSLERHLYTTTGGDTDFTNITSLRGVYITSVLAEDGSVRTVITFNQGGEWRPLMKPWNGVCDSTAKHPSECSLHIHASYSISMKLNVPMQ-PLSETNAVGLVLAHGSVGGAVSVLSPDVYVSDDGGYTWFQALKGPHHYAILDSGGLLVAVEHNPTHPISQIKFSTDEGQCWHTHNFTDDPIYFTGLASEPGARSMNVSLWGYRDTILNQYWVSVTVDFRQLLSRDCQENDYIQWLAHSSDINSPTD---GCVLGYKERFLRLRRDSVCWNGRDYKVTKEPTTCPCTLTDFH-DFGFYHEENSSVCVEQPDLIGHSLEFCLHGRKEQLQTSGYRKIPGDHCEEGITPER-KEIDLSKKCVSNLLR 728          
BLAST of Sortilin vs. Ensembl Zebrafish
Match: si:dkey-159a18.1 (si:dkey-159a18.1 [Source:ZFIN;Acc:ZDB-GENE-041210-204])

HSP 1 Score: 270.781 bits (691), Expect = 8.935e-82
Identity = 143/389 (36.76%), Postives = 218/389 (56.04%), Query Frame = 1
Query: 1018 GILFTSDSDGQVFSQSLMNHFYPSAELTSDFYKVESMRGTYIASQLNPDRSIQSLITFNRGAEWKRIKKPVNETCHNKDKTECFVQVTGAYSLMNNVPSSLPLSTPTAIGIVLVHAHLANSLKNSVSDVYITSDGGYNWIKALDGPHDYVIADHGGLLVAMGSNK----KFIKFSTDEGRCWHEHQYTTEDIRVTGLLTEPGNKAMTVAIWGYS---NNDTQWIIHVVDLSQLLSRECDDSDYEKWYAHSEMMHPNGENYAGCLLGKKEEFLRLKKDSLCKNGYSHKVTKTEKICPCTKDDFECEYGYFRTVNSKNCIKNELI---KENLCVKGIVEKIITQGYKKIPSDVCEGGFSPDKTKQKWLNQTCVEDEFKKIVVPISNTDSNT 2154
            G ++ SD  G ++S+SL  H +   E  SDF  + S+RG Y+ + L     I+S+I+FNRG  W+ +KKP N  C +  K +C + + G +S  + V    P S PTAIG+V+ H  + +S+  +  DVY++ DGGY W   L GPH Y I D GGL+VA+ + +      IKFSTDEG+CW    +T     + GL +EP +  M ++I+GY    N+   W+   +D   LL+REC+D DY  W AHS   + +     GCLLG KE F RLK  S C+NG  + V++ +  C CT +DF C+YG++   NS  C+         ++ C+   ++   T GY++IP D C+G FSP +           E+  +K+   ++++DS+T
Sbjct:   14 GTVYASDEQGILYSKSLERHLF-GGEGKSDFTNITSLRGVYLTNILEEGGCIRSVISFNRGGRWRYLKKPENVDCPDMSK-KCNLHIHGEHSHFSGVTPMTPSSEPTAIGLVIGHGSVGDSISAARPDVYVSRDGGYTWWGTLRGPHHYSILDSGGLIVAVEARRDRGISSIKFSTDEGQCWKTFNFTDHPFFLAGLASEPSSSTMNISIFGYRLDDNHKPMWVAVTIDFEHLLTRECNDQDYVTWLAHSN--YSSNPKTDGCLLGYKETFRRLKTLSACRNGRGYVVSRQQSPCICTSEDFMCDYGFYWHENSSACLPQPDFLNQTQDFCLNVDLQ---TTGYRRIPGDKCKGSFSPPRN----------EEAHQKLCGNVTSSDSHT 385          
BLAST of Sortilin vs. Ensembl Xenopus
Match: SORT1 (sortilin 1 [Source:NCBI gene;Acc:100490074])

HSP 1 Score: 388.652 bits (997), Expect = 3.645e-122
Identity = 226/707 (31.97%), Postives = 377/707 (53.32%), Query Frame = 1
Query:   88 SVDQVCDSQKEVIGNAFKNNNPISKFVFTNDTKTSVQVTWAGDNSGKIILVTTKEIQIILTYADLSDIYFSDNNGKSFKRITESLPIKKVIVRKENGLQRNILDHQNIFLVC--YDTVERSALLITKDGGETWKKVELNFILDREIKFHPFEKSWMITVNKARNLYKSIDGGLTWEFLLSDVLQYQWTTDKNYPQDIFVKTGKILETSIFEKIFGISNQKAP--VMNLKKSTDAGKSWKIIKKNIFAFFLRDKFLYISEL-ITGNRRRLMVSIDNGNTFNKVYLPTIANNQFFSILHIEEDSVYIHVDNADTRGDGILFTSDSDGQVFSQSLMNHFYPSAELTSDFYKVESMRGTYIASQLNPDRSIQSLITFNRGAEWKRIKKPVNETCHN--KDKTECFVQVTGAYSLMNNVPSSL-PLSTPTAIGIVLVHAHLANSLKNSVSDVYITSDGGYNWIKALDGPHDYVIADHGGLLVAMGSNK---KFIKFSTDEGRCWHEHQYTTEDIRVTGLLTEPGNKAMTVAIWGYSNNDTQ--WIIHVVDLSQLLSRECDDSDYEKWYAHSEMMHPNGENYAGCLLGKKEEFLRLKKDSLCKNGYSHKVTKTEKICPCTKDDFECEYGYFRTVNSKNCIKNELIKE---NLCVKGIVEKIITQGYKKIPSDVCEGGFSPDKTKQKWLNQTCVEDEFKKIVVPISNTDSNTTA 2160
            +VD  C  +K     A +N+    +F    D    + + W GD +G I+++TT  I + +     S +Y S++ GK+F+ +T    I    +  E G+     +   + LV       +   +  + D  + + + +L F     + +     ++++ ++    L+ S D G TW+ +   V   +W         I   T +             ++ KA   +M LK+++D G++++++K+ + +F L  +FL  S + + G +R++ VS + GNT+N   LP +   QF+S+L   +D V+IHVD+    G G ++TSD  G ++S+SL  H Y +    +DF  V S+ G +I S L+ D SI S+ITF++G EW  ++KP N  C +  KDK +C + +   YS+   +P  + PLS P A+GIV+ H  + +++  S   VY++ DGGY+W + LDGPH Y I D GGL+VA+  N      +KFS DEG+CW  +++T +    TGL +EPG  ++ V IWGY     +  W+ + +D + LL ++C++ DY  W AHS    P      GC+LG KE++ RL+K S+C+NG  + V+K    C CT DD+ C++GY+R  N   C++   +K    +LCV G  EK+ T GY+KIP D C GG    +          +E + KK  + + NT+ +T++
Sbjct:   56 AVDGTC-QEKWAFQGALENDTHTCQF----DLSGELSLMWIGDGTGIILVLTTFRIPLFVMTYTQSKLYRSNDYGKTFQDVTS--LINHTYIHSEFGMAIGPDNSGKVILVADVSGGSKGGRIFRSSDSAQIFVQTDLLFHPLVSVSYSTENSNFLLVLSVDFGLWISRDFGETWKEIHQSVCSAKWAAGNT----IHFTTAR------------NNSCKADFRLMTLKRTSDFGQTFRVLKERVHSFGLWGRFLLASVVELDGLKRKIHVSQNQGNTWNVAQLPAVTYEQFYSVLAATDDMVFIHVDDEGDTGCGTIYTSDDRGILYSKSLERHLYTTTGGETDFTNVTSLHGVFITSVLSEDNSIHSVITFDQGGEWSPLRKPENAQCDSTAKDKEQCSLHIHAQYSISQRLPVPMPPLSEPNAVGIVIAHGSVGDAVSVSRPGVYLSDDGGYSWSRVLDGPHHYAILDSGGLIVAVEQNDDSVNTVKFSIDEGQCWFYYKFTNDSFIFTGLASEPGALSLNVTIWGYQPGVIRHIWMSYTIDFAHLLHKDCEEKDYILWLAHS--TDPQAP-LDGCVLGYKEQYFRLRKSSVCQNGRDYTVSKVHTPCACTLDDYMCDFGYYRNENESECVEQSELKGQELDLCVYGEEEKLTTSGYRKIPGDKCTGGVQFKR----------MEIDMKKKCLNVENTEVHTSS 726          
BLAST of Sortilin vs. Ensembl Xenopus
Match: SORT1 (sortilin 1 [Source:NCBI gene;Acc:100490074])

HSP 1 Score: 388.652 bits (997), Expect = 1.110e-121
Identity = 226/707 (31.97%), Postives = 377/707 (53.32%), Query Frame = 1
Query:   88 SVDQVCDSQKEVIGNAFKNNNPISKFVFTNDTKTSVQVTWAGDNSGKIILVTTKEIQIILTYADLSDIYFSDNNGKSFKRITESLPIKKVIVRKENGLQRNILDHQNIFLVC--YDTVERSALLITKDGGETWKKVELNFILDREIKFHPFEKSWMITVNKARNLYKSIDGGLTWEFLLSDVLQYQWTTDKNYPQDIFVKTGKILETSIFEKIFGISNQKAP--VMNLKKSTDAGKSWKIIKKNIFAFFLRDKFLYISEL-ITGNRRRLMVSIDNGNTFNKVYLPTIANNQFFSILHIEEDSVYIHVDNADTRGDGILFTSDSDGQVFSQSLMNHFYPSAELTSDFYKVESMRGTYIASQLNPDRSIQSLITFNRGAEWKRIKKPVNETCHN--KDKTECFVQVTGAYSLMNNVPSSL-PLSTPTAIGIVLVHAHLANSLKNSVSDVYITSDGGYNWIKALDGPHDYVIADHGGLLVAMGSNK---KFIKFSTDEGRCWHEHQYTTEDIRVTGLLTEPGNKAMTVAIWGYSNNDTQ--WIIHVVDLSQLLSRECDDSDYEKWYAHSEMMHPNGENYAGCLLGKKEEFLRLKKDSLCKNGYSHKVTKTEKICPCTKDDFECEYGYFRTVNSKNCIKNELIKE---NLCVKGIVEKIITQGYKKIPSDVCEGGFSPDKTKQKWLNQTCVEDEFKKIVVPISNTDSNTTA 2160
            +VD  C  +K     A +N+    +F    D    + + W GD +G I+++TT  I + +     S +Y S++ GK+F+ +T    I    +  E G+     +   + LV       +   +  + D  + + + +L F     + +     ++++ ++    L+ S D G TW+ +   V   +W         I   T +             ++ KA   +M LK+++D G++++++K+ + +F L  +FL  S + + G +R++ VS + GNT+N   LP +   QF+S+L   +D V+IHVD+    G G ++TSD  G ++S+SL  H Y +    +DF  V S+ G +I S L+ D SI S+ITF++G EW  ++KP N  C +  KDK +C + +   YS+   +P  + PLS P A+GIV+ H  + +++  S   VY++ DGGY+W + LDGPH Y I D GGL+VA+  N      +KFS DEG+CW  +++T +    TGL +EPG  ++ V IWGY     +  W+ + +D + LL ++C++ DY  W AHS    P      GC+LG KE++ RL+K S+C+NG  + V+K    C CT DD+ C++GY+R  N   C++   +K    +LCV G  EK+ T GY+KIP D C GG    +          +E + KK  + + NT+ +T++
Sbjct:   56 AVDGTC-QEKWAFQGALENDTHTCQF----DLSGELSLMWIGDGTGIILVLTTFRIPLFVMTYTQSKLYRSNDYGKTFQDVTSL--INHTYIHSEFGMAIGPDNSGKVILVADVSGGSKGGRIFRSSDSAQIFVQTDLLFHPLVSVSYSTENSNFLLVLSVDFGLWISRDFGETWKEIHQSVCSAKWAAGNT----IHFTTAR------------NNSCKADFRLMTLKRTSDFGQTFRVLKERVHSFGLWGRFLLASVVELDGLKRKIHVSQNQGNTWNVAQLPAVTYEQFYSVLAATDDMVFIHVDDEGDTGCGTIYTSDDRGILYSKSLERHLYTTTGGETDFTNVTSLHGVFITSVLSEDNSIHSVITFDQGGEWSPLRKPENAQCDSTAKDKEQCSLHIHAQYSISQRLPVPMPPLSEPNAVGIVIAHGSVGDAVSVSRPGVYLSDDGGYSWSRVLDGPHHYAILDSGGLIVAVEQNDDSVNTVKFSIDEGQCWFYYKFTNDSFIFTGLASEPGALSLNVTIWGYQPGVIRHIWMSYTIDFAHLLHKDCEEKDYILWLAHS--TDPQAP-LDGCVLGYKEQYFRLRKSSVCQNGRDYTVSKVHTPCACTLDDYMCDFGYYRNENESECVEQSELKGQELDLCVYGEEEKLTTSGYRKIPGDKCTGGVQFKR----------MEIDMKKKCLNVENTEVHTSS 726          
BLAST of Sortilin vs. Ensembl Xenopus
Match: SORT1 (sortilin 1 [Source:NCBI gene;Acc:100490074])

HSP 1 Score: 362.459 bits (929), Expect = 2.077e-114
Identity = 177/447 (39.60%), Postives = 274/447 (61.30%), Query Frame = 1
Query:  748 VMNLKKSTDAGKSWKIIKKNIFAFFLRDKFLYISEL-ITGNRRRLMVSIDNGNTFNKVYLPTIANNQFFSILHIEEDSVYIHVDNADTRGDGILFTSDSDGQVFSQSLMNHFYPSAELTSDFYKVESMRGTYIASQLNPDRSIQSLITFNRGAEWKRIKKPVNETCHN--KDKTECFVQVTGAYSLMNNVPSSL-PLSTPTAIGIVLVHAHLANSLKNSVSDVYITSDGGYNWIKALDGPHDYVIADHGGLLVAMGSNK---KFIKFSTDEGRCWHEHQYTTEDIRVTGLLTEPGNKAMTVAIWGYSNNDTQ--WIIHVVDLSQLLSRECDDSDYEKWYAHSEMMHPNGENYAGCLLGKKEEFLRLKKDSLCKNGYSHKVTKTEKICPCTKDDFECEYGYFRTVNSKNCIKNELIKE---NLCVKGIVEKIITQGYKKIPSDVCEGG 2052
            +M LK+++D G++++++K+ + +F L  +FL  S + + G +R++ VS + GNT+N   LP +   QF+S+L   +D V+IHVD+    G G ++TSD  G ++S+SL  H Y +    +DF  V S+ G +I S L+ D SI S+ITF++G EW  ++KP N  C +  KDK +C + +   YS+   +P  + PLS P A+GIV+ H  + +++  S   VY++ DGGY+W + LDGPH Y I D GGL+VA+  N      +KFS DEG+CW  +++T +    TGL +EPG  ++ V IWGY     +  W+ + +D + LL ++C++ DY  W AHS    P      GC+LG KE++ RL+K S+C+NG  + V+K    C CT DD+ C++GY+R  N   C++   +K    +LCV G  EK+ T GY+KIP D C GG
Sbjct:   93 LMTLKRTSDFGQTFRVLKERVHSFGLWGRFLLASVVELDGLKRKIHVSQNQGNTWNVAQLPAVTYEQFYSVLAATDDMVFIHVDDEGDTGCGTIYTSDDRGILYSKSLERHLYTTTGGETDFTNVTSLHGVFITSVLSEDNSIHSVITFDQGGEWSPLRKPENAQCDSTAKDKEQCSLHIHAQYSISQRLPVPMPPLSEPNAVGIVIAHGSVGDAVSVSRPGVYLSDDGGYSWSRVLDGPHHYAILDSGGLIVAVEQNDDSVNTVKFSIDEGQCWFYYKFTNDSFIFTGLASEPGALSLNVTIWGYQPGVIRHIWMSYTIDFAHLLHKDCEEKDYILWLAHS--TDPQAP-LDGCVLGYKEQYFRLRKSSVCQNGRDYTVSKVHTPCACTLDDYMCDFGYYRNENESECVEQSELKGQELDLCVYGEEEKLTTSGYRKIPGDKCTGG 536          
BLAST of Sortilin vs. Ensembl Xenopus
Match: ttll4 (tubulin tyrosine ligase like 4 [Source:Xenbase;Acc:XB-GENE-492394])

HSP 1 Score: 207.223 bits (526), Expect = 2.492e-54
Identity = 181/679 (26.66%), Postives = 313/679 (46.10%), Query Frame = 1
Query:  166 VFTNDTKTSVQVTWAGDNSGKIILVTTKEIQIILTYADLSDIYFSDNNGKSFKRITE--SLPIKKVIVRKENGLQRNILDHQNIFLVCYDTVERSALLITKDGGETWKKVELNFILDREIKFHPFEKSWMITVNK---ARNLYKSIDGGLTWEFLLSDVLQYQWTTDKNYPQDIFVKTGKILETSIFEKIFGISNQKAPVMNLKKSTDAGKSW---KIIKKNIFAFFLRDKFLYISELITGNRRRLMVSIDNGNTFNKVYLPTIANNQF--------FSILHIEEDSVYIHVDNADTRGDGILFTSDSDGQVFSQSLMN--HFYP------------SAELTSDFYKVESMRGTYIASQLN---PDRSIQSLITFNRGAEWKRIKKPVNETCHNKDKTE----CFVQVTGAYSLMNN--VPSSLPLSTPTAIGIVLVHAHLANSLKNSVSDVYITSDGGYNWIKALDGPHDYVIADHGGLLVAM--GSNKKFIKFSTDEGRCWHEHQYTTEDIRVTGLLTEPGNKAMTVAIWG-YSNNDTQWIIHVVDLSQLLSRECDDSDYEKWYAHSEMMHPNGENYAGCLLGKKEEFLRLKKDSLCKNGYSHKVTKTEKICPCTKDDFECEYGY--FRTVNSKNCIKNELIKENL------CVKGIVEKIITQGYKKIPSDVCEGG 2052
            V   D+   + V WAG+ S  I+ +T   + ++   +  S++Y S + GKSFK I+E  ++P         +    +  D++    +         L I+KD  +T       F    ++  H  E S ++  +K    + L+KS D G TW  +   V  Y W                I        I+   ++      + +STD  +S    +II +++  F +RDK+++ ++ +     +   S+    ++N+     + + QF        + I    ED V++ V +++   +  L+ S+++G  FS SL N  +F P            S E  +D ++V  +RG YIA+ LN    + +++S+ITF++G  W+ +  PV      K   E    C + +    S + N  +P    LS  +A G+++    +   + + + ++Y++S  G  W ++L GPH Y   DHGG+LVA+  G +   +K+ST+EG  W    ++ + + V GLLTEPG K+    I+G Y+     WII  ++ S +L   C DSDY+ W        P+ E    CLLG+K  F R    + C NG       T   C CT++DFEC++G+   + ++S+ C+ +      L      C  G      T+GY+K+  D C GG
Sbjct:   20 VSLEDSHNQIVVHWAGEKSQVIVGLTRDSLALLGPKS--SNVYVSYDYGKSFKNISEKFTVPAGSANTATVSQFFHSPADNKRYIFI---DANEQYLWISKDFCDTVNGFPAPF-KPTDLLLHSTEPSLVLGYDKFHPNKQLWKSEDFGQTWTVIQEHVKTYSW---------------GIAPYDKINTIYVERHEPRGTSTVLRSTDFFQSRDKTEIIIEDVDDFQIRDKYMFATKTVHLQDSKKQPSVQLWVSYNR---KAMRSAQFVTRHPITEYYIADASEDQVFVCVSHSNNITN--LYISEAEGLRFSLSLENVLYFNPGGAGSDTLVRYFSNEPFADVHRVRGVRGVYIATILNGSFAEENMRSVITFDKGGTWEFLAAPVYNGYGEKVPCESSRGCSLHLAQRLSQLLNFQIPIMPILSKESAPGLIVATGTVGTDMASKM-NMYVSSTAGVRWRESLLGPHYYTWGDHGGILVAIAQGVDTNQLKYSTNEGETWKTFNFSDKAMIVYGLLTEPGEKSTVFTIFGSYTERGHSWIILQINASDVLGVPCTDSDYKLW-------SPSDERGNECLLGRKTVFKRRTAHATCFNGEDFDRPITVSNCSCTREDFECDFGFKLSKDLSSELCVPDPEFAGKLYPIPIPCPVGTT-YTRTKGYRKVSGDTCSGG 663          
BLAST of Sortilin vs. Ensembl Xenopus
Match: ttll4 (tubulin tyrosine ligase like 4 [Source:Xenbase;Acc:XB-GENE-492394])

HSP 1 Score: 206.838 bits (525), Expect = 3.911e-54
Identity = 181/679 (26.66%), Postives = 313/679 (46.10%), Query Frame = 1
Query:  166 VFTNDTKTSVQVTWAGDNSGKIILVTTKEIQIILTYADLSDIYFSDNNGKSFKRITE--SLPIKKVIVRKENGLQRNILDHQNIFLVCYDTVERSALLITKDGGETWKKVELNFILDREIKFHPFEKSWMITVNK---ARNLYKSIDGGLTWEFLLSDVLQYQWTTDKNYPQDIFVKTGKILETSIFEKIFGISNQKAPVMNLKKSTDAGKSW---KIIKKNIFAFFLRDKFLYISELITGNRRRLMVSIDNGNTFNKVYLPTIANNQF--------FSILHIEEDSVYIHVDNADTRGDGILFTSDSDGQVFSQSLMN--HFYP------------SAELTSDFYKVESMRGTYIASQLN---PDRSIQSLITFNRGAEWKRIKKPVNETCHNKDKTE----CFVQVTGAYSLMNN--VPSSLPLSTPTAIGIVLVHAHLANSLKNSVSDVYITSDGGYNWIKALDGPHDYVIADHGGLLVAM--GSNKKFIKFSTDEGRCWHEHQYTTEDIRVTGLLTEPGNKAMTVAIWG-YSNNDTQWIIHVVDLSQLLSRECDDSDYEKWYAHSEMMHPNGENYAGCLLGKKEEFLRLKKDSLCKNGYSHKVTKTEKICPCTKDDFECEYGY--FRTVNSKNCIKNELIKENL------CVKGIVEKIITQGYKKIPSDVCEGG 2052
            V   D+   + V WAG+ S  I+ +T   + ++   +  S++Y S + GKSFK I+E  ++P         +    +  D++    +         L I+KD  +T       F    ++  H  E S ++  +K    + L+KS D G TW  +   V  Y W                I        I+   ++      + +STD  +S    +II +++  F +RDK+++ ++ +     +   S+    ++N+     + + QF        + I    ED V++ V +++   +  L+ S+++G  FS SL N  +F P            S E  +D ++V  +RG YIA+ LN    + +++S+ITF++G  W+ +  PV      K   E    C + +    S + N  +P    LS  +A G+++    +   + + + ++Y++S  G  W ++L GPH Y   DHGG+LVA+  G +   +K+ST+EG  W    ++ + + V GLLTEPG K+    I+G Y+     WII  ++ S +L   C DSDY+ W        P+ E    CLLG+K  F R    + C NG       T   C CT++DFEC++G+   + ++S+ C+ +      L      C  G      T+GY+K+  D C GG
Sbjct:   79 VSLEDSHNQIVVHWAGEKSQVIVGLTRDSLALLGPKS--SNVYVSYDYGKSFKNISEKFTVPAGSANTATVSQFFHSPADNKRYIFI---DANEQYLWISKDFCDTVNGFPAPF-KPTDLLLHSTEPSLVLGYDKFHPNKQLWKSEDFGQTWTVIQEHVKTYSW---------------GIAPYDKINTIYVERHEPRGTSTVLRSTDFFQSRDKTEIIIEDVDDFQIRDKYMFATKTVHLQDSKKQPSVQLWVSYNR---KAMRSAQFVTRHPITEYYIADASEDQVFVCVSHSNNITN--LYISEAEGLRFSLSLENVLYFNPGGAGSDTLVRYFSNEPFADVHRVRGVRGVYIATILNGSFAEENMRSVITFDKGGTWEFLAAPVYNGYGEKVPCESSRGCSLHLAQRLSQLLNFQIPIMPILSKESAPGLIVATGTVGTDMASKM-NMYVSSTAGVRWRESLLGPHYYTWGDHGGILVAIAQGVDTNQLKYSTNEGETWKTFNFSDKAMIVYGLLTEPGEKSTVFTIFGSYTERGHSWIILQINASDVLGVPCTDSDYKLW-------SPSDERGNECLLGRKTVFKRRTAHATCFNGEDFDRPITVSNCSCTREDFECDFGFKLSKDLSSELCVPDPEFAGKLYPIPIPCPVGTT-YTRTKGYRKVSGDTCSGG 722          
BLAST of Sortilin vs. Ensembl Mouse
Match: Sort1 (sortilin 1 [Source:MGI Symbol;Acc:MGI:1338015])

HSP 1 Score: 429.098 bits (1102), Expect = 7.178e-137
Identity = 243/681 (35.68%), Postives = 377/681 (55.36%), Query Frame = 1
Query:   94 DQVCDSQKEVIGNAFKNNNPISKFVFTNDTKTSVQVTWAGDNSGKIILVTTKEIQIILTYADLSDIYFSDNNGKSFKRITESLPIKKVIVRKENGLQRNILDHQNIFLVCYDTVERSALLITKDGGETWKKVEL--NFILDREIKFHPFEK--------SWMITVNKARNLYKSIDGGLTWEFLLSDVLQYQWTTDKNYPQDIFVKTGKILETSIFEKIFGISNQKAPVMNLKKSTDAGKSWKIIKKNIFAFFLRDKFLYISELITGNR-RRLMVSIDNGNTFNKVYLPTIANNQFFSILHIEEDSVYIHVDNADTRGDGILFTSDSDGQVFSQSLMNHFYPSAELTSDFYKVESMRGTYIASQLNPDRSIQSLITFNRGAEWKRIKKPVNETCH--NKDKTECFVQVTGAYSLMN--NVPSSLPLSTPTAIGIVLVHAHLANSLKNSVSDVYITSDGGYNWIKALDGPHDYVIADHGGLLVAMGSNKK---FIKFSTDEGRCWHEHQYTTEDIRVTGLLTEPGNKAMTVAIWGYSNN--DTQWIIHVVDLSQLLSRECDDSDYEKWYAHSEMMHPNGENYAGCLLGKKEEFLRLKKDSLCKNGYSHKVTKTEKICPCTKDDFECEYGYFRTVNSKNCIKNELIKEN---LCVKGIVEKIITQGYKKIPSDVCEGGFSPDK 2067
            DQ C    + I    K  N   + VF +D   SV ++W GD++G I+++TT ++ +++     S +Y S++ GK+FK IT    I    +R E G+     +   + L    T E S       GG  ++  +   NF+   ++ FHP  +         +++ ++    L+ S + G  WE +   V   +W      P +I   T           + G        + L +++D GK++K I   I++F L  +FL+ S +   +  RR+ VS D G+T++   LP++   QF+SIL   ED V++HVD     G G +FTSD  G V+S+SL  H Y +    +DF  V S+RG YI S L+ D SIQS+ITF++G  W+ ++KP N  C    K+K EC + +  +YS+    NVP + PLS P A+GIV+ H  + +++   V DVYI+ DGGY+W K L+GPH Y I D GG++VA+  + +    IKFSTDEG+CW  + +T E I  TGL +EPG ++M ++IWG++ +    QW+ + VD   +L R C++ DY  W AHS      G+   GC+LG KE+FLRL+K S+C+NG  + V K   +CPC+ +DF C++GYFR  N+  C++   +K +    C+ G  E + T GY+KIP D C+GG +P +
Sbjct:   81 DQDCGRLPDFIA---KLTNNTHQHVF-DDLSGSVSLSWVGDSTGVILVLTTFQVPLVIVSFGQSKLYRSEDYGKNFKDITNL--INNTFIRTEFGMAIGPENSGKVIL----TAEVSG---GSRGGRVFRSSDFAKNFV-QTDLPFHPLTQMMYSPQNSDYLLALSTENGLWVSKNFGEKWEEIHKAVCLAKWG-----PNNIIFFT---------THVNGSCKADLGALELWRTSDLGKTFKTIGVKIYSFGLGGRFLFASVMADKDTTRRIHVSTDQGDTWSMAQLPSVGQEQFYSILAANEDMVFMHVDEPGDTGFGTIFTSDDRGIVYSKSLDRHLYTTTGGETDFTNVTSLRGVYITSTLSEDNSIQSMITFDQGGRWEHLRKPENSKCDATAKNKNECSLHIHASYSISQKLNVPMA-PLSEPNAVGIVIAHGSVGDAISVMVPDVYISDDGGYSWAKMLEGPHYYTILDSGGIIVAIEHSNRPINVIKFSTDEGQCWQSYVFTQEPIYFTGLASEPGARSMNISIWGFTESFITRQWVSYTVDFKDILERNCEEDDYTTWLAHST---DPGDYKDGCILGYKEQFLRLRKSSVCQNGRDYVVAKQPSVCPCSLEDFLCDFGYFRPENASECVEQPELKGHELEFCLYGKEEHLTTNGYRKIPGDKCQGGMNPAR 729          
BLAST of Sortilin vs. Ensembl Mouse
Match: Sort1 (sortilin 1 [Source:MGI Symbol;Acc:MGI:1338015])

