Glyceraldehyde-3-phosphate dehydrogenase

Overview
NameGlyceraldehyde-3-phosphate dehydrogenase
Smed IDSMED30009707
Length (bp)1198
Neoblast Clusters

Zeng et. al., 2018




 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30009707

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
reproductive organSMED30009707SMESG000023748.1 Contig40390newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30009707SMESG000023748.1 Contig40390uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Ensembl Human
Match: GAPDH (glyceraldehyde-3-phosphate dehydrogenase [Source:HGNC Symbol;Acc:HGNC:4141])

HSP 1 Score: 487.649 bits (1254), Expect = 5.357e-173
Identity = 232/330 (70.30%), Postives = 267/330 (80.91%), Query Frame = 1
Query:   55 GKPKVGINGFGRIGRLVLRAGLIQGKVDFVGINDPFVDVNYMVYMFKYDSTHGIYKNDVSEQDGFLVVADQKIQIFMEKDPSKIPWSDVDAEYVVESSGAFTTIQSASAHLPS-AKKVIISAPSADAPMFVMGVNHQLYEKSMNVVSNASCTTNCLAPLAKIIHDKFGIEEALMTTVHAVTATQKTVDAPSLKDWRGGRGAGQNIIPSSTGAAKAVGKVIPELNGKLTGMAFRVPTPDVSVVDLTVRLQNPAKYEDIVNAIRLECEGSMRGIMGFTDEALVSTDLCGDTRSSIFDASAGIQLNDKFVKLISWYDNEFGYSNRVIDLICHM 1041
            GK KVG+NGFGRIGRLV RA    GKVD V INDPF+D+NYMVYMF+YDSTHG +   V  ++G LV+    I IF E+DPSKI W D  AEYVVES+G FTT++ A AHL   AK+VIISAPSADAPMFVMGVNH+ Y+ S+ ++SNASCTTNCLAPLAK+IHD FGI E LMTTVHA+TATQKTVD PS K WR GRGA QNIIP+STGAAKAVGKVIPELNGKLTGMAFRVPT +VSVVDLT RL+ PAKY+DI   ++   EG ++GI+G+T+  +VS+D   DT SS FDA AGI LND FVKLISWYDNEFGYSNRV+DL+ HM
Sbjct:    2 GKVKVGVNGFGRIGRLVTRAAFNSGKVDIVAINDPFIDLNYMVYMFQYDSTHGKFHGTVKAENGKLVINGNPITIFQERDPSKIKWGDAGAEYVVESTGVFTTMEKAGAHLQGGAKRVIISAPSADAPMFVMGVNHEKYDNSLKIISNASCTTNCLAPLAKVIHDNFGIVEGLMTTVHAITATQKTVDGPSGKLWRDGRGALQNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPTANVSVVDLTCRLEKPAKYDDIKKVVKQASEGPLKGILGYTEHQVVSSDFNSDTHSSTFDAGAGIALNDHFVKLISWYDNEFGYSNRVVDLMAHM 331          
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Ensembl Human
Match: GAPDH (glyceraldehyde-3-phosphate dehydrogenase [Source:HGNC Symbol;Acc:HGNC:4141])

HSP 1 Score: 487.649 bits (1254), Expect = 5.357e-173
Identity = 232/330 (70.30%), Postives = 267/330 (80.91%), Query Frame = 1
Query:   55 GKPKVGINGFGRIGRLVLRAGLIQGKVDFVGINDPFVDVNYMVYMFKYDSTHGIYKNDVSEQDGFLVVADQKIQIFMEKDPSKIPWSDVDAEYVVESSGAFTTIQSASAHLPS-AKKVIISAPSADAPMFVMGVNHQLYEKSMNVVSNASCTTNCLAPLAKIIHDKFGIEEALMTTVHAVTATQKTVDAPSLKDWRGGRGAGQNIIPSSTGAAKAVGKVIPELNGKLTGMAFRVPTPDVSVVDLTVRLQNPAKYEDIVNAIRLECEGSMRGIMGFTDEALVSTDLCGDTRSSIFDASAGIQLNDKFVKLISWYDNEFGYSNRVIDLICHM 1041
            GK KVG+NGFGRIGRLV RA    GKVD V INDPF+D+NYMVYMF+YDSTHG +   V  ++G LV+    I IF E+DPSKI W D  AEYVVES+G FTT++ A AHL   AK+VIISAPSADAPMFVMGVNH+ Y+ S+ ++SNASCTTNCLAPLAK+IHD FGI E LMTTVHA+TATQKTVD PS K WR GRGA QNIIP+STGAAKAVGKVIPELNGKLTGMAFRVPT +VSVVDLT RL+ PAKY+DI   ++   EG ++GI+G+T+  +VS+D   DT SS FDA AGI LND FVKLISWYDNEFGYSNRV+DL+ HM
Sbjct:    2 GKVKVGVNGFGRIGRLVTRAAFNSGKVDIVAINDPFIDLNYMVYMFQYDSTHGKFHGTVKAENGKLVINGNPITIFQERDPSKIKWGDAGAEYVVESTGVFTTMEKAGAHLQGGAKRVIISAPSADAPMFVMGVNHEKYDNSLKIISNASCTTNCLAPLAKVIHDNFGIVEGLMTTVHAITATQKTVDGPSGKLWRDGRGALQNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPTANVSVVDLTCRLEKPAKYDDIKKVVKQASEGPLKGILGYTEHQVVSSDFNSDTHSSTFDAGAGIALNDHFVKLISWYDNEFGYSNRVVDLMAHM 331          
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Ensembl Human
Match: GAPDH (glyceraldehyde-3-phosphate dehydrogenase [Source:HGNC Symbol;Acc:HGNC:4141])

HSP 1 Score: 487.649 bits (1254), Expect = 5.357e-173
Identity = 232/330 (70.30%), Postives = 267/330 (80.91%), Query Frame = 1
Query:   55 GKPKVGINGFGRIGRLVLRAGLIQGKVDFVGINDPFVDVNYMVYMFKYDSTHGIYKNDVSEQDGFLVVADQKIQIFMEKDPSKIPWSDVDAEYVVESSGAFTTIQSASAHLPS-AKKVIISAPSADAPMFVMGVNHQLYEKSMNVVSNASCTTNCLAPLAKIIHDKFGIEEALMTTVHAVTATQKTVDAPSLKDWRGGRGAGQNIIPSSTGAAKAVGKVIPELNGKLTGMAFRVPTPDVSVVDLTVRLQNPAKYEDIVNAIRLECEGSMRGIMGFTDEALVSTDLCGDTRSSIFDASAGIQLNDKFVKLISWYDNEFGYSNRVIDLICHM 1041
            GK KVG+NGFGRIGRLV RA    GKVD V INDPF+D+NYMVYMF+YDSTHG +   V  ++G LV+    I IF E+DPSKI W D  AEYVVES+G FTT++ A AHL   AK+VIISAPSADAPMFVMGVNH+ Y+ S+ ++SNASCTTNCLAPLAK+IHD FGI E LMTTVHA+TATQKTVD PS K WR GRGA QNIIP+STGAAKAVGKVIPELNGKLTGMAFRVPT +VSVVDLT RL+ PAKY+DI   ++   EG ++GI+G+T+  +VS+D   DT SS FDA AGI LND FVKLISWYDNEFGYSNRV+DL+ HM
Sbjct:    2 GKVKVGVNGFGRIGRLVTRAAFNSGKVDIVAINDPFIDLNYMVYMFQYDSTHGKFHGTVKAENGKLVINGNPITIFQERDPSKIKWGDAGAEYVVESTGVFTTMEKAGAHLQGGAKRVIISAPSADAPMFVMGVNHEKYDNSLKIISNASCTTNCLAPLAKVIHDNFGIVEGLMTTVHAITATQKTVDGPSGKLWRDGRGALQNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPTANVSVVDLTCRLEKPAKYDDIKKVVKQASEGPLKGILGYTEHQVVSSDFNSDTHSSTFDAGAGIALNDHFVKLISWYDNEFGYSNRVVDLMAHM 331          
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Ensembl Human
Match: GAPDHS (glyceraldehyde-3-phosphate dehydrogenase, spermatogenic [Source:HGNC Symbol;Acc:HGNC:24864])

HSP 1 Score: 447.203 bits (1149), Expect = 4.851e-156
Identity = 219/331 (66.16%), Postives = 261/331 (78.85%), Query Frame = 1
Query:   67 VGINGFGRIGRLVLRAGLIQGKVDFVGINDPFVDVNYMVYMFKYDSTHGIYKNDVSEQDGFLVVADQKIQIFMEKDPSKIPWSDVDAEYVVESSGAFTTIQSASAHLPS-AKKVIISAPSADAPMFVMGVNHQLYEK-SMNVVSNASCTTNCLAPLAKIIHDKFGIEEALMTTVHAVTATQKTVDAPSLKDWRGGRGAGQNIIPSSTGAAKAVGKVIPELNGKLTGMAFRVPTPDVSVVDLTVRLQNPAKYEDIVNAIRLECEGSMRGIMGFTDEALVSTDLCGDTRSSIFDASAGIQLNDKFVKLISWYDNEFGYSNRVIDLICHMYRID 1053
            VGINGFGRIGRLVLRA + +G V  V +NDPF+D  YMVYMFKYDSTHG YK  V  ++G LVV + +I ++  K+P +IPW  V + YVVES+G + +IQ+AS H+ + A++V+ISAPS DAPMFVMGVN   Y   SMN+VSNASCTTNCLAPLAK+IH++FGI E LMTTVH+ TATQKTVD PS K WR GRGA QNIIP+STGAAKAV KVIPEL GKLTGMAFRVPTPDVSVVDLT RL  PA Y  I  A++   +G M GI+ +T++ +VSTD  GDT SSIFDA AGI LND FVKLISWYDNE+GYS+RV+DL+ +M+  D
Sbjct:   78 VGINGFGRIGRLVLRACMEKG-VKVVAVNDPFIDPEYMVYMFKYDSTHGRYKGSVEFRNGQLVVDNHEISVYQCKEPKQIPWRAVGSPYVVESTGVYLSIQAASDHISAGAQRVVISAPSPDAPMFVMGVNENDYNPGSMNIVSNASCTTNCLAPLAKVIHERFGIVEGLMTTVHSYTATQKTVDGPSRKAWRDGRGAHQNIIPASTGAAKAVTKVIPELKGKLTGMAFRVPTPDVSVVDLTCRLAQPAPYSAIKEAVKAAAKGPMAGILAYTEDEVVSTDFLGDTHSSIFDAKAGIALNDNFVKLISWYDNEYGYSHRVVDLLRYMFSRD 407          
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Ensembl Human
Match: GAPDH (glyceraldehyde-3-phosphate dehydrogenase [Source:HGNC Symbol;Acc:HGNC:4141])

HSP 1 Score: 425.631 bits (1093), Expect = 3.235e-149
Identity = 202/289 (69.90%), Postives = 234/289 (80.97%), Query Frame = 1
Query:  178 MVYMFKYDSTHGIYKNDVSEQDGFLVVADQKIQIFMEKDPSKIPWSDVDAEYVVESSGAFTTIQSASAHLPS-AKKVIISAPSADAPMFVMGVNHQLYEKSMNVVSNASCTTNCLAPLAKIIHDKFGIEEALMTTVHAVTATQKTVDAPSLKDWRGGRGAGQNIIPSSTGAAKAVGKVIPELNGKLTGMAFRVPTPDVSVVDLTVRLQNPAKYEDIVNAIRLECEGSMRGIMGFTDEALVSTDLCGDTRSSIFDASAGIQLNDKFVKLISWYDNEFGYSNRVIDLICHM 1041
            MVYMF+YDSTHG +   V  ++G LV+    I IF E+DPSKI W D  AEYVVES+G FTT++ A AHL   AK+VIISAPSADAPMFVMGVNH+ Y+ S+ ++SNASCTTNCLAPLAK+IHD FGI E LMTTVHA+TATQKTVD PS K WR GRGA QNIIP+STGAAKAVGKVIPELNGKLTGMAFRVPT +VSVVDLT RL+ PAKY+DI   ++   EG ++GI+G+T+  +VS+D   DT SS FDA AGI LND FVKLISWYDNEFGYSNRV+DL+ HM
Sbjct:    1 MVYMFQYDSTHGKFHGTVKAENGKLVINGNPITIFQERDPSKIKWGDAGAEYVVESTGVFTTMEKAGAHLQGGAKRVIISAPSADAPMFVMGVNHEKYDNSLKIISNASCTTNCLAPLAKVIHDNFGIVEGLMTTVHAITATQKTVDGPSGKLWRDGRGALQNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPTANVSVVDLTCRLEKPAKYDDIKKVVKQASEGPLKGILGYTEHQVVSSDFNSDTHSSTFDAGAGIALNDHFVKLISWYDNEFGYSNRVVDLMAHM 289          
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Ensembl Celegans
Match: gpd-3 (Glyceraldehyde-3-phosphate dehydrogenase 3 [Source:UniProtKB/Swiss-Prot;Acc:P17330])

HSP 1 Score: 455.292 bits (1170), Expect = 1.414e-160
Identity = 220/335 (65.67%), Postives = 269/335 (80.30%), Query Frame = 1
Query:   58 KPKVGINGFGRIGRLVLRAGLIQGKVDFVGINDPFVDVNYMVYMFKYDSTHGIYKNDVSEQDGFLVVADQ-----KIQIFMEKDPSKIPWSDVDAEYVVESSGAFTTIQSASAHLPS-AKKVIISAPSADAPMFVMGVNHQLYEKSMN-VVSNASCTTNCLAPLAKIIHDKFGIEEALMTTVHAVTATQKTVDAPSLKDWRGGRGAGQNIIPSSTGAAKAVGKVIPELNGKLTGMAFRVPTPDVSVVDLTVRLQNPAKYEDIVNAIRLECEGSMRGIMGFTDEALVSTDLCGDTRSSIFDASAGIQLNDKFVKLISWYDNEFGYSNRVIDLICHM 1041
            KP VGINGFGRIGRLVLRA + +  V+ V +NDPF+ ++YMVY+F+YDSTHG +K  V+ +  +L+VA +     KI+++  +DP++I W    A+YVVES+G FTTI+ A+AHL   AKKVIISAPSADAPMFV+GVNH+ Y+ + + ++SNASCTTNCLAPLAK+I+D FGI E LMTTVHAVTATQKTVD PS K WR GRGAGQNIIP+STGAAKAVGKVIPELNGKLTGMAFRVPTPDVSVVDLT RL+ PA  +DI   I+   +G M+GI+ +T++ +VSTD   DT SSIFDA A I LN  FVKL+SWYDNEFGYSNRV+DLI ++
Sbjct:    3 KPSVGINGFGRIGRLVLRAAVEKDSVNVVAVNDPFISIDYMVYLFQYDSTHGRFKGTVAHEGDYLLVAKEGKSQHKIKVYNSRDPAEIQWGASGADYVVESTGVFTTIEKANAHLKGGAKKVIISAPSADAPMFVVGVNHEKYDHANDHIISNASCTTNCLAPLAKVINDNFGIIEGLMTTVHAVTATQKTVDGPSGKLWRDGRGAGQNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPTPDVSVVDLTARLEKPASLDDIKKVIKAAADGPMKGILAYTEDQVVSTDFVSDTNSSIFDAGASISLNPHFVKLVSWYDNEFGYSNRVVDLISYI 337          
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Ensembl Celegans
Match: gpd-3 (Glyceraldehyde-3-phosphate dehydrogenase 3 [Source:UniProtKB/Swiss-Prot;Acc:P17330])

HSP 1 Score: 455.292 bits (1170), Expect = 1.414e-160
Identity = 220/335 (65.67%), Postives = 269/335 (80.30%), Query Frame = 1
Query:   58 KPKVGINGFGRIGRLVLRAGLIQGKVDFVGINDPFVDVNYMVYMFKYDSTHGIYKNDVSEQDGFLVVADQ-----KIQIFMEKDPSKIPWSDVDAEYVVESSGAFTTIQSASAHLPS-AKKVIISAPSADAPMFVMGVNHQLYEKSMN-VVSNASCTTNCLAPLAKIIHDKFGIEEALMTTVHAVTATQKTVDAPSLKDWRGGRGAGQNIIPSSTGAAKAVGKVIPELNGKLTGMAFRVPTPDVSVVDLTVRLQNPAKYEDIVNAIRLECEGSMRGIMGFTDEALVSTDLCGDTRSSIFDASAGIQLNDKFVKLISWYDNEFGYSNRVIDLICHM 1041
            KP VGINGFGRIGRLVLRA + +  V+ V +NDPF+ ++YMVY+F+YDSTHG +K  V+ +  +L+VA +     KI+++  +DP++I W    A+YVVES+G FTTI+ A+AHL   AKKVIISAPSADAPMFV+GVNH+ Y+ + + ++SNASCTTNCLAPLAK+I+D FGI E LMTTVHAVTATQKTVD PS K WR GRGAGQNIIP+STGAAKAVGKVIPELNGKLTGMAFRVPTPDVSVVDLT RL+ PA  +DI   I+   +G M+GI+ +T++ +VSTD   DT SSIFDA A I LN  FVKL+SWYDNEFGYSNRV+DLI ++
Sbjct:    3 KPSVGINGFGRIGRLVLRAAVEKDSVNVVAVNDPFISIDYMVYLFQYDSTHGRFKGTVAHEGDYLLVAKEGKSQHKIKVYNSRDPAEIQWGASGADYVVESTGVFTTIEKANAHLKGGAKKVIISAPSADAPMFVVGVNHEKYDHANDHIISNASCTTNCLAPLAKVINDNFGIIEGLMTTVHAVTATQKTVDGPSGKLWRDGRGAGQNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPTPDVSVVDLTARLEKPASLDDIKKVIKAAADGPMKGILAYTEDQVVSTDFVSDTNSSIFDAGASISLNPHFVKLVSWYDNEFGYSNRVVDLISYI 337          
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Ensembl Celegans
Match: gpd-2 (Glyceraldehyde-3-phosphate dehydrogenase 2 [Source:UniProtKB/Swiss-Prot;Acc:P17329])

HSP 1 Score: 454.907 bits (1169), Expect = 1.560e-160
Identity = 220/335 (65.67%), Postives = 269/335 (80.30%), Query Frame = 1
Query:   58 KPKVGINGFGRIGRLVLRAGLIQGKVDFVGINDPFVDVNYMVYMFKYDSTHGIYKNDVSEQDGFLVVADQ-----KIQIFMEKDPSKIPWSDVDAEYVVESSGAFTTIQSASAHLPS-AKKVIISAPSADAPMFVMGVNHQLYEKSMN-VVSNASCTTNCLAPLAKIIHDKFGIEEALMTTVHAVTATQKTVDAPSLKDWRGGRGAGQNIIPSSTGAAKAVGKVIPELNGKLTGMAFRVPTPDVSVVDLTVRLQNPAKYEDIVNAIRLECEGSMRGIMGFTDEALVSTDLCGDTRSSIFDASAGIQLNDKFVKLISWYDNEFGYSNRVIDLICHM 1041
            KP VGINGFGRIGRLVLRA + +  V+ V +NDPF+ ++YMVY+F+YDSTHG +K  V+ +  +L+VA +     KI+++  +DP++I W    A+YVVES+G FTTI+ A+AHL   AKKVIISAPSADAPMFV+GVNH+ Y+ + + ++SNASCTTNCLAPLAK+I+D FGI E LMTTVHAVTATQKTVD PS K WR GRGAGQNIIP+STGAAKAVGKVIPELNGKLTGMAFRVPTPDVSVVDLT RL+ PA  +DI   I+   +G M+GI+ +T++ +VSTD   DT SSIFDA A I LN  FVKL+SWYDNEFGYSNRV+DLI ++
Sbjct:    3 KPSVGINGFGRIGRLVLRAAVEKDSVNVVAVNDPFISIDYMVYLFQYDSTHGRFKGTVAHEGDYLLVAKEGKSQHKIKVYNSRDPAEIQWGASGADYVVESTGVFTTIEKANAHLKGGAKKVIISAPSADAPMFVVGVNHEKYDHANDHIISNASCTTNCLAPLAKVINDNFGIIEGLMTTVHAVTATQKTVDGPSGKLWRDGRGAGQNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPTPDVSVVDLTARLEKPASLDDIKKVIKAAADGPMKGILAYTEDQVVSTDFVSDTNSSIFDAGASISLNPHFVKLVSWYDNEFGYSNRVVDLISYI 337          
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Ensembl Celegans
Match: gpd-2 (Glyceraldehyde-3-phosphate dehydrogenase 2 [Source:UniProtKB/Swiss-Prot;Acc:P17329])

