protection of telomere 1-like protein

Overview
Nameprotection of telomere 1-like protein (AGG22603.1)
Smed IDSMED30009702
Length (bp)1653
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of protection of telomere 1-like protein (SMED30009702) t-SNE clustered cells

Violin plots show distribution of expression levels for protection of telomere 1-like protein (SMED30009702) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of protection of telomere 1-like protein (SMED30009702) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for protection of telomere 1-like protein (SMED30009702) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30009702

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30009702SMESG000018656.1 JX188060.1smed_ncbi_20200123PMID:27654173
Yin et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
prepharyngeal regionSMED30009702SMESG000018656.1 JX188060.1smed_ncbi_20200123PMID:27654173
Yin et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
parapharyngeal regionSMED30009702SMESG000018656.1 JX188060.1smed_ncbi_20200123PMID:27654173
Yin et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
tailSMED30009702SMESG000018656.1 JX188060.1smed_ncbi_20200123PMID:27654173
Yin et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
X1 cellSMED30009702SMESG000018656.1 SmedASXL_016488SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of protection of telomere 1-like protein vs. Ensembl Human
Match: POT1 (protection of telomeres 1 [Source:HGNC Symbol;Acc:HGNC:17284])

HSP 1 Score: 78.1814 bits (191), Expect = 1.245e-14
Identity = 60/209 (28.71%), Postives = 91/209 (43.54%), Query Frame = 1
Query:   94 SMQYDFTALTDVKVGEFSNVMGIIKYCSDPKKTKGKDYQMTVSITDPSVGYEGKIVCNLFNAKPENLPRITGRGDVIIMHKLKISKFRNNIQGIGIQKEGFNVAVFSKNYLIDTSKECFERIIANMSSIKNQFSITMDDLKKVQKLQEWGNSMPSSQIDEGELNLDAINFVSLSEISPRVTCSLTAQVISVLSISYLDFRTLILIWDGT 720
            +  Y +T L  +K G   NV G++K+   P  +KG DY   V+I D +     K+ C LF+   E LP I   GD++  H+LKI  ++   Q  GI   GF    F               II   SS    F+ T +D K V+ L+ W ++  S           +   + L ++ P     LT Q++    +    F  L+ +WDGT
Sbjct:    6 ATNYIYTPLNQLKGGTIVNVYGVVKFFKPPYLSKGTDYCSVVTIVDQT---NVKLTCLLFSGNYEALPIIYKNGDIVRFHRLKIQVYKKETQ--GITSSGFASLTFEGT--------LGAPIIPRTSS--KYFNFTTEDHKMVEALRVWASTHMSP----------SWTLLKLCDVQPMQYFDLTCQLLGKAEVDGASF--LLKVWDGT 187          
BLAST of protection of telomere 1-like protein vs. Ensembl Human
Match: POT1 (protection of telomeres 1 [Source:HGNC Symbol;Acc:HGNC:17284])

HSP 1 Score: 78.1814 bits (191), Expect = 1.245e-14
Identity = 60/209 (28.71%), Postives = 91/209 (43.54%), Query Frame = 1
Query:   94 SMQYDFTALTDVKVGEFSNVMGIIKYCSDPKKTKGKDYQMTVSITDPSVGYEGKIVCNLFNAKPENLPRITGRGDVIIMHKLKISKFRNNIQGIGIQKEGFNVAVFSKNYLIDTSKECFERIIANMSSIKNQFSITMDDLKKVQKLQEWGNSMPSSQIDEGELNLDAINFVSLSEISPRVTCSLTAQVISVLSISYLDFRTLILIWDGT 720
            +  Y +T L  +K G   NV G++K+   P  +KG DY   V+I D +     K+ C LF+   E LP I   GD++  H+LKI  ++   Q  GI   GF    F               II   SS    F+ T +D K V+ L+ W ++  S           +   + L ++ P     LT Q++    +    F  L+ +WDGT
Sbjct:    6 ATNYIYTPLNQLKGGTIVNVYGVVKFFKPPYLSKGTDYCSVVTIVDQT---NVKLTCLLFSGNYEALPIIYKNGDIVRFHRLKIQVYKKETQ--GITSSGFASLTFEGT--------LGAPIIPRTSS--KYFNFTTEDHKMVEALRVWASTHMSP----------SWTLLKLCDVQPMQYFDLTCQLLGKAEVDGASF--LLKVWDGT 187          
BLAST of protection of telomere 1-like protein vs. Ensembl Human
Match: POT1 (protection of telomeres 1 [Source:HGNC Symbol;Acc:HGNC:17284])

HSP 1 Score: 76.6406 bits (187), Expect = 1.465e-14
Identity = 60/209 (28.71%), Postives = 91/209 (43.54%), Query Frame = 1
Query:   94 SMQYDFTALTDVKVGEFSNVMGIIKYCSDPKKTKGKDYQMTVSITDPSVGYEGKIVCNLFNAKPENLPRITGRGDVIIMHKLKISKFRNNIQGIGIQKEGFNVAVFSKNYLIDTSKECFERIIANMSSIKNQFSITMDDLKKVQKLQEWGNSMPSSQIDEGELNLDAINFVSLSEISPRVTCSLTAQVISVLSISYLDFRTLILIWDGT 720
            +  Y +T L  +K G   NV G++K+   P  +KG DY   V+I D +     K+ C LF+   E LP I   GD++  H+LKI  ++   Q  GI   GF    F               II   SS    F+ T +D K V+ L+ W ++  S           +   + L ++ P     LT Q++    +    F  L+ +WDGT
Sbjct:    6 ATNYIYTPLNQLKGGTIVNVYGVVKFFKPPYLSKGTDYCSVVTIVDQT---NVKLTCLLFSGNYEALPIIYKNGDIVRFHRLKIQVYKKETQ--GITSSGFASLTFEGT--------LGAPIIPRTSS--KYFNFTTEDHKMVEALRVWASTHMSP----------SWTLLKLCDVQPMQYFDLTCQLLGKAEVDGASF--LLKVWDGT 187          
BLAST of protection of telomere 1-like protein vs. Ensembl Human
Match: POT1 (protection of telomeres 1 [Source:HGNC Symbol;Acc:HGNC:17284])

HSP 1 Score: 77.411 bits (189), Expect = 1.922e-14
Identity = 60/209 (28.71%), Postives = 91/209 (43.54%), Query Frame = 1
Query:   94 SMQYDFTALTDVKVGEFSNVMGIIKYCSDPKKTKGKDYQMTVSITDPSVGYEGKIVCNLFNAKPENLPRITGRGDVIIMHKLKISKFRNNIQGIGIQKEGFNVAVFSKNYLIDTSKECFERIIANMSSIKNQFSITMDDLKKVQKLQEWGNSMPSSQIDEGELNLDAINFVSLSEISPRVTCSLTAQVISVLSISYLDFRTLILIWDGT 720
            +  Y +T L  +K G   NV G++K+   P  +KG DY   V+I D +     K+ C LF+   E LP I   GD++  H+LKI  ++   Q  GI   GF    F               II   SS    F+ T +D K V+ L+ W ++  S           +   + L ++ P     LT Q++    +    F  L+ +WDGT
Sbjct:    6 ATNYIYTPLNQLKGGTIVNVYGVVKFFKPPYLSKGTDYCSVVTIVDQT---NVKLTCLLFSGNYEALPIIYKNGDIVRFHRLKIQVYKKETQ--GITSSGFASLTFEGT--------LGAPIIPRTSS--KYFNFTTEDHKMVEALRVWASTHMSP----------SWTLLKLCDVQPMQYFDLTCQLLGKAEVDGASF--LLKVWDGT 187          
BLAST of protection of telomere 1-like protein vs. Ensembl Human
Match: POT1 (protection of telomeres 1 [Source:HGNC Symbol;Acc:HGNC:17284])

HSP 1 Score: 77.7962 bits (190), Expect = 1.969e-14
Identity = 60/209 (28.71%), Postives = 91/209 (43.54%), Query Frame = 1
Query:   94 SMQYDFTALTDVKVGEFSNVMGIIKYCSDPKKTKGKDYQMTVSITDPSVGYEGKIVCNLFNAKPENLPRITGRGDVIIMHKLKISKFRNNIQGIGIQKEGFNVAVFSKNYLIDTSKECFERIIANMSSIKNQFSITMDDLKKVQKLQEWGNSMPSSQIDEGELNLDAINFVSLSEISPRVTCSLTAQVISVLSISYLDFRTLILIWDGT 720
            +  Y +T L  +K G   NV G++K+   P  +KG DY   V+I D +     K+ C LF+   E LP I   GD++  H+LKI  ++   Q  GI   GF    F               II   SS    F+ T +D K V+ L+ W ++  S           +   + L ++ P     LT Q++    +    F  L+ +WDGT
Sbjct:    6 ATNYIYTPLNQLKGGTIVNVYGVVKFFKPPYLSKGTDYCSVVTIVDQT---NVKLTCLLFSGNYEALPIIYKNGDIVRFHRLKIQVYKKETQ--GITSSGFASLTFEGT--------LGAPIIPRTSS--KYFNFTTEDHKMVEALRVWASTHMSP----------SWTLLKLCDVQPMQYFDLTCQLLGKAEVDGASF--LLKVWDGT 187          
BLAST of protection of telomere 1-like protein vs. Ensembl Zebrafish
Match: pot1 (protection of telomeres 1 homolog [Source:ZFIN;Acc:ZDB-GENE-110324-1])