HSP 1 Score: 429.098 bits (1102), Expect = 1.600e-136
Identity = 243/681 (35.68%), Postives = 377/681 (55.36%), Query Frame = 1
Query:   94 DQVCDSQKEVIGNAFKNNNPISKFVFTNDTKTSVQVTWAGDNSGKIILVTTKEIQIILTYADLSDIYFSDNNGKSFKRITESLPIKKVIVRKENGLQRNILDHQNIFLVCYDTVERSALLITKDGGETWKKVEL--NFILDREIKFHPFEK--------SWMITVNKARNLYKSIDGGLTWEFLLSDVLQYQWTTDKNYPQDIFVKTGKILETSIFEKIFGISNQKAPVMNLKKSTDAGKSWKIIKKNIFAFFLRDKFLYISELITGNR-RRLMVSIDNGNTFNKVYLPTIANNQFFSILHIEEDSVYIHVDNADTRGDGILFTSDSDGQVFSQSLMNHFYPSAELTSDFYKVESMRGTYIASQLNPDRSIQSLITFNRGAEWKRIKKPVNETCH--NKDKTECFVQVTGAYSLMN--NVPSSLPLSTPTAIGIVLVHAHLANSLKNSVSDVYITSDGGYNWIKALDGPHDYVIADHGGLLVAMGSNKK---FIKFSTDEGRCWHEHQYTTEDIRVTGLLTEPGNKAMTVAIWGYSNN--DTQWIIHVVDLSQLLSRECDDSDYEKWYAHSEMMHPNGENYAGCLLGKKEEFLRLKKDSLCKNGYSHKVTKTEKICPCTKDDFECEYGYFRTVNSKNCIKNELIKEN---LCVKGIVEKIITQGYKKIPSDVCEGGFSPDK 2067
            DQ C    + I    K  N   + VF +D   SV ++W GD++G I+++TT ++ +++     S +Y S++ GK+FK IT    I    +R E G+     +   + L    T E S       GG  ++  +   NF+   ++ FHP  +         +++ ++    L+ S + G  WE +   V   +W      P +I   T           + G        + L +++D GK++K I   I++F L  +FL+ S +   +  RR+ VS D G+T++   LP++   QF+SIL   ED V++HVD     G G +FTSD  G V+S+SL  H Y +    +DF  V S+RG YI S L+ D SIQS+ITF++G  W+ ++KP N  C    K+K EC + +  +YS+    NVP + PLS P A+GIV+ H  + +++   V DVYI+ DGGY+W K L+GPH Y I D GG++VA+  + +    IKFSTDEG+CW  + +T E I  TGL +EPG ++M ++IWG++ +    QW+ + VD   +L R C++ DY  W AHS      G+   GC+LG KE+FLRL+K S+C+NG  + V K   +CPC+ +DF C++GYFR  N+  C++   +K +    C+ G  E + T GY+KIP D C+GG +P +
Sbjct:   81 DQDCGRLPDFIA---KLTNNTHQHVF-DDLSGSVSLSWVGDSTGVILVLTTFQVPLVIVSFGQSKLYRSEDYGKNFKDITNL--INNTFIRTEFGMAIGPENSGKVIL----TAEVSG---GSRGGRVFRSSDFAKNFV-QTDLPFHPLTQMMYSPQNSDYLLALSTENGLWVSKNFGEKWEEIHKAVCLAKWG-----PNNIIFFT---------THVNGSCKADLGALELWRTSDLGKTFKTIGVKIYSFGLGGRFLFASVMADKDTTRRIHVSTDQGDTWSMAQLPSVGQEQFYSILAANEDMVFMHVDEPGDTGFGTIFTSDDRGIVYSKSLDRHLYTTTGGETDFTNVTSLRGVYITSTLSEDNSIQSMITFDQGGRWEHLRKPENSKCDATAKNKNECSLHIHASYSISQKLNVPMA-PLSEPNAVGIVIAHGSVGDAISVMVPDVYISDDGGYSWAKMLEGPHYYTILDSGGIIVAIEHSNRPINVIKFSTDEGQCWQSYVFTQEPIYFTGLASEPGARSMNISIWGFTESFITRQWVSYTVDFKDILERNCEEDDYTTWLAHST---DPGDYKDGCILGYKEQFLRLRKSSVCQNGRDYVVAKQPSVCPCSLEDFLCDFGYFRPENASECVEQPELKGHELEFCLYGKEEHLTTNGYRKIPGDKCQGGMNPAR 729          
BLAST of Sortilin vs. Ensembl Mouse
Match: Sorcs1 (sortilin-related VPS10 domain containing receptor 1 [Source:MGI Symbol;Acc:MGI:1929666])

HSP 1 Score: 204.912 bits (520), Expect = 6.255e-54
Identity = 161/655 (24.58%), Postives = 314/655 (47.94%), Query Frame = 1
Query:  157 SKFVFTNDTK-TSVQVTWAGDNSGKIILVTTKEIQIILTYADLSDIYFSDNNGKSFKRITESLPIKKVIVRKENGLQRNILDHQNIFLVCYDTVERSALLITKDGGETWKKVELNFILDREIKFHPFEKSWMITVNKARNLYKSIDGGLTWEFLLSDVL--QYQWTT--DKNYPQDIFVKTGKILETSIFEKIFGISNQKAPVMNLKKSTDAGKSWKIIKKNIF--AFFLRDKFLYISELITGNRRRLMVSIDNGNTFNKVYLPTIANNQFFSILHIEEDSVYIHVDNADTRGDGILFTSDSDGQVFSQSLMN---HFYPSAELTSDFYKVESMRGTYIASQLNPDRSIQSLITFNRGAEWKRIKKPVNETCHNKDKTECFVQVTGAYSLM----NNVPSSLPLSTPTAIGIVLVHAHLANSLKNSVSDVYITSDGGYNWIKALDGPHDYVIADHGGLLVAMGSNKKFIK---FSTDEGRCWHEHQYTTEDIRVTGLLTEPGNKAMTVAIWGYSNNDTQWIIHVVDLSQLLSRECDDSDYEKWYAHSEMMHPNGENYAGCLLGKKEEFLRLKKDSLCKNGYSHKVTKTEKICPCTKDDFECEYGYFRTVNSKNCI------KNELIKENLCVKGIVEKIITQGYKKIPSDVCEGG 2052
            + F  T D+      V W+G NS  +IL+ TK     L     S ++ S + G +++++ + + +K ++    + L     + + I L+    +E S+LLI+ D G T++K  LNF + + + FHP ++ W++  ++ + LY S + G  W+ +   V+  ++ W+       P  + ++   +   SI+               ++  T+A ++ K     I   +  ++D ++++ +L +G R    VS    + F ++ LP  A  +   ++  +E+ V+  V   +      L+ SD+ G  F+ +L N      P   +  D Y+V  ++G ++A++   D  +++ IT+N+G +W+ ++ P  +     D   C +     +  +    N   S +  S  TA  I++   ++ + L +S   ++++SD G  W +  +  H  +  D GG+LVAM      I+    S DEGR W ++ +T+  + V G+L EPG + + + ++G+ ++ ++W +  VD   +  R C + DY  W  HS+     GE    C++G K  + + K +  C  G      ++E  C CT+ DF+C+YGY R  N + C+       + L K+  C  G    + + GY+K+ S+ C  G
Sbjct:  163 TTFALTGDSAHNQAMVHWSGHNS-SVILILTKLYDYNLGSITESSLWRSTDYGTTYEKLNDKVGLKTIL----SYLYVCPTNKRKIMLLTDPEIE-SSLLISSDEGATYQKYRLNFYI-QSLLFHPKQEDWILAYSQDQKLYSSAEFGRRWQLIQESVVPNRFYWSVMGSSKEPDLVHLEARTVDGHSIYL-----------TCRMQNCTEANRN-KPFPGYIDPDSLIVQDDYVFV-QLTSGGRPHYYVSYRR-SPFAQMKLPKYALPKDMHVISTDENQVFAAVQEWNQNDTYNLYISDTRGVYFTLALENVQSSRGPEGNVMIDLYEVAGIKGMFLANK-KIDNQVKTFITYNKGRDWRLLQAPDADL--RGDPVHCLLPYCSLHLHLKVSENPYTSGIIASRDTAPSIIVASGNIGSELSDSDISMFVSSDAGNTWRQIFEEEHSILYLDQGGVLVAMKHTSLPIRHLWLSFDEGRSWSKYSFTSIPLFVDGVLGEPGEETLIMTVFGHFSHRSEWQLVKVDYKSIFDRRCAEEDYRPWQLHSQ-----GE---ACIMGAKRIYKKRKSERKCMQGKYAGAMESEP-CVCTEADFDCDYGYERHSNGQ-CLPAFWFNPSSLSKD--CSLG-QSYLNSTGYRKVVSNNCTDG 780          
BLAST of Sortilin vs. Ensembl Mouse
Match: Sorcs1 (sortilin-related VPS10 domain containing receptor 1 [Source:MGI Symbol;Acc:MGI:1929666])

HSP 1 Score: 204.527 bits (519), Expect = 7.298e-54
Identity = 161/655 (24.58%), Postives = 314/655 (47.94%), Query Frame = 1
Query:  157 SKFVFTNDTK-TSVQVTWAGDNSGKIILVTTKEIQIILTYADLSDIYFSDNNGKSFKRITESLPIKKVIVRKENGLQRNILDHQNIFLVCYDTVERSALLITKDGGETWKKVELNFILDREIKFHPFEKSWMITVNKARNLYKSIDGGLTWEFLLSDVL--QYQWTT--DKNYPQDIFVKTGKILETSIFEKIFGISNQKAPVMNLKKSTDAGKSWKIIKKNIF--AFFLRDKFLYISELITGNRRRLMVSIDNGNTFNKVYLPTIANNQFFSILHIEEDSVYIHVDNADTRGDGILFTSDSDGQVFSQSLMN---HFYPSAELTSDFYKVESMRGTYIASQLNPDRSIQSLITFNRGAEWKRIKKPVNETCHNKDKTECFVQVTGAYSLM----NNVPSSLPLSTPTAIGIVLVHAHLANSLKNSVSDVYITSDGGYNWIKALDGPHDYVIADHGGLLVAMGSNKKFIK---FSTDEGRCWHEHQYTTEDIRVTGLLTEPGNKAMTVAIWGYSNNDTQWIIHVVDLSQLLSRECDDSDYEKWYAHSEMMHPNGENYAGCLLGKKEEFLRLKKDSLCKNGYSHKVTKTEKICPCTKDDFECEYGYFRTVNSKNCI------KNELIKENLCVKGIVEKIITQGYKKIPSDVCEGG 2052
            + F  T D+      V W+G NS  +IL+ TK     L     S ++ S + G +++++ + + +K ++    + L     + + I L+    +E S+LLI+ D G T++K  LNF + + + FHP ++ W++  ++ + LY S + G  W+ +   V+  ++ W+       P  + ++   +   SI+               ++  T+A ++ K     I   +  ++D ++++ +L +G R    VS    + F ++ LP  A  +   ++  +E+ V+  V   +      L+ SD+ G  F+ +L N      P   +  D Y+V  ++G ++A++   D  +++ IT+N+G +W+ ++ P  +     D   C +     +  +    N   S +  S  TA  I++   ++ + L +S   ++++SD G  W +  +  H  +  D GG+LVAM      I+    S DEGR W ++ +T+  + V G+L EPG + + + ++G+ ++ ++W +  VD   +  R C + DY  W  HS+     GE    C++G K  + + K +  C  G      ++E  C CT+ DF+C+YGY R  N + C+       + L K+  C  G    + + GY+K+ S+ C  G
Sbjct:  163 TTFALTGDSAHNQAMVHWSGHNS-SVILILTKLYDYNLGSITESSLWRSTDYGTTYEKLNDKVGLKTIL----SYLYVCPTNKRKIMLLTDPEIE-SSLLISSDEGATYQKYRLNFYI-QSLLFHPKQEDWILAYSQDQKLYSSAEFGRRWQLIQESVVPNRFYWSVMGSSKEPDLVHLEARTVDGHSIYL-----------TCRMQNCTEANRN-KPFPGYIDPDSLIVQDDYVFV-QLTSGGRPHYYVSYRR-SPFAQMKLPKYALPKDMHVISTDENQVFAAVQEWNQNDTYNLYISDTRGVYFTLALENVQSSRGPEGNVMIDLYEVAGIKGMFLANK-KIDNQVKTFITYNKGRDWRLLQAPDADL--RGDPVHCLLPYCSLHLHLKVSENPYTSGIIASRDTAPSIIVASGNIGSELSDSDISMFVSSDAGNTWRQIFEEEHSILYLDQGGVLVAMKHTSLPIRHLWLSFDEGRSWSKYSFTSIPLFVDGVLGEPGEETLIMTVFGHFSHRSEWQLVKVDYKSIFDRRCAEEDYRPWQLHSQ-----GE---ACIMGAKRIYKKRKSERKCMQGKYAGAMESEP-CVCTEADFDCDYGYERHSNGQ-CLPAFWFNPSSLSKD--CSLG-QSYLNSTGYRKVVSNNCTDG 780          
BLAST of Sortilin vs. Ensembl Mouse
Match: Sorcs1 (sortilin-related VPS10 domain containing receptor 1 [Source:MGI Symbol;Acc:MGI:1929666])

HSP 1 Score: 204.527 bits (519), Expect = 7.595e-54
Identity = 161/655 (24.58%), Postives = 314/655 (47.94%), Query Frame = 1
Query:  157 SKFVFTNDTK-TSVQVTWAGDNSGKIILVTTKEIQIILTYADLSDIYFSDNNGKSFKRITESLPIKKVIVRKENGLQRNILDHQNIFLVCYDTVERSALLITKDGGETWKKVELNFILDREIKFHPFEKSWMITVNKARNLYKSIDGGLTWEFLLSDVL--QYQWTT--DKNYPQDIFVKTGKILETSIFEKIFGISNQKAPVMNLKKSTDAGKSWKIIKKNIF--AFFLRDKFLYISELITGNRRRLMVSIDNGNTFNKVYLPTIANNQFFSILHIEEDSVYIHVDNADTRGDGILFTSDSDGQVFSQSLMN---HFYPSAELTSDFYKVESMRGTYIASQLNPDRSIQSLITFNRGAEWKRIKKPVNETCHNKDKTECFVQVTGAYSLM----NNVPSSLPLSTPTAIGIVLVHAHLANSLKNSVSDVYITSDGGYNWIKALDGPHDYVIADHGGLLVAMGSNKKFIK---FSTDEGRCWHEHQYTTEDIRVTGLLTEPGNKAMTVAIWGYSNNDTQWIIHVVDLSQLLSRECDDSDYEKWYAHSEMMHPNGENYAGCLLGKKEEFLRLKKDSLCKNGYSHKVTKTEKICPCTKDDFECEYGYFRTVNSKNCI------KNELIKENLCVKGIVEKIITQGYKKIPSDVCEGG 2052
            + F  T D+      V W+G NS  +IL+ TK     L     S ++ S + G +++++ + + +K ++    + L     + + I L+    +E S+LLI+ D G T++K  LNF + + + FHP ++ W++  ++ + LY S + G  W+ +   V+  ++ W+       P  + ++   +   SI+               ++  T+A ++ K     I   +  ++D ++++ +L +G R    VS    + F ++ LP  A  +   ++  +E+ V+  V   +      L+ SD+ G  F+ +L N      P   +  D Y+V  ++G ++A++   D  +++ IT+N+G +W+ ++ P  +     D   C +     +  +    N   S +  S  TA  I++   ++ + L +S   ++++SD G  W +  +  H  +  D GG+LVAM      I+    S DEGR W ++ +T+  + V G+L EPG + + + ++G+ ++ ++W +  VD   +  R C + DY  W  HS+     GE    C++G K  + + K +  C  G      ++E  C CT+ DF+C+YGY R  N + C+       + L K+  C  G    + + GY+K+ S+ C  G
Sbjct:  163 TTFALTGDSAHNQAMVHWSGHNS-SVILILTKLYDYNLGSITESSLWRSTDYGTTYEKLNDKVGLKTIL----SYLYVCPTNKRKIMLLTDPEIE-SSLLISSDEGATYQKYRLNFYI-QSLLFHPKQEDWILAYSQDQKLYSSAEFGRRWQLIQESVVPNRFYWSVMGSSKEPDLVHLEARTVDGHSIYL-----------TCRMQNCTEANRN-KPFPGYIDPDSLIVQDDYVFV-QLTSGGRPHYYVSYRR-SPFAQMKLPKYALPKDMHVISTDENQVFAAVQEWNQNDTYNLYISDTRGVYFTLALENVQSSRGPEGNVMIDLYEVAGIKGMFLANK-KIDNQVKTFITYNKGRDWRLLQAPDADL--RGDPVHCLLPYCSLHLHLKVSENPYTSGIIASRDTAPSIIVASGNIGSELSDSDISMFVSSDAGNTWRQIFEEEHSILYLDQGGVLVAMKHTSLPIRHLWLSFDEGRSWSKYSFTSIPLFVDGVLGEPGEETLIMTVFGHFSHRSEWQLVKVDYKSIFDRRCAEEDYRPWQLHSQ-----GE---ACIMGAKRIYKKRKSERKCMQGKYAGAMESEP-CVCTEADFDCDYGYERHSNGQ-CLPAFWFNPSSLSKD--CSLG-QSYLNSTGYRKVVSNNCTDG 780          
BLAST of Sortilin vs. UniProt/SwissProt
Match: sp|Q6PHU5|SORT_MOUSE (Sortilin OS=Mus musculus OX=10090 GN=Sort1 PE=1 SV=1)

HSP 1 Score: 429.098 bits (1102), Expect = 5.021e-136
Identity = 243/681 (35.68%), Postives = 377/681 (55.36%), Query Frame = 1
Query:   94 DQVCDSQKEVIGNAFKNNNPISKFVFTNDTKTSVQVTWAGDNSGKIILVTTKEIQIILTYADLSDIYFSDNNGKSFKRITESLPIKKVIVRKENGLQRNILDHQNIFLVCYDTVERSALLITKDGGETWKKVEL--NFILDREIKFHPFEK--------SWMITVNKARNLYKSIDGGLTWEFLLSDVLQYQWTTDKNYPQDIFVKTGKILETSIFEKIFGISNQKAPVMNLKKSTDAGKSWKIIKKNIFAFFLRDKFLYISELITGNR-RRLMVSIDNGNTFNKVYLPTIANNQFFSILHIEEDSVYIHVDNADTRGDGILFTSDSDGQVFSQSLMNHFYPSAELTSDFYKVESMRGTYIASQLNPDRSIQSLITFNRGAEWKRIKKPVNETCH--NKDKTECFVQVTGAYSLMN--NVPSSLPLSTPTAIGIVLVHAHLANSLKNSVSDVYITSDGGYNWIKALDGPHDYVIADHGGLLVAMGSNKK---FIKFSTDEGRCWHEHQYTTEDIRVTGLLTEPGNKAMTVAIWGYSNN--DTQWIIHVVDLSQLLSRECDDSDYEKWYAHSEMMHPNGENYAGCLLGKKEEFLRLKKDSLCKNGYSHKVTKTEKICPCTKDDFECEYGYFRTVNSKNCIKNELIKEN---LCVKGIVEKIITQGYKKIPSDVCEGGFSPDK 2067
            DQ C    + I    K  N   + VF +D   SV ++W GD++G I+++TT ++ +++     S +Y S++ GK+FK IT    I    +R E G+     +   + L    T E S       GG  ++  +   NF+   ++ FHP  +         +++ ++    L+ S + G  WE +   V   +W      P +I   T           + G        + L +++D GK++K I   I++F L  +FL+ S +   +  RR+ VS D G+T++   LP++   QF+SIL   ED V++HVD     G G +FTSD  G V+S+SL  H Y +    +DF  V S+RG YI S L+ D SIQS+ITF++G  W+ ++KP N  C    K+K EC + +  +YS+    NVP + PLS P A+GIV+ H  + +++   V DVYI+ DGGY+W K L+GPH Y I D GG++VA+  + +    IKFSTDEG+CW  + +T E I  TGL +EPG ++M ++IWG++ +    QW+ + VD   +L R C++ DY  W AHS      G+   GC+LG KE+FLRL+K S+C+NG  + V K   +CPC+ +DF C++GYFR  N+  C++   +K +    C+ G  E + T GY+KIP D C+GG +P +
Sbjct:   81 DQDCGRLPDFIA---KLTNNTHQHVF-DDLSGSVSLSWVGDSTGVILVLTTFQVPLVIVSFGQSKLYRSEDYGKNFKDITNL--INNTFIRTEFGMAIGPENSGKVIL----TAEVSG---GSRGGRVFRSSDFAKNFV-QTDLPFHPLTQMMYSPQNSDYLLALSTENGLWVSKNFGEKWEEIHKAVCLAKWG-----PNNIIFFT---------THVNGSCKADLGALELWRTSDLGKTFKTIGVKIYSFGLGGRFLFASVMADKDTTRRIHVSTDQGDTWSMAQLPSVGQEQFYSILAANEDMVFMHVDEPGDTGFGTIFTSDDRGIVYSKSLDRHLYTTTGGETDFTNVTSLRGVYITSTLSEDNSIQSMITFDQGGRWEHLRKPENSKCDATAKNKNECSLHIHASYSISQKLNVPMA-PLSEPNAVGIVIAHGSVGDAISVMVPDVYISDDGGYSWAKMLEGPHYYTILDSGGIIVAIEHSNRPINVIKFSTDEGQCWQSYVFTQEPIYFTGLASEPGARSMNISIWGFTESFITRQWVSYTVDFKDILERNCEEDDYTTWLAHST---DPGDYKDGCILGYKEQFLRLRKSSVCQNGRDYVVAKQPSVCPCSLEDFLCDFGYFRPENASECVEQPELKGHELEFCLYGKEEHLTTNGYRKIPGDKCQGGMNPAR 729          
BLAST of Sortilin vs. UniProt/SwissProt
Match: sp|O54861|SORT_RAT (Sortilin OS=Rattus norvegicus OX=10116 GN=Sort1 PE=1 SV=3)

HSP 1 Score: 424.861 bits (1091), Expect = 1.835e-134
Identity = 240/681 (35.24%), Postives = 378/681 (55.51%), Query Frame = 1
Query:   94 DQVCDSQKEVIGNAFKNNNPISKFVFTNDTKTSVQVTWAGDNSGKIILVTTKEIQIILTYADLSDIYFSDNNGKSFKRITESLPIKKVIVRKENGLQRNILDHQNIFLVCYDTVERSALLITKDGGETWKKVEL--NFILDREIKFHPFEK--------SWMITVNKARNLYKSIDGGLTWEFLLSDVLQYQWTTDKNYPQDIFVKTGKILETSIFEKIFGISNQKAPVMNLKKSTDAGKSWKIIKKNIFAFFLRDKFLYISELITGNR-RRLMVSIDNGNTFNKVYLPTIANNQFFSILHIEEDSVYIHVDNADTRGDGILFTSDSDGQVFSQSLMNHFYPSAELTSDFYKVESMRGTYIASQLNPDRSIQSLITFNRGAEWKRIKKPVNETCH--NKDKTECFVQVTGAYSLMN--NVPSSLPLSTPTAIGIVLVHAHLANSLKNSVSDVYITSDGGYNWIKALDGPHDYVIADHGGLLVAMGSNKK---FIKFSTDEGRCWHEHQYTTEDIRVTGLLTEPGNKAMTVAIWGYSNN--DTQWIIHVVDLSQLLSRECDDSDYEKWYAHSEMMHPNGENYAGCLLGKKEEFLRLKKDSLCKNGYSHKVTKTEKICPCTKDDFECEYGYFRTVNSKNCIKNELIKEN---LCVKGIVEKIITQGYKKIPSDVCEGGFSPDK 2067
            DQ C    + I    K  N   + VF +D   SV ++W GD++G I+++TT ++ +++     S +Y S++ GK+FK IT    I    +R E G+     +   + L    T E S       GG  ++  +   NF+   ++ FHP  +         +++ ++    L+ S + G  WE +   V   +W      P +I   T           + G        + L +++D GK++K I   I++F L  +FL+ S +   +  RR+ VS D G+T++   LP++   QF+SIL   +D V++HVD     G G +FTSD  G V+S+SL  H Y +    +DF  V S+RG YI S L+ D SIQS+ITF++G  W+ ++KP N  C    K+K EC + +  +YS+    NVP + PLS P A+GIV+ H  + +++   V DVYI+ DGGY+W K L+GPH Y I D GG++VA+  + +    IKFSTDEG+CW  + ++ E +  TGL +EPG ++M ++IWG++ +    QW+ + +D   +L R C+++DY  W AHS      G+   GC+LG KE+FLRL+K S+C+NG  + V K   ICPC+ +DF C++GYFR  N+  C++   +K +    C+ G  E + T GY+KIP D C+GG +P +
Sbjct:   81 DQDCGRLPDFIA---KLTNNTHQHVF-DDLSGSVSLSWVGDSTGVILVLTTFQVPLVIVSFGQSKLYRSEDYGKNFKDITNL--INNTFIRTEFGMAIGPENSGKVIL----TAEVSG---GSRGGRVFRSSDFAKNFV-QTDLPFHPLTQMMYSPQNSDYLLALSTENGLWVSKNFGEKWEEIHKAVCLAKWG-----PNNIIFFT---------THVNGSCKADLGALELWRTSDLGKTFKTIGVKIYSFGLGGRFLFASVMADKDTTRRIHVSTDQGDTWSMAQLPSVGQEQFYSILAANDDMVFMHVDEPGDTGFGTIFTSDDRGIVYSKSLDRHLYTTTGGETDFTNVTSLRGVYITSTLSEDNSIQSMITFDQGGRWEHLQKPENSKCDATAKNKNECSLHIHASYSISQKLNVPMA-PLSEPNAVGIVIAHGSVGDAISVMVPDVYISDDGGYSWAKMLEGPHYYTILDSGGIIVAIEHSNRPINVIKFSTDEGQCWQSYVFSQEPVYFTGLASEPGARSMNISIWGFTESFLTRQWVSYTIDFKDILERNCEENDYTTWLAHST---DPGDYKDGCILGYKEQFLRLRKSSVCQNGRDYVVAKQPSICPCSLEDFLCDFGYFRPENASECVEQPELKGHELEFCLYGKEEHLTTNGYRKIPGDRCQGGMNPAR 729          
BLAST of Sortilin vs. UniProt/SwissProt
Match: sp|Q99523|SORT_HUMAN (Sortilin OS=Homo sapiens OX=9606 GN=SORT1 PE=1 SV=3)