HSP 1 Score: 454.907 bits (1169), Expect = 1.560e-160
Identity = 220/335 (65.67%), Postives = 269/335 (80.30%), Query Frame = 1
Query:   58 KPKVGINGFGRIGRLVLRAGLIQGKVDFVGINDPFVDVNYMVYMFKYDSTHGIYKNDVSEQDGFLVVADQ-----KIQIFMEKDPSKIPWSDVDAEYVVESSGAFTTIQSASAHLPS-AKKVIISAPSADAPMFVMGVNHQLYEKSMN-VVSNASCTTNCLAPLAKIIHDKFGIEEALMTTVHAVTATQKTVDAPSLKDWRGGRGAGQNIIPSSTGAAKAVGKVIPELNGKLTGMAFRVPTPDVSVVDLTVRLQNPAKYEDIVNAIRLECEGSMRGIMGFTDEALVSTDLCGDTRSSIFDASAGIQLNDKFVKLISWYDNEFGYSNRVIDLICHM 1041
            KP VGINGFGRIGRLVLRA + +  V+ V +NDPF+ ++YMVY+F+YDSTHG +K  V+ +  +L+VA +     KI+++  +DP++I W    A+YVVES+G FTTI+ A+AHL   AKKVIISAPSADAPMFV+GVNH+ Y+ + + ++SNASCTTNCLAPLAK+I+D FGI E LMTTVHAVTATQKTVD PS K WR GRGAGQNIIP+STGAAKAVGKVIPELNGKLTGMAFRVPTPDVSVVDLT RL+ PA  +DI   I+   +G M+GI+ +T++ +VSTD   DT SSIFDA A I LN  FVKL+SWYDNEFGYSNRV+DLI ++
Sbjct:    3 KPSVGINGFGRIGRLVLRAAVEKDSVNVVAVNDPFISIDYMVYLFQYDSTHGRFKGTVAHEGDYLLVAKEGKSQHKIKVYNSRDPAEIQWGASGADYVVESTGVFTTIEKANAHLKGGAKKVIISAPSADAPMFVVGVNHEKYDHANDHIISNASCTTNCLAPLAKVINDNFGIIEGLMTTVHAVTATQKTVDGPSGKLWRDGRGAGQNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPTPDVSVVDLTARLEKPASLDDIKKVIKAAADGPMKGILAYTEDQVVSTDFVSDTNSSIFDAGASISLNPHFVKLVSWYDNEFGYSNRVVDLISYI 337          
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Ensembl Celegans
Match: gpd-1 (Glyceraldehyde-3-phosphate dehydrogenase 1 [Source:UniProtKB/Swiss-Prot;Acc:P04970])

HSP 1 Score: 449.129 bits (1154), Expect = 4.068e-158
Identity = 222/335 (66.27%), Postives = 264/335 (78.81%), Query Frame = 1
Query:   58 KPKVGINGFGRIGRLVLRAGLIQGKVDFVGINDPFVDVNYMVYMFKYDSTHGIYKNDVSEQDGFLVV-----ADQKIQIFMEKDPSKIPWSDVDAEYVVESSGAFTTIQSASAHLPS-AKKVIISAPSADAPMFVMGVNHQLYEKSMN-VVSNASCTTNCLAPLAKIIHDKFGIEEALMTTVHAVTATQKTVDAPSLKDWRGGRGAGQNIIPSSTGAAKAVGKVIPELNGKLTGMAFRVPTPDVSVVDLTVRLQNPAKYEDIVNAIRLECEGSMRGIMGFTDEALVSTDLCGDTRSSIFDASAGIQLNDKFVKLISWYDNEFGYSNRVIDLICHM 1041
            K  VGINGFGRIGRLVLRA + +  V  V +NDPF+ ++YMVY+FKYDSTHG +K  V+    FL+V     +  KI++F  KDP+ I W  V A++VVES+G FTT + ASAHL   AKKVIISAPSADAPM+V+GVNH+ Y+ S + VVSNASCTTNCLAPLAK+I+D FGI E LMTTVHAVTATQKTVD PS K WR GRGAGQNIIP+STGAAKAVGKVIPELNGKLTGMAFRVPTPDVSVVDLTVRL+ PA  +DI   ++   +G M+GI+ +T++ +VSTD   D  SSIFDA A I LN  FVKL+SWYDNE+GYSNRV+DLI ++
Sbjct:    3 KANVGINGFGRIGRLVLRAAVEKDTVQVVAVNDPFITIDYMVYLFKYDSTHGQFKGTVTYDGDFLIVQKDGKSSHKIKVFNSKDPAAIAWGSVKADFVVESTGVFTTKEKASAHLQGGAKKVIISAPSADAPMYVVGVNHEKYDASNDHVVSNASCTTNCLAPLAKVINDNFGIIEGLMTTVHAVTATQKTVDGPSGKLWRDGRGAGQNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPTPDVSVVDLTVRLEKPASMDDIKKVVKAAADGPMKGILAYTEDQVVSTDFVSDPHSSIFDAGACISLNPNFVKLVSWYDNEYGYSNRVVDLIGYI 337          
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Ensembl Fly
Match: Gapdh2 (gene:FBgn0001092 transcript:FBtr0074112)

HSP 1 Score: 466.463 bits (1199), Expect = 5.000e-165
Identity = 230/331 (69.49%), Postives = 263/331 (79.46%), Query Frame = 1
Query:   64 KVGINGFGRIGRLVLRAGLIQGKVDFVGINDPFVDVNYMVYMFKYDSTHGIYKNDVSEQDGFLVVADQKIQIFMEKDPSKIPWSDVDAEYVVESSGAFTTIQSASAHLPS-AKKVIISAPSADAPMFVMGVNHQLYEKSMNVVSNASCTTNCLAPLAKIIHDKFGIEEALMTTVHAVTATQKTVDAPSLKDWRGGRGAGQNIIPSSTGAAKAVGKVIPELNGKLTGMAFRVPTPDVSVVDLTVRLQNPAKYEDIVNAIRLECEGSMRGIMGFTDEALVSTDLCGDTRSSIFDASAGIQLNDKFVKLISWYDNEFGYSNRVIDLICHMYRID 1053
            K+GINGFGRIGRLVLRA + +G  + V +NDPF+DVNYMVY+FK+DSTHG +K  V+ + GFLVV  QKI +F E+DP+ I W+   AEY+VES+G FTTI  AS HL   AKKVIISAPSADAPMFV GVN   Y+  M VVSNASCTTNCLAPLAK+I+D F I E LMTTVHA TATQKTVD PS K WR GRGA QNIIP+STGAAKAVGKVIP LNGKLTGMAFRVPTP+VSVVDLTVRL   A Y++I   ++    G ++GI+G+TDE +VSTD   DT SS+FDA AGI LNDKFVKLISWYDNEFGYSNRVIDLI +M   D
Sbjct:    3 KIGINGFGRIGRLVLRAAIDKG-ANVVAVNDPFIDVNYMVYLFKFDSTHGRFKGTVAAEGGFLVVNGQKITVFSERDPANINWASAGAEYIVESTGVFTTIDKASTHLKGGAKKVIISAPSADAPMFVCGVNLDAYKPDMKVVSNASCTTNCLAPLAKVINDNFEIVEGLMTTVHATTATQKTVDGPSGKLWRDGRGAAQNIIPASTGAAKAVGKVIPALNGKLTGMAFRVPTPNVSVVDLTVRLGKGASYDEIKAKVQEAANGPLKGILGYTDEEVVSTDFLSDTHSSVFDAKAGISLNDKFVKLISWYDNEFGYSNRVIDLIKYMQSKD 332          
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Ensembl Fly
Match: Gapdh2 (gene:FBgn0001092 transcript:FBtr0332618)

HSP 1 Score: 466.463 bits (1199), Expect = 5.000e-165
Identity = 230/331 (69.49%), Postives = 263/331 (79.46%), Query Frame = 1
Query:   64 KVGINGFGRIGRLVLRAGLIQGKVDFVGINDPFVDVNYMVYMFKYDSTHGIYKNDVSEQDGFLVVADQKIQIFMEKDPSKIPWSDVDAEYVVESSGAFTTIQSASAHLPS-AKKVIISAPSADAPMFVMGVNHQLYEKSMNVVSNASCTTNCLAPLAKIIHDKFGIEEALMTTVHAVTATQKTVDAPSLKDWRGGRGAGQNIIPSSTGAAKAVGKVIPELNGKLTGMAFRVPTPDVSVVDLTVRLQNPAKYEDIVNAIRLECEGSMRGIMGFTDEALVSTDLCGDTRSSIFDASAGIQLNDKFVKLISWYDNEFGYSNRVIDLICHMYRID 1053
            K+GINGFGRIGRLVLRA + +G  + V +NDPF+DVNYMVY+FK+DSTHG +K  V+ + GFLVV  QKI +F E+DP+ I W+   AEY+VES+G FTTI  AS HL   AKKVIISAPSADAPMFV GVN   Y+  M VVSNASCTTNCLAPLAK+I+D F I E LMTTVHA TATQKTVD PS K WR GRGA QNIIP+STGAAKAVGKVIP LNGKLTGMAFRVPTP+VSVVDLTVRL   A Y++I   ++    G ++GI+G+TDE +VSTD   DT SS+FDA AGI LNDKFVKLISWYDNEFGYSNRVIDLI +M   D
Sbjct:    3 KIGINGFGRIGRLVLRAAIDKG-ANVVAVNDPFIDVNYMVYLFKFDSTHGRFKGTVAAEGGFLVVNGQKITVFSERDPANINWASAGAEYIVESTGVFTTIDKASTHLKGGAKKVIISAPSADAPMFVCGVNLDAYKPDMKVVSNASCTTNCLAPLAKVINDNFEIVEGLMTTVHATTATQKTVDGPSGKLWRDGRGAAQNIIPASTGAAKAVGKVIPALNGKLTGMAFRVPTPNVSVVDLTVRLGKGASYDEIKAKVQEAANGPLKGILGYTDEEVVSTDFLSDTHSSVFDAKAGISLNDKFVKLISWYDNEFGYSNRVIDLIKYMQSKD 332          
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Ensembl Fly
Match: Gapdh1 (gene:FBgn0001091 transcript:FBtr0100479)

HSP 1 Score: 464.151 bits (1193), Expect = 4.036e-164
Identity = 230/331 (69.49%), Postives = 261/331 (78.85%), Query Frame = 1
Query:   64 KVGINGFGRIGRLVLRAGLIQGKVDFVGINDPFVDVNYMVYMFKYDSTHGIYKNDVSEQDGFLVVADQKIQIFMEKDPSKIPWSDVDAEYVVESSGAFTTIQSASAHLPS-AKKVIISAPSADAPMFVMGVNHQLYEKSMNVVSNASCTTNCLAPLAKIIHDKFGIEEALMTTVHAVTATQKTVDAPSLKDWRGGRGAGQNIIPSSTGAAKAVGKVIPELNGKLTGMAFRVPTPDVSVVDLTVRLQNPAKYEDIVNAIRLECEGSMRGIMGFTDEALVSTDLCGDTRSSIFDASAGIQLNDKFVKLISWYDNEFGYSNRVIDLICHMYRID 1053
            K+GINGFGRIGRLVLRA + +G    V +NDPF+DVNYMVY+FK+DSTHG +K  V+ + GFLVV  QKI +F E+DP+ I W+   AEYVVES+G FTTI  AS HL   AKKVIISAPSADAPMFV GVN   Y   M VVSNASCTTNCLAPLAK+I+D F I E LMTTVHA TATQKTVD PS K WR GRGA QNIIP++TGAAKAVGKVIP LNGKLTGMAFRVPTP+VSVVDLTVRL   A Y++I   +    +G ++GI+G+TDE +VSTD   DT SS+FDA AGI LNDKFVKLISWYDNEFGYSNRVIDLI +M   D
Sbjct:    3 KIGINGFGRIGRLVLRAAIDKG-ASVVAVNDPFIDVNYMVYLFKFDSTHGRFKGTVAAEGGFLVVNGQKITVFSERDPANINWASAGAEYVVESTGVFTTIDKASTHLKGGAKKVIISAPSADAPMFVCGVNLDAYSPDMKVVSNASCTTNCLAPLAKVINDNFEIVEGLMTTVHATTATQKTVDGPSGKLWRDGRGAAQNIIPAATGAAKAVGKVIPALNGKLTGMAFRVPTPNVSVVDLTVRLGKGATYDEIKAKVEEASKGPLKGILGYTDEEVVSTDFFSDTHSSVFDAKAGISLNDKFVKLISWYDNEFGYSNRVIDLIKYMQSKD 332          
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Ensembl Fly
Match: Gapdh1 (gene:FBgn0001091 transcript:FBtr0088903)

HSP 1 Score: 464.151 bits (1193), Expect = 4.036e-164
Identity = 230/331 (69.49%), Postives = 261/331 (78.85%), Query Frame = 1
Query:   64 KVGINGFGRIGRLVLRAGLIQGKVDFVGINDPFVDVNYMVYMFKYDSTHGIYKNDVSEQDGFLVVADQKIQIFMEKDPSKIPWSDVDAEYVVESSGAFTTIQSASAHLPS-AKKVIISAPSADAPMFVMGVNHQLYEKSMNVVSNASCTTNCLAPLAKIIHDKFGIEEALMTTVHAVTATQKTVDAPSLKDWRGGRGAGQNIIPSSTGAAKAVGKVIPELNGKLTGMAFRVPTPDVSVVDLTVRLQNPAKYEDIVNAIRLECEGSMRGIMGFTDEALVSTDLCGDTRSSIFDASAGIQLNDKFVKLISWYDNEFGYSNRVIDLICHMYRID 1053
            K+GINGFGRIGRLVLRA + +G    V +NDPF+DVNYMVY+FK+DSTHG +K  V+ + GFLVV  QKI +F E+DP+ I W+   AEYVVES+G FTTI  AS HL   AKKVIISAPSADAPMFV GVN   Y   M VVSNASCTTNCLAPLAK+I+D F I E LMTTVHA TATQKTVD PS K WR GRGA QNIIP++TGAAKAVGKVIP LNGKLTGMAFRVPTP+VSVVDLTVRL   A Y++I   +    +G ++GI+G+TDE +VSTD   DT SS+FDA AGI LNDKFVKLISWYDNEFGYSNRVIDLI +M   D
Sbjct:    3 KIGINGFGRIGRLVLRAAIDKG-ASVVAVNDPFIDVNYMVYLFKFDSTHGRFKGTVAAEGGFLVVNGQKITVFSERDPANINWASAGAEYVVESTGVFTTIDKASTHLKGGAKKVIISAPSADAPMFVCGVNLDAYSPDMKVVSNASCTTNCLAPLAKVINDNFEIVEGLMTTVHATTATQKTVDGPSGKLWRDGRGAAQNIIPAATGAAKAVGKVIPALNGKLTGMAFRVPTPNVSVVDLTVRLGKGATYDEIKAKVEEASKGPLKGILGYTDEEVVSTDFFSDTHSSVFDAKAGISLNDKFVKLISWYDNEFGYSNRVIDLIKYMQSKD 332          
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Ensembl Fly
Match: CG9010 (gene:FBgn0034173 transcript:FBtr0087067)

HSP 1 Score: 400.593 bits (1028), Expect = 6.820e-139
Identity = 198/338 (58.58%), Postives = 239/338 (70.71%), Query Frame = 1
Query:   49 MSGKPKVGINGFGRIGRLVLRAGLIQGKVDFVGINDPFVDVNYMVYMFKYDSTHGIYKNDVSEQDGFLVVADQKIQIFMEKDPSKIPWSDVDAEYVVESSGAFTTIQSASAHLPS-AKKVIISAPSADAPMFVMGVNHQLYEKSMNVVSNASCTTNCLAPLAKIIHDKFGIEEALMTTVHAVTATQKTVDAPSLKDWRGGRGAGQNIIPSSTGAAKAVGKVIPELNGKLTGMAFRVPTPDVSVVDLTVRLQNPAKYEDIVNAIRLECEGSMRGIMGFTDEALVSTDLCGDTRSSIFDASAGIQLNDKFVKLISWYDNEFGYSNRVIDLICHMYRIDHT 1059
            MSG   +GINGFGRIGR+  R  L++  V  V INDP +D  Y+ YM +YDSTHG +   +S     LVV  +KIQ+  E D  KI W D+    VVE SG FTT+++   HL S AKKV+ISAPSADAPMFV GVN + Y+    ++SNASCTTNCLAPLAK++HD F I E LMTTVHA TATQK +D PS K WR GR    NIIP+STGAAKAVGKVIP+LNGKLTGMAFRVP P+VSVVDLT RL  PAK +DI   I+   +  M+GI+G+ +E +VSTD  G   +S+FDA A I LND FVKLISWYDNE GYS R++DL+ +   +D  
Sbjct:    1 MSG---IGINGFGRIGRMFARQALVRKDVKIVAINDPSLDPKYLAYMLRYDSTHGQFNQKISVDGNNLVVNGKKIQLLKESDVKKIKWCDLGVHTVVECSGRFTTLKACQGHLDSGAKKVVISAPSADAPMFVCGVNLEAYKPGTAIISNASCTTNCLAPLAKVVHDNFEICEGLMTTVHAATATQKIIDGPSSKLWRDGRSGMTNIIPASTGAAKAVGKVIPDLNGKLTGMAFRVPVPNVSVVDLTCRLSKPAKMDDIKKCIKAASKCEMKGILGYVEEEVVSTDFNGSRFASVFDAKACIALNDNFVKLISWYDNETGYSCRLLDLVLYAQLVDQC 335          
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Ensembl Zebrafish
Match: gapdh (glyceraldehyde-3-phosphate dehydrogenase [Source:NCBI gene;Acc:317743])

HSP 1 Score: 479.174 bits (1232), Expect = 5.333e-170
Identity = 227/327 (69.42%), Postives = 267/327 (81.65%), Query Frame = 1
Query:   64 KVGINGFGRIGRLVLRAGLIQGKVDFVGINDPFVDVNYMVYMFKYDSTHGIYKNDVSEQDGFLVVADQKIQIFMEKDPSKIPWSDVDAEYVVESSGAFTTIQSASAHLPS-AKKVIISAPSADAPMFVMGVNHQLYEKSMNVVSNASCTTNCLAPLAKIIHDKFGIEEALMTTVHAVTATQKTVDAPSLKDWRGGRGAGQNIIPSSTGAAKAVGKVIPELNGKLTGMAFRVPTPDVSVVDLTVRLQNPAKYEDIVNAIRLECEGSMRGIMGFTDEALVSTDLCGDTRSSIFDASAGIQLNDKFVKLISWYDNEFGYSNRVIDLICHM 1041
            KVGINGFGRIGRLV RA  +  KV+ V INDPF+D++YMVYMF+YDSTHG YK +V  + G LV+    I ++ E+DP+ I W D  A YVVES+G FTTI+ ASAH+   AK+VIISAPSADAPMFVMGVNH+ Y+ S+ VVSNASCTTNCLAPLAK+I+D F I E LM+TVHA+TATQKTVD PS K WR GRGA QNIIP+STGAAKAVGKVIPELNGKLTGMAFRVPTP+VSVVDLTVRL+ PAKY++I   ++   +G M+GI+G+T+  +VSTD  GD RSSIFDA AGI LND FVKL++WYDNEFGYSNRV DL+ HM
Sbjct:    3 KVGINGFGRIGRLVTRAAFLTKKVEIVAINDPFIDLDYMVYMFQYDSTHGKYKGEVKAEGGKLVIDGHAITVYSERDPANIKWGDAGATYVVESTGVFTTIEKASAHIKGGAKRVIISAPSADAPMFVMGVNHEKYDNSLTVVSNASCTTNCLAPLAKVINDNFVIVEGLMSTVHAITATQKTVDGPSGKLWRDGRGASQNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPTPNVSVVDLTVRLEKPAKYDEIKKVVKAAADGPMKGILGYTEHQVVSTDFNGDCRSSIFDAGAGIALNDHFVKLVTWYDNEFGYSNRVCDLMAHM 329          
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Ensembl Zebrafish
Match: gapdh (glyceraldehyde-3-phosphate dehydrogenase [Source:NCBI gene;Acc:317743])

HSP 1 Score: 479.174 bits (1232), Expect = 5.333e-170
Identity = 227/327 (69.42%), Postives = 267/327 (81.65%), Query Frame = 1
Query:   64 KVGINGFGRIGRLVLRAGLIQGKVDFVGINDPFVDVNYMVYMFKYDSTHGIYKNDVSEQDGFLVVADQKIQIFMEKDPSKIPWSDVDAEYVVESSGAFTTIQSASAHLPS-AKKVIISAPSADAPMFVMGVNHQLYEKSMNVVSNASCTTNCLAPLAKIIHDKFGIEEALMTTVHAVTATQKTVDAPSLKDWRGGRGAGQNIIPSSTGAAKAVGKVIPELNGKLTGMAFRVPTPDVSVVDLTVRLQNPAKYEDIVNAIRLECEGSMRGIMGFTDEALVSTDLCGDTRSSIFDASAGIQLNDKFVKLISWYDNEFGYSNRVIDLICHM 1041
            KVGINGFGRIGRLV RA  +  KV+ V INDPF+D++YMVYMF+YDSTHG YK +V  + G LV+    I ++ E+DP+ I W D  A YVVES+G FTTI+ ASAH+   AK+VIISAPSADAPMFVMGVNH+ Y+ S+ VVSNASCTTNCLAPLAK+I+D F I E LM+TVHA+TATQKTVD PS K WR GRGA QNIIP+STGAAKAVGKVIPELNGKLTGMAFRVPTP+VSVVDLTVRL+ PAKY++I   ++   +G M+GI+G+T+  +VSTD  GD RSSIFDA AGI LND FVKL++WYDNEFGYSNRV DL+ HM
Sbjct:    3 KVGINGFGRIGRLVTRAAFLTKKVEIVAINDPFIDLDYMVYMFQYDSTHGKYKGEVKAEGGKLVIDGHAITVYSERDPANIKWGDAGATYVVESTGVFTTIEKASAHIKGGAKRVIISAPSADAPMFVMGVNHEKYDNSLTVVSNASCTTNCLAPLAKVINDNFVIVEGLMSTVHAITATQKTVDGPSGKLWRDGRGASQNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPTPNVSVVDLTVRLEKPAKYDEIKKVVKAAADGPMKGILGYTEHQVVSTDFNGDCRSSIFDAGAGIALNDHFVKLVTWYDNEFGYSNRVCDLMAHM 329          
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Ensembl Zebrafish
Match: gapdhs (glyceraldehyde-3-phosphate dehydrogenase, spermatogenic [Source:NCBI gene;Acc:406367])