HSP 1 Score: 73.559 bits (179), Expect = 2.937e-13
Identity = 61/211 (28.91%), Postives = 98/211 (46.45%), Query Frame = 1
Query:  100 QYDFTALTDVKVGEFSNVMGIIKYCSDPKKTKGKDYQMTVSITDPSVGYEGKIVCNLFNAKPENLPRITGRGDVIIMHKLKISKFRNNIQGIGIQKEGFNVAVFSKNYLIDTSKECFERIIANMSSIKNQFSITMDDLKKVQKLQEWGNSMPSSQIDEGELNLDAINFVSLSEISPRV----TCSLTAQVISVLSISYLDFRTLILIWDGT 720
            +Y +  L  +K     NV G++ +   P  +KG DY  T+ ITD S   + K++C +F  K E+ P I   GD+I +H+ K   FR++I  I      F  +  + N +ID+       I+   SS    F     D ++VQ+L++W     ++Q    +LN       SLS + P +    TC L A+ +            L+ +WDGT
Sbjct:  150 KYVYVPLNKLKSKTLVNVYGVVTFFKQPFPSKGSDYCTTLKITDQS---DVKVICTIFCKKLEDHPLIFRVGDIIRLHRFKAEAFRDSITLINT----FGWSTVTFNGIIDSP------IVPRTSS--KSFFYGEADKRRVQELRQWA----ANQSLCSDLN------TSLSSVQPHMYFDFTCQLLAKAVMHSGC------ILLKVWDGT 329          
BLAST of protection of telomere 1-like protein vs. Ensembl Zebrafish
Match: pot1 (protection of telomeres 1 homolog [Source:ZFIN;Acc:ZDB-GENE-110324-1])

HSP 1 Score: 73.559 bits (179), Expect = 3.453e-13
Identity = 61/211 (28.91%), Postives = 98/211 (46.45%), Query Frame = 1
Query:  100 QYDFTALTDVKVGEFSNVMGIIKYCSDPKKTKGKDYQMTVSITDPSVGYEGKIVCNLFNAKPENLPRITGRGDVIIMHKLKISKFRNNIQGIGIQKEGFNVAVFSKNYLIDTSKECFERIIANMSSIKNQFSITMDDLKKVQKLQEWGNSMPSSQIDEGELNLDAINFVSLSEISPRV----TCSLTAQVISVLSISYLDFRTLILIWDGT 720
            +Y +  L  +K     NV G++ +   P  +KG DY  T+ ITD S   + K++C +F  K E+ P I   GD+I +H+ K   FR++I  I      F  +  + N +ID+       I+   SS    F     D ++VQ+L++W     ++Q    +LN       SLS + P +    TC L A+ +            L+ +WDGT
Sbjct:  150 KYVYVPLNKLKSKTLVNVYGVVTFFKQPFPSKGSDYCTTLKITDQS---DVKVICTIFCKKLEDHPLIFRVGDIIRLHRFKAEAFRDSITLINT----FGWSTVTFNGIIDSP------IVPRTSS--KSFFYGEADKRRVQELRQWA----ANQSLCSDLN------TSLSSVQPHMYFDFTCQLLAKAVMHSGC------ILLKVWDGT 329          
BLAST of protection of telomere 1-like protein vs. Ensembl Zebrafish
Match: pot1 (protection of telomeres 1 homolog [Source:ZFIN;Acc:ZDB-GENE-110324-1])

HSP 1 Score: 73.1738 bits (178), Expect = 4.169e-13
Identity = 61/211 (28.91%), Postives = 98/211 (46.45%), Query Frame = 1
Query:  100 QYDFTALTDVKVGEFSNVMGIIKYCSDPKKTKGKDYQMTVSITDPSVGYEGKIVCNLFNAKPENLPRITGRGDVIIMHKLKISKFRNNIQGIGIQKEGFNVAVFSKNYLIDTSKECFERIIANMSSIKNQFSITMDDLKKVQKLQEWGNSMPSSQIDEGELNLDAINFVSLSEISPRV----TCSLTAQVISVLSISYLDFRTLILIWDGT 720
            +Y +  L  +K     NV G++ +   P  +KG DY  T+ ITD S   + K++C +F  K E+ P I   GD+I +H+ K   FR++I  I      F  +  + N +ID+       I+   SS    F     D ++VQ+L++W     ++Q    +LN       SLS + P +    TC L A+ +            L+ +WDGT
Sbjct:  150 KYVYVPLNKLKSKTLVNVYGVVTFFKQPFPSKGSDYCTTLKITDQS---DVKVICTIFCKKLEDHPLIFRVGDIIRLHRFKAEAFRDSITLINT----FGWSTVTFNGIIDSP------IVPRTSS--KSFFYGEADKRRVQELRQWA----ANQSLCSDLN------TSLSSVQPHMYFDFTCQLLAKAVMHSGC------ILLKVWDGT 329          
BLAST of protection of telomere 1-like protein vs. Ensembl Xenopus
Match: pot1 (protection of telomeres 1 [Source:NCBI gene;Acc:407850])

HSP 1 Score: 74.3294 bits (181), Expect = 2.061e-13
Identity = 39/110 (35.45%), Postives = 63/110 (57.27%), Query Frame = 1
Query:   85 VKISMQ-YDFTALTDVKVGEFSNVMGIIKYCSDPKKTKGKDYQMTVSITDPSVGYEGKIVCNLFNAKPENLPRITGRGDVIIMHKLKISKFRNNIQGIGIQKEGFNVAVF 411
             K+S Q Y +T +  ++ G+  NV G++ +   P ++KG DY + V+I D S   E K+ C LF+   E LP+I   GD++  H++K+ +F   +QGI     GF+  VF
Sbjct:    8 AKVSFQNYTYTPIDQLQHGKVYNVYGVVIFFKPPYRSKGTDYCLVVTIVDQS---EAKLKCMLFSGNQETLPKIYKVGDIVRFHRVKVQQFNGELQGIN--SSGFSSLVF 112          
BLAST of protection of telomere 1-like protein vs. Ensembl Xenopus
Match: pot1 (protection of telomeres 1 [Source:NCBI gene;Acc:407850])

HSP 1 Score: 74.3294 bits (181), Expect = 2.167e-13
Identity = 39/110 (35.45%), Postives = 63/110 (57.27%), Query Frame = 1
Query:   85 VKISMQ-YDFTALTDVKVGEFSNVMGIIKYCSDPKKTKGKDYQMTVSITDPSVGYEGKIVCNLFNAKPENLPRITGRGDVIIMHKLKISKFRNNIQGIGIQKEGFNVAVF 411
             K+S Q Y +T +  ++ G+  NV G++ +   P ++KG DY + V+I D S   E K+ C LF+   E LP+I   GD++  H++K+ +F   +QGI     GF+  VF
Sbjct:    8 AKVSFQNYTYTPIDQLQHGKVYNVYGVVIFFKPPYRSKGTDYCLVVTIVDQS---EAKLKCMLFSGNQETLPKIYKVGDIVRFHRVKVQQFNGELQGIN--SSGFSSLVF 112          
BLAST of protection of telomere 1-like protein vs. Ensembl Xenopus
Match: pot1 (protection of telomeres 1 [Source:NCBI gene;Acc:407850])

HSP 1 Score: 72.7886 bits (177), Expect = 6.361e-13
Identity = 38/109 (34.86%), Postives = 63/109 (57.80%), Query Frame = 1
Query:   88 KISMQ-YDFTALTDVKVGEFSNVMGIIKYCSDPKKTKGKDYQMTVSITDPSVGYEGKIVCNLFNAKPENLPRITGRGDVIIMHKLKISKFRNNIQGIGIQKEGFNVAVF 411
            ++S Q Y +T +  ++ G+  NV G++ +   P ++KG DY + V+I D S   E K+ C LF+   E LP+I   GD++  H++K+ +F   +QGI     GF+  VF
Sbjct:    5 QVSFQNYTYTPIDQLQHGKVYNVYGVVIFFKPPYRSKGTDYCLVVTIVDQS---EAKLKCMLFSGNQETLPKIYKVGDIVRFHRVKVQQFNGELQGIN--SSGFSSLVF 108          
BLAST of protection of telomere 1-like protein vs. Ensembl Xenopus
Match: pot1 (protection of telomeres 1 [Source:NCBI gene;Acc:407850])

HSP 1 Score: 72.7886 bits (177), Expect = 7.097e-13
Identity = 36/103 (34.95%), Postives = 59/103 (57.28%), Query Frame = 1
Query:  103 YDFTALTDVKVGEFSNVMGIIKYCSDPKKTKGKDYQMTVSITDPSVGYEGKIVCNLFNAKPENLPRITGRGDVIIMHKLKISKFRNNIQGIGIQKEGFNVAVF 411
            Y +T +  ++ G+  NV G++ +   P ++KG DY + V+I D S   E K+ C LF+   E LP+I   GD++  H++K+ +F   +QGI     GF+  VF
Sbjct:   14 YTYTPIDQLQHGKVYNVYGVVIFFKPPYRSKGTDYCLVVTIVDQS---EAKLKCMLFSGNQETLPKIYKVGDIVRFHRVKVQQFNGELQGIN--SSGFSSLVF 111          
BLAST of protection of telomere 1-like protein vs. Ensembl Mouse
Match: Pot1a (protection of telomeres 1A [Source:MGI Symbol;Acc:MGI:2141503])

