Dimer_Tnp_hAT domain-containing protein

Overview
NameDimer_Tnp_hAT domain-containing protein
Smed IDSMED30009701
Length (bp)1610
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Dimer_Tnp_hAT domain-containing protein (SMED30009701) t-SNE clustered cells

Violin plots show distribution of expression levels for Dimer_Tnp_hAT domain-containing protein (SMED30009701) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Dimer_Tnp_hAT domain-containing protein (SMED30009701) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Dimer_Tnp_hAT domain-containing protein (SMED30009701) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30009701

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymal cellSMED30009701SMESG000041464.1 dd_Smed_v4_28351_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30009701SMESG000041464.1 dd_Smed_v6_28351_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Ensembl Human
Match: KIAA1586 (KIAA1586 [Source:HGNC Symbol;Acc:HGNC:21360])

HSP 1 Score: 57.3806 bits (137), Expect = 4.944e-8
Identity = 33/87 (37.93%), Postives = 47/87 (54.02%), Query Frame = 2
Query:  557 IRGFREYLTEK------SVPDKLLPLQIALITIPISSIEAERGFLKMNIITTKTRASLMTTTVSSILFIRLVGPPLTRFDPTRYVDS 799
            +  FRE++         S+P  +   +  + TI I+S EAERGF  MNII T+ R SL    VS ++ I L+G  L  +D T +V S
Sbjct:  641 LNDFREFVNNNIKSNNVSIPTTIYKAKKIVSTIAINSAEAERGFNLMNIICTRVRNSLTIDHVSDLMTINLLGKELADWDATPFVKS 727          
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Ensembl Human
Match: KIAA1586 (KIAA1586 [Source:HGNC Symbol;Acc:HGNC:21360])

HSP 1 Score: 57.3806 bits (137), Expect = 5.464e-8
Identity = 33/87 (37.93%), Postives = 47/87 (54.02%), Query Frame = 2
Query:  557 IRGFREYLTEK------SVPDKLLPLQIALITIPISSIEAERGFLKMNIITTKTRASLMTTTVSSILFIRLVGPPLTRFDPTRYVDS 799
            +  FRE++         S+P  +   +  + TI I+S EAERGF  MNII T+ R SL    VS ++ I L+G  L  +D T +V S
Sbjct:  668 LNDFREFVNNNIKSNNVSIPTTIYKAKKIVSTIAINSAEAERGFNLMNIICTRVRNSLTIDHVSDLMTINLLGKELADWDATPFVKS 754          
BLAST of Dimer_Tnp_hAT domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9HCI6|K1586_HUMAN (E3 SUMO-protein ligase KIAA1586 OS=Homo sapiens OX=9606 GN=KIAA1586 PE=1 SV=2)

HSP 1 Score: 57.3806 bits (137), Expect = 2.624e-7
Identity = 33/87 (37.93%), Postives = 47/87 (54.02%), Query Frame = 2
Query:  557 IRGFREYLTEK------SVPDKLLPLQIALITIPISSIEAERGFLKMNIITTKTRASLMTTTVSSILFIRLVGPPLTRFDPTRYVDS 799
            +  FRE++         S+P  +   +  + TI I+S EAERGF  MNII T+ R SL    VS ++ I L+G  L  +D T +V S
Sbjct:  668 LNDFREFVNNNIKSNNVSIPTTIYKAKKIVSTIAINSAEAERGFNLMNIICTRVRNSLTIDHVSDLMTINLLGKELADWDATPFVKS 754          
BLAST of Dimer_Tnp_hAT domain-containing protein vs. TrEMBL
Match: A0A0C2MSD4 (Uncharacterized protein OS=Thelohanellus kitauei OX=669202 GN=RF11_16157 PE=4 SV=1)

HSP 1 Score: 179.874 bits (455), Expect = 3.442e-57
Identity = 103/173 (59.54%), Postives = 125/173 (72.25%), Query Frame = 2
Query:  371 FTKKLKESIEQRLLYNKDADLAYSARVLDLKQWPDNIDTH*TFGKVEIXXXXXXXXXXXXXMIRGFREYLTEKSVPDKLLPLQIALITIPISSIEAERGFLKMNIITTKTRASLMTTTVSSILFIRLVGPPLTRFDPTRYVDS*LLRSRHSTIDTNS----KECLSDENLVKL 877
            F  KLK SIE R+L N+DA+LA  AR+LD KQW +N+    TFG++EI  L  RL LNER MIRGFREY T+K+ P+ LL L  A  TI ISS E ERGF +MN+I    RASLMT TVS ++FIRLVGPPLT FDP++YVDS LLR RHS +D+ S    ++ LSDEN+ KL
Sbjct:   85 FDNKLKNSIENRMLTNEDAELAQWARILDQKQWSENVTNQITFGEMEIRKLSNRLQLNEREMIRGFREYFTKKTYPETLLLLIRATHTISISSSECERGFSQMNLIIPPIRASLMTKTVSLLIFIRLVGPPLTFFDPSKYVDSWLLRRRHSAVDSQSRKRNRDHLSDENMRKL 257          