HSP 1 Score: 457.988 bits (1177), Expect = 1.816e-161
Identity = 224/328 (68.29%), Postives = 260/328 (79.27%), Query Frame = 1
Query:   67 VGINGFGRIGRLVLRAGLIQGKVDFVGINDPFVDVNYMVYMFKYDSTHGIYKNDVSEQDGFLVVADQKIQIFMEKDPSKIPWSDVDAEYVVESSGAFTTIQSASAHLPS-AKKVIISAPSADAPMFVMGVNHQLYE-KSMNVVSNASCTTNCLAPLAKIIHDKFGIEEALMTTVHAVTATQKTVDAPSLKDWRGGRGAGQNIIPSSTGAAKAVGKVIPELNGKLTGMAFRVPTPDVSVVDLTVRLQNPAKYEDIVNAIRLECEGSMRGIMGFTDEALVSTDLCGDTRSSIFDASAGIQLNDKFVKLISWYDNEFGYSNRVIDLICHMY 1044
            VGINGFGRIGRLVLRA L +G +    INDPF+D+ YMVYMFKYDSTHG YK +V  +DG L+V  Q I +F    P++IPW D  A YVVES+G F +I  ASAH+   AK+V++SAPS DAPMFVMGVN   Y+  SM +VSNASCTTNCLAPLAK+IHD FGIEEALMTTVHA TATQKTVD PS K WR GRGA QNIIP+STGAAKAVGKVIPELNGKLTGMAFRVP  DVSVVDLT RL  PA Y +I  +++    G M+GI+G+T++++VS+D  GDT SSIFDA AGI LND FVKLISWYDNEFGYS+RV DL+ +M+
Sbjct:    6 VGINGFGRIGRLVLRACLQKG-IKVTAINDPFIDLQYMVYMFKYDSTHGRYKGEVHMEDGKLIVDGQAISVFQCMKPAEIPWGDAGALYVVESTGVFLSIDKASAHIQGGAKRVVVSAPSPDAPMFVMGVNQDKYDPSSMTIVSNASCTTNCLAPLAKVIHDNFGIEEALMTTVHAYTATQKTVDGPSAKAWRDGRGAHQNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPVADVSVVDLTCRLTRPASYANIKESVKKAAHGPMKGILGYTEDSVVSSDFVGDTHSSIFDAGAGISLNDNFVKLISWYDNEFGYSHRVADLLMYMH 332          
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Ensembl Zebrafish
Match: gapdhs (glyceraldehyde-3-phosphate dehydrogenase, spermatogenic [Source:NCBI gene;Acc:406367])

HSP 1 Score: 457.988 bits (1177), Expect = 1.816e-161
Identity = 224/328 (68.29%), Postives = 260/328 (79.27%), Query Frame = 1
Query:   67 VGINGFGRIGRLVLRAGLIQGKVDFVGINDPFVDVNYMVYMFKYDSTHGIYKNDVSEQDGFLVVADQKIQIFMEKDPSKIPWSDVDAEYVVESSGAFTTIQSASAHLPS-AKKVIISAPSADAPMFVMGVNHQLYE-KSMNVVSNASCTTNCLAPLAKIIHDKFGIEEALMTTVHAVTATQKTVDAPSLKDWRGGRGAGQNIIPSSTGAAKAVGKVIPELNGKLTGMAFRVPTPDVSVVDLTVRLQNPAKYEDIVNAIRLECEGSMRGIMGFTDEALVSTDLCGDTRSSIFDASAGIQLNDKFVKLISWYDNEFGYSNRVIDLICHMY 1044
            VGINGFGRIGRLVLRA L +G +    INDPF+D+ YMVYMFKYDSTHG YK +V  +DG L+V  Q I +F    P++IPW D  A YVVES+G F +I  ASAH+   AK+V++SAPS DAPMFVMGVN   Y+  SM +VSNASCTTNCLAPLAK+IHD FGIEEALMTTVHA TATQKTVD PS K WR GRGA QNIIP+STGAAKAVGKVIPELNGKLTGMAFRVP  DVSVVDLT RL  PA Y +I  +++    G M+GI+G+T++++VS+D  GDT SSIFDA AGI LND FVKLISWYDNEFGYS+RV DL+ +M+
Sbjct:    6 VGINGFGRIGRLVLRACLQKG-IKVTAINDPFIDLQYMVYMFKYDSTHGRYKGEVHMEDGKLIVDGQAISVFQCMKPAEIPWGDAGALYVVESTGVFLSIDKASAHIQGGAKRVVVSAPSPDAPMFVMGVNQDKYDPSSMTIVSNASCTTNCLAPLAKVIHDNFGIEEALMTTVHAYTATQKTVDGPSAKAWRDGRGAHQNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPVADVSVVDLTCRLTRPASYANIKESVKKAAHGPMKGILGYTEDSVVSSDFVGDTHSSIFDAGAGISLNDNFVKLISWYDNEFGYSHRVADLLMYMH 332          
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Ensembl Zebrafish
Match: gapdh (glyceraldehyde-3-phosphate dehydrogenase [Source:NCBI gene;Acc:317743])

HSP 1 Score: 352.443 bits (903), Expect = 2.180e-121
Identity = 169/237 (71.31%), Postives = 195/237 (82.28%), Query Frame = 1
Query:   64 KVGINGFGRIGRLVLRAGLIQGKVDFVGINDPFVDVNYMVYMFKYDSTHGIYKNDVSEQDGFLVVADQKIQIFMEKDPSKIPWSDVDAEYVVESSGAFTTIQSASAHLPS-AKKVIISAPSADAPMFVMGVNHQLYEKSMNVVSNASCTTNCLAPLAKIIHDKFGIEEALMTTVHAVTATQKTVDAPSLKDWRGGRGAGQNIIPSSTGAAKAVGKVIPELNGKLTGMAFRVPTPDVS 771
            KVGINGFGRIGRLV RA  +  KV+ V INDPF+D++YMVYMF+YDSTHG YK +V  + G LV+    I ++ E+DP+ I W D  A YVVES+G FTTI+ ASAH+   AK+VIISAPSADAPMFVMGVNH+ Y+ S+ VVSNASCTTNCLAPLAK+I+D F I E LM+TVHA+TATQKTVD PS K WR GRGA QNIIP+STGAAKAVGKVIPELNGKLTGMAFRVPTP+VS
Sbjct:    3 KVGINGFGRIGRLVTRAAFLTKKVEIVAINDPFIDLDYMVYMFQYDSTHGKYKGEVKAEGGKLVIDGHAITVYSERDPANIKWGDAGATYVVESTGVFTTIEKASAHIKGGAKRVIISAPSADAPMFVMGVNHEKYDNSLTVVSNASCTTNCLAPLAKVINDNFVIVEGLMSTVHAITATQKTVDGPSGKLWRDGRGASQNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPTPNVS 239          
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Ensembl Xenopus
Match: mbd3 (methyl-CpG binding domain protein 3 [Source:Xenbase;Acc:XB-GENE-491553])

HSP 1 Score: 474.552 bits (1220), Expect = 6.466e-168
Identity = 227/327 (69.42%), Postives = 265/327 (81.04%), Query Frame = 1
Query:   64 KVGINGFGRIGRLVLRAGLIQGKVDFVGINDPFVDVNYMVYMFKYDSTHGIYKNDVSEQDGFLVVADQKIQIFMEKDPSKIPWSDVDAEYVVESSGAFTTIQSASAHLPS-AKKVIISAPSADAPMFVMGVNHQLYEKSMNVVSNASCTTNCLAPLAKIIHDKFGIEEALMTTVHAVTATQKTVDAPSLKDWRGGRGAGQNIIPSSTGAAKAVGKVIPELNGKLTGMAFRVPTPDVSVVDLTVRLQNPAKYEDIVNAIRLECEGSMRGIMGFTDEALVSTDLCGDTRSSIFDASAGIQLNDKFVKLISWYDNEFGYSNRVIDLICHM 1041
            K+GINGFGRIGRLV RA ++ GK + V INDPF+D++YM YMFKYDSTHG +K  V  ++G LV+  + + +F E+DPS I W D  A YVVES+G FTT + A  HL   AK+VIISAPSADAPMFV+GVNH  Y+ S++VVSNASCTTNCLAPLAK+I+D FGI E LMTTVHA TATQKTVD PS K WR GRGAGQNIIP+STGAAKAVGKVIPELNGKLTGMAFRVPTP+VSVVDLT RL  PAKY+DI  AI+    G M+GI+ +T++ +VSTD  GDT SSIFDA AGI LND FVKL+SWYDNE GYS+RV+DL+CHM
Sbjct:    4 KIGINGFGRIGRLVTRAAVLSGKCEVVAINDPFIDLDYMAYMFKYDSTHGRFKGTVCVENGKLVINGKAVTVFQERDPSNIKWGDAGAVYVVESTGVFTTKEKAGLHLKGGAKRVIISAPSADAPMFVVGVNHDKYDNSLHVVSNASCTTNCLAPLAKVINDNFGILEGLMTTVHAFTATQKTVDGPSGKLWRDGRGAGQNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPTPNVSVVDLTCRLSKPAKYDDIKAAIKTAAHGPMKGILEYTEDQVVSTDFNGDTHSSIFDAGAGIALNDNFVKLVSWYDNECGYSHRVVDLMCHM 330          
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Ensembl Xenopus
Match: mbd3 (methyl-CpG binding domain protein 3 [Source:Xenbase;Acc:XB-GENE-491553])

HSP 1 Score: 464.151 bits (1193), Expect = 7.532e-164
Identity = 222/321 (69.16%), Postives = 259/321 (80.69%), Query Frame = 1
Query:   82 FGRIGRLVLRAGLIQGKVDFVGINDPFVDVNYMVYMFKYDSTHGIYKNDVSEQDGFLVVADQKIQIFMEKDPSKIPWSDVDAEYVVESSGAFTTIQSASAHLPS-AKKVIISAPSADAPMFVMGVNHQLYEKSMNVVSNASCTTNCLAPLAKIIHDKFGIEEALMTTVHAVTATQKTVDAPSLKDWRGGRGAGQNIIPSSTGAAKAVGKVIPELNGKLTGMAFRVPTPDVSVVDLTVRLQNPAKYEDIVNAIRLECEGSMRGIMGFTDEALVSTDLCGDTRSSIFDASAGIQLNDKFVKLISWYDNEFGYSNRVIDLICHM 1041
            FGRIGRLV RA ++ GK + V INDPF+D++YM YMFKYDSTHG +K  V  ++G LV+  + + +F E+DPS I W D  A YVVES+G FTT + A  HL   AK+VIISAPSADAPMFV+GVNH  Y+ S++VVSNASCTTNCLAPLAK+I+D FGI E LMTTVHA TATQKTVD PS K WR GRGAGQNIIP+STGAAKAVGKVIPELNGKLTGMAFRVPTP+VSVVDLT RL  PAKY+DI  AI+    G M+GI+ +T++ +VSTD  GDT SSIFDA AGI LND FVKL+SWYDNE GYS+RV+DL+CHM
Sbjct:    7 FGRIGRLVTRAAVLSGKCEVVAINDPFIDLDYMAYMFKYDSTHGRFKGTVCVENGKLVINGKAVTVFQERDPSNIKWGDAGAVYVVESTGVFTTKEKAGLHLKGGAKRVIISAPSADAPMFVVGVNHDKYDNSLHVVSNASCTTNCLAPLAKVINDNFGILEGLMTTVHAFTATQKTVDGPSGKLWRDGRGAGQNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPTPNVSVVDLTCRLSKPAKYDDIKAAIKTAAHGPMKGILEYTEDQVVSTDFNGDTHSSIFDAGAGIALNDNFVKLVSWYDNECGYSHRVVDLMCHM 327          
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Ensembl Xenopus
Match: mbd3 (methyl-CpG binding domain protein 3 [Source:Xenbase;Acc:XB-GENE-491553])

HSP 1 Score: 464.151 bits (1193), Expect = 1.224e-163
Identity = 225/329 (68.39%), Postives = 262/329 (79.64%), Query Frame = 1
Query:   58 KPKVGINGFGRIGRLVLRAGLIQGKVDFVGINDPFVDVNYMVYMFKYDSTHGIYKNDVSEQDGFLVVADQKIQIFMEKDPSKIPWSDVDAEYVVESSGAFTTIQSASAHLPS-AKKVIISAPSADAPMFVMGVNHQLYEKSMNVVSNASCTTNCLAPLAKIIHDKFGIEEALMTTVHAVTATQKTVDAPSLKDWRGGRGAGQNIIPSSTGAAKAVGKVIPELNGKLTGMAFRVPTPDVSVVDLTVRLQNPAKYEDIVNAIRLECEGSMRGIMGFTDEALVSTDLCGDTRSSIFDASAGIQLNDKFVKLISWYDNEFGYSNRVIDLICHM 1041
            KP    N FGRIGRLV RA ++ GK + V INDPF+D++YM YMFKYDSTHG +K  V  ++G LV+  + + +F E+DPS I W D  A YVVES+G FTT + A  HL   AK+VIISAPSADAPMFV+GVNH  Y+ S++VVSNASCTTNCLAPLAK+I+D FGI E LMTTVHA TATQKTVD PS K WR GRGAGQNIIP+STGAAKAVGKVIPELNGKLTGMAFRVPTP+VSVVDLT RL  PAKY+DI  AI+    G M+GI+ +T++ +VSTD  GDT SSIFDA AGI LND FVKL+SWYDNE GYS+RV+DL+CHM
Sbjct:   12 KPTNEGNQFGRIGRLVTRAAVLSGKCEVVAINDPFIDLDYMAYMFKYDSTHGRFKGTVCVENGKLVINGKAVTVFQERDPSNIKWGDAGAVYVVESTGVFTTKEKAGLHLKGGAKRVIISAPSADAPMFVVGVNHDKYDNSLHVVSNASCTTNCLAPLAKVINDNFGILEGLMTTVHAFTATQKTVDGPSGKLWRDGRGAGQNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPTPNVSVVDLTCRLSKPAKYDDIKAAIKTAAHGPMKGILEYTEDQVVSTDFNGDTHSSIFDAGAGIALNDNFVKLVSWYDNECGYSHRVVDLMCHM 340          
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Ensembl Xenopus
Match: mbd3 (methyl-CpG binding domain protein 3 [Source:Xenbase;Acc:XB-GENE-491553])

HSP 1 Score: 463.766 bits (1192), Expect = 1.462e-163
Identity = 222/321 (69.16%), Postives = 259/321 (80.69%), Query Frame = 1
Query:   82 FGRIGRLVLRAGLIQGKVDFVGINDPFVDVNYMVYMFKYDSTHGIYKNDVSEQDGFLVVADQKIQIFMEKDPSKIPWSDVDAEYVVESSGAFTTIQSASAHLPS-AKKVIISAPSADAPMFVMGVNHQLYEKSMNVVSNASCTTNCLAPLAKIIHDKFGIEEALMTTVHAVTATQKTVDAPSLKDWRGGRGAGQNIIPSSTGAAKAVGKVIPELNGKLTGMAFRVPTPDVSVVDLTVRLQNPAKYEDIVNAIRLECEGSMRGIMGFTDEALVSTDLCGDTRSSIFDASAGIQLNDKFVKLISWYDNEFGYSNRVIDLICHM 1041
            FGRIGRLV RA ++ GK + V INDPF+D++YM YMFKYDSTHG +K  V  ++G LV+  + + +F E+DPS I W D  A YVVES+G FTT + A  HL   AK+VIISAPSADAPMFV+GVNH  Y+ S++VVSNASCTTNCLAPLAK+I+D FGI E LMTTVHA TATQKTVD PS K WR GRGAGQNIIP+STGAAKAVGKVIPELNGKLTGMAFRVPTP+VSVVDLT RL  PAKY+DI  AI+    G M+GI+ +T++ +VSTD  GDT SSIFDA AGI LND FVKL+SWYDNE GYS+RV+DL+CHM
Sbjct:   17 FGRIGRLVTRAAVLSGKCEVVAINDPFIDLDYMAYMFKYDSTHGRFKGTVCVENGKLVINGKAVTVFQERDPSNIKWGDAGAVYVVESTGVFTTKEKAGLHLKGGAKRVIISAPSADAPMFVVGVNHDKYDNSLHVVSNASCTTNCLAPLAKVINDNFGILEGLMTTVHAFTATQKTVDGPSGKLWRDGRGAGQNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPTPNVSVVDLTCRLSKPAKYDDIKAAIKTAAHGPMKGILEYTEDQVVSTDFNGDTHSSIFDAGAGIALNDNFVKLVSWYDNECGYSHRVVDLMCHM 337          
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Ensembl Xenopus
Match: mbd3 (methyl-CpG binding domain protein 3 [Source:Xenbase;Acc:XB-GENE-491553])

HSP 1 Score: 464.151 bits (1193), Expect = 2.305e-163
Identity = 222/321 (69.16%), Postives = 259/321 (80.69%), Query Frame = 1
Query:   82 FGRIGRLVLRAGLIQGKVDFVGINDPFVDVNYMVYMFKYDSTHGIYKNDVSEQDGFLVVADQKIQIFMEKDPSKIPWSDVDAEYVVESSGAFTTIQSASAHLPS-AKKVIISAPSADAPMFVMGVNHQLYEKSMNVVSNASCTTNCLAPLAKIIHDKFGIEEALMTTVHAVTATQKTVDAPSLKDWRGGRGAGQNIIPSSTGAAKAVGKVIPELNGKLTGMAFRVPTPDVSVVDLTVRLQNPAKYEDIVNAIRLECEGSMRGIMGFTDEALVSTDLCGDTRSSIFDASAGIQLNDKFVKLISWYDNEFGYSNRVIDLICHM 1041
            FGRIGRLV RA ++ GK + V INDPF+D++YM YMFKYDSTHG +K  V  ++G LV+  + + +F E+DPS I W D  A YVVES+G FTT + A  HL   AK+VIISAPSADAPMFV+GVNH  Y+ S++VVSNASCTTNCLAPLAK+I+D FGI E LMTTVHA TATQKTVD PS K WR GRGAGQNIIP+STGAAKAVGKVIPELNGKLTGMAFRVPTP+VSVVDLT RL  PAKY+DI  AI+    G M+GI+ +T++ +VSTD  GDT SSIFDA AGI LND FVKL+SWYDNE GYS+RV+DL+CHM
Sbjct:   40 FGRIGRLVTRAAVLSGKCEVVAINDPFIDLDYMAYMFKYDSTHGRFKGTVCVENGKLVINGKAVTVFQERDPSNIKWGDAGAVYVVESTGVFTTKEKAGLHLKGGAKRVIISAPSADAPMFVVGVNHDKYDNSLHVVSNASCTTNCLAPLAKVINDNFGILEGLMTTVHAFTATQKTVDGPSGKLWRDGRGAGQNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPTPNVSVVDLTCRLSKPAKYDDIKAAIKTAAHGPMKGILEYTEDQVVSTDFNGDTHSSIFDAGAGIALNDNFVKLVSWYDNECGYSHRVVDLMCHM 360          
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Ensembl Mouse
Match: Gm3839 (predicted pseudogene 3839 [Source:MGI Symbol;Acc:MGI:3782011])

HSP 1 Score: 479.559 bits (1233), Expect = 4.525e-170
Identity = 224/327 (68.50%), Postives = 268/327 (81.96%), Query Frame = 1
Query:   64 KVGINGFGRIGRLVLRAGLIQGKVDFVGINDPFVDVNYMVYMFKYDSTHGIYKNDVSEQDGFLVVADQKIQIFMEKDPSKIPWSDVDAEYVVESSGAFTTIQSASAHLPS-AKKVIISAPSADAPMFVMGVNHQLYEKSMNVVSNASCTTNCLAPLAKIIHDKFGIEEALMTTVHAVTATQKTVDAPSLKDWRGGRGAGQNIIPSSTGAAKAVGKVIPELNGKLTGMAFRVPTPDVSVVDLTVRLQNPAKYEDIVNAIRLECEGSMRGIMGFTDEALVSTDLCGDTRSSIFDASAGIQLNDKFVKLISWYDNEFGYSNRVIDLICHM 1041
            KVG+NGFGRIGRLV RA +  GKV+ V INDPF+D+NYMVYMF+YDSTHG +   V  ++G LV+  + I IF E+DP+ I W +  AEYVVES+G FTT++ A AHL   AK+VIISAPSADAPMFVMGVNH+ Y+ S+ +VSNASCTTNCL+PLAK+IHD FGI E LMTTVHA+TATQKTVD PS K WR GRGA QNIIP+STGAAKAVGKVIPELNGKLTGMAFRVPTP+VSVVDLT RL+NPAKY+DI   ++   EG ++GI+G+T++ +VS D   ++ SS FDA AGI LND FVKLISWYDNE+GYSNRV+DL+ +M
Sbjct:    3 KVGVNGFGRIGRLVTRAAICSGKVEIVAINDPFIDLNYMVYMFQYDSTHGKFNGTVKAENGKLVINGKPITIFQERDPTNIKWGEAGAEYVVESTGVFTTMEKAGAHLKGGAKRVIISAPSADAPMFVMGVNHEKYDNSLKIVSNASCTTNCLSPLAKVIHDNFGIVEGLMTTVHAITATQKTVDGPSGKLWRDGRGAAQNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPTPNVSVVDLTCRLENPAKYDDIKKVVKQASEGPLKGILGYTEDQVVSCDFNSNSHSSTFDAGAGIALNDNFVKLISWYDNEYGYSNRVVDLMAYM 329          
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Ensembl Mouse
Match: Gapdh (glyceraldehyde-3-phosphate dehydrogenase [Source:MGI Symbol;Acc:MGI:95640])