HSP 1 Score: 80.8777 bits (198), Expect = 3.853e-16
Identity = 59/206 (28.64%), Postives = 91/206 (44.17%), Query Frame = 1
Query:  103 YDFTALTDVKVGEFSNVMGIIKYCSDPKKTKGKDYQMTVSITDPSVGYEGKIVCNLFNAKPENLPRITGRGDVIIMHKLKISKFRNNIQGIGIQKEGFNVAVFSKNYLIDTSKECFERIIANMSSIKNQFSITMDDLKKVQKLQEWGNSMPSSQIDEGELNLDAINFVSLSEISPRVTCSLTAQVISVLSISYLDFRTLILIWDGT 720
            Y +T L  +K G  +NV G++K+   P  +KG DY   V+I D +     K+ C LF+   E LP I   GD++  H+LKI  ++N +QGI     GF    F     +  +     ++          FS T  D K V+ L+ W +   S+          +   V L +  P     LT Q++    +    F  L+ +WDGT
Sbjct:    9 YTYTPLNLLKEGTIANVYGVVKFFKPPYVSKGTDYCSVVTIVDQT---NVKLTCMLFSGNYEALPIIYKVGDIVRFHRLKIQVYKNELQGINC--SGFASLTFEGTVGMPVTARTSSKV----------FSFTPQDQKMVEALRVWASKHISA----------SSTLVQLCDAQPMQYYDLTCQLLGKAQVDSTAF--LLKVWDGT 187          
BLAST of protection of telomere 1-like protein vs. Ensembl Mouse
Match: Pot1a (protection of telomeres 1A [Source:MGI Symbol;Acc:MGI:2141503])

HSP 1 Score: 81.6481 bits (200), Expect = 9.489e-16
Identity = 59/206 (28.64%), Postives = 91/206 (44.17%), Query Frame = 1
Query:  103 YDFTALTDVKVGEFSNVMGIIKYCSDPKKTKGKDYQMTVSITDPSVGYEGKIVCNLFNAKPENLPRITGRGDVIIMHKLKISKFRNNIQGIGIQKEGFNVAVFSKNYLIDTSKECFERIIANMSSIKNQFSITMDDLKKVQKLQEWGNSMPSSQIDEGELNLDAINFVSLSEISPRVTCSLTAQVISVLSISYLDFRTLILIWDGT 720
            Y +T L  +K G  +NV G++K+   P  +KG DY   V+I D +     K+ C LF+   E LP I   GD++  H+LKI  ++N +QGI     GF    F     +  +     ++          FS T  D K V+ L+ W +   S+          +   V L +  P     LT Q++    +    F  L+ +WDGT
Sbjct:    9 YTYTPLNLLKEGTIANVYGVVKFFKPPYVSKGTDYCSVVTIVDQT---NVKLTCMLFSGNYEALPIIYKVGDIVRFHRLKIQVYKNELQGINC--SGFASLTFEGTVGMPVTARTSSKV----------FSFTPQDQKMVEALRVWASKHISA----------SSTLVQLCDAQPMQYYDLTCQLLGKAQVDSTAF--LLKVWDGT 187          
BLAST of protection of telomere 1-like protein vs. Ensembl Mouse
Match: Pot1a (protection of telomeres 1A [Source:MGI Symbol;Acc:MGI:2141503])

HSP 1 Score: 81.6481 bits (200), Expect = 9.489e-16
Identity = 59/206 (28.64%), Postives = 91/206 (44.17%), Query Frame = 1
Query:  103 YDFTALTDVKVGEFSNVMGIIKYCSDPKKTKGKDYQMTVSITDPSVGYEGKIVCNLFNAKPENLPRITGRGDVIIMHKLKISKFRNNIQGIGIQKEGFNVAVFSKNYLIDTSKECFERIIANMSSIKNQFSITMDDLKKVQKLQEWGNSMPSSQIDEGELNLDAINFVSLSEISPRVTCSLTAQVISVLSISYLDFRTLILIWDGT 720
            Y +T L  +K G  +NV G++K+   P  +KG DY   V+I D +     K+ C LF+   E LP I   GD++  H+LKI  ++N +QGI     GF    F     +  +     ++          FS T  D K V+ L+ W +   S+          +   V L +  P     LT Q++    +    F  L+ +WDGT
Sbjct:    9 YTYTPLNLLKEGTIANVYGVVKFFKPPYVSKGTDYCSVVTIVDQT---NVKLTCMLFSGNYEALPIIYKVGDIVRFHRLKIQVYKNELQGINC--SGFASLTFEGTVGMPVTARTSSKV----------FSFTPQDQKMVEALRVWASKHISA----------SSTLVQLCDAQPMQYYDLTCQLLGKAQVDSTAF--LLKVWDGT 187          
BLAST of protection of telomere 1-like protein vs. Ensembl Mouse
Match: Pot1b (protection of telomeres 1B [Source:MGI Symbol;Acc:MGI:1920086])

HSP 1 Score: 75.485 bits (184), Expect = 2.614e-14
Identity = 57/204 (27.94%), Postives = 92/204 (45.10%), Query Frame = 1
Query:  109 FTALTDVKVGEFSNVMGIIKYCSDPKKTKGKDYQMTVSITDPSVGYEGKIVCNLFNAKPENLPRITGRGDVIIMHKLKISKFRNNIQGIGIQKEGFNVAVFSKNYLIDTSKECFERIIANMSSIKNQFSITMDDLKKVQKLQEWGNSMPSSQIDEGELNLDAINFVSLSEISPRVTCSLTAQVISVLSISYLDFRTLILIWDGT 720
            +T L  +K G   NV G++K+   P  +KG DY   V+I D +     K+ C LF+   + LP +   GD++    LKI  ++N +Q I   K GF    F               II  + ++  +F+ T  D   V+ L+ W ++  S+          + N V LS+  P     LT Q++    +  + F  L+ +WDGT
Sbjct:   11 YTPLNLLKEGTVVNVCGVVKFFKPPYLSKGTDYCSVVTIVDQT---NVKLTCMLFSRDYDTLPSVYKVGDIVCFQGLKIQAYKNELQAIS--KFGFASLTFDGT--------LGAPII--LRTLSKRFNFTAQDYSMVEALRTWASTHISA----------SSNLVQLSDAQPMQYYDLTCQLLGKAQVDGVSF--LLKVWDGT 187          
BLAST of protection of telomere 1-like protein vs. Ensembl Mouse
Match: Pot1b (protection of telomeres 1B [Source:MGI Symbol;Acc:MGI:1920086])

HSP 1 Score: 75.485 bits (184), Expect = 2.614e-14
Identity = 57/204 (27.94%), Postives = 92/204 (45.10%), Query Frame = 1
Query:  109 FTALTDVKVGEFSNVMGIIKYCSDPKKTKGKDYQMTVSITDPSVGYEGKIVCNLFNAKPENLPRITGRGDVIIMHKLKISKFRNNIQGIGIQKEGFNVAVFSKNYLIDTSKECFERIIANMSSIKNQFSITMDDLKKVQKLQEWGNSMPSSQIDEGELNLDAINFVSLSEISPRVTCSLTAQVISVLSISYLDFRTLILIWDGT 720
            +T L  +K G   NV G++K+   P  +KG DY   V+I D +     K+ C LF+   + LP +   GD++    LKI  ++N +Q I   K GF    F               II  + ++  +F+ T  D   V+ L+ W ++  S+          + N V LS+  P     LT Q++    +  + F  L+ +WDGT
Sbjct:   11 YTPLNLLKEGTVVNVCGVVKFFKPPYLSKGTDYCSVVTIVDQT---NVKLTCMLFSRDYDTLPSVYKVGDIVCFQGLKIQAYKNELQAIS--KFGFASLTFDGT--------LGAPII--LRTLSKRFNFTAQDYSMVEALRTWASTHISA----------SSNLVQLSDAQPMQYYDLTCQLLGKAQVDGVSF--LLKVWDGT 187          
BLAST of protection of telomere 1-like protein vs. UniProt/SwissProt
Match: sp|Q91WC1|POTE1_MOUSE (Protection of telomeres protein 1 OS=Mus musculus OX=10090 GN=Pot1 PE=1 SV=1)