HSP 1 Score: 421.779 bits (1083), Expect = 3.656e-133
Identity = 236/678 (34.81%), Postives = 382/678 (56.34%), Query Frame = 1
Query:   94 DQVCDSQKEVIGNAFKNNNPISKFVFTNDTKTSVQVTWAGDNSGKIILVTTKEIQIILTYADLSDIYFSDNNGKSFKRITESLPIKKVIVRKENGLQRNILDHQNIFLVCYDTVERSA------LLITKDGGETWKKVELNFILDREIKFHPFEKSWMITVNKARNLYKSIDGGLTWEFLLSDVLQYQWTTDKNYPQDIFVKTGKILETSIFEKIFGISNQKAPV--MNLKKSTDAGKSWKIIKKNIFAFFLRDKFLYISELITGNR-RRLMVSIDNGNTFNKVYLPTIANNQFFSILHIEEDSVYIHVDNADTRGDGILFTSDSDGQVFSQSLMNHFYPSAELTSDFYKVESMRGTYIASQLNPDRSIQSLITFNRGAEWKRIKKPVNETCH--NKDKTECFVQVTGAYSLMN--NVPSSLPLSTPTAIGIVLVHAHLANSLKNSVSDVYITSDGGYNWIKALDGPHDYVIADHGGLLVAMGSNKK---FIKFSTDEGRCWHEHQYTTEDIRVTGLLTEPGNKAMTVAIWGYSNN--DTQWIIHVVDLSQLLSRECDDSDYEKWYAHSEMMHPNGENYA-GCLLGKKEEFLRLKKDSLCKNGYSHKVTKTEKICPCTKDDFECEYGYFRTVNSKNCIKNELIKEN---LCVKGIVEKIITQGYKKIPSDVCEGGFSP 2061
            D+ C   ++ +     N +   + VF +D + SV ++W GD++G I+++TT  + +++     S +Y S++ GK+FK IT+   I    +R E G+     +   + L    T E S       +  + D  + + + +L F    ++ + P    +++ ++    L+ S + G  WE +   V   +W +D                 +IF   +   + KA +  + L +++D GKS+K I   I++F L  +FL+ S +   +  RR+ VS D G+T++   LP++   QF+SIL   +D V++HVD     G G +FTSD  G V+S+SL  H Y +    +DF  V S+RG YI S L+ D SIQ++ITF++G  W  ++KP N  C    K+K EC + +  +YS+    NVP + PLS P A+GIV+ H  + +++   V DVYI+ DGGY+W K L+GPH Y I D GG++VA+  + +    IKFSTDEG+CW  + +T + I  TGL +EPG ++M ++IWG++ +   +QW+ + +D   +L R C++ DY  W AHS     + E+Y  GC+LG KE+FLRL+K S+C+NG  + VTK   IC C+ +DF C++GY+R  N   C++   +K +    C+ G  E + T GY+KIP D C+GG +P
Sbjct:   83 DEECGRVRDFVAKLANNTH---QHVF-DDLRGSVSLSWVGDSTGVILVLTTFHVPLVIMTFGQSKLYRSEDYGKNFKDITDL--INNTFIRTEFGMAIGPENSGKVVL----TAEVSGGSRGGRIFRSSDFAKNFVQTDLPFHPLTQMMYSPQNSDYLLALSTENGLWVSKNFGGKWEEIHKAVCLAKWGSDN----------------TIFFTTYANGSCKADLGALELWRTSDLGKSFKTIGVKIYSFGLGGRFLFASVMADKDTTRRIHVSTDQGDTWSMAQLPSVGQEQFYSILAANDDMVFMHVDEPGDTGFGTIFTSDDRGIVYSKSLDRHLYTTTGGETDFTNVTSLRGVYITSVLSEDNSIQTMITFDQGGRWTHLRKPENSECDATAKNKNECSLHIHASYSISQKLNVPMA-PLSEPNAVGIVIAHGSVGDAISVMVPDVYISDDGGYSWTKMLEGPHYYTILDSGGIIVAIEHSSRPINVIKFSTDEGQCWQTYTFTRDPIYFTGLASEPGARSMNISIWGFTESFLTSQWVSYTIDFKDILERNCEEKDYTIWLAHST----DPEDYEDGCILGYKEQFLRLRKSSVCQNGRDYVVTKQPSICLCSLEDFLCDFGYYRPENDSKCVEQPELKGHDLEFCLYGREEHLTTNGYRKIPGDKCQGGVNP 729          
BLAST of Sortilin vs. UniProt/SwissProt
Match: sp|Q6NUT7|SORT1_DANRE (Sortilin OS=Danio rerio OX=7955 GN=sort1 PE=2 SV=1)

HSP 1 Score: 411.379 bits (1056), Expect = 1.884e-129
Identity = 241/663 (36.35%), Postives = 373/663 (56.26%), Query Frame = 1
Query:  175 NDTKTSVQVTWAGDNSGKIILVTTKEIQIILTYADLSDIYFSDNNGKSFKRITESLPIKKVIVRKENGLQRNILDHQNIFLVCYDTVERSALLITK--DGGETWKKVELNFILDREIKFHPFEKSWMITVNKARNLYKSIDGGLTWEFLLSDVLQYQWTTDKNYPQDIFVKTGKILETSIFEKIFGISNQKAPVMNLKKSTDAGKSWKIIKKNIFAFFLRDKFLYISELI-TGNRRRLMVSIDNGNTFNKVYLPTIANNQFFSILHIEEDSVYIHVDNADTRGDGILFTSDSDGQVFSQSLMNHFYPSAELTSDFYKVESMRGTYIASQLNPDRSIQSLITFNRGAEWKRIKKPVNETCHN--KDKTECFVQVTGAYSLMN--NVPSSLPLSTPTAIGIVLVHAHLANSLKNSVSDVYITSDGGYNWIKALDGPHDYVIADHGGLLVAMGSNKKF----IKFSTDEGRCWHEHQYTTEDIRVTGLLTEPGNKAMTVAIWGYSNN--DTQWIIHVVDLSQLLSRECDDSDYEKWYAHSEMMHPNGENYAGCLLGKKEEFLRLKKDSLCKNGYSHKVTKTEKICPCTKDDFECEYGYFRTVNSKNCIKN-ELIKENL--CVKGIVEKIITQGYKKIPSDVCEGGFSPDKTKQKWLNQTCVEDEFK 2115
            ND   SV + W GD +G ++++TT ++ + +     S +Y S++ GK+F+ IT+   I    ++ E G+     D+    ++  D  E     I +  D G+++   EL F    +I ++P + + ++  +   +L+ S D G  W+ +   V   +W  D      IF+ T               S      + L+KS D GK++K I   I++F L  +F++ S +  +G+ R + VS+D G T++   LPT+ + QF+SIL    D V++HVD     G G ++ SD  G VFS+SL  H Y +    +DF  + S+RG YI S L  D S+Q++ITFN+G EW+ + KP N  C +  K  +EC + +  +YS+    NVP   PLS   A+G+VL H  +  ++     DVY++ DGGY W +AL GPH Y I D GGLLVA+  N       IKFSTDEG+CWH H +T + I  TGL +EPG ++M V++WGY +   +  W+   VD  QLLSR+C ++DY +W AHS  ++   +   GC+LG KE FLRL++DS+C NG  +KVTK    CPCT  DF  ++G++   NS  C++  +LI  +L  C+ G  E++ T GY+KIP D CE G +P++ K+  L++ CV +  +
Sbjct:   90 NDLSGSVSLAWVGDGTGVLLVLTTFQVPLFIMRFGQSKLYRSEDYGKTFQDITDL--INNTFIQTEFGIAIGP-DNSGKVILTGDLAEGKVTKIFRSVDFGKSFVTSELPFHPLMQITYNPKDSNILMVYSINYDLWLSKDFGANWKKIHESVCLVKWGIDDT----IFLTTNP-----------NGSCSDRGTLELRKSLDYGKTFKTIGNRIYSFGLGGRFVFASIMTDSGSTRMIHVSVDQGETWDMAQLPTVGHEQFYSILAANNDMVFMHVDEPGDSGIGTIYISDDRGIVFSKSLERHLYTTTGGDTDFTNITSLRGVYITSVLAEDGSVQTVITFNQGGEWRPLMKPWNGVCDSTAKHPSECSLHIHASYSISMKLNVPMQ-PLSETNAVGLVLAHGSVGGAVSVLSPDVYVSDDGGYTWFQALKGPHHYAILDSGGLLVAVEHNPTHPISQIKFSTDEGQCWHAHNFTDDPIYFTGLASEPGARSMNVSLWGYRDTILNQYWVSVTVDFRQLLSRDCQENDYIQWLAHSSDINSPTD---GCVLGYKERFLRLRRDSVCWNGRDYKVTKEPTTCPCTLTDFH-DFGFYHEENSSVCVEQPDLIGHSLEFCLHGRKEQLQTSGYRKIPGDHCEEGITPER-KEIDLSKKCVSNLLR 728          
BLAST of Sortilin vs. UniProt/SwissProt
Match: sp|Q98930|SORL_CHICK (Sortilin-related receptor (Fragment) OS=Gallus gallus OX=9031 GN=SORL1 PE=2 SV=1)

HSP 1 Score: 211.846 bits (538), Expect = 3.375e-55
Identity = 187/687 (27.22%), Postives = 318/687 (46.29%), Query Frame = 1
Query:  163 FVFTNDTKTSVQVTWAGDNSGKIILVTTKEIQIILTYADLSDIYFSDNNGKSFKRITESLPI---KKVIVRKENGLQRNILDHQNIFLVCYDTVERSALLITKDGGETWKKVELNFILDREIKFHPFEKSWMITVNKA---RNLYKSIDGGLTWEFLLSDVLQYQWTTDK-NYPQDIFVKTGKILETSIFEKIFGISNQKAPVMNLKKSTDAGKSWK---IIKKNIFAFFLRDKFLYISELITGNRRRLMVSIDNGN-----TFNKVYLPTIANNQF--------FSILHIEEDSVYIHVDNADTRGDGILFTSDSDGQVFSQSLMNHFYPSA--------------ELTSDFYKVESMRGTYIASQLN---PDRSIQSLITFNRGAEWKRIKKPV----NETCHNKDKTECFVQVTGAYS-LMNNVPSSLP-LSTPTAIGIVLVHAHLANSLKNSVSDVYITSDGGYNWIKALDGPHDYVIADHGGLLVAM--GSNKKFIKFSTDEGRCWHEHQYTTEDIRVTGLLTEPGNKAMTVAIWG-YSNNDTQWIIHVVDLSQLLSRECDDSDYEKWYAHSEMMHPNGENYAGCLLGKKEEFLRLKKDSLCKNGYSHKVTKTEKICPCTKDDFECEYGY--FRTVNSKNCIKNELIKEN------LCVKGIVEKIITQGYKKIPSDVCEGG 2052
            +V  ND+   + V WAG+ S  I+ +    + ++      SD+Y S + GKSFK+I+E           V           + + IF+  +       L IT D  ++ +   + F    ++  H    + ++  +++   + L+KS D G TW  +   V  + W  +  + P  ++++  +   TS                 + +STD  +S +   +I +++  F LRDK+L+ ++ +     RL+ S+   +     +FN+  +      QF        + I    ED V++ V + D R +  L+ S+++G  FS SL N  Y S               E  +DF++VE +RG YIA+ LN    + +++S+ITF++G  W+ ++ P      E  H +    C + +    S L+N     +P LS  +A G+++    +  S+    ++VYI+S  G  W +AL GPH Y   DHGG+LVA+  G+    +K+ST+EG  W    ++ + + V GLLTEPG K+    I+G Y  N   W+I  V+ S +L   C ++DY+ W        P+ E    CLLG K  F R    + C NG           C CT++DFEC++G+     ++ + C+ +             C  G   +  T+GY+KI  D C GG
Sbjct:    2 WVSLNDSHNQMVVHWAGEKSNVIVALARDSLSLLGPKN--SDVYISYDYGKSFKKISERFSFGDGNSSAVAIAQFYHSPANNQRYIFVDAF----VPYLWITTDFCKSIQGFSIPFRA-ADLLLHSRNPNLVLGFDRSHPNKQLWKSDDFGQTWIMIQEHVKSFSWGVEPYDKPNTVYIERHEPSGTS----------------TVIRSTDFFQSRENKEVILEDVDDFQLRDKYLFATKAV-----RLLGSLQPSSVQLWVSFNRKPMRVA---QFVTKHPIKEYYIADASEDQVFVCVSHDDNRTN--LYISEAEGLKFSLSLENVLYYSPGGAGSDTLVRYFANEPFADFHRVEGVRGVYIATLLNGSFSEENMRSVITFDKGGTWEPLQPPAETRYGEKTHCELSQGCSLHLAQRLSQLLNFQLRRMPILSKESAPGLIIATGSIGKSMAKK-TNVYISSSAGARWREALSGPHYYTWGDHGGILVAIAQGTETDQLKYSTNEGETWKSFTFSEKPVFVYGLLTEPGEKSTIFTIFGSYKENGHSWLILQVNTSDVLGVPCTENDYKLW-------SPSDERGNECLLGHKTVFKRRTPHATCFNGEDFDRPVMVSNCSCTREDFECDFGFKLSEDLSLEVCVPDPEFAGKPYDPPVPCPVGSTYR-RTRGYRKISGDTCMGG 646          
BLAST of Sortilin vs. TrEMBL
Match: A0A1S3IST3 (Sortilin OS=Lingula unguis OX=7574 GN=LOC106167010 PE=4 SV=1)

HSP 1 Score: 544.273 bits (1401), Expect = 3.452e-177
Identity = 288/687 (41.92%), Postives = 424/687 (61.72%), Query Frame = 1
Query:   94 DQVCDSQKEVIGNAFKNNNPISKFVFTNDTKTSVQVTWAGDNSGKIILVTTKEIQIILTYADLSDIYFSDNNGKSFKRITESLPIKKVIVRKENGLQRNILDHQNIFLVCYD-TVERSALLITKDGGETWKKVELNFILDREIKFHPFEKSWMITVN---KARNLYKSIDGGLTWEFLLSDVLQYQWTTD--KNYPQDIFVKTGKILETSIFEKIFGISNQKAPVMNLKKSTDAGKSWKIIKKNIFAFFLRDKFLYISELITGN-RRRLMVSIDNGNTFNKVYLPTIANNQFFSILHIEEDSVYIHVDNADTRGDGILFTSDSDGQVFSQSLMNHFYPSAELTSDFYKVESMRGTYIASQLNPDRSIQSLITFNRGAEWKRIKKPVNETCHNKDKTECFVQVTGAYSLMNNVPSSLPLSTPTAIGIVLVHAHLANSLKNSVSDVYITSDGGYNWIKALDGPHDYVIADHGGLLVAMGSN---KKFIKFSTDEGRCWHEHQYTTEDIRVTGLLTEPGNKAMTVAIWGYSNNDTQWIIHVVDLSQLLSRECDD-SDYEKWYAHSEMMHPNGENYAGCLLGKKEEFLRLKKDSLCKNGYSHKVTK--TEKICPCTKDDFECEYGYFRTVNSKNCIKNELIKE---NLCVKGIVEKIITQGYKKIPSDVCEGGFSPDKTKQKWLNQTCVED 2106
            D  C+ QK  +   F   + ++   F N+TK S+ + WAGDNSG I++  T+E+  +   A  S +Y S N G+SF+ I     I  VI+RK+NGLQ+N  D  NIF+V ++ T + S L IT+DGG T+    + FIL  E+ FHP   + ++       +++LY S DGG TW  + +D+++Y+W  +    +   I+    K    SI   IFG    K+    L +STD G +WK++ ++I+ F ++ KFL+ S    G+ +R L VS D G ++N V +PT+  ++F+SIL + E  +++HVD     G G L+ SDS G VF++SL  H YP+    +DFYKVESMRG YIASQ++ D SI S+I+F+RGAEWK IK P    CH      C++Q+   YS+  N+P+  PLS+ +A+GI+L H H+A++L+N+  DV+++ DGGYNWIKALDGPH Y IAD GGLLVA+  N      +KFSTD GRCWHEH++T E I  TGLLTEPGNKAMTV+IWGY     +W + V+D  +++ R+C D  DYE+W  H E +H   + + GCL+G KE + R+ KDSLC NG S+ V +  +E  C C ++D+EC++G+ +    + C+++         +C+   V +  T GY+KIP D C  GF P ++ +  L+  C E+
Sbjct:   74 DTTCEQQKNQLD--FTTPDFVNTHQFVNETKASMALAWAGDNSGVILVAVTEEMGNL---ARPSVLYRSTNFGRSFEDINSR--INNVIMRKDNGLQKNPNDANNIFIVAHNLTGDVSDLYITQDGGSTFSHFTMPFILRDEMLFHPSNNNLILAQKIGYSSKDLYLSQDGGRTWRLIHTDIVKYKWDPNGAPGFENAIYATYDK---PSILTSIFGGIISKSYDYQLLRSTDLGANWKMVNEHIYEFGVQGKFLFTSVNQQGSYQRALEVSTDGGESWNGVQVPTVTEDRFYSILDMSEGMIFLHVDKPGDTGHGTLYISDSSGIVFTESLEKHLYPNYLDLTDFYKVESMRGVYIASQMSDDNSIHSMISFDRGAEWKPIKAPPGVPCHKA----CYLQIHNHYSIARNIPAKPPLSSKSAVGIILAHGHVADALQNTPPDVFVSDDGGYNWIKALDGPHHYQIADQGGLLVAIPYNTSTPNIVKFSTDGGRCWHEHKFTDEVIVFTGLLTEPGNKAMTVSIWGYGQVHREWRVFVIDFQKIIKRQCQDPQDYEEWSPHGE-LHGQQDEWKGCLIGYKETYKRVIKDSLCYNGRSYSVERSGSETPCTCRREDYECDFGFVKNAKEE-CVRDSKFSAKELKICINNHVTEDNTIGYRKIPGDGCHNGFVPQQSTEITLDVICNEE 744          
BLAST of Sortilin vs. TrEMBL
Match: A0A267H5C9 (Sortilin OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig029917g3 PE=4 SV=1)

HSP 1 Score: 513.842 bits (1322), Expect = 1.271e-165
Identity = 272/682 (39.88%), Postives = 402/682 (58.94%), Query Frame = 1
Query:  115 KEVIGNAFKNNNPISKFVFTNDTKTSVQVTWAGDNSGKIILVTTKEIQIILTYADLSDIYFSDNNGKSFKRITESL-----PIKKVIVRKENGLQRNILDHQNIFLVCYDTVERSA----LLITKDGGETWKKVELNF-ILDREIKFHPFEKSWMITVNKARNLYKSIDGGLTWEFLLSDVLQYQWTTDKNYPQDIFVK-TGKILETSIFEKIFGISNQKAPVMNLKKSTD--AGKS-WKIIKKNIFAFFLRDKFLYISELITG--NRRRLMVSIDNGNTFNKVYLPTIANNQFFSILHIEEDSVYIHVDNADTRGDGILFTSDSDGQVFSQSLMNHFYPSAELTSDFYKVESMRGTYIASQLNPDRSIQSLITFNRGAEWKRIKKPVNETCHNKDKTECFVQVTGAYSLMNNVPSSLPLSTPTAIGIVLVHAHLANSLKNSVSDVYITSDGGYNWIKALDGPHDYVIADHGGLLVAM-----GSNKKFIKFSTDEGRCWHEHQYTTEDIRVTGLLTEPGNKAMTVAIWGYSNNDTQWIIHVVDLSQLLSRECDDSDYEKWYAHSEMMHPNGENYAGCLLGKKEEFLRLKKDSLCKNGYSHKVTKTEKICPCTKDDFECEYGYFRTVNSKNCIKN-ELIKENLCVKGIVEKIITQGYKKIPSDVCEGGFSPDKTKQKWLNQT 2094
            KE + +A   +  +S+F+F+N+TK S+ +TWAG+ +   +++ T   Q +LT    S +Y S N+G++F  IT  +         ++V +  GLQRN      I+L C+D  +       L  T DGG TW      F +   +I FH  +  W++       LY S++ G  W  +   V +  W    +    I+    G+    S+       SN + P   L K TD  AG + WK + + I+++  +D F++IS+   G    R L VS D G TF +  LP+   ++FF IL   +   ++H+D  +  G G L+TS+S GQVFS+SL  +FYP    +SDFYKVESMRG ++++ L+ D S+ S+IT NRGA W+ + KP   TC   D   C++QV   YS+  +VP+  P S P+A+G+++VH H A  L+++ +DVYI+SDGGY+W  AL GPH   I ++G  LVA+     GS+ + +KFSTD GRCWH H++TTED   TGLLTEPGN+A+TVAIWGY +    W + VVDL  LLSR C DSDYE W ++  + + N  N+  C+LG KE   RLK DS+C + YS+K   +   C CTKDDFECE+GY R VNS +C+++ ++    +C    V+KIIT+GY+K+P + C+GGF P+ T Q+ L++ 
Sbjct:   39 KEKLSSAAVQSKFVSEFIFSNETKPSLLMTWAGNQT---LIIVTIRTQGVLTRD--SSVYRSTNDGRTFVNITAKILEAGATSSALLVSQSLGLQRNPAQPARIYLACHDPAKLGGATGLLYYTLDGGATWHLSSPGFPVQSAQILFHTDKPDWLL-AQAGDKLYLSVNAGQDWRLIKKRVFKASWGVSADDKDSIYAAFDGEASFVSLLRDGVASSNHRLPGRQLAKLTDFTAGSNNWKTLAEKIYSYNNKDGFIFISKSDEGKAESRHLEVSTDCGKTFVRTQLPSATPDRFFVILDTSDGLAFVHIDAGNYLGYGTLYTSNSLGQVFSKSLERNFYPPLGGSSDFYKVESMRGAFLSTVLHSDASMHSVITHNRGAVWRHLSKPDGVTCTTTDGGPCYLQVASYYSISRSVPADQPRSAPSAVGLLIVHGHTAAKLQSNPADVYISSDGGYSWYLALKGPHRVQIGNNGNFLVAVEKSANGSSPQVVKFSTDAGRCWHSHRFTTEDYVFTGLLTEPGNRALTVAIWGYVSELHHWRVFVVDLGVLLSRSCTDSDYESWLSNGAVNYDNA-NHQACVLGAKETIKRLKADSMCASTYSYKPQTSVTPCECTKDDFECEFGYTRPVNSLDCVRDPDVPTPRICDANTVKKIITEGYRKLPRNRCQGGFQPNVTHQEVLHEA 713          
BLAST of Sortilin vs. TrEMBL
Match: A0A267DZG7 (Sortilin OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig033377g1 PE=4 SV=1)

HSP 1 Score: 513.842 bits (1322), Expect = 1.346e-165
Identity = 272/682 (39.88%), Postives = 402/682 (58.94%), Query Frame = 1
Query:  115 KEVIGNAFKNNNPISKFVFTNDTKTSVQVTWAGDNSGKIILVTTKEIQIILTYADLSDIYFSDNNGKSFKRITESL-----PIKKVIVRKENGLQRNILDHQNIFLVCYDTVERSA----LLITKDGGETWKKVELNF-ILDREIKFHPFEKSWMITVNKARNLYKSIDGGLTWEFLLSDVLQYQWTTDKNYPQDIFVK-TGKILETSIFEKIFGISNQKAPVMNLKKSTD--AGKS-WKIIKKNIFAFFLRDKFLYISELITG--NRRRLMVSIDNGNTFNKVYLPTIANNQFFSILHIEEDSVYIHVDNADTRGDGILFTSDSDGQVFSQSLMNHFYPSAELTSDFYKVESMRGTYIASQLNPDRSIQSLITFNRGAEWKRIKKPVNETCHNKDKTECFVQVTGAYSLMNNVPSSLPLSTPTAIGIVLVHAHLANSLKNSVSDVYITSDGGYNWIKALDGPHDYVIADHGGLLVAM-----GSNKKFIKFSTDEGRCWHEHQYTTEDIRVTGLLTEPGNKAMTVAIWGYSNNDTQWIIHVVDLSQLLSRECDDSDYEKWYAHSEMMHPNGENYAGCLLGKKEEFLRLKKDSLCKNGYSHKVTKTEKICPCTKDDFECEYGYFRTVNSKNCIKN-ELIKENLCVKGIVEKIITQGYKKIPSDVCEGGFSPDKTKQKWLNQT 2094
            KE + +A   +  +S+F+F+N+TK S+ +TWAG+ +   +++ T   Q +LT    S +Y S N+G++F  IT  +         ++V +  GLQRN      I+L C+D  +       L  T DGG TW      F +   +I FH  +  W++       LY S++ G  W  +   V +  W    +    I+    G+    S+       SN + P   L K TD  AG + WK + + I+++  +D F++IS+   G    R L VS D G TF +  LP+   ++FF IL   +   ++H+D  +  G G L+TS+S GQVFS+SL  +FYP    +SDFYKVESMRG ++++ L+ D S+ S+IT NRGA W+ + KP   TC   D   C++QV   YS+  +VP+  P S P+A+G+++VH H A  L+++ +DVYI+SDGGY+W  AL GPH   I ++G  LVA+     GS+ + +KFSTD GRCWH H++TTED   TGLLTEPGN+A+TVAIWGY +    W + VVDL  LLSR C DSDYE W ++  + + N  N+  C+LG KE   RLK DS+C + YS+K   +   C CTKDDFECE+GY R VNS +C+++ ++    +C    V+KIIT+GY+K+P + C+GGF P+ T Q+ L++ 
Sbjct:   39 KEKLSSAAVQSKFVSEFIFSNETKPSLLMTWAGNQT---LIIVTIRTQGVLTRD--SSVYRSTNDGRTFVNITAKILEAGATSSALLVSQSLGLQRNPAQPARIYLACHDPAKLGGATGLLYYTLDGGATWHLSSPGFPVQSAQILFHTDKPDWLL-AQAGDKLYLSVNAGQDWRLIKKRVFKASWGVSADDKDSIYAAFDGEASFVSLLRDGVASSNHRLPGRQLAKLTDFTAGSNNWKTLAEKIYSYNNKDGFIFISKSDEGKAESRHLEVSTDCGKTFVRTQLPSATPDRFFVILDTSDGLAFVHIDAGNYLGYGTLYTSNSLGQVFSKSLERNFYPPLGGSSDFYKVESMRGAFLSTVLHSDASMHSVITHNRGAVWRHLSKPDGVTCTTTDGGPCYLQVASYYSISRSVPADQPRSAPSAVGLLIVHGHTAAKLQSNPADVYISSDGGYSWYLALKGPHRVQIGNNGNFLVAVEKSANGSSPQVVKFSTDAGRCWHSHRFTTEDYVFTGLLTEPGNRALTVAIWGYVSELHHWRVFVVDLGVLLSRSCTDSDYESWLSNGAVNYDNA-NHQACVLGAKETIKRLKADSMCASTYSYKPQTSVTPCECTKDDFECEFGYTRPVNSLDCVRDPDVPTPRICDANTVKKIITEGYRKLPRNRCQGGFQPNVTHQEVLHEA 713          
BLAST of Sortilin vs. TrEMBL
Match: A0A1I8I503 (Sortilin OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 511.146 bits (1315), Expect = 5.451e-165
Identity = 269/668 (40.27%), Postives = 395/668 (59.13%), Query Frame = 1
Query:  157 SKFVFTNDTKTSVQVTWAGDNSGKIILVTTKEIQIILTYADLSDIYFSDNNGKSFKRITESL-----PIKKVIVRKENGLQRNILDHQNIFLVCYDTVERSA----LLITKDGGETWKKVELNF-ILDREIKFHPFEKSWMITVNKARNLYKSIDGGLTWEFLLSDVLQYQWTTDKNYPQDIFVK-TGKILETSIFEKIFGISNQKAPVMNLKKSTD--AGKS-WKIIKKNIFAFFLRDKFLYISELITG--NRRRLMVSIDNGNTFNKVYLPTIANNQFFSILHIEEDSVYIHVDNADTRGDGILFTSDSDGQVFSQSLMNHFYPSAELTSDFYKVESMRGTYIASQLNPDRSIQSLITFNRGAEWKRIKKPVNETCHNKDKTECFVQVTGAYSLMNNVPSSLPLSTPTAIGIVLVHAHLANSLKNSVSDVYITSDGGYNWIKALDGPHDYVIADHGGLLVAM-----GSNKKFIKFSTDEGRCWHEHQYTTEDIRVTGLLTEPGNKAMTVAIWGYSNNDTQWIIHVVDLSQLLSRECDDSDYEKWYAHSEMMHPNGENYAGCLLGKKEEFLRLKKDSLCKNGYSHKVTKTEKICPCTKDDFECEYGYFRTVNSKNCIKN-ELIKENLCVKGIVEKIITQGYKKIPSDVCEGGFSPDKTKQKWLNQT 2094
            +KF+F+N+TK S+ +TWAG+ +   +++ T   Q +LT    S +Y S N+G++F  IT  +         ++V +  GLQRN      I+L C+D  +       L  T DGG TW      F +   +I FH  +  W++       LY S++ G  W  +   V +  W    +    I+    G+    S+       SN + P   L K TD  AG + WK + + I+++  +D F++IS+   G    R L VS D G TF +  LP+   ++FF IL   +   ++H+D  +  G G L+TS+S GQVFS+SL  +FYP    +SDFYKVESMRG ++++ L+ D S+ S+IT NRGA W+ + KP   TC   D   C++QV   YS+  +VP+  P S P+A+G+++VH H A  L+++ +DVYI+SDGGY+W  AL GPH   I ++G  LVA+     GS+ + +KFSTD GRCWH H++TTED   TGLLTEPGN+A+TVAIWGY +    W + VVDL  LLSR C DSDYE W ++  + + N  N+  C+LG KE   RLK DS+C + YS+K   +   C CTKDDFECE+GY R VNS +C+++ ++    +C    V+KIIT+GY+K+P + C+GGF P+ T Q+ L++ 
Sbjct:   27 AKFIFSNETKPSLLMTWAGNQT---LIIVTIRTQGVLTRD--SSVYRSTNDGRTFVNITAKILEAGATSSALLVSQSLGLQRNPAQPARIYLACHDPAKLGGATGLLYYTLDGGATWHLSSPGFPVQSAQILFHTDKPDWLL-AQAGDKLYLSVNAGQDWRLIKKRVFKASWGVSADDKDSIYAAFDGEASFVSLLRDGVASSNHRLPGRQLAKLTDFTAGSNNWKTLAEKIYSYNNKDGFIFISKSDEGKAESRHLEVSTDCGKTFVRTQLPSATPDRFFVILDTSDGLAFVHIDAGNYLGYGTLYTSNSLGQVFSKSLERNFYPPLGGSSDFYKVESMRGAFLSTVLHSDASMHSVITHNRGAVWRHLSKPDGVTCTTTDGGPCYLQVASYYSISRSVPADQPRSAPSAVGLLIVHGHTAAKLQSNPADVYISSDGGYSWYLALKGPHRVQIGNNGNFLVAVEKSANGSSPQVVKFSTDAGRCWHSHRFTTEDYVFTGLLTEPGNRALTVAIWGYVSELHHWRVFVVDLGVLLSRSCTDSDYESWLSNGAVNYDNA-NHQACVLGAKETIKRLKADSMCASTYSYKPQTSVTPCECTKDDFECEFGYTRPVNSLDCVRDPDVPTPRICDANTVKKIITEGYRKLPRNRCQGGFQPNVTHQEVLHEA 687          
BLAST of Sortilin vs. TrEMBL
Match: A0A267FI60 (Sortilin OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig029917g1 PE=4 SV=1)