HSP 1 Score: 478.404 bits (1230), Expect = 1.442e-169
Identity = 224/327 (68.50%), Postives = 267/327 (81.65%), Query Frame = 1
Query:   64 KVGINGFGRIGRLVLRAGLIQGKVDFVGINDPFVDVNYMVYMFKYDSTHGIYKNDVSEQDGFLVVADQKIQIFMEKDPSKIPWSDVDAEYVVESSGAFTTIQSASAHLPS-AKKVIISAPSADAPMFVMGVNHQLYEKSMNVVSNASCTTNCLAPLAKIIHDKFGIEEALMTTVHAVTATQKTVDAPSLKDWRGGRGAGQNIIPSSTGAAKAVGKVIPELNGKLTGMAFRVPTPDVSVVDLTVRLQNPAKYEDIVNAIRLECEGSMRGIMGFTDEALVSTDLCGDTRSSIFDASAGIQLNDKFVKLISWYDNEFGYSNRVIDLICHM 1041
            KVG+NGFGRIGRLV RA +  GKV+ V INDPF+D+NYMVYMF+YDSTHG +   V  ++G LV+  + I IF E+DP+ I W +  AEYVVES+G FTT++ A AHL   AK+VIISAPSADAPMFVMGVNH+ Y+ S+ +VSNASCTTNCLAPLAK+IHD FGI E LMTTVHA+TATQKTVD PS K WR GRGA QNIIP+STGAAKAVGKVIPELNGKLTGMAFRVPTP+VSVVDLT RL+ PAKY+DI   ++   EG ++GI+G+T++ +VS D   ++ SS FDA AGI LND FVKLISWYDNE+GYSNRV+DL+ +M
Sbjct:    3 KVGVNGFGRIGRLVTRAAICSGKVEIVAINDPFIDLNYMVYMFQYDSTHGKFNGTVKAENGKLVINGKPITIFQERDPTNIKWGEAGAEYVVESTGVFTTMEKAGAHLKGGAKRVIISAPSADAPMFVMGVNHEKYDNSLKIVSNASCTTNCLAPLAKVIHDNFGIVEGLMTTVHAITATQKTVDGPSGKLWRDGRGAAQNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPTPNVSVVDLTCRLEKPAKYDDIKKVVKQASEGPLKGILGYTEDQVVSCDFNSNSHSSTFDAGAGIALNDNFVKLISWYDNEYGYSNRVVDLMAYM 329          
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Ensembl Mouse
Match: Gapdh (glyceraldehyde-3-phosphate dehydrogenase [Source:MGI Symbol;Acc:MGI:95640])

HSP 1 Score: 478.404 bits (1230), Expect = 1.442e-169
Identity = 224/327 (68.50%), Postives = 267/327 (81.65%), Query Frame = 1
Query:   64 KVGINGFGRIGRLVLRAGLIQGKVDFVGINDPFVDVNYMVYMFKYDSTHGIYKNDVSEQDGFLVVADQKIQIFMEKDPSKIPWSDVDAEYVVESSGAFTTIQSASAHLPS-AKKVIISAPSADAPMFVMGVNHQLYEKSMNVVSNASCTTNCLAPLAKIIHDKFGIEEALMTTVHAVTATQKTVDAPSLKDWRGGRGAGQNIIPSSTGAAKAVGKVIPELNGKLTGMAFRVPTPDVSVVDLTVRLQNPAKYEDIVNAIRLECEGSMRGIMGFTDEALVSTDLCGDTRSSIFDASAGIQLNDKFVKLISWYDNEFGYSNRVIDLICHM 1041
            KVG+NGFGRIGRLV RA +  GKV+ V INDPF+D+NYMVYMF+YDSTHG +   V  ++G LV+  + I IF E+DP+ I W +  AEYVVES+G FTT++ A AHL   AK+VIISAPSADAPMFVMGVNH+ Y+ S+ +VSNASCTTNCLAPLAK+IHD FGI E LMTTVHA+TATQKTVD PS K WR GRGA QNIIP+STGAAKAVGKVIPELNGKLTGMAFRVPTP+VSVVDLT RL+ PAKY+DI   ++   EG ++GI+G+T++ +VS D   ++ SS FDA AGI LND FVKLISWYDNE+GYSNRV+DL+ +M
Sbjct:    3 KVGVNGFGRIGRLVTRAAICSGKVEIVAINDPFIDLNYMVYMFQYDSTHGKFNGTVKAENGKLVINGKPITIFQERDPTNIKWGEAGAEYVVESTGVFTTMEKAGAHLKGGAKRVIISAPSADAPMFVMGVNHEKYDNSLKIVSNASCTTNCLAPLAKVIHDNFGIVEGLMTTVHAITATQKTVDGPSGKLWRDGRGAAQNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPTPNVSVVDLTCRLEKPAKYDDIKKVVKQASEGPLKGILGYTEDQVVSCDFNSNSHSSTFDAGAGIALNDNFVKLISWYDNEYGYSNRVVDLMAYM 329          
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Ensembl Mouse
Match: Gm10358 (predicted gene 10358 [Source:MGI Symbol;Acc:MGI:3708786])

HSP 1 Score: 476.863 bits (1226), Expect = 5.301e-169
Identity = 223/327 (68.20%), Postives = 266/327 (81.35%), Query Frame = 1
Query:   64 KVGINGFGRIGRLVLRAGLIQGKVDFVGINDPFVDVNYMVYMFKYDSTHGIYKNDVSEQDGFLVVADQKIQIFMEKDPSKIPWSDVDAEYVVESSGAFTTIQSASAHLPS-AKKVIISAPSADAPMFVMGVNHQLYEKSMNVVSNASCTTNCLAPLAKIIHDKFGIEEALMTTVHAVTATQKTVDAPSLKDWRGGRGAGQNIIPSSTGAAKAVGKVIPELNGKLTGMAFRVPTPDVSVVDLTVRLQNPAKYEDIVNAIRLECEGSMRGIMGFTDEALVSTDLCGDTRSSIFDASAGIQLNDKFVKLISWYDNEFGYSNRVIDLICHM 1041
            KVG+NGFGRIGRLV RA    GKV+ V INDPF+D+NYMVYMF+YDSTHG +   V  ++G LV+  + I IF E+DP+ I W +  AEYVVES+G FTT++ A AHL   AK+VIISAPSADAPMFVMGVNH+ Y+ S+ +VSNASCTTNCLAPLAK+IHD FGI E LMTTVHA+TATQKTVD PS K WR GRGA QNIIP+STGAAKAVGKVIPELNGKLTGMAFRVPTP+VS+VDLT RL+ PAKY+DI   ++   EG ++GI+G+T++ +VS D   ++ SS FDA AGI LND FVKLISWYDNE+GYSNRV+DL+ +M
Sbjct:    3 KVGVNGFGRIGRLVTRAATCSGKVEIVAINDPFIDLNYMVYMFQYDSTHGKFNGTVKAENGKLVINGKPITIFQERDPTNIKWGEAGAEYVVESTGVFTTMEKAGAHLKGGAKRVIISAPSADAPMFVMGVNHEKYDNSLKIVSNASCTTNCLAPLAKVIHDNFGIVEGLMTTVHAITATQKTVDGPSGKLWRDGRGAAQNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPTPNVSIVDLTCRLEKPAKYDDIKKVVKQASEGPLKGILGYTEDQVVSCDFNSNSHSSTFDAGAGIALNDNFVKLISWYDNEYGYSNRVVDLMAYM 329          
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Ensembl Mouse
Match: Gapdh (glyceraldehyde-3-phosphate dehydrogenase [Source:MGI Symbol;Acc:MGI:95640])

HSP 1 Score: 477.248 bits (1227), Expect = 9.056e-169
Identity = 224/327 (68.50%), Postives = 267/327 (81.65%), Query Frame = 1
Query:   64 KVGINGFGRIGRLVLRAGLIQGKVDFVGINDPFVDVNYMVYMFKYDSTHGIYKNDVSEQDGFLVVADQKIQIFMEKDPSKIPWSDVDAEYVVESSGAFTTIQSASAHLPS-AKKVIISAPSADAPMFVMGVNHQLYEKSMNVVSNASCTTNCLAPLAKIIHDKFGIEEALMTTVHAVTATQKTVDAPSLKDWRGGRGAGQNIIPSSTGAAKAVGKVIPELNGKLTGMAFRVPTPDVSVVDLTVRLQNPAKYEDIVNAIRLECEGSMRGIMGFTDEALVSTDLCGDTRSSIFDASAGIQLNDKFVKLISWYDNEFGYSNRVIDLICHM 1041
            KVG+NGFGRIGRLV RA +  GKV+ V INDPF+D+NYMVYMF+YDSTHG +   V  ++G LV+  + I IF E+DP+ I W +  AEYVVES+G FTT++ A AHL   AK+VIISAPSADAPMFVMGVNH+ Y+ S+ +VSNASCTTNCLAPLAK+IHD FGI E LMTTVHA+TATQKTVD PS K WR GRGA QNIIP+STGAAKAVGKVIPELNGKLTGMAFRVPTP+VSVVDLT RL+ PAKY+DI   ++   EG ++GI+G+T++ +VS D   ++ SS FDA AGI LND FVKLISWYDNE+GYSNRV+DL+ +M
Sbjct:   29 KVGVNGFGRIGRLVTRAAICSGKVEIVAINDPFIDLNYMVYMFQYDSTHGKFNGTVKAENGKLVINGKPITIFQERDPTNIKWGEAGAEYVVESTGVFTTMEKAGAHLKGGAKRVIISAPSADAPMFVMGVNHEKYDNSLKIVSNASCTTNCLAPLAKVIHDNFGIVEGLMTTVHAITATQKTVDGPSGKLWRDGRGAAQNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPTPNVSVVDLTCRLEKPAKYDDIKKVVKQASEGPLKGILGYTEDQVVSCDFNSNSHSSTFDAGAGIALNDNFVKLISWYDNEYGYSNRVVDLMAYM 355          
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. UniProt/SwissProt
Match: sp|Q05025|G3P_COTJA (Glyceraldehyde-3-phosphate dehydrogenase OS=Coturnix japonica OX=93934 GN=GAPDH PE=2 SV=2)

HSP 1 Score: 492.656 bits (1267), Expect = 1.943e-174
Identity = 232/327 (70.95%), Postives = 269/327 (82.26%), Query Frame = 1
Query:   64 KVGINGFGRIGRLVLRAGLIQGKVDFVGINDPFVDVNYMVYMFKYDSTHGIYKNDVSEQDGFLVVADQKIQIFMEKDPSKIPWSDVDAEYVVESSGAFTTIQSASAHLPS-AKKVIISAPSADAPMFVMGVNHQLYEKSMNVVSNASCTTNCLAPLAKIIHDKFGIEEALMTTVHAVTATQKTVDAPSLKDWRGGRGAGQNIIPSSTGAAKAVGKVIPELNGKLTGMAFRVPTPDVSVVDLTVRLQNPAKYEDIVNAIRLECEGSMRGIMGFTDEALVSTDLCGDTRSSIFDASAGIQLNDKFVKLISWYDNEFGYSNRVIDLICHM 1041
            KVG+NGFGRIGRLV RA ++ GKV  V INDPF+D+NYMVYMFKYDSTHG +K  V  ++G LV+    I IF E+DPS I W D  AEYVVES+G FTT++ A AHL   AK+VIISAPSADAPMFVMGVNH+ Y+KS+ +VSNASCTTNCLAPLAK+IHD FGI E LMTTVHA+TATQKTVD PS K WR GRGA QNIIP+STGAAKAVGKVIPELNGKLTGMAFRVPTP+VSVVDLT RL+ PAKY+DI   ++   EG ++GI+G+T++ +VS D  GD+ SS FDA AGI LND FVKL+SWYDNEFGYSNRV+DL+ HM
Sbjct:    3 KVGVNGFGRIGRLVTRAAVLSGKVQVVAINDPFIDLNYMVYMFKYDSTHGHFKGTVKAENGKLVINGNAITIFQERDPSNIKWGDAGAEYVVESTGVFTTMEKAGAHLKGGAKRVIISAPSADAPMFVMGVNHEKYDKSLKIVSNASCTTNCLAPLAKVIHDNFGIVEGLMTTVHAITATQKTVDGPSGKLWRDGRGAAQNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPTPNVSVVDLTCRLEKPAKYDDIKRVVKAAAEGPLKGILGYTEDQVVSCDFNGDSHSSTFDAGAGIALNDNFVKLVSWYDNEFGYSNRVVDLMVHM 329          
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. UniProt/SwissProt
Match: sp|P00356|G3P_CHICK (Glyceraldehyde-3-phosphate dehydrogenase OS=Gallus gallus OX=9031 GN=GAPDH PE=2 SV=3)

HSP 1 Score: 492.271 bits (1266), Expect = 2.850e-174
Identity = 231/327 (70.64%), Postives = 270/327 (82.57%), Query Frame = 1
Query:   64 KVGINGFGRIGRLVLRAGLIQGKVDFVGINDPFVDVNYMVYMFKYDSTHGIYKNDVSEQDGFLVVADQKIQIFMEKDPSKIPWSDVDAEYVVESSGAFTTIQSASAHLPS-AKKVIISAPSADAPMFVMGVNHQLYEKSMNVVSNASCTTNCLAPLAKIIHDKFGIEEALMTTVHAVTATQKTVDAPSLKDWRGGRGAGQNIIPSSTGAAKAVGKVIPELNGKLTGMAFRVPTPDVSVVDLTVRLQNPAKYEDIVNAIRLECEGSMRGIMGFTDEALVSTDLCGDTRSSIFDASAGIQLNDKFVKLISWYDNEFGYSNRVIDLICHM 1041
            KVG+NGFGRIGRLV RA ++ GKV  V INDPF+D+NYMVYMFKYDSTHG +K  V  ++G LV+    I IF E+DPS I W+D  AEYVVES+G FTT++ A AHL   AK+VIISAPSADAPMFVMGVNH+ Y+KS+ +VSNASCTTNCLAPLAK+IHD FGI E LMTTVHA+TATQKTVD PS K WR GRGA QNIIP+STGAAKAVGKVIPELNGKLTGMAFRVPTP+VSVVDLT RL+ PAKY+DI   ++   +G ++GI+G+T++ +VS D  GD+ SS FDA AGI LND FVKL+SWYDNEFGYSNRV+DL+ HM
Sbjct:    3 KVGVNGFGRIGRLVTRAAVLSGKVQVVAINDPFIDLNYMVYMFKYDSTHGHFKGTVKAENGKLVINGHAITIFQERDPSNIKWADAGAEYVVESTGVFTTMEKAGAHLKGGAKRVIISAPSADAPMFVMGVNHEKYDKSLKIVSNASCTTNCLAPLAKVIHDNFGIVEGLMTTVHAITATQKTVDGPSGKLWRDGRGAAQNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPTPNVSVVDLTCRLEKPAKYDDIKRVVKAAADGPLKGILGYTEDQVVSCDFNGDSHSSTFDAGAGIALNDHFVKLVSWYDNEFGYSNRVVDLMVHM 329          
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. UniProt/SwissProt
Match: sp|Q5R2J2|G3P_PELSI (Glyceraldehyde-3-phosphate dehydrogenase OS=Pelodiscus sinensis OX=13735 GN=GAPDH PE=2 SV=1)

HSP 1 Score: 489.96 bits (1260), Expect = 2.354e-173
Identity = 230/327 (70.34%), Postives = 269/327 (82.26%), Query Frame = 1
Query:   64 KVGINGFGRIGRLVLRAGLIQGKVDFVGINDPFVDVNYMVYMFKYDSTHGIYKNDVSEQDGFLVVADQKIQIFMEKDPSKIPWSDVDAEYVVESSGAFTTIQSASAHLPS-AKKVIISAPSADAPMFVMGVNHQLYEKSMNVVSNASCTTNCLAPLAKIIHDKFGIEEALMTTVHAVTATQKTVDAPSLKDWRGGRGAGQNIIPSSTGAAKAVGKVIPELNGKLTGMAFRVPTPDVSVVDLTVRLQNPAKYEDIVNAIRLECEGSMRGIMGFTDEALVSTDLCGDTRSSIFDASAGIQLNDKFVKLISWYDNEFGYSNRVIDLICHM 1041
            K+G+NGFGRIGRLV RA     KV  V INDPF+D+NYMVYMFKYDSTHG +   V  ++G LV+  Q I IF E+DP+ I W D  AEYVVES+G FTT + ASAHL   AK+V+ISAPSADAPMFVMGVNH+ Y+ S+ VVSNASCTTNCLAPLAK+IHD +G+ E LMTTVHA+TATQKTVD PS K WR GRGA QNIIP+STGAAKAVGKVIPELNGKLTGMAFRVPTP+VSVVDLT RLQ PAKY+DI   ++   EG ++GI+G+T++ +VS+D  GD+RSSIFDA+AGI LND FVKL+SWYDNEFGYSNRV+DL+ HM
Sbjct:    3 KIGVNGFGRIGRLVTRAAFTCDKVQIVAINDPFIDLNYMVYMFKYDSTHGRFHGTVKAENGKLVINGQAITIFQERDPANIKWGDAGAEYVVESTGVFTTTEKASAHLKGGAKRVVISAPSADAPMFVMGVNHEKYDNSLKVVSNASCTTNCLAPLAKVIHDNYGMVEGLMTTVHAITATQKTVDGPSGKLWRDGRGAAQNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPTPNVSVVDLTCRLQKPAKYDDIKKVMKAASEGPLKGILGYTEDQVVSSDFNGDSRSSIFDAAAGIALNDNFVKLVSWYDNEFGYSNRVVDLLVHM 329          
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. UniProt/SwissProt
Match: sp|P04406|G3P_HUMAN (Glyceraldehyde-3-phosphate dehydrogenase OS=Homo sapiens OX=9606 GN=GAPDH PE=1 SV=3)

HSP 1 Score: 487.649 bits (1254), Expect = 2.573e-172
Identity = 232/330 (70.30%), Postives = 267/330 (80.91%), Query Frame = 1
Query:   55 GKPKVGINGFGRIGRLVLRAGLIQGKVDFVGINDPFVDVNYMVYMFKYDSTHGIYKNDVSEQDGFLVVADQKIQIFMEKDPSKIPWSDVDAEYVVESSGAFTTIQSASAHLPS-AKKVIISAPSADAPMFVMGVNHQLYEKSMNVVSNASCTTNCLAPLAKIIHDKFGIEEALMTTVHAVTATQKTVDAPSLKDWRGGRGAGQNIIPSSTGAAKAVGKVIPELNGKLTGMAFRVPTPDVSVVDLTVRLQNPAKYEDIVNAIRLECEGSMRGIMGFTDEALVSTDLCGDTRSSIFDASAGIQLNDKFVKLISWYDNEFGYSNRVIDLICHM 1041
            GK KVG+NGFGRIGRLV RA    GKVD V INDPF+D+NYMVYMF+YDSTHG +   V  ++G LV+    I IF E+DPSKI W D  AEYVVES+G FTT++ A AHL   AK+VIISAPSADAPMFVMGVNH+ Y+ S+ ++SNASCTTNCLAPLAK+IHD FGI E LMTTVHA+TATQKTVD PS K WR GRGA QNIIP+STGAAKAVGKVIPELNGKLTGMAFRVPT +VSVVDLT RL+ PAKY+DI   ++   EG ++GI+G+T+  +VS+D   DT SS FDA AGI LND FVKLISWYDNEFGYSNRV+DL+ HM
Sbjct:    2 GKVKVGVNGFGRIGRLVTRAAFNSGKVDIVAINDPFIDLNYMVYMFQYDSTHGKFHGTVKAENGKLVINGNPITIFQERDPSKIKWGDAGAEYVVESTGVFTTMEKAGAHLQGGAKRVIISAPSADAPMFVMGVNHEKYDNSLKIISNASCTTNCLAPLAKVIHDNFGIVEGLMTTVHAITATQKTVDGPSGKLWRDGRGALQNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPTANVSVVDLTCRLEKPAKYDDIKKVVKQASEGPLKGILGYTEHQVVSSDFNSDTHSSTFDAGAGIALNDHFVKLISWYDNEFGYSNRVVDLMAHM 331          
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. UniProt/SwissProt
Match: sp|P51469|G3P_XENLA (Glyceraldehyde-3-phosphate dehydrogenase OS=Xenopus laevis OX=8355 GN=gapdh PE=2 SV=2)