HSP 1 Score: 81.6481 bits (200), Expect = 6.637e-15
Identity = 59/206 (28.64%), Postives = 91/206 (44.17%), Query Frame = 1
Query:  103 YDFTALTDVKVGEFSNVMGIIKYCSDPKKTKGKDYQMTVSITDPSVGYEGKIVCNLFNAKPENLPRITGRGDVIIMHKLKISKFRNNIQGIGIQKEGFNVAVFSKNYLIDTSKECFERIIANMSSIKNQFSITMDDLKKVQKLQEWGNSMPSSQIDEGELNLDAINFVSLSEISPRVTCSLTAQVISVLSISYLDFRTLILIWDGT 720
            Y +T L  +K G  +NV G++K+   P  +KG DY   V+I D +     K+ C LF+   E LP I   GD++  H+LKI  ++N +QGI     GF    F     +  +     ++          FS T  D K V+ L+ W +   S+          +   V L +  P     LT Q++    +    F  L+ +WDGT
Sbjct:    9 YTYTPLNLLKEGTIANVYGVVKFFKPPYVSKGTDYCSVVTIVDQT---NVKLTCMLFSGNYEALPIIYKVGDIVRFHRLKIQVYKNELQGINC--SGFASLTFEGTVGMPVTARTSSKV----------FSFTPQDQKMVEALRVWASKHISA----------SSTLVQLCDAQPMQYYDLTCQLLGKAQVDSTAF--LLKVWDGT 187          
BLAST of protection of telomere 1-like protein vs. UniProt/SwissProt
Match: sp|Q9NUX5|POTE1_HUMAN (Protection of telomeres protein 1 OS=Homo sapiens OX=9606 GN=POT1 PE=1 SV=1)

HSP 1 Score: 77.411 bits (189), Expect = 1.163e-13
Identity = 60/209 (28.71%), Postives = 91/209 (43.54%), Query Frame = 1
Query:   94 SMQYDFTALTDVKVGEFSNVMGIIKYCSDPKKTKGKDYQMTVSITDPSVGYEGKIVCNLFNAKPENLPRITGRGDVIIMHKLKISKFRNNIQGIGIQKEGFNVAVFSKNYLIDTSKECFERIIANMSSIKNQFSITMDDLKKVQKLQEWGNSMPSSQIDEGELNLDAINFVSLSEISPRVTCSLTAQVISVLSISYLDFRTLILIWDGT 720
            +  Y +T L  +K G   NV G++K+   P  +KG DY   V+I D +     K+ C LF+   E LP I   GD++  H+LKI  ++   Q  GI   GF    F               II   SS    F+ T +D K V+ L+ W ++  S           +   + L ++ P     LT Q++    +    F  L+ +WDGT
Sbjct:    6 ATNYIYTPLNQLKGGTIVNVYGVVKFFKPPYLSKGTDYCSVVTIVDQT---NVKLTCLLFSGNYEALPIIYKNGDIVRFHRLKIQVYKKETQ--GITSSGFASLTFEGT--------LGAPIIPRTSS--KYFNFTTEDHKMVEALRVWASTHMSP----------SWTLLKLCDVQPMQYFDLTCQLLGKAEVDGASF--LLKVWDGT 187          
BLAST of protection of telomere 1-like protein vs. UniProt/SwissProt
Match: sp|Q95K48|POTE1_MACFA (Protection of telomeres protein 1 OS=Macaca fascicularis OX=9541 GN=POT1 PE=2 SV=1)

HSP 1 Score: 77.411 bits (189), Expect = 1.350e-13
Identity = 60/209 (28.71%), Postives = 91/209 (43.54%), Query Frame = 1
Query:   94 SMQYDFTALTDVKVGEFSNVMGIIKYCSDPKKTKGKDYQMTVSITDPSVGYEGKIVCNLFNAKPENLPRITGRGDVIIMHKLKISKFRNNIQGIGIQKEGFNVAVFSKNYLIDTSKECFERIIANMSSIKNQFSITMDDLKKVQKLQEWGNSMPSSQIDEGELNLDAINFVSLSEISPRVTCSLTAQVISVLSISYLDFRTLILIWDGT 720
            +  Y +T L  +K G   NV G++K+   P  +KG DY   V+I D +     K+ C LF+   E LP I   GD++  H+LKI  ++   Q  GI   GF    F               II   SS    F+ T +D K V+ L+ W ++  S           +   + L ++ P     LT Q++    +    F  L+ +WDGT
Sbjct:    6 ATNYIYTPLNQLKGGTIVNVYGVVKFFKPPYLSKGTDYCSVVTIVDQT---NVKLTCLLFSGNYEALPIIYKNGDIVRFHRLKIQVYKKETQ--GITSSGFASLTFEGT--------LGAPIIPRTSS--KYFNFTTEDHKMVETLRVWASTHMSP----------SWTLLKLCDVQPMQYFDLTCQLLGKAEVDGASF--LLKVWDGT 187          
BLAST of protection of telomere 1-like protein vs. UniProt/SwissProt
Match: sp|P62597|POTE1_CHICK (Protection of telomeres protein 1 OS=Gallus gallus OX=9031 GN=POT1 PE=1 SV=1)

HSP 1 Score: 75.8702 bits (185), Expect = 4.132e-13
Identity = 57/210 (27.14%), Postives = 97/210 (46.19%), Query Frame = 1
Query:   91 ISMQYDFTALTDVKVGEFSNVMGIIKYCSDPKKTKGKDYQMTVSITDPSVGYEGKIVCNLFNAKPENLPRITGRGDVIIMHKLKISKFRNNIQGIGIQKEGFNVAVFSKNYLIDTSKECFERIIANMSSIKNQFSITMDDLKKVQKLQEWGNSMPSSQIDEGELNLDAINFVSLSEISPRVTCSLTAQVISVLSISYLDFRTLILIWDGT 720
            ++ +Y +T L  +K G   N+ GI+K+   P  +KG DY   V++ D S     K+ C LFN   ++LP+I   GD++  H++KI ++   +Q  GI   GF    F               ++   SS    ++   ++ K V++L+ W  S  S    E +          LS++ P +   LT Q++    +    F  L+ +WDGT
Sbjct:  149 VAPKYVYTPLNCLKDGTVVNLYGIVKFFKPPYISKGTDYCSVVTLVDQS---NVKLTCTLFNGNLDSLPKIYKNGDIVRFHRVKIREYNGQMQ--GITSAGFASLTFDGT--------VGAPVVPRASS--KVYTFVDEEQKTVEELRIWAASNLSVSGPEAK----------LSDVKPMMFFDLTCQLVGKAKVDGSSF--LLKVWDGT 331          
BLAST of protection of telomere 1-like protein vs. UniProt/SwissProt
Match: sp|Q6NKX5|POT1B_ARATH (Protection of telomeres protein 1b OS=Arabidopsis thaliana OX=3702 GN=POT1B PE=1 SV=1)

HSP 1 Score: 54.6842 bits (130), Expect = 1.478e-6
Identity = 77/352 (21.88%), Postives = 148/352 (42.05%), Query Frame = 1
Query:  190 TKGKDYQMTVSITDPSVGYEGKIVCNLFNAKP-ENLPRITGRGDVIIMHKLKISKFRNNIQGIGIQKEGFNVAVFSKNYLIDTSKECFERIIANMSSIKNQFSITMDDLKKVQKLQEWGNSMPSSQIDEGELNLDAINFVSLSEISPRVTCSLTAQVISVLSISYLDFRTLILIWDGT-IPGCDLNRKFITILSNCIK-EKHDTELMAQFG--GKISNPYLGYIFLKEE-SLIGPGDYVYFHRVFVEPPLNGPGVCLVADRCKVGILTKESQQYDKLLARLESFSESLPCVADCISIDLKQLTKWSLKD--YGKMLKQFDYEIEFNENEKYQFNITARVVKVHPSTEKEFND 1221
            + G D   T+ I DP   Y G  +   F A+   +LPR+   GD+I++ ++KI      I  +  +    + A+F+  + +D+        I   SS K  F +   D   +  L+EW   M + + ++G     +  F SL +I      +L+ Q++ +  + Y D R  + +WDGT +P C++  K    L  C++ E   T ++ +F   G +    +  +  K+    + PG +V    +F +  +                +++E + +       E FS     +A CIS    ++T  +  D  +  ++    Y      N   +F    R ++V+P   ++  D
Sbjct:   37 SNGSDCSCTLKIVDP--WYSGSGLPVKFVARTIRDLPRVESIGDIILLSRVKIVLINRKITALCNETTSSSFALFNGKHSVDS--------IPYQSSPK--FLMREQDKNFLSNLREW---MITYKFEDG-----SCCFTSLKDIKEGECSNLSCQIVHISKV-YKD-RWYLFVWDGTEMPPCNILVK-SERLPLCVEPEMLPTYMLRKFPTFGSVLRIIVDRVSEKQAIHCLQPGQHVKLLNLFFQVNMGLWNATFTPSTKMQYTMSREMEAFSPQRMCGEKFSPRWNPIARCISRSHSEITGVAHDDAPFVSLMDILTY-----HNVTAKFRCVVRFIQVYPRDVRKLRD 360          
BLAST of protection of telomere 1-like protein vs. TrEMBL
Match: T1R2R5 (Protection of telomere 1-like protein OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 672.544 bits (1734), Expect = 0.000e+0
Identity = 328/332 (98.80%), Postives = 329/332 (99.10%), Query Frame = 1
Query:   97 MQYDFTALTDVKVGEFSNVMGIIKYCSDPKKTKGKDYQMTVSITDPSVGYEGKIVCNLFNAKPENLPRITGRGDVIIMHKLKISKFRNNIQGIGIQKEGFNVAVFSKNYLIDTSKECFERIIANMSSIKNQFSITMDDLKKVQKLQEWGNSMPSSQIDEGELNLDAINFVSLSEISPRVTCSLTAQVISVLSISYLDFRTLILIWDGTIPGCDLNRKFITILSNCIKEKHDTELMAQFGGKISNPYLGYIFLKEESLIGPGDYVYFHRVFVEPPLNGPGVCLVADRCKVGILTKESQQYDKLLARLESFSESLPCVADCISIDLKQLTKWSL 1092
            MQYDFTALTDVKVGEFSNVMGIIKYCSDPKKTKGKDYQMTVSITD SVGYEGKIVCNLFNAKPENLPRITGRGDVIIMHKLKISKFRNNIQGIGIQKEGFNVAVFSKNYLIDTSKECFERIIANMSSIKNQFSITMDDLKKVQKLQEWGNSMPSSQIDEGELNLDAINFVSLSEISPRVTCSLTAQVISVLSI+YLDFRTLILIWDGTIPGCDLNRKFITILSNCIKEKHDTELMAQFGGKISNPYLGYIFLKEESLIGPGDYVYFHRVFVEPPLNGPGVCLVADRCKVGILTKESQQYDKLLARLESFSE LPCVADCISIDLKQLTK SL
Sbjct:    1 MQYDFTALTDVKVGEFSNVMGIIKYCSDPKKTKGKDYQMTVSITDASVGYEGKIVCNLFNAKPENLPRITGRGDVIIMHKLKISKFRNNIQGIGIQKEGFNVAVFSKNYLIDTSKECFERIIANMSSIKNQFSITMDDLKKVQKLQEWGNSMPSSQIDEGELNLDAINFVSLSEISPRVTCSLTAQVISVLSINYLDFRTLILIWDGTIPGCDLNRKFITILSNCIKEKHDTELMAQFGGKISNPYLGYIFLKEESLIGPGDYVYFHRVFVEPPLNGPGVCLVADRCKVGILTKESQQYDKLLARLESFSEGLPCVADCISIDLKQLTKVSL 332          
BLAST of protection of telomere 1-like protein vs. TrEMBL
Match: A0A0R3X8W3 (Telo_bind domain-containing protein OS=Hydatigena taeniaeformis OX=6205 GN=TTAC_LOCUS9973 PE=4 SV=1)