HSP 1 Score: 511.916 bits (1317), Expect = 6.890e-165
Identity = 271/682 (39.74%), Postives = 402/682 (58.94%), Query Frame = 1
Query:  115 KEVIGNAFKNNNPISKFVFTNDTKTSVQVTWAGDNSGKIILVTTKEIQIILTYADLSDIYFSDNNGKSFKRITESL-----PIKKVIVRKENGLQRNILDHQNIFLVCYDTVERSA----LLITKDGGETWKKVELNF-ILDREIKFHPFEKSWMITVNKARNLYKSIDGGLTWEFLLSDVLQYQWTTDKNYPQDIFVK-TGKILETSIFEKIFGISNQKAPVMNLKKSTD--AGKS-WKIIKKNIFAFFLRDKFLYISELITG--NRRRLMVSIDNGNTFNKVYLPTIANNQFFSILHIEEDSVYIHVDNADTRGDGILFTSDSDGQVFSQSLMNHFYPSAELTSDFYKVESMRGTYIASQLNPDRSIQSLITFNRGAEWKRIKKPVNETCHNKDKTECFVQVTGAYSLMNNVPSSLPLSTPTAIGIVLVHAHLANSLKNSVSDVYITSDGGYNWIKALDGPHDYVIADHGGLLVAM-----GSNKKFIKFSTDEGRCWHEHQYTTEDIRVTGLLTEPGNKAMTVAIWGYSNNDTQWIIHVVDLSQLLSRECDDSDYEKWYAHSEMMHPNGENYAGCLLGKKEEFLRLKKDSLCKNGYSHKVTKTEKICPCTKDDFECEYGYFRTVNSKNCIKN-ELIKENLCVKGIVEKIITQGYKKIPSDVCEGGFSPDKTKQKWLNQT 2094
            KE + +A   +  +S+F+F+N+TK S+ +TWAG+ +   +++ T   Q +LT    S +Y S N+G++F  IT  +         ++V +  GL+RN      I+L C+D  +       L  T DGG TW      F +   +I FH  +  W++       LY S++ G  W  +   V +  W    +    I+    G+    S+       SN + P   L K TD  AG + WK + + I+++  +D F++IS+   G    R L VS D G TF +  LP+   ++FF IL   +   ++H+D  +  G G L+TS+S GQVFS+SL  +FYP    +SDFYKVESMRG ++++ L+ D S+ S+IT NRGA W+ + KP   TC   D   C++QV   YS+  +VP+  P S P+A+G+++VH H A  L+++ +DVYI+SDGGY+W  AL GPH   I ++G  LVA+     GS+ + +KFSTD GRCWH H++TTED   TGLLTEPGN+A+TVAIWGY +    W + VVDL  LLSR C DSDYE W ++  + + N  N+  C+LG KE   RLK DS+C + YS+K   +   C CTKDDFECE+GY R VNS +C+++ ++    +C    V+KIIT+GY+K+P + C+GGF P+ T Q+ L++ 
Sbjct:   39 KEKLSSAAVQSKFVSEFIFSNETKPSLLMTWAGNQT---LIIVTIRTQGVLTRD--SSVYRSTNDGRTFVNITAKILEAGATSSALLVSQSLGLKRNPAQPARIYLACHDPAKLGGATGLLYYTLDGGATWHLSSPGFPVQSAQILFHTDKPDWLL-AQAGDKLYLSVNAGQDWRLIKKRVFKASWGVSADDKDSIYAAFDGEASFVSLLRDGVASSNHRLPGRQLAKLTDFTAGSNNWKTLAEKIYSYNNKDGFIFISKSDEGKAESRHLEVSTDCGKTFVRTQLPSATPDRFFVILDTSDGLAFVHIDAGNYLGYGTLYTSNSLGQVFSKSLERNFYPPLGGSSDFYKVESMRGAFLSTVLHSDASMHSVITHNRGAVWRHLSKPDGVTCTTTDGGPCYLQVASYYSISRSVPADQPRSAPSAVGLLIVHGHTAAKLQSNPADVYISSDGGYSWYLALKGPHRVQIGNNGNFLVAVEKSANGSSPQVVKFSTDAGRCWHSHRFTTEDYVFTGLLTEPGNRALTVAIWGYVSELHHWRVFVVDLGVLLSRSCTDSDYESWLSNGAVNYDNA-NHQACVLGAKETIKRLKADSMCASTYSYKPQTSVTPCECTKDDFECEFGYTRPVNSLDCVRDPDVPTPRICDANTVKKIITEGYRKLPRNRCQGGFQPNVTHQEVLHEA 713          
BLAST of Sortilin vs. Ensembl Cavefish
Match: sort1a (sortilin 1 [Source:NCBI gene;Acc:103040260])

HSP 1 Score: 421.394 bits (1082), Expect = 3.986e-134
Identity = 233/674 (34.57%), Postives = 374/674 (55.49%), Query Frame = 1
Query:  175 NDTKTSVQVTWAGDNSGKIILVTTKEIQIILTYADLSDIYFSDNNGKSFKRITESLPIKKVIVRKENGLQRNILDHQNIFLVC-YDTVERSALLITKDGGETWKKVELNFILDREIKFHPFEKSWMITVNKARNLYKSIDGGLTWEFLLSDVLQYQWTTDKNYPQDIFVKTGKILETSIFEKIFGISNQKAPVMNLKKSTDAGKSWKIIKKNIFAFFLRDKFLYISEL-ITGNRRRLMVSIDNGNTFNKVYLPTIANNQFFSILHIEEDSVYIHVDNADTRGDGILFTSDSDGQVFSQSLMNHFYPSAELTSDFYKVESMRGTYIASQLNPDRSIQSLITFNRGAEWKRIKKPVNETCHNK--DKTECFVQVTGAY--SLMNNVPSSLPLSTPTAIGIVLVHAHLANSLKNSVSDVYITSDGGYNWIKALDGPHDYVIADHGGLLVAMGSNKK----FIKFSTDEGRCWHEHQYTTEDIRVTGLLTEPGNKAMTVAIWGY--SNNDTQWIIHVVDLSQLLSRECDDSDYEKWYAHSEMMHPNGENYAGCLLGKKEEFLRLKKDSLCKNGYSHKVTKTEKICPCTKDDFECEYGYFRTVNSKNCIKNELIKEN---LCVKGIVEKIITQGYKKIPSDVCEGGFSPDKTKQKWLNQTCVEDEFKKIVVPISNTDSN 2151
            ND   SV + W GD +G ++++TT ++ + +     S +Y S++ GKSF+ +T+   I    ++ E G+     +   + L       + S +  + D G+++   +L F    +I ++P   S +  ++   +L+ S D G +W+ +   V   +W T                +T  F      S     ++ L+K++D G+S+K I   I++F L  +F++ S +  T   R + VS+D G  +N   LPT+ + QF+SIL    D V++HVD     G G ++ SD  G VFS+SL  H Y S    +DF  V S+RG Y+ S L  D S+Q+++TF +G +W+ ++KP N  C     D   C + +  +Y  S+M NVP  LPL+ P A+G++L H  + +++     DV+++ DGGY W +AL GPH Y I D GGLLVA+  N       IKFSTDEG+CWH + +T E I  TGL +EPG ++M +++WGY  S     W+   +D  QL SR+C + DY +W AHS+      +   GCLLG KE++LRL+KDS+C NG  + ++K    CPCT DDF+C++GY+R  NS  C++   +K +    C+ G  E++ T GY+KIP D CEGG  P++     L++ CV +  +  ++  +++ S+
Sbjct:   92 NDLSGSVSLAWVGDGTGVLLVLTTFQVPLFMIRFGQSKLYRSEDYGKSFQDVTDL--INNTFIQSEFGIAIGPENSGKVILTGDVSDGKASRIFRSMDFGKSFYPSDLPFQPIMQIAYNPENSSILTAISITYDLWLSTDFGQSWKKIHDTVCLVKWGT---------------ADTLFFTTNPNGSCSDKGMLELRKTSDNGQSFKTIGSRIYSFGLGGRFIFASVMSATSLTRMIHVSVDKGEVWNMAQLPTVGHEQFYSILAANNDMVFMHVDEPGDSGMGTIYVSDDRGTVFSKSLERHLYTSTGGDTDFTIVSSLRGVYMTSVLAQDGSVQTVVTFGQGGKWRPLRKPWNGKCDATAGDPGLCSLHIHASYSTSMMLNVP-MLPLTEPNAVGLILAHGSVGDAVSVLSPDVFVSDDGGYTWSQALKGPHHYAILDSGGLLVAVEHNPNQPIFQIKFSTDEGQCWHVYNFTDEPIYFTGLASEPGARSMNLSLWGYRESMMSQYWVSVTIDFKQLFSRDCGEGDYVQWLAHSDN---KSDPTDGCLLGFKEKYLRLRKDSVCWNGRDYVISKQPTQCPCTLDDFQCDFGYYRAENSSECVEQPDLKGHTLEFCLHGRKEQLQTSGYRKIPGDRCEGGKVPERRVID-LSKKCVSNLLRPELLSEAHSGSS 743          
BLAST of Sortilin vs. Ensembl Cavefish
Match: sort1b (sortilin-like [Source:NCBI gene;Acc:103047724])

HSP 1 Score: 420.239 bits (1079), Expect = 9.142e-134
Identity = 231/680 (33.97%), Postives = 376/680 (55.29%), Query Frame = 1
Query:  175 NDTKTSVQVTWAGDNSGKIILVTTKEIQIILTYADLSDIYFSDNNGKSFKRITESLPIKKVIVRKENGLQRNILDHQNIFLVCYDTVERSA-LLITKDGGETWKKVELNFILDREIKFHPFEKSWMITVNKARNLYKSIDGGLTWEFLLSDVLQYQWTTDKNYPQDIFVKTGKILETSIFEKIFGISNQKAPVMNLKKSTDAGKSWKIIKKNIFAFFLRDKFLYISELI-TGNRRRLMVSIDNGNTFNKVYLPTIANNQFFSILHIEEDSVYIHVDNADTRGDGILFTSDSDGQVFSQSLMNHFYPSAELTSDFYKVESMRGTYIASQLNPDRSIQSLITFNRGAEWKRIKKPVNETCHN--KDKTECFVQVTGAYSLMN--NVPSSLPLSTPTAIGIVLVHAHLANSLKNSVSDVYITSDGGYNWIKALDGPHDYVIADHGGLLVAMGSNKKF----IKFSTDEGRCWHEHQYTTEDIRVTGLLTEPGNKAMTVAIWGYSNN--DTQWIIHVVDLSQLLSRECDDSDYEKWYAHSEMMHPNGENYAGCLLGKKEEFLRLKKDSLCKNGYSHKVTKTEKICPCTKDDFECEYGYFRTVNSKNCIKNELIKEN---LCVKGIVEKIITQGYKKIPSDVCEGGFSPDKTKQKWLNQTCVEDEFKKIVVPISNTDSNTTAKHS 2169
            +D   SV + W GD +G ++ +TT ++ + +     S +Y S++ GK+F+ +TE   I    +  + G+         + L    +   SA + ++ D G ++ + +L F    +I ++P   + ++ ++   +L+ S + G  W  +   V   +W  D                T  F      S     ++ LKK+ D G++   I + I++F +  +FL+ S +  TG  R + VS+D G  +N   LP + + QF+SIL    + V++HVD     G G ++ SD  G V+S+SL +H Y +    +DF  V S+RG ++ S L  D S+Q++++F++G EW  ++KP N  C +  KDK +C + +  +YS+    NVP  LPLS P A+G+++ H  + +++     DVY++ DGGY+W++AL+GPH Y I D GGLLVA+  N       IKFSTDEG+CWH + +T E +  TGL +EPG ++M V+IWGY        W+   +D  +LL+R+C ++DY  W AHS+ +    +   GC+LG KE+FLRLKKDS+C NG  + V K    C CT DDF C++GY+R  NS +C++   +K +   LC+ G  E + T GY+KIP D CEGG  P++ K+  + + C+ +    ++ P   T +N    HS
Sbjct:   88 DDLSGSVSLAWIGDGTGVLLALTTFQVPLFMLRFGQSRLYRSEDYGKTFQDVTEL--ISNTFISTDFGIAIGPESSGKVILTGDLSGSGSARIFLSSDFGNSFTRSDLPFNPKMQIVYNPQNPNVLVAISTKSDLWISENFGEKWRIISETVCAVKWGADN---------------TLFFSTNLNGSCSDRGMLTLKKTIDNGQTINTIAEKIYSFGIGGRFLFASVMTGTGTLRMIHVSVDQGKEWNMAQLPPVGHEQFYSILAANNEMVFMHVDEPGDTGFGTIYVSDDRGMVYSKSLEHHLYTATGGDNDFTNVTSLRGVFMTSVLAEDGSVQTVVSFDQGGEWVPLRKPENSECDSTAKDKDKCSLHIHASYSISMKLNVP-MLPLSEPNAVGLIIAHGSVGDAISVLTPDVYVSDDGGYSWLRALEGPHHYAILDSGGLLVAVEHNPTVPISQIKFSTDEGQCWHVYNFTKEPLFFTGLASEPGARSMNVSIWGYRETLITQYWVSVTIDFRELLTRDCVENDYVPWLAHSDDI---SDPKDGCMLGYKEKFLRLKKDSVCWNGRDYNVNKQPTPCACTLDDFLCDFGYYRNENSSDCLEQPELKGHDLELCIHGKKEHLQTNGYRKIPGDKCEGGNQPER-KEVDIRKKCISN----LLDPQMQTQNNGKPSHS 741          
BLAST of Sortilin vs. Ensembl Cavefish
Match: sort1b (sortilin-like [Source:NCBI gene;Acc:103047724])

HSP 1 Score: 406.371 bits (1043), Expect = 1.218e-128
Identity = 225/659 (34.14%), Postives = 366/659 (55.54%), Query Frame = 1
Query:  175 NDTKTSVQVTWAGDNSGKIILVTTKEIQIILTYADLSDIYFSDNNGKSFKRITESLPIKKVIVRKENGLQRNILDHQNIFLVCYDTVERSA-LLITKDGGETWKKVELNFILDREIKFHPFEKSWMITVNKARNLYKSIDGGLTWEFLLSDVLQYQWTTDKNYPQDIFVKTGKILETSIFEKIFGISNQKAPVMNLKKSTDAGKSWKIIKKNIFAFFLRDKFLYISELI-TGNRRRLMVSIDNGNTFNKVYLPTIANNQFFSILHIEEDSVYIHVDNADTRGDGILFTSDSDGQVFSQSLMNHFYPSAELTSDFYKVESMRGTYIASQLNPDRSIQSLITFNRGAEWKRIKKPVNETCHN--KDKTECFVQVTGAYSLMN--NVPSSLPLSTPTAIGIVLVHAHLANSLKNSVSDVYITSDGGYNWIKALDGPHDYVIADHGGLLVAMGSNKKF----IKFSTDEGRCWHEHQYTTEDIRVTGLLTEPGNKAMTVAIWGYSNN--DTQWIIHVVDLSQLLSRECDDSDYEKWYAHSEMMHPNGENYAGCLLGKKEEFLRLKKDSLCKNGYSHKVTKTEKICPCTKDDFECEYGYFRTVNSKNCIKNELIKEN---LCVKGIVEKIITQGYKKIPSDVCEGGFSPDKTKQKWLNQTCVED 2106
            +D   SV + W GD +G ++ +TT ++ + +     S +Y S++ GK+F+ +TE   I    +  + G+         + L    +   SA + ++ D G ++ + +L F    +I ++P   + ++ ++   +L+ S + G  W  + S                  VKT K +                  + LKK+ D G++   I + I++F +  +FL+ S +  TG  R + VS+D G  +N   LP + + QF+SIL    + V++HVD     G G ++ SD  G V+S+SL +H Y +    +DF  V S+RG ++ S L  D S+Q++++F++G EW  ++KP N  C +  KDK +C + +  +YS+    NVP  LPLS P A+G+++ H  + +++     DVY++ DGGY+W++AL+GPH Y I D GGLLVA+  N       IKFSTDEG+CWH + +T E +  TGL +EPG ++M V+IWGY        W+   +D  +LL+R+C ++DY  W AHS+ +    +   GC+LG KE+FLRLKKDS+C NG  + V K    C CT DDF C++GY+R  NS +C++   +K +   LC+ G  E + T GY+KIP D CEGG  P++ K+  + + C+ +
Sbjct:   88 DDLSGSVSLAWIGDGTGVLLALTTFQVPLFMLRFGQSRLYRSEDYGKTFQDVTEL--ISNTFISTDFGIAIGPESSGKVILTGDLSGSGSARIFLSSDFGNSFTRSDLPFNPKMQIVYNPQNPNVLVAISTKSDLWISENFGEKWRIIKS------------------VKTFKGM------------------LTLKKTIDNGQTINTIAEKIYSFGIGGRFLFASVMTGTGTLRMIHVSVDQGKEWNMAQLPPVGHEQFYSILAANNEMVFMHVDEPGDTGFGTIYVSDDRGMVYSKSLEHHLYTATGGDNDFTNVTSLRGVFMTSVLAEDGSVQTVVSFDQGGEWVPLRKPENSECDSTAKDKDKCSLHIHASYSISMKLNVP-MLPLSEPNAVGLIIAHGSVGDAISVLTPDVYVSDDGGYSWLRALEGPHHYAILDSGGLLVAVEHNPTVPISQIKFSTDEGQCWHVYNFTKEPLFFTGLASEPGARSMNVSIWGYRETLITQYWVSVTIDFRELLTRDCVENDYVPWLAHSDDI---SDPKDGCMLGYKEKFLRLKKDSVCWNGRDYNVNKQPTPCACTLDDFLCDFGYYRNENSSDCLEQPELKGHDLELCIHGKKEHLQTNGYRKIPGDKCEGGNQPER-KEVDIRKKCISN 703          
BLAST of Sortilin vs. Ensembl Cavefish
Match: sort1a (sortilin 1 [Source:NCBI gene;Acc:103040260])

HSP 1 Score: 404.831 bits (1039), Expect = 1.312e-127
Identity = 229/662 (34.59%), Postives = 367/662 (55.44%), Query Frame = 1
Query:  214 DNSGKIILV-TTKEIQIILTYADLSDIYFSDNNGKSFKRITESLPIKKVIVRKENGLQRNILDHQNIFLVC-YDTVERSALLITKDGGETWKKVELNFILDREIKFHPFEKSWMITVNKARNLYKSIDGGLTWEFLLSDVLQYQWTTDKNYPQDIFVKTGKILETSIFEKIFGISNQKAPVMNLKKSTDAGKSWKIIKKNIFAFFLRDKFLYISEL-ITGNRRRLMVSIDNGNTFNKVYLPTIANNQFFSILHIEEDSVYIHVDNADTRGDGILFTSDSDGQVFSQSLMNHFYPSAELTSDFYKVESMRGTYIASQLNPDRSIQSLITFNRGAEWKRIKKPVNETCHNK--DKTECFVQVTGAY--SLMNNVPSSLPLSTPTAIGIVLVHAHLANSLKNSVSDVYITSDGGYNWIKALDGPHDYVIADHGGLLVAMGSNKK----FIKFSTDEGRCWHEHQYTTEDIRVTGLLTEPGNKAMTVAIWGY--SNNDTQWIIHVVDLSQLLSRECDDSDYEKWYAHSEMMHPNGENYAGCLLGKKEEFLRLKKDSLCKNGYSHKVTKTEKICPCTKDDFECEYGYFRTVNSKNCIKNELIKEN---LCVKGIVEKIITQGYKKIPSDVCEGGFSPDKTKQKWLNQTCVEDEFKKIVVPISNTDSN 2151
            DN+  ++LV TT ++ + +     S +Y S++ GKSF+ +T+   I    ++ E G+     +   + L       + S +  + D G+++   +L F    +I ++P   S +  ++   +L+ S D G +W+ +   V   +W T                +T  F      S     ++ L+K++D G+S+K I   I++F L  +F++ S +  T   R + VS+D G  +N   LPT+ + QF+SIL    D V++HVD     G G ++ SD  G VFS+SL  H Y S    +DF  V S+RG Y+ S L  D S+Q+++TF +G +W+ ++KP N  C     D   C + +  +Y  S+M NVP  LPL+ P A+G++L H  + +++     DV+++ DGGY W +AL GPH Y I D GGLLVA+  N       IKFSTDEG+CWH + +T E I  TGL +EPG ++M +++WGY  S     W+   +D  QL SR+C + DY +W AHS+      +   GCLLG KE++LRL+KDS+C NG  + ++K    CPCT DDF+C++GY+R  NS  C++   +K +    C+ G  E++ T GY+KIP D CEGG  P++     L++ CV +  +  ++  +++ S+
Sbjct:   84 DNTHTVLLVLTTFQVPLFMIRFGQSKLYRSEDYGKSFQDVTDL--INNTFIQSEFGIAIGPENSGKVILTGDVSDGKASRIFRSMDFGKSFYPSDLPFQPIMQIAYNPENSSILTAISITYDLWLSTDFGQSWKKIHDTVCLVKWGT---------------ADTLFFTTNPNGSCSDKGMLELRKTSDNGQSFKTIGSRIYSFGLGGRFIFASVMSATSLTRMIHVSVDKGEVWNMAQLPTVGHEQFYSILAANNDMVFMHVDEPGDSGMGTIYVSDDRGTVFSKSLERHLYTSTGGDTDFTIVSSLRGVYMTSVLAQDGSVQTVVTFGQGGKWRPLRKPWNGKCDATAGDPGLCSLHIHASYSTSMMLNVP-MLPLTEPNAVGLILAHGSVGDAVSVLSPDVFVSDDGGYTWSQALKGPHHYAILDSGGLLVAVEHNPNQPIFQIKFSTDEGQCWHVYNFTDEPIYFTGLASEPGARSMNLSLWGYRESMMSQYWVSVTIDFKQLFSRDCGEGDYVQWLAHSDN---KSDPTDGCLLGFKEKYLRLRKDSVCWNGRDYVISKQPTQCPCTLDDFQCDFGYYRAENSSECVEQPDLKGHTLEFCLHGRKEQLQTSGYRKIPGDRCEGGKVPERRVID-LSKKCVSNLLRPELLSEAHSGSS 723          
BLAST of Sortilin vs. Ensembl Cavefish
Match: si:dkey-159a18.1 (sortilin-like [Source:NCBI gene;Acc:103040108])