HSP 1 Score: 487.263 bits (1253), Expect = 3.435e-172
Identity = 234/327 (71.56%), Postives = 267/327 (81.65%), Query Frame = 1
Query:   64 KVGINGFGRIGRLVLRAGLIQGKVDFVGINDPFVDVNYMVYMFKYDSTHGIYKNDVSEQDGFLVVADQKIQIFMEKDPSKIPWSDVDAEYVVESSGAFTTIQSASAHLPS-AKKVIISAPSADAPMFVMGVNHQLYEKSMNVVSNASCTTNCLAPLAKIIHDKFGIEEALMTTVHAVTATQKTVDAPSLKDWRGGRGAGQNIIPSSTGAAKAVGKVIPELNGKLTGMAFRVPTPDVSVVDLTVRLQNPAKYEDIVNAIRLECEGSMRGIMGFTDEALVSTDLCGDTRSSIFDASAGIQLNDKFVKLISWYDNEFGYSNRVIDLICHM 1041
            KVGINGFG IGRLV RA    GKV  V INDPF+D++YMVYMFKYDSTHG +K  V  ++G L++ DQ I +F E+DPS I W D  A YVVES+G FTT + AS HL   AK+V+ISAPSADAPMFV+GVNH+ YE S+ VVSNASCTTNCLAPLAK+I+D FGI E LMTTVHA TATQKTVD PS K WR GRGAGQNIIP+STGAAKAVGKVIPELNGK+TGMAFRVPTP+VSVVDLT RLQ PAKY+DI  AI+   EG M+GI+G+T + +VSTD  GDT SSIFDA AGI LN+ FVKL+SWYDNE GYSNRV+DL+CHM
Sbjct:    3 KVGINGFGCIGRLVTRAAFDSGKVQVVAINDPFIDLDYMVYMFKYDSTHGRFKGTVKAENGKLIINDQVITVFQERDPSSIKWGDAGAVYVVESTGVFTTTEKASLHLKGGAKRVVISAPSADAPMFVVGVNHEKYENSLKVVSNASCTTNCLAPLAKVINDNFGIVEGLMTTVHAFTATQKTVDGPSGKLWRDGRGAGQNIIPASTGAAKAVGKVIPELNGKITGMAFRVPTPNVSVVDLTCRLQKPAKYDDIKAAIKTASEGPMKGILGYTQDQVVSTDFNGDTHSSIFDADAGIALNENFVKLVSWYDNECGYSNRVVDLVCHM 329          
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. TrEMBL
Match: A0A3B4CTS4 (Glyceraldehyde-3-phosphate dehydrogenase OS=Pygocentrus nattereri OX=42514 PE=3 SV=1)

HSP 1 Score: 496.508 bits (1277), Expect = 1.795e-173
Identity = 235/327 (71.87%), Postives = 272/327 (83.18%), Query Frame = 1
Query:   64 KVGINGFGRIGRLVLRAGLIQGKVDFVGINDPFVDVNYMVYMFKYDSTHGIYKNDVSEQDGFLVVADQKIQIFMEKDPSKIPWSDVDAEYVVESSGAFTTIQSASAHLPS-AKKVIISAPSADAPMFVMGVNHQLYEKSMNVVSNASCTTNCLAPLAKIIHDKFGIEEALMTTVHAVTATQKTVDAPSLKDWRGGRGAGQNIIPSSTGAAKAVGKVIPELNGKLTGMAFRVPTPDVSVVDLTVRLQNPAKYEDIVNAIRLECEGSMRGIMGFTDEALVSTDLCGDTRSSIFDASAGIQLNDKFVKLISWYDNEFGYSNRVIDLICHM 1041
            KVGINGFGRIGRLV RA     KV+ V INDPF+D++YMVYMFKYDSTHG YK +V  + G L++    I++F E+DP+ I W+D  A+YVVES+G FTTI+ ASAHL   AK+VIISAPSADAPMFVMGVNH+ Y+KS+ VVSNASCTTNCLAPLAK++HDKFGI E LM+TVHA+TATQKTVD PS K WR GRGA QNIIP+STGAAKAVGKVIPELNGKLTGMAFRVPTP+VSVVDLTVRL+ PAKY+DI   I+   EG M+GI+G+T+  +VSTD  GD RSSIFDA AGI LND FVKL++WYDNEFGYSNRV DL+ HM
Sbjct:    3 KVGINGFGRIGRLVTRAAFTSKKVEIVAINDPFIDLDYMVYMFKYDSTHGKYKGEVKAEGGKLIIDGHAIKVFSERDPANIKWADAGAQYVVESTGVFTTIEKASAHLKGGAKRVIISAPSADAPMFVMGVNHEKYDKSLAVVSNASCTTNCLAPLAKVVHDKFGIIEGLMSTVHAITATQKTVDGPSGKLWRDGRGASQNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPTPNVSVVDLTVRLEKPAKYDDIKKVIKEASEGPMKGILGYTEHQVVSTDFNGDCRSSIFDAGAGIALNDHFVKLVTWYDNEFGYSNRVCDLMAHM 329          
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. TrEMBL
Match: A0A3B3QXW7 (Glyceraldehyde-3-phosphate dehydrogenase OS=Paramormyrops kingsleyae OX=1676925 PE=3 SV=1)

HSP 1 Score: 494.197 bits (1271), Expect = 1.729e-172
Identity = 233/327 (71.25%), Postives = 273/327 (83.49%), Query Frame = 1
Query:   64 KVGINGFGRIGRLVLRAGLIQGKVDFVGINDPFVDVNYMVYMFKYDSTHGIYKNDVSEQDGFLVVADQKIQIFMEKDPSKIPWSDVDAEYVVESSGAFTTIQSASAHLPS-AKKVIISAPSADAPMFVMGVNHQLYEKSMNVVSNASCTTNCLAPLAKIIHDKFGIEEALMTTVHAVTATQKTVDAPSLKDWRGGRGAGQNIIPSSTGAAKAVGKVIPELNGKLTGMAFRVPTPDVSVVDLTVRLQNPAKYEDIVNAIRLECEGSMRGIMGFTDEALVSTDLCGDTRSSIFDASAGIQLNDKFVKLISWYDNEFGYSNRVIDLICHM 1041
            KVG+NGFGRIGRLV RA    GKV+ V INDPF+D++YMVYMFKYDSTHG +K +V  + G L ++ + I +F E+DP+ I W +  AEYVVES+G FTT + ASAHL   AK+VIISAPSADAPMFVMGVNH+ Y+ S+ VVSNASCTTNCLAPLAK+I+D F I E LM+TVHA+TATQKTVD PS K WR GRGAGQNIIP+STGAAKAVGKVIPELNGKLTGMAFRVPTP+VSVVDLTVRL+ PAKY+DI  A++   EG M+GI+G+T++ +VSTD  GD+RSSIFDA AGI LND FVKL+SWYDNEFGYSNRVIDL+ HM
Sbjct:    3 KVGVNGFGRIGRLVTRAAFQSGKVEIVAINDPFIDLDYMVYMFKYDSTHGNFKGEVKAEGGKLYISGKAITVFHERDPANIKWGEAGAEYVVESTGVFTTTEKASAHLKGGAKRVIISAPSADAPMFVMGVNHEKYDNSLKVVSNASCTTNCLAPLAKVINDTFTIVEGLMSTVHAITATQKTVDGPSGKLWRDGRGAGQNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPTPNVSVVDLTVRLEKPAKYDDIKKAVKAASEGPMKGILGYTEDQVVSTDFNGDSRSSIFDAGAGIALNDHFVKLVSWYDNEFGYSNRVIDLMAHM 329          
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. TrEMBL
Match: A0A1W7RH86 (Glyceraldehyde-3-phosphate dehydrogenase OS=Agkistrodon contortrix contortrix OX=8713 PE=3 SV=1)

HSP 1 Score: 493.426 bits (1269), Expect = 2.955e-172
Identity = 233/327 (71.25%), Postives = 270/327 (82.57%), Query Frame = 1
Query:   64 KVGINGFGRIGRLVLRAGLIQGKVDFVGINDPFVDVNYMVYMFKYDSTHGIYKNDVSEQDGFLVVADQKIQIFMEKDPSKIPWSDVDAEYVVESSGAFTTIQSASAHLPS-AKKVIISAPSADAPMFVMGVNHQLYEKSMNVVSNASCTTNCLAPLAKIIHDKFGIEEALMTTVHAVTATQKTVDAPSLKDWRGGRGAGQNIIPSSTGAAKAVGKVIPELNGKLTGMAFRVPTPDVSVVDLTVRLQNPAKYEDIVNAIRLECEGSMRGIMGFTDEALVSTDLCGDTRSSIFDASAGIQLNDKFVKLISWYDNEFGYSNRVIDLICHM 1041
            K+GINGFGRIGRLV RA L   KV+ V INDPF+D+NYMVYMFKYDSTHG +   V  ++G LVV    I +F E+DP+ I W +  AEYVVES+G FTT + ASAHL   AK+VIISAPSADAPMFVMGVNH+ Y+KS+ VVSNASCTTNCLAPLAK+IHD +GI E LMTTVHA+TATQKTVD PS K WR GRGA QNIIP+STGAAKAVGKVIP+LNGKLTGMAFRVPTP+VSVVDLT RL  PAKY+DI   ++   EG M+GI+G+T++ +VS+D  GDTRSSIFDA+AGI LND FVKLISWYDNE+GYSNRV+DL+ HM
Sbjct:    3 KIGINGFGRIGRLVTRAALHNSKVEVVAINDPFIDLNYMVYMFKYDSTHGRFHGTVQAENGKLVVNGHAITVFQERDPANIKWGEAGAEYVVESTGVFTTTEKASAHLKGGAKRVIISAPSADAPMFVMGVNHEKYDKSLTVVSNASCTTNCLAPLAKVIHDNYGIVEGLMTTVHAITATQKTVDGPSGKQWRDGRGAAQNIIPASTGAAKAVGKVIPDLNGKLTGMAFRVPTPNVSVVDLTCRLGKPAKYDDIKKVVKAASEGPMKGILGYTEDQVVSSDFNGDTRSSIFDAAAGIALNDHFVKLISWYDNEYGYSNRVVDLMVHM 329          
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. TrEMBL
Match: A0A226MZ71 (Glyceraldehyde-3-phosphate dehydrogenase OS=Callipepla squamata OX=9009 GN=ASZ78_000789 PE=3 SV=1)

HSP 1 Score: 492.271 bits (1266), Expect = 8.447e-172
Identity = 231/327 (70.64%), Postives = 270/327 (82.57%), Query Frame = 1
Query:   64 KVGINGFGRIGRLVLRAGLIQGKVDFVGINDPFVDVNYMVYMFKYDSTHGIYKNDVSEQDGFLVVADQKIQIFMEKDPSKIPWSDVDAEYVVESSGAFTTIQSASAHLPS-AKKVIISAPSADAPMFVMGVNHQLYEKSMNVVSNASCTTNCLAPLAKIIHDKFGIEEALMTTVHAVTATQKTVDAPSLKDWRGGRGAGQNIIPSSTGAAKAVGKVIPELNGKLTGMAFRVPTPDVSVVDLTVRLQNPAKYEDIVNAIRLECEGSMRGIMGFTDEALVSTDLCGDTRSSIFDASAGIQLNDKFVKLISWYDNEFGYSNRVIDLICHM 1041
            KVG+NGFGRIGRLV RA ++ GKV  V INDPF+D+NYMVYMFKYDSTHG +K  V  ++G LV+    I IF E+DPS I W+D  AEYVVES+G FTT++ A AHL   AK+VIISAPSADAPMFVMGVNH+ Y+KS+ +VSNASCTTNCLAPLAK+IHD FGI E LMTTVHA+TATQKTVD PS K WR GRGA QNIIP+STGAAKAVGKVIPELNGKLTGMAFRVPTP+VSVVDLT RL+ PAKY+DI   ++   +G ++GI+G+T++ +VS D  GD+ SS FDA AGI LND FVKL+SWYDNEFGYSNRV+DL+ HM
Sbjct:    3 KVGVNGFGRIGRLVTRAAVLSGKVQVVAINDPFIDLNYMVYMFKYDSTHGHFKGTVKAENGKLVINGHAITIFQERDPSNIKWADAGAEYVVESTGVFTTMEKAGAHLKGGAKRVIISAPSADAPMFVMGVNHEKYDKSLKIVSNASCTTNCLAPLAKVIHDNFGIVEGLMTTVHAITATQKTVDGPSGKLWRDGRGAAQNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPTPNVSVVDLTCRLEKPAKYDDIKRVVKAAADGPLKGILGYTEDQVVSCDFNGDSHSSTFDAGAGIALNDHFVKLVSWYDNEFGYSNRVVDLMVHM 329          
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. TrEMBL
Match: G1NMR6 (Glyceraldehyde-3-phosphate dehydrogenase OS=Meleagris gallopavo OX=9103 GN=GAPDH PE=3 SV=1)

HSP 1 Score: 492.271 bits (1266), Expect = 8.447e-172
Identity = 231/327 (70.64%), Postives = 270/327 (82.57%), Query Frame = 1
Query:   64 KVGINGFGRIGRLVLRAGLIQGKVDFVGINDPFVDVNYMVYMFKYDSTHGIYKNDVSEQDGFLVVADQKIQIFMEKDPSKIPWSDVDAEYVVESSGAFTTIQSASAHLPS-AKKVIISAPSADAPMFVMGVNHQLYEKSMNVVSNASCTTNCLAPLAKIIHDKFGIEEALMTTVHAVTATQKTVDAPSLKDWRGGRGAGQNIIPSSTGAAKAVGKVIPELNGKLTGMAFRVPTPDVSVVDLTVRLQNPAKYEDIVNAIRLECEGSMRGIMGFTDEALVSTDLCGDTRSSIFDASAGIQLNDKFVKLISWYDNEFGYSNRVIDLICHM 1041
            KVG+NGFGRIGRLV RA ++ GKV  V INDPF+D+NYMVYMFKYDSTHG +K  V  ++G LV+    I IF E+DPS I W+D  AEYVVES+G FTT++ A AHL   AK+VIISAPSADAPMFVMGVNH+ Y+KS+ +VSNASCTTNCLAPLAK+IHD FGI E LMTTVHA+TATQKTVD PS K WR GRGA QNIIP+STGAAKAVGKVIPELNGKLTGMAFRVPTP+VSVVDLT RL+ PAKY+DI   ++   +G ++GI+G+T++ +VS D  GD+ SS FDA AGI LND FVKL+SWYDNEFGYSNRV+DL+ HM
Sbjct:    3 KVGVNGFGRIGRLVTRAAVLSGKVQVVAINDPFIDLNYMVYMFKYDSTHGHFKGTVKAENGKLVINGHAITIFQERDPSNIKWADAGAEYVVESTGVFTTMEKAGAHLKGGAKRVIISAPSADAPMFVMGVNHEKYDKSLKIVSNASCTTNCLAPLAKVIHDNFGIVEGLMTTVHAITATQKTVDGPSGKLWRDGRGAAQNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPTPNVSVVDLTCRLEKPAKYDDIKRVVKAAADGPLKGILGYTEDQVVSCDFNGDSHSSTFDAGAGIALNDHFVKLVSWYDNEFGYSNRVVDLMVHM 329          
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Ensembl Cavefish
Match: ENSAMXT00000050002.1 (glyceraldehyde-3-phosphate dehydrogenase-like [Source:NCBI gene;Acc:103041091])

HSP 1 Score: 485.337 bits (1248), Expect = 2.196e-172
Identity = 229/327 (70.03%), Postives = 268/327 (81.96%), Query Frame = 1
Query:   64 KVGINGFGRIGRLVLRAGLIQGKVDFVGINDPFVDVNYMVYMFKYDSTHGIYKNDVSEQDGFLVVADQKIQIFMEKDPSKIPWSDVDAEYVVESSGAFTTIQSASAHLPS-AKKVIISAPSADAPMFVMGVNHQLYEKSMNVVSNASCTTNCLAPLAKIIHDKFGIEEALMTTVHAVTATQKTVDAPSLKDWRGGRGAGQNIIPSSTGAAKAVGKVIPELNGKLTGMAFRVPTPDVSVVDLTVRLQNPAKYEDIVNAIRLECEGSMRGIMGFTDEALVSTDLCGDTRSSIFDASAGIQLNDKFVKLISWYDNEFGYSNRVIDLICHM 1041
            KVGINGFGRIGRLV R   +  KVD V INDPF+D+ YMVYMF YDSTHG +K +V  ++G L + +  I +F EKDP+ I W+D  AEYVVES+G FTT++ ASAHL   AK+VIISAPSADAPMFVMGVN  +Y+KSM V+SNASCTTNCLAPLAK+IHD FGI E LM+TVHA+TATQKTVD PS K WR GRGA QNIIP+STGAAKAVGKVIPELNGKLTGMAFRVPTP+VSVVDLTVRL+ PAKYE I   ++   EG +RGI+G+TDE LVSTD  GD+ SS FDA AGI L+D FVKL++WYDNE+GYS+RVIDL+ ++
Sbjct:    3 KVGINGFGRIGRLVTRVAFLTEKVDIVAINDPFIDIEYMVYMFTYDSTHGRFKGEVKSENGKLFINNHPITVFSEKDPANIKWADTGAEYVVESTGVFTTVEKASAHLKGGAKRVIISAPSADAPMFVMGVNQNVYDKSMKVISNASCTTNCLAPLAKVIHDNFGIIEGLMSTVHAITATQKTVDGPSGKLWRDGRGASQNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPTPNVSVVDLTVRLEKPAKYERIKKVVKAAAEGPLRGILGYTDEPLVSTDFNGDSHSSYFDADAGIALSDNFVKLVTWYDNEYGYSSRVIDLMVYI 329          
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Ensembl Cavefish
Match: gapdh (glyceraldehyde-3-phosphate dehydrogenase [Source:NCBI gene;Acc:103027606])

HSP 1 Score: 484.567 bits (1246), Expect = 4.671e-172
Identity = 232/327 (70.95%), Postives = 267/327 (81.65%), Query Frame = 1
Query:   64 KVGINGFGRIGRLVLRAGLIQGKVDFVGINDPFVDVNYMVYMFKYDSTHGIYKNDVSEQDGFLVVADQKIQIFMEKDPSKIPWSDVDAEYVVESSGAFTTIQSASAHLPS-AKKVIISAPSADAPMFVMGVNHQLYEKSMNVVSNASCTTNCLAPLAKIIHDKFGIEEALMTTVHAVTATQKTVDAPSLKDWRGGRGAGQNIIPSSTGAAKAVGKVIPELNGKLTGMAFRVPTPDVSVVDLTVRLQNPAKYEDIVNAIRLECEGSMRGIMGFTDEALVSTDLCGDTRSSIFDASAGIQLNDKFVKLISWYDNEFGYSNRVIDLICHM 1041
            KVGINGFGRIGRLV RA     KV+ V INDPF+D++YMVYMFKYDSTHG YK +V  + G LV+    I +F E+DP+ I W D  A+YVVES+G FTTI+ ASAHL   AK+VIISAPSADAPMFVMGVNH+ Y+ S+ VVSNASCTTNCLAPLAK+I+D F I E LM+TVHA+TATQKTVD PS K WR GRGA QNIIP+STGAAKAVGKVIPELNGKLTGMAFRVPTP+VSVVDLTVRL+ PAKY+DI   ++   EG M+GI+G+T+  +VSTD  GD RSSIFDA AGI LND FVKL++WYDNEFGYSNRV DL+ HM
Sbjct:    3 KVGINGFGRIGRLVTRAAFHSKKVEVVAINDPFIDLDYMVYMFKYDSTHGKYKGEVKAEGGKLVIDGHAITVFSERDPANIKWGDAGADYVVESTGVFTTIEKASAHLKGGAKRVIISAPSADAPMFVMGVNHEKYDNSLKVVSNASCTTNCLAPLAKVINDNFVIIEGLMSTVHAITATQKTVDGPSGKLWRDGRGASQNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPTPNVSVVDLTVRLEKPAKYDDIKKVVKAASEGPMKGILGYTEHQVVSTDFNGDERSSIFDAGAGIALNDHFVKLVTWYDNEFGYSNRVCDLMAHM 329          
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Ensembl Cavefish
Match: gapdhs (glyceraldehyde-3-phosphate dehydrogenase 2 [Source:NCBI gene;Acc:111192112])