HSP 1 Score: 101.679 bits (252), Expect = 3.319e-19
Identity = 75/227 (33.04%), Postives = 111/227 (48.90%), Query Frame = 1
Query:   85 VKISMQYDFTALTDVKVGEFSNVMGIIKYCSDPKKTKGKDYQMTVSITDPSVGYEGKIVCNLFNAKPENLPRITGRGDVIIMHKLKISKFRNNIQGIGIQKEGFNVAVFSKNYLIDTSKECFERIIANMSSIKNQFSITMDDLKKVQKLQEWGNSMPSSQIDEG-------ELNLDAINFVSLSEISPRVTCSLTAQVISVLSISYLDFRTLIL-IWDGTIPGCDLN 741
            V+   QY+FT L ++  G   NV+ ++K+   PKKT+G  + M VSI+DPS+  + K    + N   E LP I   GD++IMH+L +S FR  +QG G +  GF V VF     ID+    +E   A         + T  DL +V++L+ W NS       EG       E+  D  N   +  +      +  AQV+++ S        LIL IWDG  P  +L+
Sbjct:    6 VQPQNQYEFTDLRNITEGRH-NVIAVVKFFKPPKKTRGSGFSMFVSISDPSLKGD-KFSVTIINNNVEKLPPIRSPGDIVIMHRLSVSDFRGRLQGYGSESIGFAVTVFPG--AIDSLLIPYEPTSA--------CTFTDVDLSRVKELRNWYNSPDCPLEKEGLQLLNHPEVEQDMHNLSRIHSVKLNSFFNTEAQVVAIYSYPSEVSNDLILCIWDGEPPNDNLH 220          
BLAST of protection of telomere 1-like protein vs. TrEMBL
Match: W6UEI5 (Protection of telomeres protein OS=Echinococcus granulosus OX=6210 GN=EGR_05805 PE=4 SV=1)

HSP 1 Score: 99.7525 bits (247), Expect = 1.800e-18
Identity = 72/234 (30.77%), Postives = 114/234 (48.72%), Query Frame = 1
Query:   85 VKISMQYDFTALTDVKVGEFSNVMGIIKYCSDPKKTKGKDYQMTVSITDPSVGYEGKIVCNLFNAKPENLPRITGRGDVIIMHKLKISKFRNNIQGIGIQKEGFNVAVFSKNYLIDTSKECFERIIANMSSIKNQFSITMDDLKKVQKLQEWGNS--------MPSS------QIDEGELNLDAINFVSLSEISPRVTCSLTAQVISVLSISYLDFRTLIL-IWDGTIPGCDLN 741
            V    QY+F  L ++  G   N++ ++K+   P+KT+G  + M VSI+DPS+  + K    + N   + LP I   GD++IMH+L +S FR  +QG G +  GF VAVF     +D+S   +E          +  + T  DL +V++L+ W NS         P S      Q +    NL  I+ V ++        +  AQV+++ +        LIL +WDG  P  DL+
Sbjct:    6 VPPQHQYEFVDLRNITEGRH-NIIAVVKFFKPPQKTRGSGFSMFVSISDPSLKGD-KFSVTVINNNVDKLPPIHSPGDIVIMHRLSVSTFRGRLQGYGSENAGFAVAVFPGT--VDSSLAPYEST--------STCTFTDKDLSRVKELRTWYNSPECPLEKEAPQSLSPYKAQAEHDTHNLSRIHSVKVNSF-----FNTEAQVVAIYTYPTEVTNDLILCLWDGEPPRDDLD 222          
BLAST of protection of telomere 1-like protein vs. TrEMBL
Match: A0A068WPK2 (Protection of telomeres protein 1 OS=Echinococcus granulosus OX=6210 GN=EgrG_000062800 PE=4 SV=1)

HSP 1 Score: 99.3673 bits (246), Expect = 3.266e-18
Identity = 69/229 (30.13%), Postives = 110/229 (48.03%), Query Frame = 1
Query:   85 VKISMQYDFTALTDVKVGEFSNVMGIIKYCSDPKKTKGKDYQMTVSITDPSVGYEGKIVCNLFNAKPENLPRITGRGDVIIMHKLKISKFRNNIQGIGIQKEGFNVAVFSKNYLIDTSKECFERIIANMSSIKNQFSITMDDLKKVQKLQEWGNSMPSSQIDEGELNL---------DAINFVSLSEISPRVTCSLTAQVISVLSISYLDFRTLIL-IWDGTIPGCDLN 741
            V    QY+F  L ++  G   N++ ++K+   P+KT+G  + M VSI+DPS+  + K    + N   + LP I   GD++IMH+L +S FR  +QG G +  GF VAVF     +D+S   +E          +  + T  DL +V++L+ W NS       E   +L         D  N   +  +      +  AQV+++ +        LIL +WDG  P  DL+
Sbjct:    6 VPPQHQYEFVDLRNITEGRH-NIIAVVKFFKPPQKTRGSGFSMFVSISDPSLKGD-KFSVTVINNNVDKLPPIHSPGDIVIMHRLSVSTFRGRLQGYGSENAGFAVAVFPGT--VDSSLAPYEST--------STCTFTDKDLSRVKELRTWYNSPECPLEKEAPQSLSPYKAQAEHDTHNLSRIHSVKVNSFFNTEAQVVAIYTYPTEVTNDLILCLWDGEPPRDDLD 222          
BLAST of protection of telomere 1-like protein vs. TrEMBL
Match: A0A504YUV7 (Telo_bind domain-containing protein OS=Fasciola gigantica OX=46835 GN=FGIG_07399 PE=4 SV=1)

HSP 1 Score: 97.4413 bits (241), Expect = 6.720e-18
Identity = 70/222 (31.53%), Postives = 106/222 (47.75%), Query Frame = 1
Query:  148 NVMGIIKYCSDPKKTKGKDYQMTVSITDPSVGYEGKIVCNLFNAKPENLPRITGRGDVIIMHKLKISKFRNNIQGIGIQKEGFNVAVFSKNYLID-TSKECFERIIANMSSIKNQFSITMDDLKKVQKLQEWGNSMPSSQIDEGELNL-----------DAINFV----SLSEISPRVT-------------CSLTAQVISVLSISYLDFRTLILIWDGTIP 726
            NV+ ++K C  PK+TKG  + + VSITDPS+   GK+ C  FN   E+LP I   GDVI+MH+L I +FR+ +QG G    GF   VFS       T + C         ++K  F     +L +V++L++W NS P+  ++    +L           DA N +    S   +  R T              S+  QV+S+   +    R ++ +WDG  P
Sbjct:   24 NVIAVVKCCKKPKRTKGSGFSVFVSITDPSL-EGGKLPCIFFNDSMEHLPPIQEPGDVIVMHRLVIREFRDQVQGCGFASTGFAATVFSGRVEDPLTPRPC---------AVKCSF--YEAELARVKELRDWYNS-PACPVEREPCSLSNPPNPTVAPSDASNMLDVNCSWGPVGTRCTPIQRLWSARATKFISIQGQVVSIYRQTTESDRVILYLWDGPPP 232          
BLAST of protection of telomere 1-like protein vs. Ensembl Cavefish
Match: pot1 (protection of telomeres 1 [Source:NCBI gene;Acc:103027589])