HSP 1 Score: 402.905 bits (1034), Expect = 2.367e-127
Identity = 228/651 (35.02%), Postives = 354/651 (54.38%), Query Frame = 1
Query:  169 FTNDTKTSVQVTWAGDNSGKIILVTTKEIQIILTY-ADLSDIYFSDNNGKSFKRITESLPIKKVIVRKENGLQRNILDHQNIFLVCYDTVER---SALLITKDGGETWKKVELNFILDREIKFHPFEKSWMITVNKARNLYKSIDGGLTWEFLLSDVLQYQWTTDKNYPQDIFVKTGKILETSIFEKIFGISNQKAPVMNLKKSTDAGKSWKIIKKNIFAFFLRDKFLYISEL-ITGNRRRLMVSIDNGNTFNKVYLPTIANNQFFSILHIEEDSVYIHVDNADTRGD-GILFTSDSDGQVFSQSLMNHFYPSAELTSDFYKVESMRGTYIASQLNPDRSIQSLITFNRGAEWKRIKKPVNETCHNKDKTECFVQVTGAYSLMNNVPSSLPLSTPTAIGIVLVHAHLANSLKNSVSDVYITSDGGYNWIKALDGPHDYVIADHGGLLVAMGSNK----KFIKFSTDEGRCWHEHQYTTEDIRVTGLLTEPGNKAMTVAIWGYSNND---TQWIIHVVDLSQLLSRECDDSDYEKWYAHSEMMHPNGENYAGCLLGKKEEFLRLKKDSLCKNGYSHKVTKTEKICPCTKDDFECEYGYFRTVNSKNCIKNELIKENL---CVKGIVEKIITQGYKKIPSDVCEGGFSPDKTK 2073
            F  D   +  +TW GD +G I++++T    +   Y    S +Y S++ GK+F  I+ +  +    ++K+ G+     + Q + L+            +  + D G T+K V+L F   + I FH   K  ++ +     L+ S D G  W  +   V  + W              G  L  S   K    ++++  ++ L+++ D G+++  I +NIF F     FL+ S L   G+ R + VS D G  FNK  LPT  + QF+S+L  +ED ++IHVD+       G ++TSD  G ++S+SL  H +   E  SDF  V S+RG Y+ + L  D  I ++ITFN+G EW  ++KP N  C  ++  +C + + G +   + +   +PL+ P+A+G+++ H  + +S+  S  DVY++SDGGYNWI  L GPH Y I D GGLLVA+ ++K      IKFSTDEG+CW  + +TT    + GL +EPG+K M ++++GY  +D     W+   +D  +LL+REC D DY +W AHS+         AGC+LG KE F RLK  S+C+NG  + V+K +  CPCT++D+ C+YGY+   NS  C+  E   +     CV+    +I   GY+KIPSD CEGGFSP   K
Sbjct:   71 FHGDDGFTFSLTWVGDGTGVILVLSTVSSSLESFYEGSYSRLYRSEDYGKAFHDISHA--VNHTFIKKDFGICAGPGNSQQVILIAELPTTHNPGGVIFTSVDAGVTFKSVQLPFHPAQPISFHDKNKECLLVIGTDGGLWLSQDFGKKWSKIHDGVYSFTW------------GPGNTLFFSYSPKNTVDADKQGKLL-LRRTQDLGRTFTTISQNIFTFGYIGGFLFTSVLEKQGSPRVIYVSSDQGENFNKALLPTATSEQFYSLLDGDEDMIFIHVDSPGENSHFGTIYTSDDRGILYSKSLERHLF-GMERKSDFTNVTSLRGVYLTNVLKKDGRITTVITFNKGGEWIPLRKPQNVDC-GRNVKKCNLHIHGEHCHYSGISPMVPLTDPSAVGLIIAHGSVGDSISASKPDVYVSSDGGYNWIGTLRGPHFYSILDSGGLLVAVEAHKDRPVHVIKFSTDEGQCWKTYNFTTHPFFIAGLASEPGSKTMNISVFGYRPDDDDQPMWVAVTIDFEKLLTRECGDEDYMEWLAHSD-----SSETAGCVLGYKETFRRLKMMSVCRNGRDYVVSKQQMPCPCTREDYMCDYGYYHHENSSECVLQEGFIDKTPKNCVESDKHQIT--GYRKIPSDKCEGGFSPPHQK 697          
BLAST of Sortilin vs. Ensembl Sea Lamprey
Match: SORT1 (sortilin 1 [Source:HGNC Symbol;Acc:HGNC:11186])

HSP 1 Score: 358.607 bits (919), Expect = 1.821e-112
Identity = 210/662 (31.72%), Postives = 357/662 (53.93%), Query Frame = 1
Query:  175 NDTKTSVQVTWAGDNSGKIILVTTKEIQI--ILTYADLSDIYFSDNNGKSFKRITESLPIKKVIVRKENGLQRNILDHQNIFLVCYDTVERSAL---LITKDGGETWKKVELNFILDREIKFHPFEKSWMITVNKARNLYKSIDGGLTWEFLLSDVLQYQWTTDKNYPQDIFVKTGKILETSIFEKIFGISNQKAPVMNLKKSTDAGKSWKIIKKNIFAFFLRDKFLYISELITG----NRRRLMVSIDNGNTFNKVYLPTIANNQFFSILHIEEDSVYIHVDNADTRGDGILFTSDSDGQVFSQSLMNHFYPSAELTSDFYKVESMRGTYIASQLNPDRSIQSLITFNRGAEWKRIKKPVNETCHN--KDKTECFVQVTGAYSLMNNVPSSLP---LSTPTAIGIVLVHAHLANSLKNSVSDVYITSDGGYNWIKALDGPHDYVIADHGGLLVAM----GSNKKFIKFSTDEGRCWHEHQYTTEDIRVTGLLTEPGNKAMTVAIWGYS-------NNDTQWIIHVVDLSQLLSRECDDSDYEKWYAHSEMMHPNGENYAGCLLGKKEEFLRLKKDSLCKNGYSHKVTKTEKICPCTKDDFECEYGYFRTVNSKNCIKNELIKE---NLCVKGIVEKIITQGYKKIPSDVCEGGFSPDKTKQ 2076
            +D  + + + W G+ SG ++ +T ++  +  +    D S +Y S + GK++K IT+   I   ++R ++ +  + L+ Q + L+  + + R+ L   + +KDGG  +    + F    +  FHP     ++ ++   +L+ + D G+TW  + S V+ Y+W  D           G +  T+  ++    S Q    + LKKS D G ++  +   I  F +   F+Y S L        R  L +SID G  +N   L     ++ +++L  +ED +++HVD+ + +  G ++TSD  G +FS+SL  HF+ +    +DF  V SM+G YI +++  D  +QS ITFNRG +W+ I KP N  C     ++++C + + G Y+++ +  SS+P   LS   AIG+++ H ++  SL  +  DVY++ DGGY W + L GPH Y I D GGL+VA+          I FSTD G+ WHE  ++ E++ V GL++EPG K+  V++WG+          D  W+ + +D   LL R C D D+E W AH  M  P  ++ +GC+LG K  F  LKK+S C  G  +   +T   CPCT++D+ C++GY++  +S  C++     +   ++CV    + I T+GY+K+P D CEGG   + T++
Sbjct:    1 DDDGSQMTLAWVGNKSGVVLALTARDFNVPFLQLLFDRSKLYISTDYGKTYKDITDQ--IGYGMIRNDHSIISHPLNPQRVVLLT-EQLGRALLYFLVTSKDGGLNFTAQLIPFAPMTKFSFHPINPDVLVCISLNASLFITKDFGITWRLIHSHVITYKWAED-----------GSLFLTTTGDENPQFSRQW---LQLKKSIDYGDTFLTMASGIQEFGVAGHFMYSSVLYQNVSVKARLVLHISIDGGKNWNIAQLAPSNVSRIYAVLWYDEDMLFMHVDDPEVKTYGCIYTSDRRGIIFSKSLDRHFFTTFLFNTDFTPVASMKGVYITTRIAEDNRVQSRITFNRGGQWQPILKPKNVECKADVSNESDCALHIHGKYTILQD--SSVPQLLLSEQNAIGLIIAHGNVGASLNVTERDVYLSEDGGYTWSRVLQGPHYYSILDSGGLIVAVPFSYSHTPGVIHFSTDAGQTWHEFLFSPENLMVKGLVSEPGAKSTHVSVWGHHLKMTNPVRVDLVWVSYTIDFGILLKRNCTDEDFEPWLAH-WMEGPTNQS-SGCVLGVKRTFRMLKKNSSCLKGPDYFPNETLGYCPCTEEDYMCDFGYYK--DSGKCVEEWKFNKTSLHVCVTEGEQLIETEGYRKVPGDKCEGGLQHNSTRK 639          
BLAST of Sortilin vs. Ensembl Sea Lamprey
Match: SORT1 (sortilin 1 [Source:HGNC Symbol;Acc:HGNC:11186])

HSP 1 Score: 348.977 bits (894), Expect = 1.735e-108
Identity = 212/687 (30.86%), Postives = 365/687 (53.13%), Query Frame = 1
Query:  175 NDTKTSVQVTWAGDNSGKIILVTTKEIQIILTYADLSDIYFSDNNGKSFKRIT------ESLPIKKVIVRKENGLQRNILDHQNIFLVCYDTVERSALLITKDGGETWKKVELNFILDREIKFHPFEKSWMITVNKARNLYKSIDGGLTWEFLLSDVLQYQWTTDKNYPQDIFVKTGKILETSIFEKIFGISNQKAPVMNLKKSTDAGKSWKIIKKNIFAFFLRDKFLYISELITGNRRR-LMVSIDNGNTFNKVYLPTIANNQFFSILHIEEDSVYIHVDNADTRGDGILFTSDSDGQVFSQSLMNHFYPSAELTSDFYKVESMRGTYIASQLNP--DRSIQSLITFNRGAEWKRIKKPVNETCHNKDKTE-CFVQVTGAYSL---MNNVPSSLPLSTPTAIGIVLVHAHLANSLKNSVS-DVYITSDGGYNWIKALDGPHDYVIADHGGLLVAM--GSNKKFIKFSTDEGRCWHEHQYTTEDIRVTGLLTEPGNKAMTVAIWGYSNNDT-QWIIHVVDLSQLLSRECDDSDYEKWYAHSEMMHPNGENYAGCLLGKKEEFLRLKKDSLCK-NGYSHKVTKTEKICPCTKDDFECEYGYFRTVNSKNCIKNELIKE----NLCVKGIVEKIITQGYKKIPSDVCEGGFSPDKTKQKWLNQTC---VEDEFKKIVVPISNTDSNTTA 2160
            ND   +V +TW G ++G ++ V+    ++I   +  S +Y S++ G SF  I+       +LP  +VIV   +  +  +L  +NI            + I++DGG+T++  ++ F     + FH      ++  + +  L+ + D   +++ L   V  Y+W+        +    G+ +E    E I G        + L +S+D+ +S + I + +++F +  +FL  S +   +++R L VS D G+++    LP I   +F+SIL  +++ +++HVD     G G L+ SD  G VFS+SL +H Y +   ++DF  V S RG +I S+L+   D S +S+ITF++G  W+ + +P N  C   +  E C + +    S+   +  VP   PLS P+A G+VL H  +  S   + + DVY++ DGG++W ++L+GPH   I + GGLLVA+   +    ++FS DEGRCW    ++ E + +  LLTEPG ++++ ++     + T + ++  +D SQLL R C   DYE+W A      P G    GC+LG  E  +RLK D+ C+ NG + +       CPCT+ D+ C++G+FR   S  C++          ++C +G  E+++TQGY+KIP D CEGGF P    +  +++TC   ++D+      P S  +SN+ A
Sbjct:    1 NDESANVTITWVGRDTGVVLAVS----RVIEAVSWKSRLYRSEDYGGSFSDISALVDGGHALPALEVIVGPGSSQRVVLLPRENI-------ARDVKVWISEDGGKTFRARDMPFTPQHGMAFHSASHDHLLASSSSNELWITEDFFGSFKKLGDAVRAYKWSPQDTTAYYLASPHGQKVE----EAIVG-------TLELMRSSDSSRSAQRIAERVYSFGIGGRFLCASVVHEKDKQRVLQVSTDRGDSWTMAQLPPIDTEEFYSILGADDNIIFVHVDEKGDTGRGTLYVSDDRGAVFSESLASHLYTARNGSADFINVTSARGAFITSRLSAATDGSARSVITFDQGGAWQPLPRPTNVPCEGGNGEEQCRLTIHSDLSMSQEVREVPHG-PLSEPSASGLVLAHGTVGQSQAPAAAPDVYVSRDGGHSWARSLEGPHVCAILNSGGLLVAVPYAATVNTVRFSLDEGRCWGSVMFSLEPLALERLLTEPGARSLSASVLARRLHPTPRLVLTTIDFSQLLQRNCVAGDYEEWTA------PLGR---GCVLGSTEHDMRLKPDAACRTNGQALRPASRSVPCPCTQRDYSCDFGFFRPNGSWECVEEASAPGRRSLHVCARGQQEELLTQGYRKIPGDRCEGGFRPSGDLRS-ISKTCTYSLQDD------PKSTPNSNSQA 648          
BLAST of Sortilin vs. Ensembl Sea Lamprey
Match: sorl1 (sortilin-related receptor, L(DLR class) A repeats containing [Source:ZFIN;Acc:ZDB-GENE-050208-22])

HSP 1 Score: 207.223 bits (526), Expect = 4.751e-57
Identity = 185/679 (27.25%), Postives = 313/679 (46.10%), Query Frame = 1
Query:  175 NDTKTSVQVTWAGDNSGKIILVTTKEIQIILTYADLSDIYFSDNNGKSFKRITESLPIKKVIVRKENGLQRNILDH-----QNIFLVCYDTVERSALLITKDGGETWKKVELNFILDREIKFHPFEKSWMITVNKA---RNLYKSIDGGLTWEFLLSDVLQYQWTTDKNYPQDIFVKTGKILETSIFEKIFGISNQKAPVMNLKKSTDAGKSWKIIKKNIFAFFLRDKFLYISELITGNRRRLMVSIDNGNTFNKVYLPTIANNQF--------FSILHIEEDSVYIHVDNADTRGDGILFTSDSDGQVFSQSLMNHFY-----PSA---------ELTSDFYKVESMRGTYIASQLN----PDRSIQSLITFNRGAEWKRI--------KKPVNETCHNKDKTECFVQVTGAYS-LMNNVPSSLP-LSTPTAIGIVLVHAHLANSLKNSVSDVYITSDGGYNWIKALDGPHDYVIADHGGLLVAMGSN--KKFIKFSTDEGRCWHEHQYTTEDIRVTGLLTEPGNKAMTVAIWGYSNNDTQ-WIIHVVDLSQLLSRECDDSDYEKWYAHSEMMHPNGENYAGCLLGKKEEFLRLKKDSLCKNGYSHKVTKTEKICPCTKDDFECEYGYFRTVNSKNCIKNELIKENL------CVKGIVEKIITQGYKKIPSDVCEGG 2052
            ND    + V WAG+ S   ++V       ++     S +Y S + G S+K I  +        R  NG +  I         N   +  DT+  S L IT D G+T K     F    ++  H    + ++  + +   + L+KS + G +W  +   V  Y W  +   P D         E  ++ +    +N    + +     DA K   ++ + +  F LRD +++ ++ +     +   S+    + N+     + ++QF        + I    ED V++ V++    G   L+ S+ +G  FS SL    Y     P A         E  +D ++VE +RG YIA+Q++     + +++S ITF++G EW+ +         +PVN  C  KD   C + VT  YS L+N     LP +S  +A G+++    +  +L +   +VYI+S  G +W + L GPH +   DHGG+LVA+        +KFSTDEG+ W + Q++TE+I V GL+TEPG K+    I+G        W+I  ++++ +L   C D DY+ W    E+ +        CLLG+K  + R    +LC NG           C CT++DFEC+ G+  T+ ++ C+++     +       C  G + +  T+GY+K+  D C GG
Sbjct:    2 NDNHNQMVVHWAGEKSN--VIVALARDSPLVQKEPSSAVYVSYDYGHSYKNIQTNFS------RLPNGSETVIAQFYHSPVDNRRYIFTDTLH-SYLWITNDFGQTVKNFSCPF-RPTDLLLHNKNPNLVLGYDSSHANKQLWKSDNFGESWTLIHEKVKSYYWGIE---PYD--------EENVVYVERLEPTNTSTILRSDDFFQDATKQ-HVLLQGVDDFQLRDSYMFATKTVHLVGSKYPRSVQLWVSHNR---KPLRSSQFRTKHPIVEYYIADASEDQVFVCVNHEG--GLTNLYISEREGLKFSLSLERVLYFSPKGPGADTLVRYFAQEPFADIHRVEGLRGIYIATQVSGEHFSEENMRSFITFDKGGEWQPLLPPDTDSWGRPVN--CQLKDN--CSLHVTQKYSQLLNFRDRLLPVMSKISAPGLIMASGSVGKNLAHK-PNVYISSTAGAHWRETLVGPHYFAWGDHGGILVAVSQEGLTGMLKFSTDEGQTWRDFQFSTENITVYGLMTEPGEKSAVFTIFGSKAPAAHSWLILQINMTYVLGSACLDEDYKLWSPADELGNE-------CLLGRKTVYKRRTAHALCFNGEDFDRPIMSSNCSCTREDFECDTGFKLTLENEQCVQDTDFDGDPYAPPVNCPAGTMYR-QTKGYRKVSGDTCSGG 640          
BLAST of Sortilin vs. Ensembl Sea Lamprey
Match: sorl1 (sortilin-related receptor, L(DLR class) A repeats containing [Source:ZFIN;Acc:ZDB-GENE-050208-22])

HSP 1 Score: 202.986 bits (515), Expect = 4.347e-54
Identity = 182/671 (27.12%), Postives = 307/671 (45.75%), Query Frame = 1
Query:  199 VTWAGDNSGKIILVTTKEIQIILTYADLSDIYFSDNNGKSFKRIT---ESLPIKKVIVRKENGLQRNILDHQNIFLVCYDTVERSALLITKDGGETWKKVELNFILDREIKFHPFEKSWMITVNKARNLYKSID-------------GGLTWEFLLSDVLQYQWTTDKNYPQDIFVKTGKILETSIFEKIFGISNQKAPVMNLKKSTDAGKSWKIIKKNIFAFFLRDKFLYISELI--TGNRRRLMVSIDNGNTFNKVYLPTIANNQFFSILHIEEDSVYIHVDNADTRGDGILFTSDSDGQVFSQSLMNHFY-----PSA---------ELTSDFYKVESMRGTYIASQLN----PDRSIQSLITFNRGAEWKRIKKPVNET------CHNKDKTECFVQVTGAYS-LMNNVPSSLP-LSTPTAIGIVLVHAHLANSLKNSVSDVYITSDGGYNWIKALDGPHDYVIADHGGLLVAMGSN--KKFIKFSTDEGRCWHEHQYTTEDIRVTGLLTEPGNKAMTVAIWGYSNNDTQ-WIIHVVDLSQLLSRECDDSDYEKWYAHSEMMHPNGENYAGCLLGKKEEFLRLKKDSLCKNGYSHKVTKTEKICPCTKDDFECEYGYFRTVNSKNCIKNELIKENL------CVKGIVEKIITQGYKKIPSDVCEGG 2052
            V WAG+ S   ++V       ++     S +Y S + G S+K I      LP     V  +     + +D++       DT+  S L IT D G+T K    NF         PF  + ++  NK  NL    D             GG    ++   V  + W +    P +I ++     +     K F I       +    ++ +  S  I+   +  F LRD +++ ++ +     R    ++   G + N  +  +   ++++ I    ED V++ V++    G   L+ S+ +G  FS SL    Y     P A         E  +D ++VE +RG YIA+Q++     + +++S ITF++G EW+ +  P  ++      C  KD   C + VT  YS L+N     LP +S  +A G+++    +  +L +   +VYI+S  G +W + L GPH +   DHGG+LVA+        +KFSTDEG+ W + Q++TE+I V GL+TEPG K+    I+G        W+I  ++++ +L   C D DY+ W    E+ +        CLLG+K  + R    +LC NG           C CT++DFEC+ G+  T+ ++ C+++     +       C  G + +  T+GY+K+  D C GG
Sbjct:    3 VHWAGEKSN--VIVALARDSPLVQKEPSSAVYVSYDYGHSYKNIQTNFSRLPNGSETVIAQ--FYHSPVDNRRYIFT--DTLH-SYLWITNDFGQTVK----NFSC-------PFRPTDLLLHNKNPNLVLGYDSSHANCTANPPHRGGCGGAYVNVQVCHHGWGSLYALPHEIGIQ-----DLFFLHKFFLIFKN----VFFSSASFSFGSQTILSYGVDDFQLRDSYMFATKTVVRAPPRTSRWLAYTYGQSQNTAFGISAGAHEYY-IADASEDQVFVCVNHEG--GLTNLYISEREGLKFSLSLERVLYFSPKGPGADTLVRYFAQEPFADIHRVEGLRGIYIATQVSGEHFSEENMRSFITFDKGGEWQPLLPPDTDSWGRPVNCQLKDN--CSLHVTQKYSQLLNFRDRLLPVMSKISAPGLIMASGSVGKNLAHK-PNVYISSTAGAHWRETLVGPHYFAWGDHGGILVAVSQEGLTGMLKFSTDEGQTWRDFQFSTENITVYGLMTEPGEKSAVFTIFGSKAPAAHSWLILQINMTYVLGSACLDEDYKLWSPADELGNE-------CLLGRKTVYKRRTAHALCFNGEDFDRPIMSSNCSCTREDFECDTGFKLTLENEQCVQDTDFDGDPYAPPVNCPAGTMYR-QTKGYRKVSGDTCSGG 632          
BLAST of Sortilin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004105.1 (pep scaffold:Pmarinus_7.0:GL477143:142842:164167:1 gene:ENSPMAG00000003744.1 transcript:ENSPMAT00000004105.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 182.57 bits (462), Expect = 1.582e-49
Identity = 132/524 (25.19%), Postives = 241/524 (45.99%), Query Frame = 1
Query:  406 NIFLVCYDTVERSALLITKDGGETWKKVELNFILDREIKFHPFEKSWMITVNKARNLYKSIDGGLTWEFL---LSDVLQYQWTTDKNYPQDIFVKTGKILETSIFEKIFGISNQ----KAPVMNLKKSTDAGKSWKIIKKNIFAFFLRDKFLYISELITGNRRRLMVSIDNGNTFNKVYLPTIANNQFFSILHIEEDSVYIHVDNADTRGDGILFTSDSDGQVFSQSLMN---HFYPSAELTSDFYKVESMRGTYIASQLNPDRSIQSLITFNRGAEWKRIKKPVNETCHNKDKTECFVQVTGAY----SLMNNVPSSLPLSTPTAIGIVLVHAHLANSLKNSVSDVYITSDGGYNWIKALDGPHDYVIADHGGLLVAMGSNKKFIK---FSTDEGRCWHEHQYTTEDIRVTGLLTEPGNKAMTVAIWGYSNNDTQWIIHVVDLSQLLSRECDDSDYEKWYAHSEMMHPNGENYAGCLLGKKEEFLRLKKDSLCKNGYSHKVTKTEKICPCTKDDFECEYGYFR 1926
             I LV    VERS L ++ D G +++++ + F L + + FHP  + W++  ++   LY S++ G  W  L   +SD   Y    D +  Q++           +  ++ G   +      P+ N   +         I +N  +  + + ++++ ++  G+  R  VS      F ++  P  A  +   IL    + V+    + +      L+ SD  G   + SL N      PSA    + ++V  +RG ++A+Q      +++ +T+NRG +W+ +  P  +    +  T C +     +    S  + V +   +S  TA G+++   +L   L      ++++SDGG  W +A D  H  +  DHGG ++A+      IK   +S DEG  W  H ++   I + GLL+EPG++ + + ++G+++  + W +  +D   L   +C D DYE W  H++           C++G+  EF + K  SLC NG S        +C C   DFEC+YG+ R
Sbjct:    1 QIVLVNEPHVERS-LHVSLDEGASFQRIRVTFSL-QSLLFHPHMEDWLLAYSQDGKLYVSMELGRDWHLLQERVSDGRYYWAVPDIDKDQEL-----------VHVEVQGADGEFYYVTCPISNCTGTALFSPFPGAIDQN--SLLVENHYVFV-QVTDGHIARYYVS-HGRRQFRQMLFPKYALPRDLHILSTGGEGVFAAARDWNQNQTYGLYFSDERGDRLTLSLANVACSDIPSAPKIINVHEVNGLRGVFLANQRQA-AEVKTYVTYNRGRDWRLLAAPATDLL--ERPTHCLLPACSLHLHLHSSGDTVMAGKVVSMATAPGLLMATGNLGAGLVEYEEKMFVSSDGGNTWSQAFDDEHHILFLDHGGAIIAVKDTAMPIKQLWYSVDEGISWKVHDFSPTPIYIDGLLSEPGDETLVITMFGHASLRSDWELVKIDFRTLFFHDCSDEDYENWTFHNQD--------EACIMGEVHEFRKRKLSSLCINGKSFNKRLKSNLCLCKDSDFECDYGFER 496          
BLAST of Sortilin vs. Ensembl Yeast
Match: YNR065C (Protein of unknown function; protein-protein interactions suggest a possible role in actin patch formation; YNR065C is not an essential gene [Source:SGD;Acc:S000005348])

HSP 1 Score: 154.836 bits (390), Expect = 6.464e-39
Identity = 156/645 (24.19%), Postives = 285/645 (44.19%), Query Frame = 1
Query:  388 NILDHQNIFLVCYDTVERSALL---------ITKDGGETWKKVELNFILDREIKFHPFEKSWMITVNKARNLYKSIDGGLTWEFL-LSDVLQYQWTTD-KNYPQDIFVKTG---------------------------KILETSIFEKIFGI-----SNQKAPVMNLKKSTDAGKSW-----------KIIKKNIFAFFLRDKFLYISELITGNRRRLMVSIDNGNTFNKVYLP---TIANNQFFSILHIEEDSVYIHV-DNADTRGD-GILFTSDSDGQVFSQSLMNHFYPSAELTSDFYKVESMRGTYIASQLN---------PDRSIQSLITFNRGAEWKRIKKPVNET------CHNKDKTECFVQVTGAYSLMNNVPSSLPLSTPTAIGIVLVHAHLANSL-KNSVSDVYITSDGGYNWIKALDGPHDYVIADHGGLLVAMGSNKKF--IKFSTDEGRCWHEHQYTTEDIRVTGLLTEPGNKAMTVAIWGYSNN--DTQWIIHVVDLSQLLSRECDDSDYEKWYAHSEMMHPNGENYAGCLLGKKEEFLRLKKDSLC--KNGYSHKVTKTEKICPCTKDDFECEYGYFRTVNSKNCIKNELIKEN---LCVK--GIVEKIITQGYKKIPSDVCEGGFSPD 2064
            N  D +  F   +DTV   +L+         I+ DGG+T K+ + N     E+ F+P+  S         N++ + D G ++    L +  Q     D     QD F+  G                           ++L+ +I  +  G      SN++  +  +KK +   +S            KII +NI  +     ++ ++     N  R  V+ID G  F +   P    ++  + F+IL  E+ S+++H+  N ++  D G L  S+S+G  F  +L +    +     DF KV+ + G  I + ++          D  +++ ITFN G++W  +K P  ++      C +    +C + + G Y+   ++  +   S+ +A+G++    ++ + L        ++T+DGG  W +   GPH +   DHGG+LV +  N +   I +STD G+ W ++++  + + V  ++T P + A+   ++G + N     +  + +D   +  R+C+     K  A  +   P G    GCL G + EFLR K D  C   N    + ++  K C CT+ DFEC+Y +++  +    +   L   N   +C K   ++E   + GY+KIP   C+GG   D
Sbjct:  277 NKFDFEIKFYQYFDTVADESLVMLNSIGDAYISHDGGQTIKRFDTNGEKIVEVVFNPYFNSSAYLFGSKGNIFSTHDRGHSFMIAKLPEARQLGMPLDFSAKAQDTFIYYGGKNCESILSPECHAVAYLTKDGGETFTEMLDNAIHCEFAGTLFEYPSNEEMVMCQVKKKSSETRSLVSSIDFFQGDNKIIFENIIGYLSTGGYIIVAVPHEDNELRAYVTID-GTEFAEAKFPYGQDVSKQEAFTILGSEKGSIFLHLATNLESGHDFGNLLKSNSNGTSFV-TLEHAVNRNTFGYVDFEKVQGLEGIIITNIVSNREKVGENKEDEQLKTKITFNDGSDWNFLKPPKKDSEGKKFPCDSVSLDKCSLHLHG-YTERKDIRDTY--SSGSALGMMFGVGNVGDKLLPYEECSTFLTTDGGETWTEVKKGPHQWEYGDHGGVLVLVPENAETDSISYSTDFGKTWKDYKFCGDKVLVKDIITVPRDSALRFLLFGEAKNMGSGSFRTYTIDFRNIFERQCEFDITGKKRADFK-YSPLGSR-TGCLFGHQTEFLR-KTDEKCFIGNIPLSEFSRNVKNCSCTRQDFECDYNFYKASDGTCKLVKGLSSANGADICKKEPDLIEYYDSSGYRKIPLSTCKGGLKLD 913          