HSP 1 Score: 457.218 bits (1175), Expect = 2.544e-161
Identity = 221/328 (67.38%), Postives = 261/328 (79.57%), Query Frame = 1
Query:   67 VGINGFGRIGRLVLRAGLIQGKVDFVGINDPFVDVNYMVYMFKYDSTHGIYKNDVSEQDGFLVVADQKIQIFMEKDPSKIPWSDVDAEYVVESSGAFTTIQSASAHLPS-AKKVIISAPSADAPMFVMGVNHQLYE-KSMNVVSNASCTTNCLAPLAKIIHDKFGIEEALMTTVHAVTATQKTVDAPSLKDWRGGRGAGQNIIPSSTGAAKAVGKVIPELNGKLTGMAFRVPTPDVSVVDLTVRLQNPAKYEDIVNAIRLECEGSMRGIMGFTDEALVSTDLCGDTRSSIFDASAGIQLNDKFVKLISWYDNEFGYSNRVIDLICHMY 1044
            VGINGFGRIGRLVLRA L +G +    INDPF+D+ YMVYMFKYDSTHG Y  +V +++G L+V DQ I +F    P++IPW D  A YVVES+G F +++ AS+H+   AK+V++SAPS DAPMFVMGVN   Y+  SM +VSNASCTTNCLAPLAK+IHD FGIEEALMTTVHA TATQKTVD PS K WR GRGA QNIIP+STGAAKAVGKVIPELNGKLTGMAFRVP  DVSVVDLT RL  PA Y DI  A++    G ++G +G+T++++VS+D  GDT SSIFDA AGI LND FVKLISWYDNEFGYS+RV DL+ +M+
Sbjct:    6 VGINGFGRIGRLVLRACLQKG-IKVTAINDPFIDLQYMVYMFKYDSTHGRYHGEVRQENGKLIVDDQAISVFQCMKPAEIPWGDAGAVYVVESTGVFLSVEKASSHIQGGAKRVVVSAPSPDAPMFVMGVNEDKYDPSSMTIVSNASCTTNCLAPLAKVIHDNFGIEEALMTTVHAYTATQKTVDGPSAKAWRDGRGAHQNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPVADVSVVDLTCRLTKPASYADIKEAVKKAAHGPLKGFLGYTEDSVVSSDFIGDTHSSIFDAGAGISLNDNFVKLISWYDNEFGYSHRVADLLLYMH 332          
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Ensembl Cavefish
Match: gapdhs (glyceraldehyde-3-phosphate dehydrogenase 2 [Source:NCBI gene;Acc:111192112])

HSP 1 Score: 457.218 bits (1175), Expect = 2.544e-161
Identity = 221/328 (67.38%), Postives = 261/328 (79.57%), Query Frame = 1
Query:   67 VGINGFGRIGRLVLRAGLIQGKVDFVGINDPFVDVNYMVYMFKYDSTHGIYKNDVSEQDGFLVVADQKIQIFMEKDPSKIPWSDVDAEYVVESSGAFTTIQSASAHLPS-AKKVIISAPSADAPMFVMGVNHQLYE-KSMNVVSNASCTTNCLAPLAKIIHDKFGIEEALMTTVHAVTATQKTVDAPSLKDWRGGRGAGQNIIPSSTGAAKAVGKVIPELNGKLTGMAFRVPTPDVSVVDLTVRLQNPAKYEDIVNAIRLECEGSMRGIMGFTDEALVSTDLCGDTRSSIFDASAGIQLNDKFVKLISWYDNEFGYSNRVIDLICHMY 1044
            VGINGFGRIGRLVLRA L +G +    INDPF+D+ YMVYMFKYDSTHG Y  +V +++G L+V DQ I +F    P++IPW D  A YVVES+G F +++ AS+H+   AK+V++SAPS DAPMFVMGVN   Y+  SM +VSNASCTTNCLAPLAK+IHD FGIEEALMTTVHA TATQKTVD PS K WR GRGA QNIIP+STGAAKAVGKVIPELNGKLTGMAFRVP  DVSVVDLT RL  PA Y DI  A++    G ++G +G+T++++VS+D  GDT SSIFDA AGI LND FVKLISWYDNEFGYS+RV DL+ +M+
Sbjct:    6 VGINGFGRIGRLVLRACLQKG-IKVTAINDPFIDLQYMVYMFKYDSTHGRYHGEVRQENGKLIVDDQAISVFQCMKPAEIPWGDAGAVYVVESTGVFLSVEKASSHIQGGAKRVVVSAPSPDAPMFVMGVNEDKYDPSSMTIVSNASCTTNCLAPLAKVIHDNFGIEEALMTTVHAYTATQKTVDGPSAKAWRDGRGAHQNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPVADVSVVDLTCRLTKPASYADIKEAVKKAAHGPLKGFLGYTEDSVVSSDFIGDTHSSIFDAGAGISLNDNFVKLISWYDNEFGYSHRVADLLLYMH 332          
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Ensembl Cavefish
Match: gapdhs (glyceraldehyde-3-phosphate dehydrogenase 2 [Source:NCBI gene;Acc:111192112])

HSP 1 Score: 457.218 bits (1175), Expect = 2.544e-161
Identity = 221/328 (67.38%), Postives = 261/328 (79.57%), Query Frame = 1
Query:   67 VGINGFGRIGRLVLRAGLIQGKVDFVGINDPFVDVNYMVYMFKYDSTHGIYKNDVSEQDGFLVVADQKIQIFMEKDPSKIPWSDVDAEYVVESSGAFTTIQSASAHLPS-AKKVIISAPSADAPMFVMGVNHQLYE-KSMNVVSNASCTTNCLAPLAKIIHDKFGIEEALMTTVHAVTATQKTVDAPSLKDWRGGRGAGQNIIPSSTGAAKAVGKVIPELNGKLTGMAFRVPTPDVSVVDLTVRLQNPAKYEDIVNAIRLECEGSMRGIMGFTDEALVSTDLCGDTRSSIFDASAGIQLNDKFVKLISWYDNEFGYSNRVIDLICHMY 1044
            VGINGFGRIGRLVLRA L +G +    INDPF+D+ YMVYMFKYDSTHG Y  +V +++G L+V DQ I +F    P++IPW D  A YVVES+G F +++ AS+H+   AK+V++SAPS DAPMFVMGVN   Y+  SM +VSNASCTTNCLAPLAK+IHD FGIEEALMTTVHA TATQKTVD PS K WR GRGA QNIIP+STGAAKAVGKVIPELNGKLTGMAFRVP  DVSVVDLT RL  PA Y DI  A++    G ++G +G+T++++VS+D  GDT SSIFDA AGI LND FVKLISWYDNEFGYS+RV DL+ +M+
Sbjct:    6 VGINGFGRIGRLVLRACLQKG-IKVTAINDPFIDLQYMVYMFKYDSTHGRYHGEVRQENGKLIVDDQAISVFQCMKPAEIPWGDAGAVYVVESTGVFLSVEKASSHIQGGAKRVVVSAPSPDAPMFVMGVNEDKYDPSSMTIVSNASCTTNCLAPLAKVIHDNFGIEEALMTTVHAYTATQKTVDGPSAKAWRDGRGAHQNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPVADVSVVDLTCRLTKPASYADIKEAVKKAAHGPLKGFLGYTEDSVVSSDFIGDTHSSIFDAGAGISLNDNFVKLISWYDNEFGYSHRVADLLLYMH 332          
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Ensembl Sea Lamprey
Match: gapdh (glyceraldehyde-3-phosphate dehydrogenase [Source:NCBI gene;Acc:317743])

HSP 1 Score: 419.468 bits (1077), Expect = 1.511e-147
Identity = 202/303 (66.67%), Postives = 240/303 (79.21%), Query Frame = 1
Query:   67 VGINGFGRIGRLVLRAGLIQGKVDFVGINDPFVDVNYMVYMFKYDSTHGIYKNDVSEQDGFLVVADQKIQIFMEKDPSKIPWSDVDAEYVVESSGAFTTIQSASAHLPS-AKKVIISAPSADAPMFVMGVNHQLYEKSMNVVSNASCTTNCLAPLAKIIHDKFGIEEALMTTVHAVTATQKTVDAPSLKDWRGGRGAGQNIIPSSTGAAKAVGKVIPELNGKLTGMAFRVPTPDVSVVDLTVRLQNPAKYEDIVNAIRLECEGSMRGIMGFTDEALVSTDLCGDTRSSIFDASAGIQLNDKFV 972
            +GINGFGRIGRLV RA + +  ++ V INDPF+D+ YMVYMFKYDSTHG +K DV  +DG L++    + ++ E+DP+ IPW    A+YVVES+G FTTI  AS HL   AK VIISAPSADAPMFVMGVNH+ Y+ S+ VVSNASCTTNCLAPLAK+I+D FGI E LMTTVH+ TATQKTVD PS K WR GRGA QNIIP+STGAAKAVG VIPELNGKLTGMAFRVPTP+VSVVDLT RL  PA Y++I   +R   +G ++GI+G+T++ +VSTD  GDT SSIFDA AGI LN +FV
Sbjct:    4 IGINGFGRIGRLVARAAVQKEDINVVAINDPFIDLEYMVYMFKYDSTHGRFKGDVKVEDGKLLINGHAVSVYSERDPANIPWGKHGADYVVESTGVFTTIDKASLHLKGGAKHVIISAPSADAPMFVMGVNHEKYDPSLKVVSNASCTTNCLAPLAKVINDNFGIVEGLMTTVHSYTATQKTVDGPSAKLWRDGRGASQNIIPASTGAAKAVGMVIPELNGKLTGMAFRVPTPNVSVVDLTCRLAKPASYDEIKAKVREASKGDLKGILGYTEDLVVSTDFNGDTHSSIFDAQAGIALNKQFV 306          
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Ensembl Sea Lamprey
Match: gapdh (glyceraldehyde-3-phosphate dehydrogenase [Source:NCBI gene;Acc:317743])

HSP 1 Score: 352.058 bits (902), Expect = 7.320e-122
Identity = 171/245 (69.80%), Postives = 196/245 (80.00%), Query Frame = 1
Query:   73 INGFGRIGRLVLRAGLIQGKVDFVGINDPFVDVNYMVYMFKYDSTHGIYKNDVSEQDGFLVVADQKIQIFMEKDPSKIPWSDVDAEYVVESSGAFTTIQSASAHLPS-AKKVIISAPSADAPMFVMGVNHQLYEKSMNVVSNASCTTNCLAPLAKIIHDKFGIEEALMTTVHAVTATQKTVDAPSLKDWRGGRGAGQNIIPSSTGAAKAVGKVIPELNGKLTGMAFRVPTPDVSVVDLTVRLQNP 804
            IN FGRIGRLV RA + +  ++ V INDPF+D+ YMVYMFKYDSTHG +K DV  +DG L++    + ++ E+DP+ IPW    A+YVVES+G FTTI  AS HL   AK VIISAPSADAPMFVMGVNH+ Y+ S+ VVSNASCTTNCLAPLAK+I+D FGI E LMTTVH+ TATQKTVD PS K WR GRGA QNIIP+STGAAKAVG VIPELNGKLTGMAFRVPTP+VSVVDLT RL  P
Sbjct:    7 INQFGRIGRLVARAAVQKEDINVVAINDPFIDLEYMVYMFKYDSTHGRFKGDVKVEDGKLLINGHAVSVYSERDPANIPWGKHGADYVVESTGVFTTIDKASLHLKGGAKHVIISAPSADAPMFVMGVNHEKYDPSLKVVSNASCTTNCLAPLAKVINDNFGIVEGLMTTVHSYTATQKTVDGPSAKLWRDGRGASQNIIPASTGAAKAVGMVIPELNGKLTGMAFRVPTPNVSVVDLTCRLAKP 251          
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Ensembl Yeast
Match: TDH2 (Glyceraldehyde-3-phosphate dehydrogenase (GAPDH), isozyme 2; involved in glycolysis and gluconeogenesis; tetramer that catalyzes reaction of glyceraldehyde-3-phosphate to 1,3 bis-phosphoglycerate; detected in cytoplasm and cell wall; protein abundance increases in response to DNA replication stress; GAPDH-derived antimicrobial peptides are active against a wide variety of wine-related yeasts and bateria; TDH2 has a paralog, TDH3, that arose from the whole genome duplication [Source:SGD;Acc:S000003769])

HSP 1 Score: 432.18 bits (1110), Expect = 2.141e-152
Identity = 198/329 (60.18%), Postives = 256/329 (77.81%), Query Frame = 1
Query:   64 KVGINGFGRIGRLVLRAGLIQGKVDFVGINDPFVDVNYMVYMFKYDSTHGIYKNDVSEQDGFLVVADQKIQIFMEKDPSKIPWSDVDAEYVVESSGAFTTIQSASAHLPS-AKKVIISAPSADAPMFVMGVNHQLYEKSMNVVSNASCTTNCLAPLAKIIHDKFGIEEALMTTVHAVTATQKTVDAPSLKDWRGGRGAGQNIIPSSTGAAKAVGKVIPELNGKLTGMAFRVPTPDVSVVDLTVRLQNPAKYEDIVNAIRLECEGSMRGIMGFTDEALVSTDLCGDTRSSIFDASAGIQLNDKFVKLISWYDNEFGYSNRVIDLICHMYR 1047
            +V INGFGRIGRLV+R  L +  V+ V +NDPF+  +Y  YMFKYDSTHG Y  +VS  D  ++V   KI  F E+DP+ +PW+ ++ +  ++S+G F  + +A  H+ + AKKV+I+APS+ APMFVMGVN + Y   + +VSNASCTTNCLAPLAK+I+D FGIEE LMTTVH++TATQKTVD PS KDWRGGR A  NIIPSSTGAAKAVGKV+PEL GKLTGMAFRVPT DVSVVDLTV+L     Y++I   ++   EG ++G++G+T++A+VS+D  GD+ SSIFDA+AGIQL+ KFVKL+SWYDNE+GYS RV+DL+ H+ +
Sbjct:    3 RVAINGFGRIGRLVMRIALQRKNVEVVALNDPFISNDYSAYMFKYDSTHGRYAGEVSHDDKHIIVDGHKIATFQERDPANLPWASLNIDIAIDSTGVFKELDTAQKHIDAGAKKVVITAPSSTAPMFVMGVNEEKYTSDLKIVSNASCTTNCLAPLAKVINDAFGIEEGLMTTVHSMTATQKTVDGPSHKDWRGGRTASGNIIPSSTGAAKAVGKVLPELQGKLTGMAFRVPTVDVSVVDLTVKLNKETTYDEIKKVVKAAAEGKLKGVLGYTEDAVVSSDFLGDSNSSIFDAAAGIQLSPKFVKLVSWYDNEYGYSTRVVDLVEHVAK 331          
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Ensembl Yeast
Match: TDH3 (Glyceraldehyde-3-phosphate dehydrogenase (GAPDH), isozyme 3; involved in glycolysis and gluconeogenesis; tetramer that catalyzes the reaction of glyceraldehyde-3-phosphate to 1,3 bis-phosphoglycerate; detected in the cytoplasm and cell wall; GAPDH-derived antimicrobial peptides secreted by S. cerevisiae are active against a wide variety of wine-related yeasts and bacteria; binds AU-rich RNA [Source:SGD;Acc:S000003424])

HSP 1 Score: 431.409 bits (1108), Expect = 3.947e-152
Identity = 198/329 (60.18%), Postives = 255/329 (77.51%), Query Frame = 1
Query:   64 KVGINGFGRIGRLVLRAGLIQGKVDFVGINDPFVDVNYMVYMFKYDSTHGIYKNDVSEQDGFLVVADQKIQIFMEKDPSKIPWSDVDAEYVVESSGAFTTIQSASAHLPS-AKKVIISAPSADAPMFVMGVNHQLYEKSMNVVSNASCTTNCLAPLAKIIHDKFGIEEALMTTVHAVTATQKTVDAPSLKDWRGGRGAGQNIIPSSTGAAKAVGKVIPELNGKLTGMAFRVPTPDVSVVDLTVRLQNPAKYEDIVNAIRLECEGSMRGIMGFTDEALVSTDLCGDTRSSIFDASAGIQLNDKFVKLISWYDNEFGYSNRVIDLICHMYR 1047
            +V INGFGRIGRLV+R  L +  V+ V +NDPF+  +Y  YMFKYDSTHG Y  +VS  D  ++V  +KI  + E+DP+ +PW   + +  ++S+G F  + +A  H+ + AKKV+I+APS+ APMFVMGVN + Y   + +VSNASCTTNCLAPLAK+I+D FGIEE LMTTVH++TATQKTVD PS KDWRGGR A  NIIPSSTGAAKAVGKV+PEL GKLTGMAFRVPT DVSVVDLTV+L     Y++I   ++   EG ++G++G+T++A+VS+D  GD+ SSIFDASAGIQL+ KFVKL+SWYDNE+GYS RV+DL+ H+ +
Sbjct:    3 RVAINGFGRIGRLVMRIALSRPNVEVVALNDPFITNDYAAYMFKYDSTHGRYAGEVSHDDKHIIVDGKKIATYQERDPANLPWGSSNVDIAIDSTGVFKELDTAQKHIDAGAKKVVITAPSSTAPMFVMGVNEEKYTSDLKIVSNASCTTNCLAPLAKVINDAFGIEEGLMTTVHSLTATQKTVDGPSHKDWRGGRTASGNIIPSSTGAAKAVGKVLPELQGKLTGMAFRVPTVDVSVVDLTVKLNKETTYDEIKKVVKAAAEGKLKGVLGYTEDAVVSSDFLGDSHSSIFDASAGIQLSPKFVKLVSWYDNEYGYSTRVVDLVEHVAK 331          
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Ensembl Yeast
Match: TDH1 (Glyceraldehyde-3-phosphate dehydrogenase (GAPDH), isozyme 1; involved in glycolysis and gluconeogenesis; tetramer that catalyzes the reaction of glyceraldehyde-3-phosphate to 1,3 bis-phosphoglycerate; detected in the cytoplasm and cell wall; protein abundance increases in response to DNA replication stress; GAPDH-derived antimicrobial peptides secreted by S. cerevisiae are active against a wide variety of wine-related yeasts and bateria [Source:SGD;Acc:S000003588])

HSP 1 Score: 429.483 bits (1103), Expect = 2.883e-151
Identity = 201/329 (61.09%), Postives = 254/329 (77.20%), Query Frame = 1
Query:   64 KVGINGFGRIGRLVLRAGLIQGKVDFVGINDPFVDVNYMVYMFKYDSTHGIYKNDVSEQDGFLVVADQKIQIFMEKDPSKIPWSDVDAEYVVESSGAFTTIQSASAHLPS-AKKVIISAPSADAPMFVMGVNHQLYEKSMNVVSNASCTTNCLAPLAKIIHDKFGIEEALMTTVHAVTATQKTVDAPSLKDWRGGRGAGQNIIPSSTGAAKAVGKVIPELNGKLTGMAFRVPTPDVSVVDLTVRLQNPAKYEDIVNAIRLECEGSMRGIMGFTDEALVSTDLCGDTRSSIFDASAGIQLNDKFVKLISWYDNEFGYSNRVIDLICHMYR 1047
            ++ INGFGRIGRLVLR  L +  ++ V +NDPF+  +Y  YM KYDSTHG YK  VS  D  +++   KI  + E+DP+ +PW  +  +  V+S+G F  + +A  H+ + AKKV+I+APS+ APMFV+GVNH  Y     +VSNASCTTNCLAPLAK+I+D FGIEE LMTTVH++TATQKTVD PS KDWRGGR A  NIIPSSTGAAKAVGKV+PEL GKLTGMAFRVPT DVSVVDLTV+L+  A Y+ I  A++   EG M+G++G+T++A+VS+D  GDT +SIFDASAGIQL+ KFVKLISWYDNE+GYS RV+DLI ++ +
Sbjct:    3 RIAINGFGRIGRLVLRLALQRKDIEVVAVNDPFISNDYAAYMVKYDSTHGRYKGTVSHDDKHIIIDGVKIATYQERDPANLPWGSLKIDVAVDSTGVFKELDTAQKHIDAGAKKVVITAPSSSAPMFVVGVNHTKYTPDKKIVSNASCTTNCLAPLAKVINDAFGIEEGLMTTVHSMTATQKTVDGPSHKDWRGGRTASGNIIPSSTGAAKAVGKVLPELQGKLTGMAFRVPTVDVSVVDLTVKLEKEATYDQIKKAVKAAAEGPMKGVLGYTEDAVVSSDFLGDTHASIFDASAGIQLSPKFVKLISWYDNEYGYSARVVDLIEYVAK 331          
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Ensembl Nematostella
Match: EDO40842 (Glyceraldehyde-3-phosphate dehydrogenase [Source:UniProtKB/TrEMBL;Acc:A7S5Y2])

HSP 1 Score: 454.521 bits (1168), Expect = 1.209e-160
Identity = 217/326 (66.56%), Postives = 262/326 (80.37%), Query Frame = 1
Query:   70 GINGFGRIGRLVLRAGLIQGKVDFVGINDPFVDVNYMVYMFKYDSTHGIYKNDVSEQDGFLVVADQKIQIFMEKDPSKIPWSDVDAEYVVESSGAFTTIQSASAHLPS-AKKVIISAPSADAPMFVMGVNHQLYEKSMNVVSNASCTTNCLAPLAKIIHDKFGIEEALMTTVHAVTATQKTVDAPSLKDWRGGRGAGQNIIPSSTGAAKAVGKVIPELNGKLTGMAFRVPTPDVSVVDLTVRLQNPAKYEDIVNAIRLECEGSMRG-IMGFTDEALVSTDLCGDTRSSIFDASAGIQLNDKFVKLISWYDNEFGYSNRVIDLICHM 1041
            GINGFGRIGRLV RA L +  V  V INDPF+D++YMVYMFKYDSTHG +K  V  +DG LV+  + + +F  KDP++IPW +  A+YVVES+G FTT++ A  HL   AKKVIISAPSADAPMFVMGVNH+ Y+ SM VVSNASCTTNCLAPL K+I+D FG+EE LMTT+HA TATQKTVD PS K+WR GRGA QN+IP+STGAAKAVGKVIPE+NGKLTGMAFRVP  DVSVVDLT RL+ PAKYE+I   ++   E    G  +G+T++ +VSTD  G+  SS+FDA AGIQLNDKFVKL++WYDNE+GYS+RV+DL+ +M
Sbjct:    5 GINGFGRIGRLVCRASLERDDVQIVAINDPFIDLDYMVYMFKYDSTHGRFKGTVEAKDGKLVINGKPVSVFACKDPTQIPWGETGADYVVESTGVFTTLEKAGFHLKGGAKKVIISAPSADAPMFVMGVNHEKYDPSMTVVSNASCTTNCLAPLVKVINDNFGLEEGLMTTIHAYTATQKTVDGPSAKNWRDGRGAHQNVIPASTGAAKAVGKVIPEVNGKLTGMAFRVPVADVSVVDLTCRLKKPAKYEEIKAVVKKASESKEMGQYLGYTEDQVVSTDFIGERVSSVFDARAGIQLNDKFVKLVTWYDNEYGYSHRVVDLMRYM 330          
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Ensembl Nematostella
Match: EDO29412 (Glyceraldehyde-3-phosphate dehydrogenase [Source:UniProtKB/TrEMBL;Acc:A7T3Q4])