HSP 1 Score: 74.7146 bits (182), Expect = 1.287e-13
Identity = 60/214 (28.04%), Postives = 102/214 (47.66%), Query Frame = 1
Query:  100 QYDFTALTDVKVGEFSNVMGIIKYCSDPKKTKGKDYQMTVSITDPSVGYEGKIVCNLFNAKPENLPRITGRGDVIIMHKLKISKFRNNIQGIGIQKEGFNVAVFSKNYLIDTSKECFERIIANMSSIKNQFSITMDDLKKVQKLQEWGNSMPSSQIDEGELNLDAINFVSLSEISPRVTCSLTAQVISVLSISYLDFRTLIL-IWDGTIPGCDL 738
            +Y +  L+++K     NV G++ +   P  TKG DY  T+ ITD S     K+ C +F+ K E+ P+I   GD+I +H++K   F  ++    +   G++   F  + +ID+  E          +    F     D   V+ L++W  S         +  L + + V LS + P++   LT Q   +LS + +D R ++L +WDGT  G  L
Sbjct:  152 KYTYIPLSELKPRSIVNVYGVVTFFKQPFPTKGTDYCSTLKITDQS---NAKVGCTIFSEKLEDHPKIFRVGDIIRLHRVKAQMFNGSM--TLLTTLGWSTITF--DGMIDSPVE--------PRTSSRTFHFDEADKHTVEALRQWAAS---------QSLLTSESTVPLSSVQPKMYFDLTCQ---LLSKACMDSRCILLKVWDGTECGHSL 338          
BLAST of protection of telomere 1-like protein vs. Ensembl Cavefish
Match: pot1 (protection of telomeres 1 [Source:NCBI gene;Acc:103027589])

HSP 1 Score: 74.7146 bits (182), Expect = 1.301e-13
Identity = 60/217 (27.65%), Postives = 103/217 (47.47%), Query Frame = 1
Query:   91 ISMQYDFTALTDVKVGEFSNVMGIIKYCSDPKKTKGKDYQMTVSITDPSVGYEGKIVCNLFNAKPENLPRITGRGDVIIMHKLKISKFRNNIQGIGIQKEGFNVAVFSKNYLIDTSKECFERIIANMSSIKNQFSITMDDLKKVQKLQEWGNSMPSSQIDEGELNLDAINFVSLSEISPRVTCSLTAQVISVLSISYLDFRTLIL-IWDGTIPGCDL 738
            +  +Y +  L+++K     NV G++ +   P  TKG DY  T+ ITD S     K+ C +F+ K E+ P+I   GD+I +H++K   F  ++    +   G++   F  + +ID+  E          +    F     D   V+ L++W  S         +  L + + V LS + P++   LT Q   +LS + +D R ++L +WDGT  G  L
Sbjct:  133 VHPKYTYIPLSELKPRSIVNVYGVVTFFKQPFPTKGTDYCSTLKITDQS---NAKVGCTIFSEKLEDHPKIFRVGDIIRLHRVKAQMFNGSM--TLLTTLGWSTITF--DGMIDSPVE--------PRTSSRTFHFDEADKHTVEALRQWAAS---------QSLLTSESTVPLSSVQPKMYFDLTCQ---LLSKACMDSRCILLKVWDGTECGHSL 322          
BLAST of protection of telomere 1-like protein vs. Ensembl Cavefish
Match: pot1 (protection of telomeres 1 [Source:NCBI gene;Acc:103027589])

HSP 1 Score: 74.3294 bits (181), Expect = 1.587e-13
Identity = 60/214 (28.04%), Postives = 102/214 (47.66%), Query Frame = 1
Query:  100 QYDFTALTDVKVGEFSNVMGIIKYCSDPKKTKGKDYQMTVSITDPSVGYEGKIVCNLFNAKPENLPRITGRGDVIIMHKLKISKFRNNIQGIGIQKEGFNVAVFSKNYLIDTSKECFERIIANMSSIKNQFSITMDDLKKVQKLQEWGNSMPSSQIDEGELNLDAINFVSLSEISPRVTCSLTAQVISVLSISYLDFRTLIL-IWDGTIPGCDL 738
            +Y +  L+++K     NV G++ +   P  TKG DY  T+ ITD S     K+ C +F+ K E+ P+I   GD+I +H++K   F  ++    +   G++   F  + +ID+  E          +    F     D   V+ L++W  S         +  L + + V LS + P++   LT Q   +LS + +D R ++L +WDGT  G  L
Sbjct:  152 KYTYIPLSELKPRSIVNVYGVVTFFKQPFPTKGTDYCSTLKITDQS---NAKVGCTIFSEKLEDHPKIFRVGDIIRLHRVKAQMFNGSM--TLLTTLGWSTITF--DGMIDSPVE--------PRTSSRTFHFDEADKHTVEALRQWAAS---------QSLLTSESTVPLSSVQPKMYFDLTCQ---LLSKACMDSRCILLKVWDGTECGHSL 338          
BLAST of protection of telomere 1-like protein vs. Ensembl Cavefish
Match: pot1 (protection of telomeres 1 [Source:NCBI gene;Acc:103027589])

HSP 1 Score: 74.3294 bits (181), Expect = 1.596e-13
Identity = 60/214 (28.04%), Postives = 102/214 (47.66%), Query Frame = 1
Query:  100 QYDFTALTDVKVGEFSNVMGIIKYCSDPKKTKGKDYQMTVSITDPSVGYEGKIVCNLFNAKPENLPRITGRGDVIIMHKLKISKFRNNIQGIGIQKEGFNVAVFSKNYLIDTSKECFERIIANMSSIKNQFSITMDDLKKVQKLQEWGNSMPSSQIDEGELNLDAINFVSLSEISPRVTCSLTAQVISVLSISYLDFRTLIL-IWDGTIPGCDL 738
            +Y +  L+++K     NV G++ +   P  TKG DY  T+ ITD S     K+ C +F+ K E+ P+I   GD+I +H++K   F  ++    +   G++   F  + +ID+  E          +    F     D   V+ L++W  S         +  L + + V LS + P++   LT Q   +LS + +D R ++L +WDGT  G  L
Sbjct:  152 KYTYIPLSELKPRSIVNVYGVVTFFKQPFPTKGTDYCSTLKITDQS---NAKVGCTIFSEKLEDHPKIFRVGDIIRLHRVKAQMFNGSM--TLLTTLGWSTITF--DGMIDSPVE--------PRTSSRTFHFDEADKHTVEALRQWAAS---------QSLLTSESTVPLSSVQPKMYFDLTCQ---LLSKACMDSRCILLKVWDGTECGHSL 338          
BLAST of protection of telomere 1-like protein vs. Ensembl Sea Lamprey
Match: POT1 (protection of telomeres 1 [Source:HGNC Symbol;Acc:HGNC:17284])

HSP 1 Score: 71.2478 bits (173), Expect = 2.736e-13
Identity = 60/213 (28.17%), Postives = 95/213 (44.60%), Query Frame = 1
Query:   97 MQYDFTALTDVKVGEFSNVMGIIKYCSDPKKTKGKDYQMTVSITDPSVGYEGKIVCNLFNAKPENLPRITGRGDVIIMHKLKISKFRNNIQGIGIQKEGFNVAVFSKNYLIDTSKECFERIIANMSSIKNQFSITMDDLKKVQKLQEWGNSMPSSQIDEGELNLDAINFVSLSEISP----RVTCSLTAQVISVLSISYLDFRTLIL-IWDGT 720
            + Y +  +  ++ G   NV G +K+   P  T G D+ M +S+ D S    G + C +F   PE LP++T  GD++ MH+LK+  ++  +QG      GF+  VFS    +  S E         S+  N       D K +  L++W +          E  +     V L E+ P     + C L A+ +       +D RT IL +WDGT
Sbjct:    7 VSYTYVTIDKIREGMVVNVYGAVKFFRPPTFTNGTDHFMILSLVDQSEPEHG-LRCMIF-GHPEQLPQVTRVGDIVRMHRLKVQLYQGVLQGSS--SPGFSTLVFSGQ--MGASME-------PSSTTTNYHLNPAVDHKILLALRQWAS----------ERFVSPSYGVRLFEVKPPQFLDIRCQLVAKAV-------VDHRTTILKVWDGT 189          
BLAST of protection of telomere 1-like protein vs. Ensembl Nematostella
Match: EDO47031 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNA7])