HSP 2 Score: 58.9214 bits (141), Expect = 3.198e-9
Identity = 57/239 (23.85%), Postives = 102/239 (42.68%), Query Frame = 1
Query: 1402 VYITSDGGYNWIKALDGPHDYVIADHGGLLVAM-------GSNKKFIKFSTDEGRCWHEHQYTTEDIRVTGL-LTEP-----GNKAMTVAIWGYSNNDTQWII------HVVDLSQLL-SRECDDSDYEKWYAHSEMMHPNGENYAGCLLGKKEEFLRLKKDSLCKNGYSHK-VTKTEKIC-PCTKDDFECEYGYFRTVNSKNCIK--NELIKENLCVKGIVEKIITQGYKKIPSDVCE 2046
             +I+ DGG  W    +    Y   D G ++V +       G  +    +S D+GR W+E++ T     V    L  P     G+K +    +  ++++T  I       +++D S    SR C++ D+E W                C+ G K ++ R K+D+ C    + K ++  E  C  C + D+EC + + R  N   CI   N +   N+C K   + ++ +  + I  D C+
Sbjct:   20 TFISRDGGLTWRFVHNSSGLYATGDLGNIIVYIPYDPEEDGDFQSEFYYSLDQGRTWNEYELTNAISSVHPYKLINPTPDGSGSKFIFKGTFATTDSETNSITSLKGVEYIIDFSAAFDSRTCEEEDFEDWDLAD----------GKCVNGAKYKYRRRKQDAQCLVKKAFKDLSLDETPCNSCGESDYECSFEFVRDANGL-CIPDYNLIAFSNICDKSKDKSVLVEPLQLIKGDECK 247          
BLAST of Sortilin vs. Ensembl Yeast
Match: PEP1 (Type I transmembrane sorting receptor for multiple vacuolar hydrolases; cycles between the late-Golgi and prevacuolar endosome-like compartments [Source:SGD;Acc:S000000113])

HSP 1 Score: 152.91 bits (385), Expect = 3.004e-38
Identity = 162/674 (24.04%), Postives = 290/674 (43.03%), Query Frame = 1
Query:  313 KSFKRITESLPIKKVIVRKENGLQRNILDHQNIFLVCYDTVERSALL---------ITKDGGETWKKVELNFILDREIKFHPFEKSWMITVNKARNLYKSIDGGLTWEFL-LSDVLQYQWTTDKNY-PQDIFVKTG---------------------------KILETSIFEKIFG---------------ISNQKAPVMNLKKSTDAGKSWK-IIKKNIFAFFLRDKFLYISELITGNRRRLMVSIDNGNTFNKVYLP---TIANNQFFSILHIEEDSVYIHVDN--ADTRGDGILFTSDSDGQVFSQSLMNHFYPSAELTSDFYKVESMRGTYIA---------SQLNPDRSIQSLITFNRGAEWKRIKKPVNET------CHNKDKTECFVQVTGAYSLMNNVPSSLPLSTPTAIGIVLVHAHLA-NSLKNSVSDVYITSDGGYNWIKALDGPHDYVIADHGGLLVAMGSNKKF--IKFSTDEGRCWHEHQYTTEDIRVTGLLTEPGNKAMTVAIWGYSNN--DTQWIIHVVDLSQLLSRECDDSDYEKWYAHSEMMHPNGENYAGCLLGKKEEFLRLKKDSLC--KNGYSHKVTKTEKICPCTKDDFECEYGYFRTVNSKNCIKNELIK-------ENLCVK--GIVEKIITQGYKKIPSDVCEGGFSPD 2064
            KS     E +P KK    KE  +  N  D +  F   +DTV   +LL         I+ DGG+T K+ + N     E+ F+P+  S         +++ + D G ++    L +  Q     D N   QD F+  G                           ++L+ +I  +  G               +  + +   +L  STD  +  K  + +NI  +     ++ ++     N  R  V+ID G  F +   P    +   + F+IL  E+ S+++H+       R  G L  S+S+G  F  +L +    +     DF K++ + G  +          ++   D+ +++ ITFN G++W  +K P  ++      C +K   EC + + G Y+   ++  +   S+ +A+G++    ++  N L       + T+DGG  W +    PH +   DHGG+LV +  N +   I +STD G+ W ++++  + + V  + T P + A+   ++G + +   + +  + +D   +  R+C D D     +      P G   + CL G + EFLR K D  C   N    + ++  K C CT+ DFEC+Y +++  N   C   +L+K        ++C K   ++E   + GY+KIP   CEGG   D
Sbjct:  710 KSVDISCEGVP-KKGTNDKEIVVTENKFDFKIQFYQYFDTVTDESLLMINSRGEAYISHDGGQTIKRFDSNGETIIEVVFNPYYNSSAYLFGSKGSIFSTHDRGYSFMTAKLPEARQLGMPLDFNAKAQDTFIYYGGKNCESILSPECHAVAYLTNDGGETFTEMLDNAIHCEFAGSLFKYPSNEDMVMCQVKEKSSQTRSLVSSTDFFQDDKNTVFENIIGYLSTGGYIIVAVPHENNELRAYVTID-GTEFAEAKFPYDEDVGKQEAFTILESEKGSIFLHLATNLVPGRDFGNLLKSNSNGTSFV-TLEHAVNRNTFGYVDFEKIQGLEGIILTNIVSNSDKVAENKEDKQLKTKITFNEGSDWNFLKPPKRDSEGKKFSCSSKSLDECSLHLHG-YTERKDIRDTY--SSGSALGMMFGVGNVGPNLLPYKECSTFFTTDGGETWAEVKKTPHQWEYGDHGGILVLVPENSETDSISYSTDFGKTWKDYKFCADKVLVKDITTVPRDSALRFLLFGEAADIGGSSFRTYTIDFRNIFERQC-DFDITGKESADYKYSPLGSK-SNCLFGHQTEFLR-KTDENCFIGNIPLSEFSRNIKNCSCTRQDFECDYNFYK-ANDGTC---KLVKGLSPANAADVCKKEPDLIEYFESSGYRKIPLSTCEGGLKLD 1370          

HSP 2 Score: 69.707 bits (169), Expect = 1.465e-12
Identity = 149/626 (23.80%), Postives = 250/626 (39.94%), Query Frame = 1
Query:  442 SALLITKDGGETWKKVEL----NFILDRE--IKFHPFEKSWMIT---------------------------VNKAR---NLYKSIDGGLTWEFLLSDVLQYQWTTDKNYPQDI----FVKTGKI--LETS------IFEKIFGISNQ-KAPVMN--LKKSTDAGKSWKIIKKNIFAFFLRDKFL--------YISELITGNRRRLMVSID-----NGNTFNKVYLPTIANNQFFSILHIEEDSV-YIHVDNADTRGD-----GI---LFTSDSDGQVFSQSLMNHFYPSAELTS--DFYKVESMRGTYIASQLNPDRSIQ-------------SLITFNRGAEWKRIK--KPVNETCHNKDKTE---CFVQVTGAYSLMNNVPSSLPLSTPTAIGIVLVHAHLANSLKNSVSD-----VYITSDGGYNWIKALDGPHDYVIADHGGLLVAMGSN-------KKFIKFSTDEGRCWHEHQYTTEDIRVTGLLTEPGNKAMTVAIWGYS---NNDTQWIIHVVDLSQLLS-RECDDSDYEKWYAHSEMMHPNGENYAGCLLGKKEEFLRLKKDSLC-KNGYSHKVTKTEKIC-PCTKDDFECEYGYFRTVNSKNCIK--NELIKENLC 1980
            S L IT D G++W+++ L      I  RE  I+ HP  K++ +                             N  R    ++ S DGG ++  + S + +     ++N P  I    F KT K   LE+S      +F+ +  I ++  +P     L  +TD GKS K   +       +DK +        ++  L  G+R   M S+D     + + F   Y+PT   +       I ED++  I +  +  R D     GI   +  SDS G  FS       + + E+    +FY+   ++GT IAS     R                + I+ + G  W  +K   P N    + D T+   C +Q         N+  +   STPTA GI++    + +    SV D      +I+ DGG  W  A D P  Y + D+G ++VA+  N       +    +S D+G+ W E+Q  T       + T P        + G++    + T   I+ +D S   + + C+++D+E W                C+ G K +  R K+D+ C        +   E  C  CT+ D+EC + + R    K C+   N ++  ++C
Sbjct:   98 SYLYITNDQGKSWERITLPDSGESISPRECYIETHPLNKNYFLAKCNYCEKTEVNNDNEENSGDEEGQFEIFNITRCTDKVFASNDGGKSFSEIKSSLER-----NENSPISISDCGFAKTSKDSDLESSDTSIICLFQNMQLIMDEFSSPYTESKLVLTTDWGKSLKEFDQ------FKDKVVNGYRILKSHMVVLTQGDRYNDMSSMDVWVSNDLSNFKMAYMPTQLRHSMQG--EIYEDAMGRIILPMSRERSDQEEDKGIVSEILISDSQGLKFSPIP----WTANEVFGYINFYQPTYLKGTMIASLYPLSRRRNRKGKAKGVKSKGVTKISVDNGLTWTMLKVVDPDNADSFDCDITDFENCSLQ---------NMFYTREGSTPTA-GILMTTGIVGDG---SVFDWGDQRTFISRDGGLTWKLAFDFPCLYAVGDYGNVIVAIPYNADEDDDPQSEFYYSLDQGKTWTEYQLETTIYPNEVMNTTPDGSGAKFILNGFTLAHMDGTTNFIYAIDFSTAFNDKTCEENDFEDWNLAE----------GKCVNGVKYKIRRRKQDAQCLVKKVFEDLQLFETACDKCTEADYECAFEFVRDATGK-CVPDYNLIVLSDVC 682          
BLAST of Sortilin vs. Ensembl Yeast
Match: VTH2 (Putative membrane glycoprotein; has strong similarity to Vth1p and Pep1p/Vps10p; may be involved in vacuolar protein sorting [Source:SGD;Acc:S000003758])

HSP 1 Score: 149.058 bits (375), Expect = 5.149e-37
Identity = 157/652 (24.08%), Postives = 279/652 (42.79%), Query Frame = 1
Query:  367 KENGLQRNILDHQNIFLVCYDTVERSALL---------ITKDGGETWKKVELNFILDREIKFHPFEKSWMITVNKARNLYKSIDGGLTWEFL-LSDVLQYQWTTD-KNYPQDIFVKTG---------------------------KILETSIFEKIFGI-----SNQKAPVMNLKKSTDAGKSW-----------KIIKKNIFAFFLRDKFLYISELITGNRRRLMVSIDNGNTFNKVYLP---TIANNQFFSILHIEEDSVYIHV-DNADTRGD-GILFTSDSDGQVFSQSLMNHFYPSAELTSDFYKVESMRGTYIASQLN---------PDRSIQSLITFNRGAEWKRIKKPVNET------CHNKDKTECFVQVTGAYSLMNNVPSSLPLSTPTAIGIVLVHAHLANSL-KNSVSDVYITSDGGYNWIKALDGPHDYVIADHGGLLVAMGSNKKF--IKFSTDEGRCWHEHQYTTEDIRVTGLLTEPGNKAMTVAIWGYSNN--DTQWIIHVVDLSQLLSRECDDSDYEKWYAHSEMMHPNGENYAGCLLGKKEEFLRLKKDSLC--KNGYSHKVTKTEKICPCTKDDFECEYGYFRTVNSKNCIKNELIKEN---LCVK--GIVEKIITQGYKKIPSDVCEGGFSPD 2064
            KE     N  D +  F   +DTV   +L+         I+ DGG+T K+ + +     EI F+P+  S         N++ + D G ++    L +  Q     D     QD F+  G                           ++L+ +I  +  G      SN    +  +K+     +S            K + +NI  +     ++ ++     N  R  V+ D G  F +   P    I     F+IL  EE S+++H+  N ++  D G L  S+S+G  F  +L +    +     DF KV+ + G  I + ++          D  +++ ITFN G++W  +K P  ++      C +    +C + + G Y+   ++  +   S+ +A+G++    ++ + L        ++T+DGG  W +   GPH +   DHGG+LV +  N +   I +STD G+ W ++++  + + V  ++T P + A+   ++G + N     +  + +D   +  R+C + D            P G    GCL G K EFLR K D  C   N    + ++  K CPCT+ DFEC+Y +++  +    +   L   N   +C K   ++E   + GY+KIP   C+GG   D
Sbjct:  703 KEIVTTENKFDFEIKFYQYFDTVADESLVMLNSIGDAYISHDGGQTIKRFDTDGEKIVEIVFNPYFNSSAYLFGSKGNIFLTHDRGYSFMIAKLPEARQLGMPLDFSAKAQDTFIYYGGKNCESILSPECHAVAYLTKDGGETFTEMLDNAIHCEFAGTLFKYPSNDDMVMCQVKEKFSQTRSLVSSTDFFQDDRKTVFENIIGYLSTGGYIIVAVPHEDNELRAYVTND-GAEFTEAKFPYDEDIGKQDAFTILGSEEGSIFLHLATNLESGHDFGNLLKSNSNGTSFV-TLEHAVNRNTFGYVDFEKVQGLEGIIITNIVSNSEKVGENKEDEQLKTKITFNDGSDWNFLKPPKKDSEGKKFPCDSVSLDKCSLHLHG-YTERKDIRDTY--SSGSALGMMFGVGNVGDRLLPYEECSTFLTTDGGETWTEVKKGPHQWEYGDHGGVLVLVPENAETDSISYSTDFGKTWKDYKFCGDKVLVKDIITVPRDSALRFLLFGEAKNMGSGSFRTYTIDFRNIFERQC-EFDITGRKRADFKYSPLGSR-TGCLFGHKTEFLR-KTDEKCFIGNIPLSEFSRNVKNCPCTRQDFECDYNFYKASDGTCKLVKGLSSANGADICKKEPDLIEYYDSSGYRKIPLSTCKGGLKLD 1346          

HSP 2 Score: 50.8322 bits (120), Expect = 9.157e-7
Identity = 62/312 (19.87%), Postives = 124/312 (39.74%), Query Frame = 1
Query: 1174 QSLITFNRGAEWKRIKKPVNET-----CHNKDKTECFVQVTGAYSLMNNVPSSLPLSTPTAIGIVLVHAHLANSLKNSVSD--VYITSDGGYNWIKALDGPHDYVIADHGGLLVAM-------GSNKKFIKFSTDEGRCWHEHQYTTE--DIRVTGLLTEPGNKAMTVAIWGYSNNDTQWIIHVVDLSQLLS-RECDDSDYEKWYAHSEMMHPNGENYAGCLLGKKEEFLRLKKDSLCKNGYSHK-VTKTEKIC-PCTKDDFECEYGYFRTVNSKNCIK--NELIKENLCVKGIVEKIITQGYKKIPSDVCE 2046
            ++ ++ + G  W  +K    E      C       C +Q T  Y L N  PS+         GI+++   + +    +  +   +I+ D G  W    +    Y   D G +++ +       G       +S D+G+ W E+         R+   +++ G+ +  +        D  +I + +D S +   + C++ D+E W                C+ G K ++ R K+D+ C    + K ++  E  C  CT  D+EC + + R     +CI   N +   ++C K   + ++ +  + I  D C+
Sbjct:  391 ETKVSVDNGLTWTNLKVVDRENVDLFGCDVTKPERCSLQ-THFYDLRNLNPSA---------GIMMISGIVGDGSAYNWKEEKTFISRDSGLTWRLVHNSTGLYTTGDLGNIIMYIPYRSNENGDVPSKFYYSLDQGKTWGEYDLIMPIYPYRLVSTISD-GSGSKFILTGTSITEDPIFITYSIDFSAVFDYKSCEEGDFEDWNLAD----------GKCVNGAKYKYRRRKQDAQCLVKKAFKDLSLDETPCNSCTGSDYECSFEFVRDAKG-DCIPDYNLIALSDICDKSKGKSVLVKPLQLIKGDKCK 680          
BLAST of Sortilin vs. Ensembl Yeast
Match: VTH1 (Putative membrane glycoprotein; has strong similarity to Vth2p and Pep1p/Vps10p; may be involved in vacuolar protein sorting [Source:SGD;Acc:S000001435])

HSP 1 Score: 149.058 bits (375), Expect = 5.194e-37
Identity = 157/652 (24.08%), Postives = 279/652 (42.79%), Query Frame = 1
Query:  367 KENGLQRNILDHQNIFLVCYDTVERSALL---------ITKDGGETWKKVELNFILDREIKFHPFEKSWMITVNKARNLYKSIDGGLTWEFL-LSDVLQYQWTTD-KNYPQDIFVKTG---------------------------KILETSIFEKIFGI-----SNQKAPVMNLKKSTDAGKSW-----------KIIKKNIFAFFLRDKFLYISELITGNRRRLMVSIDNGNTFNKVYLP---TIANNQFFSILHIEEDSVYIHV-DNADTRGD-GILFTSDSDGQVFSQSLMNHFYPSAELTSDFYKVESMRGTYIASQLN---------PDRSIQSLITFNRGAEWKRIKKPVNET------CHNKDKTECFVQVTGAYSLMNNVPSSLPLSTPTAIGIVLVHAHLANSL-KNSVSDVYITSDGGYNWIKALDGPHDYVIADHGGLLVAMGSNKKF--IKFSTDEGRCWHEHQYTTEDIRVTGLLTEPGNKAMTVAIWGYSNN--DTQWIIHVVDLSQLLSRECDDSDYEKWYAHSEMMHPNGENYAGCLLGKKEEFLRLKKDSLC--KNGYSHKVTKTEKICPCTKDDFECEYGYFRTVNSKNCIKNELIKEN---LCVK--GIVEKIITQGYKKIPSDVCEGGFSPD 2064
            KE     N  D +  F   +DTV   +L+         I+ DGG+T K+ + +     EI F+P+  S         N++ + D G ++    L +  Q     D     QD F+  G                           ++L+ +I  +  G      SN    +  +K+     +S            K + +NI  +     ++ ++     N  R  V+ D G  F +   P    I     F+IL  EE S+++H+  N ++  D G L  S+S+G  F  +L +    +     DF KV+ + G  I + ++          D  +++ ITFN G++W  +K P  ++      C +    +C + + G Y+   ++  +   S+ +A+G++    ++ + L        ++T+DGG  W +   GPH +   DHGG+LV +  N +   I +STD G+ W ++++  + + V  ++T P + A+   ++G + N     +  + +D   +  R+C + D            P G    GCL G K EFLR K D  C   N    + ++  K CPCT+ DFEC+Y +++  +    +   L   N   +C K   ++E   + GY+KIP   C+GG   D
Sbjct:  703 KEIVTTENKFDFEIKFYQYFDTVADESLVMLNSIGDAYISHDGGQTIKRFDTDGEKIVEIVFNPYFNSSAYLFGSKGNIFLTHDRGYSFMIAKLPEARQLGMPLDFSAKAQDTFIYYGGKNCESILSPECHAVAYLTKDGGETFTEMLDNAIHCEFAGTLFKYPSNDDMVMCQVKEKFSQTRSLVSSTDFFQDDRKTVFENIIGYLSTGGYIIVAVPHEDNELRAYVTND-GAEFTEAKFPYDEDIGKQDAFTILGSEEGSIFLHLATNLESGHDFGNLLKSNSNGTSFV-TLEHAVNRNTFGYVDFEKVQGLEGIIITNIVSNSEKVGENKEDEQLKTKITFNDGSDWNFLKPPKKDSEGKKFPCDSVSLDKCSLHLHG-YTERKDIRDTY--SSGSALGMMFGVGNVGDRLLPYEECSTFLTTDGGETWTEVKKGPHQWEYGDHGGVLVLVPENAETDSISYSTDFGKTWKDYKFCGDKVLVKDIITVPRDSALRFLLFGEAKNMGSGSFRTYTIDFRNIFERQC-EFDITGRKRADFKYSPLGSR-TGCLFGHKTEFLR-KTDEKCFIGNIPLSEFSRNVKNCPCTRQDFECDYNFYKASDGTCKLVKGLSSANGADICKKEPDLIEYYDSSGYRKIPLSTCKGGLKLD 1346          

HSP 2 Score: 50.8322 bits (120), Expect = 9.716e-7
Identity = 62/312 (19.87%), Postives = 124/312 (39.74%), Query Frame = 1
Query: 1174 QSLITFNRGAEWKRIKKPVNET-----CHNKDKTECFVQVTGAYSLMNNVPSSLPLSTPTAIGIVLVHAHLANSLKNSVSD--VYITSDGGYNWIKALDGPHDYVIADHGGLLVAM-------GSNKKFIKFSTDEGRCWHEHQYTTE--DIRVTGLLTEPGNKAMTVAIWGYSNNDTQWIIHVVDLSQLLS-RECDDSDYEKWYAHSEMMHPNGENYAGCLLGKKEEFLRLKKDSLCKNGYSHK-VTKTEKIC-PCTKDDFECEYGYFRTVNSKNCIK--NELIKENLCVKGIVEKIITQGYKKIPSDVCE 2046
            ++ ++ + G  W  +K    E      C       C +Q T  Y L N  PS+         GI+++   + +    +  +   +I+ D G  W    +    Y   D G +++ +       G       +S D+G+ W E+         R+   +++ G+ +  +        D  +I + +D S +   + C++ D+E W                C+ G K ++ R K+D+ C    + K ++  E  C  CT  D+EC + + R     +CI   N +   ++C K   + ++ +  + I  D C+
Sbjct:  391 ETKVSVDNGLTWTNLKVVDRENVDLFGCDVTKPERCSLQ-THFYDLRNLNPSA---------GIMMISGIVGDGSAYNWKEEKTFISRDSGLTWRLVHNSTGLYTTGDLGNIIMYIPYRSNENGDVPSKFYYSLDQGKTWGEYDLIMPIYPYRLVSTISD-GSGSKFILTGTSITEDPIFITYSIDFSAVFDYKSCEEGDFEDWNLAD----------GKCVNGAKYKYRRRKQDAQCLVKKAFKDLSLDETPCNSCTGSDYECSFEFVRDAKG-DCIPDYNLIALSDICDKSKGKSVLVKPLQLIKGDKCK 680          
BLAST of Sortilin vs. Ensembl Yeast
Match: YCR100C_mRNA (Putative protein of unknown function [Source:SGD;Acc:S000000697])

HSP 1 Score: 49.2914 bits (116), Expect = 1.431e-6
Identity = 70/255 (27.45%), Postives = 113/255 (44.31%), Query Frame = 1
Query:  892 DNGNTFNKVYLPTIANNQFFSILHIEEDSV----------YIHVDNADTRGDGILFTSDSDGQVFS--QSLMNHFYPSAELT-SDFYKVESMRGTYIAS------QLNPDRSI---QSLITFNRGAEWKRIKKPVNETCHNKDKTECFVQVTGAYSLMNNVPSSLPLSTPTAIGIVLVHAHLA--NSLKNSVSDVYITSDGGYNWIKALDGPHDYVIADHGGLLVAM-------GSNKKFIKFSTDEGRCWHEHQ 1563
            ++ +TF K  LPT    +   ++ I EDS+            + +NAD     I F SDS G  FS  +   NH + +  LT  DF K  ++ G++  S      Q+N   +I   ++ I+ + G  W  +K  V+E   N D   C +      SL      +L LS P+A GI+L+   +   N         +I+ DGG  W  A +    Y   D G ++V +       G  +  + FS D+GR W++++
Sbjct:   10 NDASTFQKAQLPTQL--RHVKVIKIREDSIGRIILLISTEITNEENADPDLSEI-FISDSQGLKFSPVEWTPNHQFGNFRLTFPDFLK-GTIFGSFHPSIDYSNHQVNYTENIAGGETKISVDNGLTWSNLKV-VDE--ENADSFGCDITRPERCSLQGYF-YNLKLSNPSA-GIILMTGSVGDDNEFDRKDRKTFISRDGGLTWRVAHNSSGLYATGDLGNIIVYIPSPSYKDGDVQSKLYFSLDQGRTWNQYE 255          
BLAST of Sortilin vs. Ensembl Nematostella
Match: EDO39068 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SB80])

HSP 1 Score: 412.535 bits (1059), Expect = 1.165e-127
Identity = 246/697 (35.29%), Postives = 370/697 (53.08%), Query Frame = 1
Query:  160 KFVFTNDTKTSVQVTWAGDNSGKIILVTTKEIQIILTYADLSDIYFSDNNGKSFKRITESLPIKKVIVRKENGLQRNILDHQNIFLVCYDTV---ERSALLITKDGGETWKKVELNFILDREIKFHPFEKSWMITVNK--ARNLYKSIDGGLTWEFLLSDVLQYQWTTDKNYPQDIFVKTGKILETSIFEKIFGISNQKAPVMNLKKSTDAGKSWKIIKKNIFAFFLRDKFLYIS-ELITGNRRRLM-VSIDNGNTFNKVYLPTIANNQFFSILHIEEDSVYIHVDNADTRGDGILFTSDSDGQVFSQSLMNHFYPSAELTSDFYKVESMRGTYIASQLNPDRSIQSLITFNRGAEWKRIKKPVNETCHN----------------------------------KDKTECFVQVTGAYSLMNNVPSSL--PLSTPTAIGIVLVHAHLANSLKNSVSDVYITSDGGYNWIKALDGPHDYVIADHGGLLVAM---GSNKKFIKFSTDEGRCWHEHQYTTEDIRVTGLLTEPGNKAMTVAIWGYSNNDTQWIIHVVDLSQLLSRECDDSDYEKWYAHSEMMHPNGENYAGCLLGKKEEFLRLKKDSLCKNGYSHKVTKTEKICPCTKDDFECEYGYFRTVNSKNCIKNELIKENLCVKGIVEKIITQGYKKIPSDVCEGGFSPDKTKQKWLNQTCVEDEF 2112
            +F+FTN+++ S+ ++W G +   I+L+ T E+ I  T    S +Y S + GK+FK+I     I    +R+  G+Q++ +D   + LV Y      + S L +T DG  +WK  +  F +   I+FHP   +W++  +   ++  + S + G +W  L S V+  +W     +      K  K  E+SI   +       APV N            ++ K+ + F ++  FL++S +L   NR R+M VS D G+TF+K  +P+I   QF+SIL + E  V++HVD+    G G L+TSD+DG VF +SL NH Y + +  +DFYKVESM GTYI S +N D SI ++ITF+RG EWK I    N+ C                                    KD++ C + +   +SL   VP  +  PLS   A GI++ HA+   +L  +   ++++ +GGY+W +AL GPH Y IADHG L+VA+    S    + +S DEG CW+ +Q+T  ++  TGL+T PG + +  +IWGY+  +  W +  VD  +LL+ +C +SDYE W  H      +G+N  GCLLG+K  F R K DSLC NG           C CT  D ECEYG++R V    C K+   K  LC+ G  E I  +GY++IP DVCEGG  PDK K    ++ C    +
Sbjct:  467 EFIFTNESRLSISMSWVGSDFKTILLLATSEMLIFAT--QRSALYKSSDFGKTFKQINTD--IFNAHIRRNFGIQKSPVDPNRVILVSYSLPIFGKFSTLYVTMDGANSWKSFQAPFQISGAIEFHPRNNNWILARSNLLSQGAFLSTNFGRSWTRLRSYVMSAKWGARHEF------KVEK-EESSILLTV-------APVEN------------VLVKHCYTFGIQGPFLFVSVDLNKNNRTRIMHVSTDGGDTFDKAGVPSIFPEQFYSILDMSEGMVFLHVDSPQDTGKGALYTSDADGIVFDKSLENHVYTNFDAATDFYKVESMNGTYITSIMNADNSISTVITFDRGGEWKPIPLDQNKLCKGIKFNQMLPQEQEALGFVATLKLLSPQSSEPQVPRKDQS-CSLHIHYRFSLSRGVPGMVQGPLSESNAPGIIIAHANPGAALMAANIGIWVSRNGGYDWKQALKGPHYYSIADHGKLIVAVPATASGTSDLMYSVDEGACWYRYQFTETNLVFTGLVTAPGARTLRFSIWGYTLPNKTWRVITVDFEKLLTFKCLNSDYESWVPHG-----SGKN-EGCLLGRKVTFRRAKPDSLCYNGEDFVGMTAMDHCSCTMADLECEYGFYRKVGESECKKDPTKKPKLCIGGEQEDITDRGYRRIPGDVCEGGL-PDKAKYLDAHKRCFNSSY 1125          
BLAST of Sortilin vs. Ensembl Nematostella
Match: EDO45218 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RTH9])