HSP 1 Score: 219.935 bits (559), Expect = 1.453e-69
Identity = 118/255 (46.27%), Postives = 166/255 (65.10%), Query Frame = 1
Query:  271 IQIFMEKDPSKIPWSDVDAEYVVESSGAFTTIQSASAHLPS-AKKVIISAPS--ADAPMFVMGVNHQLYEKSMNVVSNASCTTNCLAPLAKIIHDKFGIEEALMTTVHAVTATQKTVDAPSLKDWRGGRGAGQNIIPSSTGAAKAVGKVIPELNGKLTGMAFRVPTPDVSVVDLTVRLQNPAKYEDIVNAIRLECEGSMRGIMGFTDEALVSTDLCGDTRSSIFDASAGIQLNDKFVKLISWYDNEFGYSNRVID 1026
            IQIF E+DP K+ W  +D + V E +G FT  ++A+ HL   AKKV++SAP+  ADA + V GVNH +      VVSNASCTTNCLAPLAK++++  GI E +MTT+HA T  Q   D  S   +R  R A  ++IP+ TGAA+AVG V+PEL GKL+G+A RVPT +VS+VDL+         E+I + +R   +GS   I+ + +  LVS D      S IFD S   ++++  +K+ +WYDNE+G+SNR++D
Sbjct:    8 IQIFSERDPHKLDWKSLDIDIVFECTGRFTEREAAAVHLAQGAKKVLVSAPAKGADATI-VYGVNHDILTAEHTVVSNASCTTNCLAPLAKVLNEHIGITEGMMTTIHAYTNDQHLSDVYSNDIYRA-RAATLSMIPTRTGAAEAVGLVLPELKGKLSGLAVRVPTANVSLVDLSFTPARATHAEEINHLMREASQGSFSNIIEYNELPLVSVDFNHHPASCIFD-STQTRVSEGLIKVFAWYDNEWGFSNRMLD 259          
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Ensembl Nematostella
Match: EDO25919 (Glyceraldehyde-3-phosphate dehydrogenase [Source:UniProtKB/TrEMBL;Acc:A7TDD3])

HSP 1 Score: 162.155 bits (409), Expect = 2.880e-47
Identity = 96/268 (35.82%), Postives = 151/268 (56.34%), Query Frame = 1
Query:  271 IQIFMEKDPSKIPWSDVDAE--YVVESSGAFTTIQSASAHLPS--AKKVIISAPSADAPMFVMGVNHQLYE-KSMNVVSNASCTTNCLAPLAKIIHDKFGIEEALMTTVHAVTATQKTVDAPSLKDWRGGRGAGQNIIPSSTGAAKAVGKVIPELNGKLTGMAFRVPTPDVSVVDLTVRLQNPAKYEDIVNAI-RLECEGSMRGIMGFT-DEALVSTDLCGDTRSSIFDASAGIQLND-KFVKLISWYDNEFGYSNRVIDLICHMYRI 1050
            + +     P +I ++    E   V++++GAFTT ++   HL S  A KV+++AP    P  V GVNH  +    +N+ S ASCTTN + P+  +I D  G+ +  + T+HA T  Q  VD    K +R GR A  N++ + TGA  AV K +P L GKLT  A RVP P+ S+V L + +      E++ N I +   EG +   + ++ +  LVS+D+ G    SI+D++A I   D K + +  WYDNE+GYS++VI L  ++ ++
Sbjct:    4 VHLITANGPEEIDYTQYGIEDALVIDNTGAFTTEEALQRHLTSKGATKVLLTAPGKGVPNIVYGVNHTEFNPDEVNIYSAASCTTNAITPILNVIEDTLGVTKGHIETIHAYTNDQNLVDNMH-KKYRRGRSAALNMVITETGAGSAVAKALPSLAGKLTSNAIRVPVPNGSLVVLNLEVDKTTTVEELNNIIKKYALEGKLVEQIKYSLNNELVSSDIVGTPAPSIYDSNATIVSADGKNIVMYVWYDNEYGYSHQVIRLAKYISKV 270          
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Ensembl Medaka
Match: gapdh (glyceraldehyde-3-phosphate dehydrogenase [Source:NCBI gene;Acc:101172760])

HSP 1 Score: 487.649 bits (1254), Expect = 2.671e-173
Identity = 230/327 (70.34%), Postives = 268/327 (81.96%), Query Frame = 1
Query:   64 KVGINGFGRIGRLVLRAGLIQGKVDFVGINDPFVDVNYMVYMFKYDSTHGIYKNDVSEQDGFLVVADQKIQIFMEKDPSKIPWSDVDAEYVVESSGAFTTIQSASAHLPS-AKKVIISAPSADAPMFVMGVNHQLYEKSMNVVSNASCTTNCLAPLAKIIHDKFGIEEALMTTVHAVTATQKTVDAPSLKDWRGGRGAGQNIIPSSTGAAKAVGKVIPELNGKLTGMAFRVPTPDVSVVDLTVRLQNPAKYEDIVNAIRLECEGSMRGIMGFTDEALVSTDLCGDTRSSIFDASAGIQLNDKFVKLISWYDNEFGYSNRVIDLICHM 1041
            KVGINGFGRIGRLV RA     KV+ V INDPF+D++YMVYMFKYDSTH  +K +V  + G LV+   +I +F E+DP+ I W +  A+YVVES+G FTTI+ ASAHL   AK+VIISAPSADAPMFVMGVNH+ Y+ S+ VVSNASCTTNCLAPLAK++HD FGI E LM+TVHA+TATQKTVD PS K WR GRGA QNIIP+STGAAKAVGKVIPELNGKLTGMAFRVPTP+VSVVDLTVRL+ PAKY+DI   ++   EG M+G +G+T++ +VSTD  GDT SSIFDA AGI LND FVKL+SWYDNEFGYSNRV DL+ HM
Sbjct:    3 KVGINGFGRIGRLVTRAAFTSKKVEIVAINDPFIDLDYMVYMFKYDSTHNRFKGEVKAEGGKLVIDGHQITVFHERDPTNIKWGEAGAQYVVESTGVFTTIEKASAHLKGGAKRVIISAPSADAPMFVMGVNHEKYDNSLTVVSNASCTTNCLAPLAKVVHDNFGIVEGLMSTVHAITATQKTVDGPSGKLWRDGRGASQNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPTPNVSVVDLTVRLEKPAKYDDIKKVVKAASEGPMKGFLGYTEDQVVSTDFNGDTHSSIFDAGAGIALNDHFVKLVSWYDNEFGYSNRVCDLMAHM 329          
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Ensembl Medaka
Match: gapdh (glyceraldehyde-3-phosphate dehydrogenase [Source:NCBI gene;Acc:101172760])

HSP 1 Score: 487.649 bits (1254), Expect = 2.671e-173
Identity = 230/327 (70.34%), Postives = 268/327 (81.96%), Query Frame = 1
Query:   64 KVGINGFGRIGRLVLRAGLIQGKVDFVGINDPFVDVNYMVYMFKYDSTHGIYKNDVSEQDGFLVVADQKIQIFMEKDPSKIPWSDVDAEYVVESSGAFTTIQSASAHLPS-AKKVIISAPSADAPMFVMGVNHQLYEKSMNVVSNASCTTNCLAPLAKIIHDKFGIEEALMTTVHAVTATQKTVDAPSLKDWRGGRGAGQNIIPSSTGAAKAVGKVIPELNGKLTGMAFRVPTPDVSVVDLTVRLQNPAKYEDIVNAIRLECEGSMRGIMGFTDEALVSTDLCGDTRSSIFDASAGIQLNDKFVKLISWYDNEFGYSNRVIDLICHM 1041
            KVGINGFGRIGRLV RA     KV+ V INDPF+D++YMVYMFKYDSTH  +K +V  + G LV+   +I +F E+DP+ I W +  A+YVVES+G FTTI+ ASAHL   AK+VIISAPSADAPMFVMGVNH+ Y+ S+ VVSNASCTTNCLAPLAK++HD FGI E LM+TVHA+TATQKTVD PS K WR GRGA QNIIP+STGAAKAVGKVIPELNGKLTGMAFRVPTP+VSVVDLTVRL+ PAKY+DI   ++   EG M+G +G+T++ +VSTD  GDT SSIFDA AGI LND FVKL+SWYDNEFGYSNRV DL+ HM
Sbjct:    3 KVGINGFGRIGRLVTRAAFTSKKVEIVAINDPFIDLDYMVYMFKYDSTHNRFKGEVKAEGGKLVIDGHQITVFHERDPTNIKWGEAGAQYVVESTGVFTTIEKASAHLKGGAKRVIISAPSADAPMFVMGVNHEKYDNSLTVVSNASCTTNCLAPLAKVVHDNFGIVEGLMSTVHAITATQKTVDGPSGKLWRDGRGASQNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPTPNVSVVDLTVRLEKPAKYDDIKKVVKAASEGPMKGFLGYTEDQVVSTDFNGDTHSSIFDAGAGIALNDHFVKLVSWYDNEFGYSNRVCDLMAHM 329          
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Ensembl Medaka
Match: gapdhs (glyceraldehyde-3-phosphate dehydrogenase 2 [Source:NCBI gene;Acc:101167730])

HSP 1 Score: 445.277 bits (1144), Expect = 1.123e-156
Identity = 217/328 (66.16%), Postives = 255/328 (77.74%), Query Frame = 1
Query:   67 VGINGFGRIGRLVLRAGLIQGKVDFVGINDPFVDVNYMVYMFKYDSTHGIYKNDVSEQDGFLVVADQKIQIFMEKDPSKIPWSDVDAEYVVESSGAFTTIQSASAHLPS-AKKVIISAPSADAPMFVMGVNHQLYE-KSMNVVSNASCTTNCLAPLAKIIHDKFGIEEALMTTVHAVTATQKTVDAPSLKDWRGGRGAGQNIIPSSTGAAKAVGKVIPELNGKLTGMAFRVPTPDVSVVDLTVRLQNPAKYEDIVNAIRLECEGSMRGIMGFTDEALVSTDLCGDTRSSIFDASAGIQLNDKFVKLISWYDNEFGYSNRVIDLICHMY 1044
            VGINGFGRIGRLVLRA L +G +  V INDPF+D+ YMVYMFKYDSTHG Y  +VS +DG L+V    I +F    P++IPW    A+YVVES+G F +++ AS H+   A++V++SAPS DAPMFVMGVN   Y+  SM +VSNASCTTNCLAPLAK+IHD FGIEEALMTTVHA TATQKTVD PS K WR GRGA  NIIP+STGAAKAVGKVIP LNGKLTGMAFRVP  DVSVVDLT RL   A Y +I  A++    G M+GI+G+T++ +VS+D  GDT SSIFDA AGI LND FVKLISWYDNE+GYS RV DL+ +M+
Sbjct:    6 VGINGFGRIGRLVLRACLQKG-IKVVAINDPFIDLQYMVYMFKYDSTHGRYHGEVSHEDGKLIVDGNAISVFQCMKPAEIPWGSAGAKYVVESTGVFLSVEKASLHIQGGAQRVVVSAPSPDAPMFVMGVNEDKYDPSSMTIVSNASCTTNCLAPLAKVIHDNFGIEEALMTTVHAYTATQKTVDGPSAKAWRDGRGAHANIIPASTGAAKAVGKVIPALNGKLTGMAFRVPVADVSVVDLTCRLSKAASYGEIKEAVKKAAHGPMKGILGYTEDQVVSSDFIGDTHSSIFDAGAGISLNDNFVKLISWYDNEYGYSTRVADLLLYMH 332          
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Ensembl Medaka
Match: gapdhs (glyceraldehyde-3-phosphate dehydrogenase 2 [Source:NCBI gene;Acc:101167730])

HSP 1 Score: 395.971 bits (1016), Expect = 7.996e-138
Identity = 191/291 (65.64%), Postives = 225/291 (77.32%), Query Frame = 1
Query:  178 MVYMFKYDSTHGIYKNDVSEQDGFLVVADQKIQIFMEKDPSKIPWSDVDAEYVVESSGAFTTIQSASAHLPS-AKKVIISAPSADAPMFVMGVNHQLYE-KSMNVVSNASCTTNCLAPLAKIIHDKFGIEEALMTTVHAVTATQKTVDAPSLKDWRGGRGAGQNIIPSSTGAAKAVGKVIPELNGKLTGMAFRVPTPDVSVVDLTVRLQNPAKYEDIVNAIRLECEGSMRGIMGFTDEALVSTDLCGDTRSSIFDASAGIQLNDKFVKLISWYDNEFGYSNRVIDLICHMY 1044
            MVYMFKYDSTHG Y  +VS +DG L+V    I +F    P++IPW    A+YVVES+G F +++ AS H+   A++V++SAPS DAPMFVMGVN   Y+  SM +VSNASCTTNCLAPLAK+IHD FGIEEALMTTVHA TATQKTVD PS K WR GRGA  NIIP+STGAAKAVGKVIP LNGKLTGMAFRVP  DVSVVDLT RL   A Y +I  A++    G M+GI+G+T++ +VS+D  GDT SSIFDA AGI LND FVKLISWYDNE+GYS RV DL+ +M+
Sbjct:    1 MVYMFKYDSTHGRYHGEVSHEDGKLIVDGNAISVFQCMKPAEIPWGSAGAKYVVESTGVFLSVEKASLHIQGGAQRVVVSAPSPDAPMFVMGVNEDKYDPSSMTIVSNASCTTNCLAPLAKVIHDNFGIEEALMTTVHAYTATQKTVDGPSAKAWRDGRGAHANIIPASTGAAKAVGKVIPALNGKLTGMAFRVPVADVSVVDLTCRLSKAASYGEIKEAVKKAAHGPMKGILGYTEDQVVSSDFIGDTHSSIFDAGAGISLNDNFVKLISWYDNEYGYSTRVADLLLYMH 291          
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Planmine SMEST
Match: SMESG000023748.1 (SMESG000023748.1)

HSP 1 Score: 697.582 bits (1799), Expect = 0.000e+0
Identity = 336/337 (99.70%), Postives = 337/337 (100.00%), Query Frame = 1
Query:   49 MSGKPKVGINGFGRIGRLVLRAGLIQGKVDFVGINDPFVDVNYMVYMFKYDSTHGIYKNDVSEQDGFLVVADQKIQIFMEKDPSKIPWSDVDAEYVVESSGAFTTIQSASAHLPSAKKVIISAPSADAPMFVMGVNHQLYEKSMNVVSNASCTTNCLAPLAKIIHDKFGIEEALMTTVHAVTATQKTVDAPSLKDWRGGRGAGQNIIPSSTGAAKAVGKVIPELNGKLTGMAFRVPTPDVSVVDLTVRLQNPAKYEDIVNAIRLECEGSMRGIMGFTDEALVSTDLCGDTRSSIFDASAGIQLNDKFVKLISWYDNEFGYSNRVIDLICHMYRIDHT 1059
            MSGKPKVGINGFGRIGRLVLRAGLIQGKVDFVGINDPFVDVNYMVYMFKYDSTHGIYKNDVSEQDGFLVVADQKIQIFMEKDPSKIPWSDVDAEYVVESSGAFTTIQSASAHLPSAKKVIISAPSADAPMFVMGVNHQLYEKSMNVVSNASCTTNCLAPLAKIIHDKFGIEEALMTTVHAVTATQKTVDAPSLKDWRGGRGAGQNIIPSSTGAAKAVGKVIPELNGKLTG+AFRVPTPDVSVVDLTVRLQNPAKYEDIVNAIRLECEGSMRGIMGFTDEALVSTDLCGDTRSSIFDASAGIQLNDKFVKLISWYDNEFGYSNRVIDLICHMYRIDHT
Sbjct:    1 MSGKPKVGINGFGRIGRLVLRAGLIQGKVDFVGINDPFVDVNYMVYMFKYDSTHGIYKNDVSEQDGFLVVADQKIQIFMEKDPSKIPWSDVDAEYVVESSGAFTTIQSASAHLPSAKKVIISAPSADAPMFVMGVNHQLYEKSMNVVSNASCTTNCLAPLAKIIHDKFGIEEALMTTVHAVTATQKTVDAPSLKDWRGGRGAGQNIIPSSTGAAKAVGKVIPELNGKLTGIAFRVPTPDVSVVDLTVRLQNPAKYEDIVNAIRLECEGSMRGIMGFTDEALVSTDLCGDTRSSIFDASAGIQLNDKFVKLISWYDNEFGYSNRVIDLICHMYRIDHT 337          
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Planmine SMEST
Match: SMESG000023748.1 (SMESG000023748.1)

HSP 1 Score: 615.15 bits (1585), Expect = 0.000e+0
Identity = 298/299 (99.67%), Postives = 299/299 (100.00%), Query Frame = 1
Query:   49 MSGKPKVGINGFGRIGRLVLRAGLIQGKVDFVGINDPFVDVNYMVYMFKYDSTHGIYKNDVSEQDGFLVVADQKIQIFMEKDPSKIPWSDVDAEYVVESSGAFTTIQSASAHLPSAKKVIISAPSADAPMFVMGVNHQLYEKSMNVVSNASCTTNCLAPLAKIIHDKFGIEEALMTTVHAVTATQKTVDAPSLKDWRGGRGAGQNIIPSSTGAAKAVGKVIPELNGKLTGMAFRVPTPDVSVVDLTVRLQNPAKYEDIVNAIRLECEGSMRGIMGFTDEALVSTDLCGDTRSSIFDASA 945
            MSGKPKVGINGFGRIGRLVLRAGLIQGKVDFVGINDPFVDVNYMVYMFKYDSTHGIYKNDVSEQDGFLVVADQKIQIFMEKDPSKIPWSDVDAEYVVESSGAFTTIQSASAHLPSAKKVIISAPSADAPMFVMGVNHQLYEKSMNVVSNASCTTNCLAPLAKIIHDKFGIEEALMTTVHAVTATQKTVDAPSLKDWRGGRGAGQNIIPSSTGAAKAVGKVIPELNGKLTG+AFRVPTPDVSVVDLTVRLQNPAKYEDIVNAIRLECEGSMRGIMGFTDEALVSTDLCGDTRSSIFDASA
Sbjct:    1 MSGKPKVGINGFGRIGRLVLRAGLIQGKVDFVGINDPFVDVNYMVYMFKYDSTHGIYKNDVSEQDGFLVVADQKIQIFMEKDPSKIPWSDVDAEYVVESSGAFTTIQSASAHLPSAKKVIISAPSADAPMFVMGVNHQLYEKSMNVVSNASCTTNCLAPLAKIIHDKFGIEEALMTTVHAVTATQKTVDAPSLKDWRGGRGAGQNIIPSSTGAAKAVGKVIPELNGKLTGIAFRVPTPDVSVVDLTVRLQNPAKYEDIVNAIRLECEGSMRGIMGFTDEALVSTDLCGDTRSSIFDASA 299          
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Planmine SMEST
Match: SMESG000034925.1 (SMESG000034925.1)

HSP 1 Score: 575.474 bits (1482), Expect = 0.000e+0
Identity = 270/336 (80.36%), Postives = 299/336 (88.99%), Query Frame = 1
Query:   49 MSGKPKVGINGFGRIGRLVLRAGLIQGKVDFVGINDPFVDVNYMVYMFKYDSTHGIYKNDVSEQDGFLVVADQKIQIFMEKDPSKIPWSDVDAEYVVESSGAFTTIQSASAHLPSAKKVIISAPSADAPMFVMGVNHQLYEKSMNVVSNASCTTNCLAPLAKIIHDKFGIEEALMTTVHAVTATQKTVDAPSLKDWRGGRGAGQNIIPSSTGAAKAVGKVIPELNGKLTGMAFRVPTPDVSVVDLTVRLQNPAKYEDIVNAIRLECEGSMRGIMGFTDEALVSTDLCGDTRSSIFDASAGIQLNDKFVKLISWYDNEFGYSNRVIDLICHMYRIDH 1056
            M+ KPKVGINGFGRIGRLVLRAGL++  V FVG+NDPFVDV+YMVYMFKYDSTHG +K+ V    G L+V DQ I +FMEKDP+KIPW  V A+YVVESSG FTTI +ASAHLP+ KKVIISAPSADAPMFVMGVN   YEK+MNVVSNASCTTNCLAPLAKIIHD FGIEEALMTTVHAVTATQKTVDAPSLKDWRGGRGAGQNIIPSSTGAAKAVGKVIPELNGKLTGMAFRVPTPDVSVVDLTVRL+ P KY+ I  A++   +G M+GIMG+T++ +VSTD+CGD RSSIFDA AGIQL+D FVKLISWYDNEFGYSNRVIDLICHMY++D+
Sbjct:    1 MASKPKVGINGFGRIGRLVLRAGLLKKNVTFVGVNDPFVDVDYMVYMFKYDSTHGKFKDSVKADKGNLIVGDQSIAVFMEKDPTKIPWDKVQADYVVESSGVFTTIAAASAHLPATKKVIISAPSADAPMFVMGVNQDKYEKTMNVVSNASCTTNCLAPLAKIIHDNFGIEEALMTTVHAVTATQKTVDAPSLKDWRGGRGAGQNIIPSSTGAAKAVGKVIPELNGKLTGMAFRVPTPDVSVVDLTVRLKKPTKYQAIKEAVKKASQGPMKGIMGYTEDQVVSTDMCGDVRSSIFDAEAGIQLSDTFVKLISWYDNEFGYSNRVIDLICHMYKVDN 336          
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Planmine SMEST
Match: SMESG000033355.1 (SMESG000033355.1)