HSP 1 Score: 77.7962 bits (190), Expect = 4.750e-15
Identity = 104/483 (21.53%), Postives = 203/483 (42.03%), Query Frame = 1
Query:   94 SMQYDFTALTDVKVGEFSNVMGIIKYCSDPKKTKGKDYQMTVSITDPSV-GYEGKIVCNLFNAKPENLPRITGRGDVIIMHKLKISKFRNNIQGI--GIQKEGFNVAVFSKNYLIDTSKECFERIIANMSSIKNQFSITMDDLKKVQKLQEWGNSMPSSQIDEGELNLDAINFVSLSEISPRVT-CSLTAQVISVLSISYLDFRTLILIWDGTIP--GCDLNRKFITILSNCIKEKHDTELMAQFGGKISNPYLGYIFLKEESLIG------PGDYVYFHRVF---VEPPLNG-PGV-CLVADRCKVG---ILTKESQQYD----KLLARLESFSESLPC------VADCISIDLKQLTKWSLKDYGKMLKQFDYEIEFNENEKYQFNITARVVKVHPSTEKEFNDSMVIFCSCCQELRD-------------------MKDVSQLAYACPKCAVPIP---MITMVFEDFTGWLTGVVVGQSV 1386
            S +  +T L ++K G   N  G++K+C   K  +G +Y   +S+ D S+   E    CN+F    E+LP +   GD++ +  + + +F    QG     + + F+   F+ +Y         +  +  M+S   ++ +  DD+ +V++L++   + P  +I+            ++S + P     +L  QV+++     L+F  ++ +WDGT P  GCD+       + +  +   D ++  Q GG ++ P    + L +E   G      PGD+V    V    V+   NG P V C++   C  G    + K++   D    KL   ++++ ++ P       +A+ +S    Q T  ++ D+  +     ++I   E    ++    + +   P   KEF   + + CS C++L                       D     ++CP C  P     + +++  D T  L  +V    V
Sbjct:  197 SGKESYTKLAELKHGAIKNFYGLVKFCKVSKTRRG-EYVAAISLVDESLSSLEESFKCNIFTKSVEHLPLVHSVGDILRLDGVSLVRFNGVTQGTVSSFKSDSFSWLSFNGSY---------DAPVLPMASSSAKYHMDDDDITRVRELKDLAKTAP--RINPSR------TLQTISGLDPSTQFVNLACQVLALWKDPALNF-LVLQVWDGTTPRYGCDVE------VDDHSRWVMDRKISEQAGG-MAIP----VCLYDEHSTGPAADLNPGDFVMLANVRLKEVDNEENGKPRVECMMHSDCINGRGVYMLKDTGWTDWYLQKLKDSIQNYLDTHPPQSLREEIAEAVSDLRTQQTSCTVTDHPMVPFTTLWDIHNQEKVPNKYKCRVKAISFIPPQTKEF---VQLHCSTCKKLASRIGGPSGSNIDDDCDGLGTQHDRDVTPHSCPVCGNPFTRTYLFSLLLADRTDMLIAMVFDDDV 646          
BLAST of protection of telomere 1-like protein vs. Ensembl Medaka
Match: pot1 (protection of telomeres 1 [Source:NCBI gene;Acc:101169692])

HSP 1 Score: 73.559 bits (179), Expect = 2.982e-13
Identity = 58/207 (28.02%), Postives = 93/207 (44.93%), Query Frame = 1
Query:  100 QYDFTALTDVKVGEFSNVMGIIKYCSDPKKTKGKDYQMTVSITDPSVGYEGKIVCNLFNAKPENLPRITGRGDVIIMHKLKISKFRNNIQGIGIQKEGFNVAVFSKNYLIDTSKECFERIIANMSSIKNQFSITMDDLKKVQKLQEWGNSMPSSQIDEGELNLDAINFVSLSEISPRVTCSLTAQVISVLSISYLDFRTLILIWDGT 720
            +Y +T L D+K G   NV G++ +   P K+ G D+  ++ ITD S      I C +F  K E  P+I   GD++ MH++K+  F N I    +   GF+V  F              R +              +D ++V++LQ W        I    + L   N VSLS + P+    LT Q+++   +      +L+ +WDGT
Sbjct:  168 RYTYTPLGDLKAGSVVNVYGVVVFFKQPFKSHGTDFCSSLKITDKS---NHSIGCTIFCEKLEEHPKIFQNGDIVRMHRVKVQLFNNTI--TLVNTFGFSVVTFDGKPSGSVEPRTSSRTV----------HFDEEDRRRVEELQTW--------ISSQNILLPLTNSVSLSAVQPKAYFDLTCQLLAKAPVD--STCSLLRVWDGT 349          
BLAST of protection of telomere 1-like protein vs. Planmine SMEST
Match: SMESG000018656.1 (SMESG000018656.1)