HSP 1 Score: 192.586 bits (488), Expect = 2.425e-50
Identity = 178/670 (26.57%), Postives = 297/670 (44.33%), Query Frame = 1
Query:  142 NNNPISKFVFTNDTKTSVQVTWAGDNSGKIILVTTKEIQIILTYADLSDIYFSDNNGKSFKRITESLPIKKVIVRKENGLQRNILDHQNIFLVCYDTVERSALLITKDGGETWKKVELNFILDREIKFHPFEKSWMI---TVNKARNLYKSIDGGLTWEFLLSDVLQYQWTTDKNYPQD----IFVKTGKILE-TSIFEKIFGISNQKAPVMNLKKSTDAGKSWKIIKKNIFAFFLRDKFLYISELITGNRRRLMVSIDNGNTFNKVYLPTIANNQFFSILHIEEDSVYIHVDNADTRGDGILFTSDSDGQVFSQSLMNHFYPSAELTS------------DFYKVESMRGTYIASQLNPD----RSIQSLITFNRGAEWKRIKKPVNE---TCHNKDKTECFVQVTGAYSLMNNVPSSLP-LSTPTAIGIVLVHAHLANSLKNSVSDVYITSDGGYNWIKALDGPHDYVIADHGGLLVAMGSNKKFIKFSTDEGRCWHEHQYTTED-IRVTGLLTEPGNKAMTVAIWGYSNNDTQWIIHVVDLSQLLSRECDDSDYEKWYAHSEMMHPNGENYAGCLLGKKEEFLRLKKDSLCKNGYSHKVTKTEKICPCTKDDFECEYGYFRTVNSKNCIKNELIKENL---CVKGIVEKIITQGYKKIPSDVCEGGF 2055
            +  P  K +  ND+     V WAGD+   I+++T        +    S ++ S + G+SF   T         +        + +D+     V  D V R  +  T D   T+ K EL+F  D+ I FHP     ++   T    + L+ S D G TW      V  + W      P D    ++V+  ++L   SI  K    SN    +++                 +  F + D F++ S+  +G+   L+VS+D    F    + T      F +    E+ V++ V ++       L+ SDS G  +S SL    Y S +  S            D +KV+ +RG YIASQL       R+I SLIT+++G EW  I  P N+      N     C + V+  +          P LS  +A GI+L    L ++L+    D+Y++SD GY+W ++   P +++      + +  G       +S ++G  W  +++  +D + V GLLTEPG ++ +  I+G  +   +W I  ++L ++L   C   DY+ W    +       N + CL+G+K  + R    + C NGY +    TE+ CPCT++DFEC+ G FR      C+ + + +  +   C+ G +    T+GY+K+  D CE G 
Sbjct:   86 DQTPDVKELHLNDSHLMAYVHWAGDSKDTIVVLTRDPNPGPRS---TSFVWISKDYGRSFSNYTSLFNQSSGSIASITLFYASPVDNNRYLFV--DKV-RKLMFATLDDCNTFTKTELSFTADK-ILFHPTNADVVLAYDTTASVKRLFVSQDFGFTWVLKDEQVRSFFWGIP---PLDDANTLYVERQELLGGKSIVVKTDYFSNSAVSLVS----------------GVNDFEVVDNFMFASKTTSGSGLSLLVSVDR-QPFKTAKISTRLPILDFLVADASENQVFLAVSHSSQTTH--LYISDSTGLSYSMSLERVLYFSVKTGSTWLRHYIDHSFVDLHKVDGIRGVYIASQLTAGSVGHRNIMSLITYDKGGEWSAIAAPKNDYRGKPLNCTLPSCSLHVSQEFGKYYPYTKYSPMLSKTSAPGIILAMGTLGSNLRVQ-GDLYLSSDAGYSWHQS---PLNWLT-----VFLCAG-----YSYSWNDGETWLTYEFLQDDRMVVYGLLTEPGEQSASFTIFGSHSGHHRWTIVQINLRRVLGSPCVPQDYKTWIPSDQ------RNGSWCLMGRKTIYERRIAHAHCFNGYDYDRPITEQNCPCTREDFECDVG-FRLSFGSRCVPDGIPQTTIPSTCLPGTLYS-KTKGYRKVSGDTCEKGL 704          
BLAST of Sortilin vs. Ensembl Nematostella
Match: EDO35926 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SK47])

HSP 1 Score: 168.318 bits (425), Expect = 9.622e-43
Identity = 166/694 (23.92%), Postives = 301/694 (43.37%), Query Frame = 1
Query:  160 KFVFTNDTKTSVQVTWAGDNSGKIILVTTKEIQIILT-----YADLSDIYFSDNNGKSFKR--ITESLPIKKVI--VRKENGLQRNILDHQNIFLVCYDTVERSALLITKDGGETWKKVELNFILDREIKFHPFEKSWMITVN-KARNLYKSIDGGLTWEFLLSDVLQYQWTTDK--NYPQDIF--VKTGKILETSIFEKIFGISNQKAPVMNLKKSTDAGKSWKIIKKNIFAFFLRDKFLYISELITGNRRRLMVSIDNGNTFNKVYLPTIANNQFFSILHIEEDSVYIHVDNADTRGDGILFTSDSDGQVFSQSLMNHF------YPSAELTSDFYKVESMRGTYIAS-QLNPDRSIQSLITFNRGAEWKRIKKPVNETCH---NKDKTECFVQVTGAYSLMNNVPSSLPLSTPTAIGIVLVHAHLANSLKNSVSDVYITSDGGYNWIKALDGPHDYVIADHGGLLVA--MGSNKKFIKFSTDEGRCWHEHQYTTEDIRVTGLLTEPGNKAMTVAIWG-YSNNDTQWIIHVVDLSQLLSRECDDSDYEKWYAHSEMMHPNGENYAGCLLGKKEEFLRLKKDSLCKNGYSHKVTKTEKICPCTKDDFECEYGYFRTVNSKNCIKNEL--IKENLCVKGIVEKIITQGYKKIPSDVCEGGFSPDKTKQKWLNQTCVEDEFKKIVVPISNTDSNT 2154
            +FV   D  +   + W+G  S  I + T    +I  T     YA  + I+ S N G+SF R  +T+  P    I  +R   G  + +L         +D   R  L ++ + G +++ V+L F    +I+ H      ++  +     LY S D G  W  L + V +Y W      N P+ +F  VK      +S+ +     S+    V     S     S         +F ++  +L++ +    +   L VS + G  F K   P       + ++   E  V + V +  T     L+ S ++G  +S SL          +   +  +D + V+S+RG Y+A+      R  +++ITF++G  W  ++ P +        K      +Q +  Y  +  +     +S+ TA+G+++    L  S   +  +V+++ DGG  W + L G +D+V+ DHGG++ A  + +N K +++S  EG  W   +   + +   GL+TEPG+  +   I+G + N   +W+   ++ S + S+ C D++Y +W    E +  N      C LG+   + R K    C NG  +  +     C CT +D+ C+ G+ R  +   C   +L  +  + C +     + + GY+K+P D C GG      K  W     +  E  +I++  +   S T
Sbjct:   88 EFVLHGDNHSVAFLHWSGARSEVIFIFTADYREINRTNVGSIYAKSAYIWRSTNYGESFDRDDVTK-FPKGSSISGIRFCKGNNKKVL--------VFDKAARQ-LYVSTNEGSSYESVKLLF-RPADIRCHSIYDDMLLGYDDTTEKLYYSKDSGTHWTLLSAFVAKYYWVLPHLGNNPKIVFIEVKNNGRYHSSVLKFADLSSDSPDGVQVFDNSLGFFGS--------LSFEMQGNYLFVKKHYPSSA--LFVSYNLGK-FQKAVFPLKLPETDYYVVDASEGEVLVSVKHLMTYN---LYVSGTNGTKYSLSLQRLLATRTIQWNKIQTLADIHMVKSLRGVYLANIHFGHKRYFRTMITFDKGGTWYPLRVPQDSQSSCVLPKCSLNLHMQHSQHYYQIPGI-----VSSKTAVGLIIAQGELGTSFTLN-PNVFMSRDGGLTWKRVLYGSYDFVLLDHGGIIAAVPLRNNTKTVQYSCSEGNTWASLE-LAQGLLAYGLVTEPGSTTLVSNIFGQHLNKRFEWLSVKLNFSSVFSQPCTDANYTQWSPVDERVSGN------CSLGEMIVYTRRKASDCCFNGRDYNGSIIRGTCNCTDEDYMCDVGFKRDRDDNECYPEDLAVLVPDPCPE-TTYYMKSSGYRKVPGDRCSGGQLEQDFKPVWTRCPTLAPEGLQIIMERTTVASLT 742          
BLAST of Sortilin vs. Ensembl Nematostella
Match: EDO41879 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S315])

HSP 1 Score: 55.4546 bits (132), Expect = 9.824e-8
Identity = 54/211 (25.59%), Postives = 88/211 (41.71%), Query Frame = 1
Query: 1525 FSTDEGRCWHEHQYTTED--IRVTGLLTEPGNKAMTVAIWGYS--NNDTQWIIHVVDLSQLLSRECDDSDYEKWYAHSEMMHPNGENYAG---CLLGKKEEFLRLKKDSLCKNGYSHKVTKTEKICPCTKDDFECEYGYFRTVNSKNCIKNELIKENLCVKGIVEKIITQGYKKIPSDVCEGGFSPDKTKQKW----LNQTCVEDEFKKIV 2124
            +ST+ G  W    +T+    + V  ++T+   K     ++G +  +N  QW +  ++L+ +L   C  SD + W           ++ AG   C+LG++ E+        C  G  ++  K  K C C + DFEC                         K +VE I+TQ  +K+P  +  G    D  KQ W    +N T V D  +KIV
Sbjct:  428 YSTNGGNNWTSIPFTSPQNKVLVEDIMTQAEEKLPIFILYGSTIKDNKKQWKLFHINLTSVLGSPCQASDMQLWVP--------SDDRAGLERCILGEQVEYKIRNWTKTCLMGKDYEAGKVVKSCTCRRVDFECPQN----------------------KVLVEDIMTQAEEKLPIFILYGSTIKDNKKQ-WKLFHINLTSVLDP-EKIV 606          
BLAST of Sortilin vs. Ensembl Medaka
Match: sort1b (sortilin [Source:NCBI gene;Acc:101158853])

HSP 1 Score: 432.565 bits (1111), Expect = 2.066e-138
Identity = 245/674 (36.35%), Postives = 384/674 (56.97%), Query Frame = 1
Query:  136 FKNNNPISKFVFTNDTKTSVQVTWAGDNSGKIILVTTKEIQIILTYADLSDIYFSDNNGKSFKRITESLPIKKVIVRKENGLQRNILDHQNIFL---VCYDTVERSALLITKDGGETWKKVELNFILDREIKFHPFEKSWMITVNKARNLYKSIDGGLTWEFLLSDVLQYQWTTDKNYPQDIFVKTGKILETSIFEKIFGISNQKAPVMNLKKSTDAGKSWKIIKKNIFAFFLRDKFLYISELITGNRRRLM-VSIDNGNTFNKVYLPTIANNQFFSILHIEEDSVYIHVDNADTRGDGILFTSDSDGQVFSQSLMNHFYPSAELTSDFYKVESMRGTYIASQLNPDRSIQSLITFNRGAEWKRIKKPVNETCH--NKDKTECFVQVTGAYSLMN--NVPSSLPLSTPTAIGIVLVHAHLANSLKNSVSDVYITSDGGYNWIKALDGPHDYVIADHGGLLVAMGSNK----KFIKFSTDEGRCWHEHQYTTEDIRVTGLLTEPGNKAMTVAIWGYSNN--DTQWIIHVVDLSQLLSRECDDSDYEKWYAHSEMMHPNGENYAGCLLGKKEEFLRLKKDSLCKNGYSHKVTKTEKICPCTKDDFECEYGYFRTVNSKNCIKNELIKE---NLCVKGIVEKIITQGYKKIPSDVCEGGFSPDKTKQKWLNQTCVED 2106
              NN  +  F   +D   SV + W GD +G I+ +TT ++   L     S +Y SDN GKSF+ +T    I    +  + G+     +   + L   V  D  ++  + ++ D G+T+   +LNF+   ++ ++P + + +   +  + L+ + D G +W  +   V   +W  +KN    I+  T K             S     ++ LKK+TD GK+ K I   +++F    +FL++S + + +R R++ VS+D G T+N   LP +A++QF+SIL   ++ V+IHVD       G ++ SD  G V+S+SL +H Y +    +DF  V S+RG +I S +  D SIQS+++F++G EW  ++ P N  C    KD  +C   +  AYS+    +VP  LPLS P A+G++L H  + +S      DV+++ DGGY+WIKALDGPH Y I D GGLLVA+  +     K IKFSTDEG+CWH + +TTE I  TGL +EPG ++M V++WGY ++     W+   +D   LL+R+CDD+DY +W AHS+ +    +   GC+LG KE+FLRL+KDS+C NG  ++V      C CT DDF C++GY+R  NS  C++   ++     LC+ G  E+++T GY+KIP D C GG +P K ++  L++ CV D
Sbjct:   84 LANNTHLHLF---DDLSGSVSLAWVGDGTGVILALTTYQMPFFLFKFGQSKLYRSDNYGKSFQDVTNL--INHTFITTDFGIAIGPENSGKVILTGEVSGD--DKPRIFVSDDSGKTFTHHDLNFMPLTQMSYNPEDSNVLFVFSSKKELWLTEDFGQSWRKIHDMVCLVKWG-NKN---TIYFTTSK-----------NASCSDRGMLELKKTTDYGKTIKTIASKVYSFGRGGRFLFVSIMTSQDRLRVLHVSVDQGETWNIAQLPAVAHDQFYSILAANDEIVFIHVDEPGDSLFGTVYVSDDRGTVYSKSLEHHLYTTPGGDTDFTNVTSLRGVFITSVMAEDNSIQSVVSFDQGGEWVPLRTPSNVNCKVTAKDPDKCEFHIHAAYSMAMKLDVP-MLPLSEPNAVGLILAHGSIGDSSSVIRPDVFVSDDGGYSWIKALDGPHHYAILDSGGLLVAVEHSPSDTIKQIKFSTDEGQCWHVYNFTTEPIFFTGLASEPGARSMNVSLWGYRDSYISQNWVSFTIDFRDLLTRDCDDNDYVQWLAHSDDI---SDPTDGCMLGYKEKFLRLRKDSVCWNGRDYQVASQPTPCACTLDDFLCDFGYYREENSSKCVEEPDLQHKVLELCLHGKEEQLVTSGYRKIPGDKCVGGQTP-KREEIDLSKRCVSD 730          
BLAST of Sortilin vs. Ensembl Medaka
Match: sort1b (sortilin [Source:NCBI gene;Acc:101158853])

HSP 1 Score: 432.565 bits (1111), Expect = 2.463e-138
Identity = 245/674 (36.35%), Postives = 384/674 (56.97%), Query Frame = 1
Query:  136 FKNNNPISKFVFTNDTKTSVQVTWAGDNSGKIILVTTKEIQIILTYADLSDIYFSDNNGKSFKRITESLPIKKVIVRKENGLQRNILDHQNIFL---VCYDTVERSALLITKDGGETWKKVELNFILDREIKFHPFEKSWMITVNKARNLYKSIDGGLTWEFLLSDVLQYQWTTDKNYPQDIFVKTGKILETSIFEKIFGISNQKAPVMNLKKSTDAGKSWKIIKKNIFAFFLRDKFLYISELITGNRRRLM-VSIDNGNTFNKVYLPTIANNQFFSILHIEEDSVYIHVDNADTRGDGILFTSDSDGQVFSQSLMNHFYPSAELTSDFYKVESMRGTYIASQLNPDRSIQSLITFNRGAEWKRIKKPVNETCH--NKDKTECFVQVTGAYSLMN--NVPSSLPLSTPTAIGIVLVHAHLANSLKNSVSDVYITSDGGYNWIKALDGPHDYVIADHGGLLVAMGSNK----KFIKFSTDEGRCWHEHQYTTEDIRVTGLLTEPGNKAMTVAIWGYSNN--DTQWIIHVVDLSQLLSRECDDSDYEKWYAHSEMMHPNGENYAGCLLGKKEEFLRLKKDSLCKNGYSHKVTKTEKICPCTKDDFECEYGYFRTVNSKNCIKNELIKE---NLCVKGIVEKIITQGYKKIPSDVCEGGFSPDKTKQKWLNQTCVED 2106
              NN  +  F   +D   SV + W GD +G I+ +TT ++   L     S +Y SDN GKSF+ +T    I    +  + G+     +   + L   V  D  ++  + ++ D G+T+   +LNF+   ++ ++P + + +   +  + L+ + D G +W  +   V   +W  +KN    I+  T K             S     ++ LKK+TD GK+ K I   +++F    +FL++S + + +R R++ VS+D G T+N   LP +A++QF+SIL   ++ V+IHVD       G ++ SD  G V+S+SL +H Y +    +DF  V S+RG +I S +  D SIQS+++F++G EW  ++ P N  C    KD  +C   +  AYS+    +VP  LPLS P A+G++L H  + +S      DV+++ DGGY+WIKALDGPH Y I D GGLLVA+  +     K IKFSTDEG+CWH + +TTE I  TGL +EPG ++M V++WGY ++     W+   +D   LL+R+CDD+DY +W AHS+ +    +   GC+LG KE+FLRL+KDS+C NG  ++V      C CT DDF C++GY+R  NS  C++   ++     LC+ G  E+++T GY+KIP D C GG +P K ++  L++ CV D
Sbjct:   84 LANNTHLHLF---DDLSGSVSLAWVGDGTGVILALTTYQMPFFLFKFGQSKLYRSDNYGKSFQDVTNL--INHTFITTDFGIAIGPENSGKVILTGEVSGD--DKPRIFVSDDSGKTFTHHDLNFMPLTQMSYNPEDSNVLFVFSSKKELWLTEDFGQSWRKIHDMVCLVKWG-NKN---TIYFTTSK-----------NASCSDRGMLELKKTTDYGKTIKTIASKVYSFGRGGRFLFVSIMTSQDRLRVLHVSVDQGETWNIAQLPAVAHDQFYSILAANDEIVFIHVDEPGDSLFGTVYVSDDRGTVYSKSLEHHLYTTPGGDTDFTNVTSLRGVFITSVMAEDNSIQSVVSFDQGGEWVPLRTPSNVNCKVTAKDPDKCEFHIHAAYSMAMKLDVP-MLPLSEPNAVGLILAHGSIGDSSSVIRPDVFVSDDGGYSWIKALDGPHHYAILDSGGLLVAVEHSPSDTIKQIKFSTDEGQCWHVYNFTTEPIFFTGLASEPGARSMNVSLWGYRDSYISQNWVSFTIDFRDLLTRDCDDNDYVQWLAHSDDI---SDPTDGCMLGYKEKFLRLRKDSVCWNGRDYQVASQPTPCACTLDDFLCDFGYYREENSSKCVEEPDLQHKVLELCLHGKEEQLVTSGYRKIPGDKCVGGQTP-KREEIDLSKRCVSD 730          
BLAST of Sortilin vs. Ensembl Medaka
Match: ENSORLT00000020004.2 (sortilin [Source:NCBI gene;Acc:101169531])

HSP 1 Score: 431.024 bits (1107), Expect = 6.749e-138
Identity = 232/688 (33.72%), Postives = 380/688 (55.23%), Query Frame = 1
Query:   94 DQVCDSQKEVIGNAFKNNNPISKFVFTNDTKTSVQVTWAGDNSGKIILVTTKEIQIILTYADLSDIYFSDNNGKSFKRITESLPIKKVIVRKENGLQRNILDHQNIFLVCYDT--VERSALLITKDGGETWKKVELNFILDREIKFHPFEKSWMITVNKARNLYKSIDGGLTWEFLLSDVLQYQWTTDKNYPQDIFVKTGKILETSIFEKIFGISNQKAPVMNLKKSTDAGKSWKIIKKNIFAFFLRDKFLYISELI-TGNRRRLMVSIDNGNTFNKVYLPTIANNQFFSILHIEEDSVYIHVDNADTRGDGILFTSDSDGQVFSQSLMNHFYPSAELTSDFYKVESMRGTYIASQLNPDRSIQSLITFNRGAEWKRIKKPVNETCHNKDKTE----CFVQVTGAYS--LMNNVPSSLPLSTPTAIGIVLVHAHLANSLKNSVSDVYITSDGGYNWIKALDGPHDYVIADHGGLLVAMGSNKKF---IKFSTDEGRCWHEHQYTTEDIRVTGLLTEPGNKAMTVAIWGYSNNDTQWIIHVVDLSQLLSRECDDSDYEKWYAHSEMMHPNGENYAGCLLGKKEEFLRLKKDSLCKNGYSHKVTKTEKICPCTKDDFECEYGYFRTVNSKNCIKNELIKEN---LCVKGIVEKIITQGYKKIPSDVCEGGFSPDKTKQKWLNQTCVEDEF 2112
            DQ C     ++G      N  S F+F   T  S+ + W GD +G ++++TT     +L     S++Y S++ GK+F+ +T+   I    ++ E G+  +  DH    L+  D     R  L  ++D G ++ + +L F    ++ F+P + + ++T++   +L+ S D G TW  +   V   +W++                 T  F     +S  +  ++ LKK+ + G+S++ I   +++F L  KF++ S +  TG  R + VS+D G  +N   LPT  N QF+S L   +D +++HVD+    G G ++ SD  G VFS+SL  H Y +    +DF  + S+RG Y+ S L  D  ++++IT+++GA+W+ +++P N  C +   T     C + +  +YS  +  NVP  LPLS P A+G++L H  L ++      DVY++ DGGY W+ AL GPH Y I D GGLLVA+         IKFSTDEG+CWH + +T + +  +G+ +EPG+++M V++WGY N+ ++W++  +D  +LL+R+CDD DY +W AHS     + +   GC+LG KE  LRL+KDS+C NG    V +    C CT+ D+ C++G++R  NS  C+  E +K      C+    E++ T GY+KIP + CEGGF P + K+  L + C  D  
Sbjct:   62 DQTC---TPLLGVEAALLNHTSTFMFKVRTAGSLSLAWVGDGTGVLLVLTTFHAPFLLMRFGQSNLYRSEDYGKTFRDVTDR--INHTFIQSEFGISVSP-DHSGKVLLTGDVSGFGRFRLFRSRDFGLSFAQSDLPFEPLIQMLFNPEDSNTLLTLSIRLDLWLSEDFGATWRKIHDSVCLVRWSSRN---------------TIYFTTSNNVSCSEKGMLELKKTLNYGRSFQTIATRVYSFALGGKFVFASIMTGTGTERTIHVSVDGGGHWNMAQLPTATNQQFYSFLAANQDMIFMHVDDPGDTGIGTIYVSDDRGIVFSKSLERHLYTTTGSDTDFTTISSLRGVYLTSILTEDGVVETVITYDQGAKWQTLRRPENSQCGSDTSTNRANTCRLHIHASYSTTMKMNVP-MLPLSQPNAVGLILAHGSLGDAESTLFPDVYVSDDGGYTWMLALKGPHHYAILDSGGLLVAVEHTNALVNQIKFSTDEGQCWHTYNFTNDPLHFSGMDSEPGSRSMNVSLWGYRNDFSKWVVVTIDFKKLLTRDCDDGDYVEWLAHSADRSGSSD---GCVLGYKETLLRLRKDSVCWNGRDFVVRRKPSPCLCTEVDYHCDFGFYRPENSSECVMQEEVKGRALEFCLNDTAEQLQTSGYRKIPGNQCEGGFQPTR-KETDLGKICTSDAL 723          
BLAST of Sortilin vs. Ensembl Medaka
Match: si:dkey-159a18.1 (sortilin-like [Source:NCBI gene;Acc:101157659])

HSP 1 Score: 337.806 bits (865), Expect = 8.782e-106
Identity = 167/413 (40.44%), Postives = 252/413 (61.02%), Query Frame = 1
Query:  871 RRLMVSIDNGNTFNKVYLPTIANNQFFSILHIEEDSVYIHVDNADTRGDGILFTSDSDGQVFSQSLMNHFYPSAELTSDFYKVESMRGTYIASQLNPDRSIQSLITFNRGAEWKRIKKPVNETCHNKDKTECFVQVTGAYSLMNNVPSSLPLSTPTAIGIVLVHAHLANSLKNSV-SDVYITSDGGYNWIKALDGPHDYVIADHGGLLVAMGSNK----KFIKFSTDEGRCWHEHQYTTEDIRVTGLLTEPGNKAMTVAIWGYSNND---TQWIIHVVDLSQLLSRECDDSDYEKWYAHSEMMHPNGENYAGCLLGKKEEFLRLKKDSLCKNGYSHKVTKTEKICPCTKDDFECEYGYFRTVNSKNCIKNELIKE---NLCVKGIVEKIITQGYKKIPSDVCEGGFSPDKTKQ 2076
            R +  S D G TF++  LP+ +  QF+SIL  +ED +++HVDN      G ++TSD  G +FS+SL  H +      SDF  + S+RG Y+ ++L+ D  I+S+I+FNRG  W+++ KP N  C    K +C + + G +S  N +   + LS  TA+G+V+ H  + +SL +S   DV+++SDGGY+W   L GPH Y I D GGL+VA+ +      K IKFSTDEG+CW  + +T +     GL +EPG KAM+V++WG+   D     W+   +D   L++REC   DYE W AHS      G N  GC+LG KE + RLKK+S+C+NG ++ V K +  C CT++D+ C+YG++R VN+  C+K          +C+ G  ++++T GY+K+ SD CEGGF+P  + Q
Sbjct:    8 RVMYFSSDQGKTFSQALLPSASTEQFYSILDGDEDMLFMHVDNPGDTYFGTMYTSDDRGILFSKSLERHLF-DGHRKSDFTNITSLRGVYLTNKLDVDGRIRSVISFNRGGAWRQLDKPENVDCEAHVK-KCNLHIHGEHSRKNGIVPMVALSDATAVGLVIAHGSVGDSLSSSQHPDVFVSSDGGYSWKGTLKGPHLYSILDSGGLIVAVEAQHSGQVKTIKFSTDEGQCWKLYNFTEQPFFFAGLASEPGTKAMSVSVWGFRPEDDGQPMWVAVTIDFQSLITRECSKKDYEVWLAHSTEEKDPGTN--GCVLGAKETYRRLKKESVCRNGRNYVVKKKQSPCLCTREDYICDYGFYRHVNTSECVKQPDATNKTMEMCLNGQEDELLTTGYRKVASDRCEGGFAPRLSAQ 416          
BLAST of Sortilin vs. Ensembl Medaka
Match: ENSORLT00000002839.2 (VPS10 domain-containing receptor SorCS1 [Source:NCBI gene;Acc:101163788])