HSP 1 Score: 465.692 bits (1197), Expect = 1.025e-164
Identity = 225/335 (67.16%), Postives = 264/335 (78.81%), Query Frame = 1
Query:   58 KPKVGINGFGRIGRLVLRAGLIQGKVDFVGINDPFVDVNYMVYMFKYDSTHGIYKNDVSEQDGFLVVADQKIQIFMEKDPSKIPWSDVDAEYVVESSGAFTTIQSASAHLPS--AKKVIISAPSADAPMFVMGVNHQLYEKSMNVVSNASCTTNCLAPLAKIIHDKFGIEEALMTTVHAVTATQKTVDAPSLKDWRGGRGAGQNIIPSSTGAAKAVGKVIPELNGKLTGMAFRVPTPDVSVVDLTVRLQNPAKYEDIVNAIRLECEGSMRGIMGFTDEALVSTDLCGDTRSSIFDASAGIQLNDKFVKLISWYDNEFGYSNRVIDLICHMYRIDH 1056
            K +VGINGFGRIGRLVLRA + +  +D V INDPF+++ YMVYMFKYDSTHG +   V  +D  L+V    I +F E++P +IPW   + EYVVES+G FTTI  ASAH+ +  AKKVIISAPSADAPMFVMGVN + Y+  M VVSNASCTTNCLAPLAK+I+D FGIEE LMTT+HA TATQKTVD PS K WR GRGA QNIIP+STGAAKAVG+VI ELNGKLTGMAFRVP  DVSVVDLT +L+ PAKY +I  AI+   E SM+ I+G+T++ +VS D  GD  SSIFDA+AGIQLND FVKL+SWYDNEFGYS RV+DLI +M   DH
Sbjct:    2 KAQVGINGFGRIGRLVLRAAIEKETIDVVAINDPFINLEYMVYMFKYDSTHGKFPGTVEAKDDKLMVNGHAISVFNERNPEEIPWDKANCEYVVESTGVFTTIDKASAHIKNNRAKKVIISAPSADAPMFVMGVNQEKYDPKMKVVSNASCTTNCLAPLAKVINDNFGIEEGLMTTIHAYTATQKTVDGPSAKLWRDGRGAAQNIIPASTGAAKAVGQVITELNGKLTGMAFRVPVADVSVVDLTCKLKKPAKYSEIKAAIKKASETSMKNILGYTEDEVVSQDFRGDQHSSIFDANAGIQLNDTFVKLVSWYDNEFGYSCRVVDLIAYMMTRDH 336          
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Planmine SMEST
Match: SMESG000052353.1 (SMESG000052353.1)

HSP 1 Score: 446.047 bits (1146), Expect = 5.155e-157
Identity = 226/335 (67.46%), Postives = 265/335 (79.10%), Query Frame = 1
Query:   58 KPKVGINGFGRIGRLVLRAGLIQGKVDFVGINDPFVDVNYMVYMFKYDSTHGIYKNDVSEQDGFLVVADQKIQIFMEKDPSKIPWSDVDAEYVVESSGAFTTIQSASAHLPS--AKKVIISAPSADAPMFVMGVNHQLYEKSMNVVSNASCTTNCLAPLAKIIHDKFGIEEALMTTVHAVTATQKTVDAPSLKDWRGGRGAGQNIIPSSTGAAKAVGKVIPELNGKLTGMAFRVPTPDVSVVDLTVRLQNPAKYEDIVNAIRLECEGSMRGIMGFTDEALVSTDLCGDTRSSIFDASAGIQLNDKFVKLISWYDNEFGYSNRVIDLICHMYRIDH 1056
            KP+VGINGFGRIGRLVLRA L +G VD V +NDPF++++YMVYMFKYDSTHG +   V  +DG LVV    I ++ +K+P +IPW      YVVES+G FTTI+ AS H  +  AKKVIISAPSADAPM+VMGVNH+ Y+  +++VSNASCTTNCLAPLAK+I D FGI E LMTT+HA TATQKTVD PS K WR GRGA QNIIP+STGAAKAVGKVIPELNGK+TGMAFRVP PDVSVVDLT +L  PAKY++I  AI+   E SM+GI+ +T+E +VS D  GD  SSIFDA AGIQL D FVKL++WYDNE+GYS RVIDLI HM   DH
Sbjct:    3 KPRVGINGFGRIGRLVLRAALEKGTVDVVALNDPFIELDYMVYMFKYDSTHGKFHGHVETKDGKLVVDGHAISVYNKKNPEEIPWDHDQCYYVVESTGVFTTIEKASMHTKNNRAKKVIISAPSADAPMYVMGVNHEKYDPKISIVSNASCTTNCLAPLAKVIVDNFGIVEGLMTTIHAYTATQKTVDGPSSKLWRDGRGAAQNIIPASTGAAKAVGKVIPELNGKITGMAFRVPVPDVSVVDLTCKLSKPAKYDEIKAAIKHASETSMKGILAYTEEEVVSQDFKGDHHSSIFDAKAGIQLTDTFVKLVAWYDNEYGYSCRVIDLIQHMSTKDH 337          
The following BLAST results are available for this feature:
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GAPDH5.357e-17370.30glyceraldehyde-3-phosphate dehydrogenase [Source:H... [more]
GAPDH5.357e-17370.30glyceraldehyde-3-phosphate dehydrogenase [Source:H... [more]
GAPDH5.357e-17370.30glyceraldehyde-3-phosphate dehydrogenase [Source:H... [more]
GAPDHS4.851e-15666.16glyceraldehyde-3-phosphate dehydrogenase, spermato... [more]
GAPDH3.235e-14969.90glyceraldehyde-3-phosphate dehydrogenase [Source:H... [more]
back to top
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gpd-31.414e-16065.67Glyceraldehyde-3-phosphate dehydrogenase 3 [Sourc... [more]
gpd-31.414e-16065.67Glyceraldehyde-3-phosphate dehydrogenase 3 [Sourc... [more]
gpd-21.560e-16065.67Glyceraldehyde-3-phosphate dehydrogenase 2 [Sourc... [more]
gpd-21.560e-16065.67Glyceraldehyde-3-phosphate dehydrogenase 2 [Sourc... [more]
gpd-14.068e-15866.27Glyceraldehyde-3-phosphate dehydrogenase 1 [Sourc... [more]
back to top
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Gapdh25.000e-16569.49gene:FBgn0001092 transcript:FBtr0074112[more]
Gapdh25.000e-16569.49gene:FBgn0001092 transcript:FBtr0332618[more]
Gapdh14.036e-16469.49gene:FBgn0001091 transcript:FBtr0100479[more]
Gapdh14.036e-16469.49gene:FBgn0001091 transcript:FBtr0088903[more]
CG90106.820e-13958.58gene:FBgn0034173 transcript:FBtr0087067[more]
back to top
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gapdh5.333e-17069.42glyceraldehyde-3-phosphate dehydrogenase [Source:N... [more]
gapdh5.333e-17069.42glyceraldehyde-3-phosphate dehydrogenase [Source:N... [more]
gapdhs1.816e-16168.29glyceraldehyde-3-phosphate dehydrogenase, spermato... [more]
gapdhs1.816e-16168.29glyceraldehyde-3-phosphate dehydrogenase, spermato... [more]
gapdh2.180e-12171.31glyceraldehyde-3-phosphate dehydrogenase [Source:N... [more]
back to top
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mbd36.466e-16869.42methyl-CpG binding domain protein 3 [Source:Xenbas... [more]
mbd37.532e-16469.16methyl-CpG binding domain protein 3 [Source:Xenbas... [more]
mbd31.224e-16368.39methyl-CpG binding domain protein 3 [Source:Xenbas... [more]
mbd31.462e-16369.16methyl-CpG binding domain protein 3 [Source:Xenbas... [more]
mbd32.305e-16369.16methyl-CpG binding domain protein 3 [Source:Xenbas... [more]
back to top
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Gm38394.525e-17068.50predicted pseudogene 3839 [Source:MGI Symbol;Acc:M... [more]
Gapdh1.442e-16968.50glyceraldehyde-3-phosphate dehydrogenase [Source:M... [more]
Gapdh1.442e-16968.50glyceraldehyde-3-phosphate dehydrogenase [Source:M... [more]
Gm103585.301e-16968.20predicted gene 10358 [Source:MGI Symbol;Acc:MGI:37... [more]
Gapdh9.056e-16968.50glyceraldehyde-3-phosphate dehydrogenase [Source:M... [more]
back to top
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q05025|G3P_COTJA1.943e-17470.95Glyceraldehyde-3-phosphate dehydrogenase OS=Coturn... [more]
sp|P00356|G3P_CHICK2.850e-17470.64Glyceraldehyde-3-phosphate dehydrogenase OS=Gallus... [more]
sp|Q5R2J2|G3P_PELSI2.354e-17370.34Glyceraldehyde-3-phosphate dehydrogenase OS=Pelodi... [more]
sp|P04406|G3P_HUMAN2.573e-17270.30Glyceraldehyde-3-phosphate dehydrogenase OS=Homo s... [more]
sp|P51469|G3P_XENLA3.435e-17271.56Glyceraldehyde-3-phosphate dehydrogenase OS=Xenopu... [more]
back to top
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3B4CTS41.795e-17371.87Glyceraldehyde-3-phosphate dehydrogenase OS=Pygoce... [more]
A0A3B3QXW71.729e-17271.25Glyceraldehyde-3-phosphate dehydrogenase OS=Paramo... [more]
A0A1W7RH862.955e-17271.25Glyceraldehyde-3-phosphate dehydrogenase OS=Agkist... [more]
A0A226MZ718.447e-17270.64Glyceraldehyde-3-phosphate dehydrogenase OS=Callip... [more]
G1NMR68.447e-17270.64Glyceraldehyde-3-phosphate dehydrogenase OS=Meleag... [more]
back to top
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000050002.12.196e-17270.03glyceraldehyde-3-phosphate dehydrogenase-like [Sou... [more]
gapdh4.671e-17270.95glyceraldehyde-3-phosphate dehydrogenase [Source:N... [more]
gapdhs2.544e-16167.38glyceraldehyde-3-phosphate dehydrogenase 2 [Source... [more]
gapdhs2.544e-16167.38glyceraldehyde-3-phosphate dehydrogenase 2 [Source... [more]
gapdhs2.544e-16167.38glyceraldehyde-3-phosphate dehydrogenase 2 [Source... [more]
back to top
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
gapdh1.511e-14766.67glyceraldehyde-3-phosphate dehydrogenase [Source:N... [more]
gapdh7.320e-12269.80glyceraldehyde-3-phosphate dehydrogenase [Source:N... [more]
back to top
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
TDH22.141e-15260.18Glyceraldehyde-3-phosphate dehydrogenase (GAPDH), ... [more]
TDH33.947e-15260.18Glyceraldehyde-3-phosphate dehydrogenase (GAPDH), ... [more]
TDH12.883e-15161.09Glyceraldehyde-3-phosphate dehydrogenase (GAPDH), ... [more]
back to top
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO408421.209e-16066.56Glyceraldehyde-3-phosphate dehydrogenase [Source:... [more]
EDO294121.453e-6946.27Glyceraldehyde-3-phosphate dehydrogenase [Source:... [more]
EDO259192.880e-4735.82Glyceraldehyde-3-phosphate dehydrogenase [Source:... [more]
back to top
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
gapdh2.671e-17370.34glyceraldehyde-3-phosphate dehydrogenase [Source:N... [more]
gapdh2.671e-17370.34glyceraldehyde-3-phosphate dehydrogenase [Source:N... [more]
gapdhs1.123e-15666.16glyceraldehyde-3-phosphate dehydrogenase 2 [Source... [more]
gapdhs7.996e-13865.64glyceraldehyde-3-phosphate dehydrogenase 2 [Source... [more]
back to top
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000023748.10.000e+099.70SMESG000023748.1[more]
SMESG000023748.10.000e+099.67SMESG000023748.1[more]
SMESG000034925.10.000e+080.36SMESG000034925.1[more]
SMESG000033355.11.025e-16467.16SMESG000033355.1[more]
SMESG000052353.15.155e-15767.46SMESG000052353.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30009707 ID=SMED30009707|Name=Glyceraldehyde-3-phosphate dehydrogenase|organism=Schmidtea mediterranea sexual|type=transcript|length=1198bp
ATCAGTTACCATTCATTAATCTATCAACAGATTAATTAAAATTAATTAAT
GAGTGGTAAACCAAAAGTAGGAATTAACGGTTTTGGAAGAATAGGCCGAT
TGGTACTTCGGGCTGGACTGATTCAAGGAAAGGTTGATTTCGTTGGAATT
AATGATCCTTTCGTGGATGTCAACTACATGGTGTACATGTTTAAGTATGA
CTCCACGCATGGTATTTATAAAAATGATGTCTCTGAACAAGACGGCTTCT
TAGTTGTCGCTGATCAGAAAATACAGATCTTTATGGAAAAAGATCCCTCA
AAAATTCCTTGGTCAGATGTCGATGCAGAGTATGTAGTAGAGAGTAGCGG
TGCTTTTACAACTATACAATCGGCTTCTGCTCATTTGCCGTCAGCAAAAA
AAGTGATAATCAGTGCTCCGTCGGCAGATGCACCTATGTTTGTGATGGGT
GTCAACCATCAGTTATATGAAAAGTCAATGAATGTCGTTTCTAATGCATC
GTGCACTACTAATTGTCTAGCTCCTTTGGCTAAGATTATACATGATAAAT
TTGGAATTGAAGAAGCATTGATGACAACTGTTCATGCTGTTACTGCAACT
CAAAAAACAGTAGATGCTCCATCACTTAAAGATTGGAGAGGTGGCAGAGG
AGCAGGGCAGAATATTATACCATCATCAACTGGAGCTGCTAAAGCTGTTG
GGAAAGTTATTCCAGAGTTAAATGGCAAATTGACTGGAATGGCATTTCGT
GTTCCGACTCCTGACGTATCAGTCGTTGATCTAACGGTTAGATTACAGAA
TCCGGCTAAATATGAAGATATTGTAAATGCAATACGTTTGGAATGTGAAG
GTTCGATGAGAGGTATAATGGGTTTTACTGATGAAGCTCTAGTGTCAACT
GATCTCTGTGGGGATACTCGGTCTTCAATCTTCGACGCTTCAGCAGGTAT
TCAGCTAAATGATAAATTTGTGAAATTAATTTCTTGGTATGACAATGAAT
TCGGTTATAGCAATAGAGTTATAGACTTGATCTGTCACATGTATAGAATA
GATCATACGTGATTCAGAATTTTGATCTAGAAACTATTTATCGTGATCAG
TGAAACAGTTATTCTAGTTTATTACGTATTTTACATTGATAGTTATGATT
ATGGATAAATCATGTATTTTTATTACTTAATTTGATTACAAATAAAAC
back to top

protein sequence of SMED30009707-orf-1

>SMED30009707-orf-1 ID=SMED30009707-orf-1|Name=SMED30009707-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=338bp
MSGKPKVGINGFGRIGRLVLRAGLIQGKVDFVGINDPFVDVNYMVYMFKY
DSTHGIYKNDVSEQDGFLVVADQKIQIFMEKDPSKIPWSDVDAEYVVESS
GAFTTIQSASAHLPSAKKVIISAPSADAPMFVMGVNHQLYEKSMNVVSNA
SCTTNCLAPLAKIIHDKFGIEEALMTTVHAVTATQKTVDAPSLKDWRGGR
GAGQNIIPSSTGAAKAVGKVIPELNGKLTGMAFRVPTPDVSVVDLTVRLQ
NPAKYEDIVNAIRLECEGSMRGIMGFTDEALVSTDLCGDTRSSIFDASAG
IQLNDKFVKLISWYDNEFGYSNRVIDLICHMYRIDHT*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005811lipid particle
GO:0005886plasma membrane
GO:0031965nuclear membrane
GO:0043231intracellular membrane-bounded organelle
GO:0097452GAIT complex
GO:1990904ribonucleoprotein complex
GO:0005634nucleus
GO:0005737cytoplasm
GO:0005829cytosol
GO:0005856cytoskeleton
GO:0015630microtubule cytoskeleton
Vocabulary: biological process
TermDefinition
GO:0010951negative regulation of endopeptidase activity
GO:0017148negative regulation of translation
GO:0031640killing of cells of other organism
GO:0050715positive regulation of cytokine secretion
GO:0050832defense response to fungus
GO:0051873killing by host of symbiont cells
GO:0052501positive regulation by organism of apoptotic process in other organism involved in symbiotic interaction
GO:0061844antimicrobial humoral immune response mediated by antimicrobial peptide
GO:0071346cellular response to interferon-gamma
GO:0055114oxidation-reduction process
GO:0000226microtubule cytoskeleton organization
GO:0006006glucose metabolic process
GO:0006096glycolytic process
GO:0006915apoptotic process
GO:0035606peptidyl-cysteine S-trans-nitrosylation
GO:0050821protein stabilization
GO:0051402neuron apoptotic process
Vocabulary: molecular function
TermDefinition
GO:0019828aspartic-type endopeptidase inhibitor activity
GO:0042802identical protein binding
GO:0097718disordered domain specific binding
GO:0016620oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor
GO:0004365glyceraldehyde-3-phosphate dehydrogenase (NAD+) (phosphorylating) activity
GO:0008017microtubule binding
GO:0016491oxidoreductase activity
GO:0016740transferase activity
GO:0035605peptidyl-cysteine S-nitrosylase activity
GO:0050661NADP binding
GO:0051287NAD binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR006424Glyceraldehyde-3-P_DH_1
IPR036291NAD(P)-bd_dom_sf
IPR020831GlycerAld/Erythrose_P_DH
IPR020828GlycerAld_3-P_DH_NAD(P)-bd
IPR020829GlycerAld_3-P_DH_cat
IPR016040NAD(P)-bd_dom
IPR020830GlycerAld_3-P_DH_AS
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR020831Glyceraldehyde/Erythrose phosphate dehydrogenase familyPRINTSPR00078G3PDHDRGNASEcoord: 270..285
score: 47.46
coord: 173..189
score: 72.87
coord: 146..164
score: 81.41
coord: 230..247
score: 77.21
coord: 111..124
score: 55.55
IPR020831Glyceraldehyde/Erythrose phosphate dehydrogenase familyPIRSFPIRSF000149GAPDHcoord: 4..335
e-value: 7.2E-120
score: 397.9
IPR020831Glyceraldehyde/Erythrose phosphate dehydrogenase familyPANTHERPTHR10836GLYCERALDEHYDE 3-PHOSPHATE DEHYDROGENASEcoord: 6..334
IPR020828Glyceraldehyde 3-phosphate dehydrogenase, NAD(P) binding domainSMARTSM00846gp_dh_n_7coord: 5..152
e-value: 9.4E-83
score: 290.9
IPR020828Glyceraldehyde 3-phosphate dehydrogenase, NAD(P) binding domainPFAMPF00044Gp_dh_Ncoord: 6..105
e-value: 2.7E-34
score: 117.5
IPR020829Glyceraldehyde 3-phosphate dehydrogenase, catalytic domainPFAMPF02800Gp_dh_Ccoord: 157..314
e-value: 6.0E-67
score: 224.2
IPR006424Glyceraldehyde-3-phosphate dehydrogenase, type ITIGRFAMTIGR01534TIGR01534coord: 6..326
e-value: 1.8E-124
score: 413.2
NoneNo IPR availableGENE3DG3DSA:3.40.50.720coord: 6..328
e-value: 8.3E-146
score: 487.0
NoneNo IPR availableGENE3DG3DSA:3.30.360.10coord: 151..314
e-value: 8.3E-146
score: 487.0
NoneNo IPR availablePANTHERPTHR10836:SF79GLYCERALDEHYDE-3-PHOSPHATE DEHYDROGENASE, TESTIS-SPECIFICcoord: 6..334
NoneNo IPR availableSUPERFAMILYSSF55347Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domaincoord: 151..314
IPR020830Glyceraldehyde 3-phosphate dehydrogenase, active sitePROSITEPS00071GAPDHcoord: 150..157
IPR036291NAD(P)-binding domain superfamilySUPERFAMILYSSF51735NAD(P)-binding Rossmann-fold domainscoord: 6..173