HSP 1 Score: 1016.14 bits (2626), Expect = 0.000e+0
Identity = 492/496 (99.19%), Postives = 493/496 (99.40%), Query Frame = 1
Query:   97 MQYDFTALTDVKVGEFSNVMGIIKYCSDPKKTKGKDYQMTVSITDPSVGYEGKIVCNLFNAKPENLPRITGRGDVIIMHKLKISKFRNNIQGIGIQKEGFNVAVFSKNYLIDTSKECFERIIANMSSIKNQFSITMDDLKKVQKLQEWGNSMPSSQIDEGELNLDAINFVSLSEISPRVTCSLTAQVISVLSISYLDFRTLILIWDGTIPGCDLNRKFITILSNCIKEKHDTELMAQFGGKISNPYLGYIFLKEESLIGPGDYVYFHRVFVEPPLNGPGVCLVADRCKVGILTKESQQYDKLLARLESFSESLPCVADCISIDLKQLTKWSLKDYGKMLKQFDYEIEFNENEKYQFNITARVVKVHPSTEKEFNDSMVIFCSCCQELRDMKDVSQLAYACPKCAVPIPMITMVFEDFTGWLTGVVVGQSVLDMLNLVMIDAKQPNWWVHLFGQNKIESINQWLSHVKRLADGWIEGKLVFKRTLHGKVLPFIEDIV 1584
            MQYDFTALTDVKVGEFSNVMGIIKYCSDPKKTKGKDYQMTVSITD SVGYEGKIVCNLFNAKPENLPRITGRGDVIIMHKLKISKFRNNIQGIGIQKEGFNVAVFSKNYLIDTSKE FERIIANMSSIKNQFSITMDDLKKVQKLQEWGNSMPSSQIDEGELNLDAINFVSLSEISPRVTCSLTAQVISVLSI+YLDFRTLILIWDGTIPGCDLNRKFITILSNCIKEKHDTELMAQFGGKISNPYLGYIFLKEESLIGPGDYVYFHRVFVEPPLNGPGVCLVADRCKVGILTKESQQYDKLLARLESFSE LPCVADCISIDLKQLTKWSLKDYGKMLKQFDYEIEFNENEKYQFNITARVVKVHPSTEKEFNDSMVIFCSCCQELRDMKDVSQLAYACPKCAVPIPMITMVFEDFTGWLTGVVVGQSVLDMLNLVMIDAKQPNWWVHLFGQNKIESINQWLSHVKRLADGWIEGKLVFKRTLHGKVLPFIEDIV
Sbjct:    1 MQYDFTALTDVKVGEFSNVMGIIKYCSDPKKTKGKDYQMTVSITDASVGYEGKIVCNLFNAKPENLPRITGRGDVIIMHKLKISKFRNNIQGIGIQKEGFNVAVFSKNYLIDTSKESFERIIANMSSIKNQFSITMDDLKKVQKLQEWGNSMPSSQIDEGELNLDAINFVSLSEISPRVTCSLTAQVISVLSINYLDFRTLILIWDGTIPGCDLNRKFITILSNCIKEKHDTELMAQFGGKISNPYLGYIFLKEESLIGPGDYVYFHRVFVEPPLNGPGVCLVADRCKVGILTKESQQYDKLLARLESFSEGLPCVADCISIDLKQLTKWSLKDYGKMLKQFDYEIEFNENEKYQFNITARVVKVHPSTEKEFNDSMVIFCSCCQELRDMKDVSQLAYACPKCAVPIPMITMVFEDFTGWLTGVVVGQSVLDMLNLVMIDAKQPNWWVHLFGQNKIESINQWLSHVKRLADGWIEGKLVFKRTLHGKVLPFIEDIV 496          
The following BLAST results are available for this feature:
BLAST of protection of telomere 1-like protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
POT11.245e-1428.71protection of telomeres 1 [Source:HGNC Symbol;Acc:... [more]
POT11.245e-1428.71protection of telomeres 1 [Source:HGNC Symbol;Acc:... [more]
POT11.465e-1428.71protection of telomeres 1 [Source:HGNC Symbol;Acc:... [more]
POT11.922e-1428.71protection of telomeres 1 [Source:HGNC Symbol;Acc:... [more]
POT11.969e-1428.71protection of telomeres 1 [Source:HGNC Symbol;Acc:... [more]
back to top
BLAST of protection of telomere 1-like protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of protection of telomere 1-like protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of protection of telomere 1-like protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
pot12.937e-1328.91protection of telomeres 1 homolog [Source:ZFIN;Acc... [more]
pot13.453e-1328.91protection of telomeres 1 homolog [Source:ZFIN;Acc... [more]
pot14.169e-1328.91protection of telomeres 1 homolog [Source:ZFIN;Acc... [more]
back to top
BLAST of protection of telomere 1-like protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 4
Match NameE-valueIdentityDescription
pot12.061e-1335.45protection of telomeres 1 [Source:NCBI gene;Acc:40... [more]
pot12.167e-1335.45protection of telomeres 1 [Source:NCBI gene;Acc:40... [more]
pot16.361e-1334.86protection of telomeres 1 [Source:NCBI gene;Acc:40... [more]
pot17.097e-1334.95protection of telomeres 1 [Source:NCBI gene;Acc:40... [more]
back to top
BLAST of protection of telomere 1-like protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pot1a3.853e-1628.64protection of telomeres 1A [Source:MGI Symbol;Acc:... [more]
Pot1a9.489e-1628.64protection of telomeres 1A [Source:MGI Symbol;Acc:... [more]
Pot1a9.489e-1628.64protection of telomeres 1A [Source:MGI Symbol;Acc:... [more]
Pot1b2.614e-1427.94protection of telomeres 1B [Source:MGI Symbol;Acc:... [more]
Pot1b2.614e-1427.94protection of telomeres 1B [Source:MGI Symbol;Acc:... [more]
back to top
BLAST of protection of telomere 1-like protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q91WC1|POTE1_MOUSE6.637e-1528.64Protection of telomeres protein 1 OS=Mus musculus ... [more]
sp|Q9NUX5|POTE1_HUMAN1.163e-1328.71Protection of telomeres protein 1 OS=Homo sapiens ... [more]
sp|Q95K48|POTE1_MACFA1.350e-1328.71Protection of telomeres protein 1 OS=Macaca fascic... [more]
sp|P62597|POTE1_CHICK4.132e-1327.14Protection of telomeres protein 1 OS=Gallus gallus... [more]
sp|Q6NKX5|POT1B_ARATH1.478e-621.88Protection of telomeres protein 1b OS=Arabidopsis ... [more]
back to top
BLAST of protection of telomere 1-like protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
T1R2R50.000e+098.80Protection of telomere 1-like protein OS=Schmidtea... [more]
A0A0R3X8W33.319e-1933.04Telo_bind domain-containing protein OS=Hydatigena ... [more]
W6UEI51.800e-1830.77Protection of telomeres protein OS=Echinococcus gr... [more]
A0A068WPK23.266e-1830.13Protection of telomeres protein 1 OS=Echinococcus ... [more]
A0A504YUV76.720e-1831.53Telo_bind domain-containing protein OS=Fasciola gi... [more]
back to top
BLAST of protection of telomere 1-like protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
pot11.287e-1328.04protection of telomeres 1 [Source:NCBI gene;Acc:10... [more]
pot11.301e-1327.65protection of telomeres 1 [Source:NCBI gene;Acc:10... [more]
pot11.587e-1328.04protection of telomeres 1 [Source:NCBI gene;Acc:10... [more]
pot11.596e-1328.04protection of telomeres 1 [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of protection of telomere 1-like protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
POT12.736e-1328.17protection of telomeres 1 [Source:HGNC Symbol;Acc:... [more]
back to top
BLAST of protection of telomere 1-like protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of protection of telomere 1-like protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO470314.750e-1521.53Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of protection of telomere 1-like protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
pot12.982e-1328.02protection of telomeres 1 [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of protection of telomere 1-like protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000018656.10.000e+099.19SMESG000018656.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30009702
GenBankAGG22603.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30009702 ID=SMED30009702|Name=protection of telomere 1-like protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1653bp
TTTGTCGCGCAACTTATCAAATTCAAAAAATATTATTGGTTTAAGTAAAT
TTTTTTCATATTTAAATTACAAGTTTTCTATTTGGTAAAGATATCAATGC
AATACGATTTTACTGCTTTAACAGATGTTAAAGTTGGTGAATTTTCCAAT
GTCATGGGTATAATAAAATATTGTTCTGATCCAAAAAAGACAAAGGGTAA
AGATTACCAAATGACTGTAAGCATAACTGACCCATCTGTTGGATATGAAG
GGAAAATCGTGTGCAATCTTTTTAATGCAAAACCTGAAAATCTCCCTAGG
ATTACTGGAAGAGGAGATGTTATAATAATGCACAAATTAAAAATAAGCAA
ATTTAGAAATAACATTCAAGGAATAGGAATTCAAAAAGAAGGATTCAACG
TGGCTGTATTTTCAAAAAACTATTTGATAGATACATCAAAGGAATGTTTT
GAACGCATAATCGCCAACATGAGTTCAATAAAAAATCAGTTCTCTATTAC
AATGGATGATTTAAAAAAGGTTCAAAAACTTCAAGAATGGGGAAATTCAA
TGCCTTCTTCACAAATTGATGAAGGCGAATTAAATCTGGATGCAATAAAC
TTTGTTTCGTTGTCAGAAATCAGCCCTAGAGTTACATGCTCGTTGACAGC
ACAAGTTATCAGTGTTCTTTCTATAAGCTATCTCGATTTTCGAACGTTAA
TTTTGATCTGGGATGGTACTATTCCCGGATGTGATCTCAACAGAAAGTTC
ATCACTATCCTTTCGAATTGCATTAAAGAAAAACACGATACAGAGCTGAT
GGCCCAATTCGGGGGCAAAATATCTAATCCATATCTGGGTTATATTTTCT
TGAAAGAAGAATCATTAATCGGTCCCGGTGACTATGTGTACTTTCATAGG
GTTTTTGTTGAACCCCCTCTTAACGGTCCAGGAGTTTGTCTTGTCGCAGA
TCGATGCAAGGTTGGAATATTGACGAAGGAAAGTCAGCAGTATGATAAAT
TACTCGCAAGACTTGAAAGTTTCTCTGAAAGCTTACCTTGCGTAGCTGAT
TGCATCAGTATTGATTTAAAACAACTGACTAAATGGTCACTAAAAGATTA
CGGGAAAATGCTGAAACAATTTGATTATGAAATTGAATTCAATGAGAATG
AAAAATATCAATTTAATATAACTGCACGAGTAGTGAAGGTTCATCCAAGC
ACAGAAAAAGAATTCAATGATTCGATGGTCATATTTTGCTCGTGCTGCCA
AGAATTGAGAGATATGAAAGATGTTTCACAATTGGCATATGCTTGCCCAA
AGTGTGCTGTGCCTATTCCTATGATTACAATGGTATTTGAGGATTTCACA
GGATGGCTGACTGGTGTTGTTGTCGGTCAGTCTGTGTTGGATATGTTGAA
TCTGGTAATGATCGATGCCAAGCAACCGAACTGGTGGGTGCACTTGTTTG
GTCAGAATAAAATCGAGTCAATAAATCAGTGGCTTTCCCATGTCAAGCGA
TTAGCTGATGGATGGATTGAAGGGAAATTGGTTTTCAAACGGACCCTTCA
CGGAAAAGTTTTACCATTTATCGAAGATATTGTTTTATTGGATTATTTAT
AATCAGATAGTTTTTTGTTACGTCTCTGTCCAATCTCGATAATCAGTATT
ATT
back to top

protein sequence of SMED30009702-orf-1

>SMED30009702-orf-1 ID=SMED30009702-orf-1|Name=SMED30009702-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=502bp
MQYDFTALTDVKVGEFSNVMGIIKYCSDPKKTKGKDYQMTVSITDPSVGY
EGKIVCNLFNAKPENLPRITGRGDVIIMHKLKISKFRNNIQGIGIQKEGF
NVAVFSKNYLIDTSKECFERIIANMSSIKNQFSITMDDLKKVQKLQEWGN
SMPSSQIDEGELNLDAINFVSLSEISPRVTCSLTAQVISVLSISYLDFRT
LILIWDGTIPGCDLNRKFITILSNCIKEKHDTELMAQFGGKISNPYLGYI
FLKEESLIGPGDYVYFHRVFVEPPLNGPGVCLVADRCKVGILTKESQQYD
KLLARLESFSESLPCVADCISIDLKQLTKWSLKDYGKMLKQFDYEIEFNE
NEKYQFNITARVVKVHPSTEKEFNDSMVIFCSCCQELRDMKDVSQLAYAC
PKCAVPIPMITMVFEDFTGWLTGVVVGQSVLDMLNLVMIDAKQPNWWVHL
FGQNKIESINQWLSHVKRLADGWIEGKLVFKRTLHGKVLPFIEDIVLLDY
L*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
PLANA:0000419prepharyngeal region
PLANA:0000420parapharyngeal region
PLANA:0000421tail
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR028389POT1
IPR011564Telomer_end-bd_POT1/Cdc13
IPR012340NA-bd_OB-fold
Vocabulary: biological process
TermDefinition
GO:0000723telomere maintenance
Vocabulary: molecular function
TermDefinition
GO:0003677DNA binding
GO:0043047single-stranded telomeric DNA binding
Vocabulary: cellular component
TermDefinition
GO:0000784nuclear chromosome, telomeric region
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR011564Telomeric single stranded DNA binding POT1/Cdc13SMARTSM00976Telo_bind_a_2coord: 5..133
e-value: 7.4E-14
score: 62.0
IPR011564Telomeric single stranded DNA binding POT1/Cdc13PFAMPF02765POT1coord: 9..148
e-value: 4.6E-19
score: 68.7
NoneNo IPR availableGENE3DG3DSA:2.40.50.140coord: 1..156
e-value: 1.6E-32
score: 114.0
IPR028389Protection of telomeres protein 1PANTHERPTHR14513PROTECTION OF TELOMERES 1coord: 2..269
IPR012340Nucleic acid-binding, OB-foldSUPERFAMILYSSF50249Nucleic acid-binding proteinscoord: 6..153