HSP 1 Score: 206.838 bits (525), Expect = 1.271e-54
Identity = 168/661 (25.42%), Postives = 313/661 (47.35%), Query Frame = 1
Query:  157 SKFVFTNDTK-TSVQVTWAGDNSGKIILVTTKEIQIILTYADLSDIYFSDNNGKSFKRITESLPIKKVIVRKENGLQRNILDHQNIFLVCYDTVERSALLITKDGGETWKKVELNFILDREIKFHPFEKSWMITVNKARNLYKSIDGGLTWEFLLSDVL--QYQWTTDKNYPQDIFVKTGKI-LETSIFEKIFGISNQKAPVMNLKKSTDAGKSWKI---IKKNIFAFFLRDKFLYISELITGNRRRLMVSIDNGNTFNKVYLPTIANNQFFSILHIEEDSVYIHVDNADTRGDGILFTSDSDGQVFSQSLMN---HFYPSAELTSDFYKVESMRGTYIASQLNPDRSIQSLITFNRGAEWKRIKKPVNETCHNKDKTECFVQVTGAYSLM----NNVPSSLPLSTPTAIGIVLVHAHLANSLKNSVSDVYITSDGGYNWIKALDGPHDYVIADHGGLLVAMGSNKKFIK---FSTDEGRCWHEHQYTTEDIRVTGLLTEPGNKAMTVAIWGYSNNDTQWIIHVVDLSQLLSRECDDSDYEKWYAHSEMMHPNGENYAGCLLGKKEEFLRLKKDSLCKNGYSHKVTKTEKICPCTKDDFECEYGYFRTVNSKNCIKNELIKENL---CVKGIVEKIITQGYKKIPSDVCEGGFSPDKTKQK 2079
            S F  T D+      V W+G NS  +IL+ TK +   L     S ++ S + G +++++ + +  K ++    + L  +  + + I L+    VE S+LLI+ D G T++K  LNF +   + FHP ++ W++  +  + LY S++ G  W+ +   V   ++ W+        +  + G I LETSI E              L+  TD+ K       I  N  +  ++D+++++ ++ T  R    VS    + F  + LP     +   ++  +++ V   V   +      L+ SD+ G  ++ +L N          +  D Y+V  ++G ++A++   D  +++ IT+NRG +W+ ++ P  +   N     C +     +  +    N   S    S  +A GI++    + + L  +   V+ITSD G  W +  D  +  +  D GG LVA+      I+    S DEGR W+++ +T   + V G+L EPG + + + I+G+ ++ ++W +  +D   + +R C ++DY+ W+ H++     GE    CL+G K  + +LK  S C  G  + V  T   C C + DFEC+YGY R  + +          ++   C  G+   + + GY+K+ S+ C  G S + T ++
Sbjct:  223 STFALTGDSSHNQAMVHWSGQNS-SVILMLTKLLDFNLNSVTESSLWRSTDYGTTYQKLNDKVGAKTIL----SYLYVSPNNKRKIMLLTDPEVE-SSLLISSDEGATYQKYRLNFYI-LSLLFHPEQEDWILAYSHDQKLYSSVEFGRRWQLVHERVAPNRFYWSK-----MGLDKEPGLIHLETSISE-----GQALYVTCKLQNCTDSNKGKPFPGYIDPN--SLVVQDEYVFV-QVSTPGRPVYYVSAKR-DVFTPMKLPKYTLPKELHVISTDDNRVVAAVQEWNQNETYNLYVSDTSGVYYTLALENVVSSMGLEGNVMVDLYEVAGIKGMFLANK-KMDNQVKTHITYNRGRDWRLLQAPSRDLRGNS--IHCVLPYCSLHLHLHVSTNPYTSGNIASRESAPGIIVASGSIGSELTTTNGSVFITSDAGNTWRQIFDEEYAVLYLDQGGALVAIRHTPLPIRHLWLSFDEGRQWNKYSFTNTPLFVDGVLGEPGEETLIMTIFGHFSHRSEWQLVKIDFRSIFNRRCTEADYQTWHLHNQ-----GEP---CLMGVKRIYRKLKPMSRCVMGKMYSVAMTSSPCDCMEADFECDYGYERRSDGRCSPAFWFHPSSMSRSCTTGMT-FLNSTGYRKVISNNCTAGVSAEFTARR 850          
BLAST of Sortilin vs. Planmine SMEST
Match: SMESG000061919.1 (SMESG000061919.1)

HSP 1 Score: 1592.4 bits (4122), Expect = 0.000e+0
Identity = 809/811 (99.75%), Postives = 811/811 (100.00%), Query Frame = 1
Query:   31 MKYLFTTFSAFLFVNYIYSSVDQVCDSQKEVIGNAFKNNNPISKFVFTNDTKTSVQVTWAGDNSGKIILVTTKEIQIILTYADLSDIYFSDNNGKSFKRITESLPIKKVIVRKENGLQRNILDHQNIFLVCYDTVERSALLITKDGGETWKKVELNFILDREIKFHPFEKSWMITVNKARNLYKSIDGGLTWEFLLSDVLQYQWTTDKNYPQDIFVKTGKILETSIFEKIFGISNQKAPVMNLKKSTDAGKSWKIIKKNIFAFFLRDKFLYISELITGNRRRLMVSIDNGNTFNKVYLPTIANNQFFSILHIEEDSVYIHVDNADTRGDGILFTSDSDGQVFSQSLMNHFYPSAELTSDFYKVESMRGTYIASQLNPDRSIQSLITFNRGAEWKRIKKPVNETCHNKDKTECFVQVTGAYSLMNNVPSSLPLSTPTAIGIVLVHAHLANSLKNSVSDVYITSDGGYNWIKALDGPHDYVIADHGGLLVAMGSNKKFIKFSTDEGRCWHEHQYTTEDIRVTGLLTEPGNKAMTVAIWGYSNNDTQWIIHVVDLSQLLSRECDDSDYEKWYAHSEMMHPNGENYAGCLLGKKEEFLRLKKDSLCKNGYSHKVTKTEKICPCTKDDFECEYGYFRTVNSKNCIKNELIKENLCVKGIVEKIITQGYKKIPSDVCEGGFSPDKTKQKWLNQTCVEDEFKKIVVPISNTDSNTTAKHSELKQSNASSSPNNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNLKYKVLAGLKTDDDSPLIANEVGYESVSPTKSLKVNGRGGSEDSDVDMIS 2463
            MKYLFTTFSAFLFVNYIYSSVDQVCDSQKEVIGNAFKN+NPISKFVFTNDTKTSVQVTWAGDNSGKIILVTTKEIQIILTYADLSDIYFSDNNGKSFKRITESLPIKKVIVRKENGLQRNILDHQNIFLVCYDTVERSALLITKDGGETWKKVELNFILDREIKFHPFEKSWMITVNKARNLYKSIDGGLTWEFLLSDVLQYQWTTDKNYPQ+IFVKTGKILETSIFEKIFGISNQKAPVMNLKKSTDAGKSWKIIKKNIFAFFLRDKFLYISELITGNRRRLMVSIDNGNTFNKVYLPTIANNQFFSILHIEEDSVYIHVDNADTRGDGILFTSDSDGQVFSQSLMNHFYPSAELTSDFYKVESMRGTYIASQLNPDRSIQSLITFNRGAEWKRIKKPVNETCHNKDKTECFVQVTGAYSLMNNVPSSLPLSTPTAIGIVLVHAHLANSLKNSVSDVYITSDGGYNWIKALDGPHDYVIADHGGLLVAMGSNKKFIKFSTDEGRCWHEHQYTTEDIRVTGLLTEPGNKAMTVAIWGYSNNDTQWIIHVVDLSQLLSRECDDSDYEKWYAHSEMMHPNGENYAGCLLGKKEEFLRLKKDSLCKNGYSHKVTKTEKICPCTKDDFECEYGYFRTVNSKNCIKNELIKENLCVKGIVEKIITQGYKKIPSDVCEGGFSPDKTKQKWLNQTCVEDEFKKIVVPISNTDSNTTAKHSELKQSNASSSPNNIVAISITSILIIILILFFAFIIVARRRIITNRAANLKYKVLAGLKTDDDSPLIANEVGYESVSPTKSLKVNGRGGSEDSDVDMIS
Sbjct:    1 MKYLFTTFSAFLFVNYIYSSVDQVCDSQKEVIGNAFKNHNPISKFVFTNDTKTSVQVTWAGDNSGKIILVTTKEIQIILTYADLSDIYFSDNNGKSFKRITESLPIKKVIVRKENGLQRNILDHQNIFLVCYDTVERSALLITKDGGETWKKVELNFILDREIKFHPFEKSWMITVNKARNLYKSIDGGLTWEFLLSDVLQYQWTTDKNYPQNIFVKTGKILETSIFEKIFGISNQKAPVMNLKKSTDAGKSWKIIKKNIFAFFLRDKFLYISELITGNRRRLMVSIDNGNTFNKVYLPTIANNQFFSILHIEEDSVYIHVDNADTRGDGILFTSDSDGQVFSQSLMNHFYPSAELTSDFYKVESMRGTYIASQLNPDRSIQSLITFNRGAEWKRIKKPVNETCHNKDKTECFVQVTGAYSLMNNVPSSLPLSTPTAIGIVLVHAHLANSLKNSVSDVYITSDGGYNWIKALDGPHDYVIADHGGLLVAMGSNKKFIKFSTDEGRCWHEHQYTTEDIRVTGLLTEPGNKAMTVAIWGYSNNDTQWIIHVVDLSQLLSRECDDSDYEKWYAHSEMMHPNGENYAGCLLGKKEEFLRLKKDSLCKNGYSHKVTKTEKICPCTKDDFECEYGYFRTVNSKNCIKNELIKENLCVKGIVEKIITQGYKKIPSDVCEGGFSPDKTKQKWLNQTCVEDEFKKIVVPISNTDSNTTAKHSELKQSNASSSPNNIVAISITSILIIILILFFAFIIVARRRIITNRAANLKYKVLAGLKTDDDSPLIANEVGYESVSPTKSLKVNGRGGSEDSDVDMIS 811          
The following BLAST results are available for this feature:
BLAST of Sortilin vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SORT17.613e-13434.81sortilin 1 [Source:HGNC Symbol;Acc:HGNC:11186][more]
SORT15.773e-12635.89sortilin 1 [Source:HGNC Symbol;Acc:HGNC:11186][more]
SORCS12.939e-5424.54sortilin related VPS10 domain containing receptor ... [more]
SORL13.139e-5326.98sortilin related receptor 1 [Source:HGNC Symbol;Ac... [more]
SORCS21.276e-5024.81sortilin related VPS10 domain containing receptor ... [more]
back to top
BLAST of Sortilin vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Sortilin vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Sortilin vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sort1a4.243e-13336.35sortilin 1a [Source:NCBI gene;Acc:406511][more]
sort1a6.079e-13336.35sortilin 1a [Source:NCBI gene;Acc:406511][more]
sort1b5.963e-13134.74sortilin 1b [Source:ZFIN;Acc:ZDB-GENE-030131-7447][more]
sort1a7.640e-13036.20sortilin 1a [Source:NCBI gene;Acc:406511][more]
si:dkey-159a18.18.935e-8236.76si:dkey-159a18.1 [Source:ZFIN;Acc:ZDB-GENE-041210-... [more]
back to top
BLAST of Sortilin vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SORT13.645e-12231.97sortilin 1 [Source:NCBI gene;Acc:100490074][more]
SORT11.110e-12131.97sortilin 1 [Source:NCBI gene;Acc:100490074][more]
SORT12.077e-11439.60sortilin 1 [Source:NCBI gene;Acc:100490074][more]
ttll42.492e-5426.66tubulin tyrosine ligase like 4 [Source:Xenbase;Acc... [more]
ttll43.911e-5426.66tubulin tyrosine ligase like 4 [Source:Xenbase;Acc... [more]
back to top
BLAST of Sortilin vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Sort17.178e-13735.68sortilin 1 [Source:MGI Symbol;Acc:MGI:1338015][more]
Sort11.600e-13635.68sortilin 1 [Source:MGI Symbol;Acc:MGI:1338015][more]
Sorcs16.255e-5424.58sortilin-related VPS10 domain containing receptor ... [more]
Sorcs17.298e-5424.58sortilin-related VPS10 domain containing receptor ... [more]
Sorcs17.595e-5424.58sortilin-related VPS10 domain containing receptor ... [more]
back to top
BLAST of Sortilin vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6PHU5|SORT_MOUSE5.021e-13635.68Sortilin OS=Mus musculus OX=10090 GN=Sort1 PE=1 SV... [more]
sp|O54861|SORT_RAT1.835e-13435.24Sortilin OS=Rattus norvegicus OX=10116 GN=Sort1 PE... [more]
sp|Q99523|SORT_HUMAN3.656e-13334.81Sortilin OS=Homo sapiens OX=9606 GN=SORT1 PE=1 SV=... [more]
sp|Q6NUT7|SORT1_DANRE1.884e-12936.35Sortilin OS=Danio rerio OX=7955 GN=sort1 PE=2 SV=1[more]
sp|Q98930|SORL_CHICK3.375e-5527.22Sortilin-related receptor (Fragment) OS=Gallus gal... [more]
back to top
BLAST of Sortilin vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3IST33.452e-17741.92Sortilin OS=Lingula unguis OX=7574 GN=LOC106167010... [more]
A0A267H5C91.271e-16539.88Sortilin OS=Macrostomum lignano OX=282301 GN=BOX15... [more]
A0A267DZG71.346e-16539.88Sortilin OS=Macrostomum lignano OX=282301 GN=BOX15... [more]
A0A1I8I5035.451e-16540.27Sortilin OS=Macrostomum lignano OX=282301 PE=4 SV=... [more]
A0A267FI606.890e-16539.74Sortilin OS=Macrostomum lignano OX=282301 GN=BOX15... [more]
back to top
BLAST of Sortilin vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sort1a3.986e-13434.57sortilin 1 [Source:NCBI gene;Acc:103040260][more]
sort1b9.142e-13433.97sortilin-like [Source:NCBI gene;Acc:103047724][more]
sort1b1.218e-12834.14sortilin-like [Source:NCBI gene;Acc:103047724][more]
sort1a1.312e-12734.59sortilin 1 [Source:NCBI gene;Acc:103040260][more]
si:dkey-159a18.12.367e-12735.02sortilin-like [Source:NCBI gene;Acc:103040108][more]
back to top
BLAST of Sortilin vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SORT11.821e-11231.72sortilin 1 [Source:HGNC Symbol;Acc:HGNC:11186][more]
SORT11.735e-10830.86sortilin 1 [Source:HGNC Symbol;Acc:HGNC:11186][more]
sorl14.751e-5727.25sortilin-related receptor, L(DLR class) A repeats ... [more]
sorl14.347e-5427.12sortilin-related receptor, L(DLR class) A repeats ... [more]
ENSPMAT00000004105.11.582e-4925.19pep scaffold:Pmarinus_7.0:GL477143:142842:164167:1... [more]
back to top
BLAST of Sortilin vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
YNR065C6.464e-3924.19Protein of unknown function; protein-protein inter... [more]
PEP13.004e-3824.04Type I transmembrane sorting receptor for multiple... [more]
VTH25.149e-3724.08Putative membrane glycoprotein; has strong similar... [more]
VTH15.194e-3724.08Putative membrane glycoprotein; has strong similar... [more]
YCR100C_mRNA1.431e-627.45Putative protein of unknown function [Source:SGD;A... [more]
back to top
BLAST of Sortilin vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO390681.165e-12735.29Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO452182.425e-5026.57Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO359269.622e-4323.92Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO418799.824e-825.59Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Sortilin vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sort1b2.066e-13836.35sortilin [Source:NCBI gene;Acc:101158853][more]
sort1b2.463e-13836.35sortilin [Source:NCBI gene;Acc:101158853][more]
ENSORLT00000020004.26.749e-13833.72sortilin [Source:NCBI gene;Acc:101169531][more]
si:dkey-159a18.18.782e-10640.44sortilin-like [Source:NCBI gene;Acc:101157659][more]
ENSORLT00000002839.21.271e-5425.42VPS10 domain-containing receptor SorCS1 [Source:NC... [more]
back to top
BLAST of Sortilin vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000061919.10.000e+099.75SMESG000061919.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30009710 ID=SMED30009710|Name=Sortilin|organism=Schmidtea mediterranea sexual|type=transcript|length=2635bp
TATTTATGTCCAAATAAGCTACAATTTTAAATGAAATATTTATTTACTAC
TTTTAGTGCCTTTTTATTTGTCAATTACATCTATTCATCAGTTGATCAAG
TATGTGATTCTCAGAAAGAAGTAATTGGAAATGCCTTTAAAAATAATAAC
CCAATTTCCAAATTTGTCTTTACCAATGATACGAAAACGTCTGTGCAAGT
TACTTGGGCTGGTGATAATAGTGGAAAAATCATTTTAGTAACAACCAAAG
AAATTCAAATAATACTTACTTACGCGGATCTTTCAGATATTTATTTCAGT
GATAATAATGGAAAATCATTTAAAAGAATAACTGAAAGTTTGCCCATTAA
AAAGGTGATAGTTCGAAAAGAAAATGGCCTTCAACGAAACATCTTAGATC
ATCAAAATATATTTTTGGTGTGCTATGATACAGTCGAGCGATCTGCTCTT
TTAATTACCAAAGATGGAGGAGAAACTTGGAAAAAGGTCGAATTGAATTT
CATTTTAGATAGAGAAATTAAATTTCATCCTTTCGAAAAATCTTGGATGA
TAACAGTAAACAAAGCCAGAAATCTTTACAAATCGATCGATGGAGGACTT
ACATGGGAATTTCTCTTGAGTGATGTTCTACAATATCAATGGACCACGGA
TAAAAATTATCCTCAAGATATATTTGTTAAAACTGGAAAAATACTAGAAA
CATCAATTTTCGAAAAAATTTTCGGAATCTCGAATCAAAAAGCCCCAGTG
ATGAATTTAAAGAAATCTACTGATGCCGGTAAATCATGGAAAATCATTAA
AAAGAATATTTTTGCATTTTTCTTACGAGACAAGTTTCTATATATTTCCG
AATTAATCACAGGAAATCGACGACGTTTGATGGTTTCTATAGATAACGGC
AATACTTTTAATAAAGTTTATTTACCGACAATAGCAAACAATCAATTTTT
TTCGATTTTGCACATTGAAGAAGATTCAGTATATATTCATGTAGATAATG
CCGACACGCGAGGTGATGGAATTTTATTTACTTCGGATTCTGATGGACAA
GTGTTTAGCCAATCACTGATGAACCATTTCTATCCTTCAGCGGAATTAAC
AAGTGATTTCTATAAAGTAGAATCTATGCGGGGAACATATATAGCAAGTC
AACTTAATCCCGATCGATCAATACAATCATTAATCACTTTCAACCGAGGC
GCAGAATGGAAGCGCATTAAGAAGCCAGTAAATGAGACTTGTCACAACAA
AGATAAAACTGAGTGTTTTGTCCAAGTTACTGGTGCCTATAGCCTTATGA
ATAACGTGCCATCGTCATTGCCACTCAGCACCCCAACTGCTATAGGCATT
GTATTAGTTCATGCACATCTTGCAAACAGTTTAAAAAACTCCGTATCAGA
TGTCTATATCACCAGTGATGGCGGCTACAATTGGATAAAGGCGCTTGATG
GACCTCATGATTACGTTATTGCTGATCATGGCGGCTTATTAGTTGCTATG
GGAAGTAATAAAAAGTTTATAAAATTTAGTACTGATGAAGGGAGATGTTG
GCACGAACATCAGTATACAACTGAGGATATTCGTGTTACTGGTCTCTTAA
CAGAACCTGGTAACAAAGCAATGACAGTTGCCATATGGGGTTATAGTAAT
AATGATACTCAATGGATAATACATGTGGTGGATCTATCTCAGTTGCTAAG
TCGAGAATGTGATGATAGCGATTATGAAAAATGGTATGCTCATTCAGAAA
TGATGCATCCTAACGGAGAAAATTATGCTGGATGCTTATTAGGGAAAAAA
GAGGAATTTTTGAGATTAAAGAAAGATTCCTTATGTAAAAATGGATATTC
TCACAAGGTCACTAAAACCGAGAAAATTTGTCCGTGCACTAAAGATGATT
TTGAATGCGAATACGGTTATTTTCGAACTGTTAACAGCAAAAATTGTATA
AAAAATGAATTGATTAAGGAAAATCTTTGTGTAAAAGGAATAGTTGAAAA
AATTATTACCCAAGGATATAAAAAAATACCTTCTGATGTATGTGAAGGCG
GATTTTCTCCTGATAAAACTAAACAGAAATGGTTAAATCAAACTTGTGTA
GAGGATGAATTTAAGAAAATTGTTGTTCCTATTTCGAATACTGATTCGAA
TACTACGGCAAAACATAGTGAATTGAAACAAAGCAATGCTTCTAGCTCAC
CGAATAACATTGTGGCCATATCAATTACCAGCATTTTAATAATAATACTT
ATTTTGTTTTTCGCATTCATTATTGTTGCAAGACGAAGGATAATTACTAA
TAGAGCAGCTAACTTAAAATATAAAGTGCTTGCTGGATTAAAAACCGATG
ATGATTCTCCACTTATTGCTAACGAAGTTGGTTATGAAAGCGTCAGTCCT
ACAAAATCATTGAAAGTTAACGGGAGGGGTGGATCTGAAGATTCAGATGT
CGATATGATTAGTTAAATCGAAGGAATTTTTCTTCAAAATCATTAACCAT
TACATGGAGTAACCTTGACACAATTCATTTTGTTTTCATTGCTGTGCTGT
TTTTAATTTTGGATATTCTAATGCTTCATCAATTTATTCCAACATTTGTA
AATTAATAAATATATATTTTTGGTATTAAAAAAAA
back to top

protein sequence of SMED30009710-orf-1

>SMED30009710-orf-1 ID=SMED30009710-orf-1|Name=SMED30009710-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=812bp
MKYLFTTFSAFLFVNYIYSSVDQVCDSQKEVIGNAFKNNNPISKFVFTND
TKTSVQVTWAGDNSGKIILVTTKEIQIILTYADLSDIYFSDNNGKSFKRI
TESLPIKKVIVRKENGLQRNILDHQNIFLVCYDTVERSALLITKDGGETW
KKVELNFILDREIKFHPFEKSWMITVNKARNLYKSIDGGLTWEFLLSDVL
QYQWTTDKNYPQDIFVKTGKILETSIFEKIFGISNQKAPVMNLKKSTDAG
KSWKIIKKNIFAFFLRDKFLYISELITGNRRRLMVSIDNGNTFNKVYLPT
IANNQFFSILHIEEDSVYIHVDNADTRGDGILFTSDSDGQVFSQSLMNHF
YPSAELTSDFYKVESMRGTYIASQLNPDRSIQSLITFNRGAEWKRIKKPV
NETCHNKDKTECFVQVTGAYSLMNNVPSSLPLSTPTAIGIVLVHAHLANS
LKNSVSDVYITSDGGYNWIKALDGPHDYVIADHGGLLVAMGSNKKFIKFS
TDEGRCWHEHQYTTEDIRVTGLLTEPGNKAMTVAIWGYSNNDTQWIIHVV
DLSQLLSRECDDSDYEKWYAHSEMMHPNGENYAGCLLGKKEEFLRLKKDS
LCKNGYSHKVTKTEKICPCTKDDFECEYGYFRTVNSKNCIKNELIKENLC
VKGIVEKIITQGYKKIPSDVCEGGFSPDKTKQKWLNQTCVEDEFKKIVVP
ISNTDSNTTAKHSELKQSNASSSPNNIVAISITSILIIILILFFAFIIVA
RRRIITNRAANLKYKVLAGLKTDDDSPLIANEVGYESVSPTKSLKVNGRG
GSEDSDVDMIS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0002032epidermal cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR015943WD40/YVTN_repeat-like_dom_sf
IPR036278Sialidase_sf
IPR006581VPS10
IPR031778Sortilin_N
IPR031777Sortilin_C
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0005634nucleus
GO:0005764lysosome
GO:0005765lysosomal membrane
GO:0005768endosome
GO:0005769early endosome
GO:0005783endoplasmic reticulum
GO:0005789endoplasmic reticulum membrane
GO:0005794Golgi apparatus
GO:0005829cytosol
GO:0005886plasma membrane
GO:0005905clathrin-coated pit
GO:0009986cell surface
GO:0010008endosome membrane
GO:0016020membrane
GO:0030136clathrin-coated vesicle
GO:0030140trans-Golgi network transport vesicle
GO:0030425dendrite
GO:0030659cytoplasmic vesicle membrane
GO:0031410cytoplasmic vesicle
GO:0031965nuclear membrane
GO:0032580Golgi cisterna membrane
GO:0043025neuronal cell body
GO:0043231intracellular membrane-bounded organelle
GO:0048471perinuclear region of cytoplasm
Vocabulary: biological process
TermDefinition
GO:0001503ossification
GO:0006810transport
GO:0006895Golgi to endosome transport
GO:0006897endocytosis
GO:0007186G-protein coupled receptor signaling pathway
GO:0007218neuropeptide signaling pathway
GO:0007275multicellular organism development
GO:0008333endosome to lysosome transport
GO:0008625extrinsic apoptotic signaling pathway via death domain receptors
GO:0010468regulation of gene expression
GO:0014902myotube differentiation
GO:0016050vesicle organization
GO:0030154cell differentiation
GO:0032509endosome transport via multivesicular body sorting pathway
GO:0032868response to insulin
GO:0038180nerve growth factor signaling pathway
GO:0045599negative regulation of fat cell differentiation
GO:0046323glucose import
GO:0048011neurotrophin TRK receptor signaling pathway
GO:0048227plasma membrane to endosome transport
GO:0051005negative regulation of lipoprotein lipase activity
GO:1904037positive regulation of epithelial cell apoptotic process
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0010465nerve growth factor receptor activity
GO:0019899enzyme binding
GO:0030379neurotensin receptor activity, non-G-protein coupled
GO:0048406nerve growth factor binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR006581VPS10SMARTSM00602vps10coord: 76..694
e-value: 2.8E-112
score: 389.0
IPR015943WD40/YVTN repeat-like-containing domain superfamilyGENE3DG3DSA:2.130.10.10coord: 27..335
e-value: 2.2E-14
score: 54.9
IPR031778Sortilin, N-terminalPFAMPF15902Sortilin-Vps10coord: 86..522
e-value: 7.0E-78
score: 262.4
NoneNo IPR availableGENE3DG3DSA:2.10.70.90coord: 619..693
e-value: 3.6E-17
score: 64.3
NoneNo IPR availableGENE3DG3DSA:2.10.70.80coord: 558..617
e-value: 4.5E-20
score: 73.4
NoneNo IPR availablePANTHERPTHR12106:SF23SORTILINcoord: 44..800
NoneNo IPR availablePANTHERPTHR12106SORTILIN RELATEDcoord: 44..800
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..19
score: 0.601
NoneNo IPR availableSUPERFAMILYSSF110296Oligoxyloglucan reducing end-specific cellobiohydrolasecoord: 243..539
NoneNo IPR availableTMHMMTMhelixcoord: 727..749
IPR031777Sortilin, C-terminalPFAMPF15901Sortilin_Ccoord: 524..681
e-value: 2.6E-34
score: 119.0
IPR036278Sialidase superfamilySUPERFAMILYSSF50939Sialidasescoord: 57..212