HSP 2 Score: 73.1738 bits (178), Expect = 3.442e-57
Identity = 41/71 (57.75%), Postives = 48/71 (67.61%), Query Frame = 3
Query:  120 DL*LMYDALLELSEFSLNLQQRDMNLYKAYQKIKAPAQVFEEQPIIPDHYYKIVVTAAYNNLFRGVSLYKK 332
            DL LM DAL ELSE SL+LQ+R+++LYKA QKIKA  QVFEE+      YYK    AA N  F GV L+ K
Sbjct:    2 DLGLMCDALQELSELSLDLQERNIDLYKANQKIKALVQVFEERSQNAGTYYKTATAAAENLSFHGVILHTK 72          
BLAST of Dimer_Tnp_hAT domain-containing protein vs. TrEMBL
Match: A0A0C2MTG0 (Uncharacterized protein OS=Thelohanellus kitauei OX=669202 GN=RF11_11350 PE=4 SV=1)

HSP 1 Score: 127.487 bits (319), Expect = 3.846e-31
Identity = 69/111 (62.16%), Postives = 84/111 (75.68%), Query Frame = 2
Query:  554 MIRGFREYLTEKSVPDKLLPLQIALITIPISSIEAERGFLKMNIITTKTRASLMTTTVSSILFIRLVGPPLTRFDPTRYVDS*LLRSRHSTIDTNSKE---CLSDENLVKL 877
            MIRGF EYL EK+  + LL L   ++TI ISS + ERGF  MN+I T TRASLMT TVSS++FIRLVGPPLT FDP++YVDS LLR RHS +D+ S++    LSDEN+ KL
Sbjct:   17 MIRGFCEYLMEKTSGETLLLLIRGILTICISSSKCERGFSLMNLIMTLTRASLMTETVSSLIFIRLVGPPLTFFDPSKYVDSWLLRGRHSAVDSQSRKRNRDLSDENMRKL 127          
BLAST of Dimer_Tnp_hAT domain-containing protein vs. TrEMBL
Match: A0A1B6M310 (Uncharacterized protein (Fragment) OS=Graphocephala atropunctata OX=36148 GN=g.1297 PE=4 SV=1)

HSP 1 Score: 130.568 bits (327), Expect = 6.330e-31
Identity = 74/159 (46.54%), Postives = 104/159 (65.41%), Query Frame = 2
Query:  371 FTKKLKESIEQRLLYNKDADLAYSARVLDLKQWPDNIDTH*TFGKVEIXXXXXXXXXXXXXMIRGFREYLTEKSVPDKLLPLQIALITIPISSIEAERGFLKMNIITTKTRASLMTTTVSSILFIRLVGPPLTRFDPTRYVDS*LLRSRHSTIDTNSKE 847
            F   LK SIE RLL  KD  LA + +V+D + WP++I    TFG+ E+  L +R  LNER +I GFREY+  +++PD L  L+ ++ ++ ISS E ERGF +MN+I T  R+SL  TTVS +LF+++ GPPL  F P +YVD+ L+   HS +   SKE
Sbjct:   73 FYGALKTSIEARLLNEKDTKLAETFKVMDTRNWPEDIPI--TFGENEMRELASRFKLNERQLITGFREYIYSRTLPDSLCRLEQSINSVAISSSECERGFSQMNLIITPLRSSLKITTVSGLLFVKINGPPLRLFQPEKYVDTWLVSGHHSALAVKSKE 229          
BLAST of Dimer_Tnp_hAT domain-containing protein vs. TrEMBL
Match: H3AKH7 (Dimer_Tnp_hAT domain-containing protein OS=Latimeria chalumnae OX=7897 PE=4 SV=1)

HSP 1 Score: 80.8777 bits (198), Expect = 1.618e-25
Identity = 58/153 (37.91%), Postives = 78/153 (50.98%), Query Frame = 2
Query:  380 KLKESIEQRLLYNKDADLAYSARVLDLKQWPDNIDTH*TFGKVEIXXXXXX-XXXXXXXMIRGFREYLTEKS-----VPDKLLPLQIALITIPISSIEAERGFLKMNIITTKTRASLMTTTVSSILFIRLVGPPLTRFDPTRYVDS*LLRSRH 820
            K++E I  +L Y    +L     VLD  +WP N D    FG   I +L         + ++ GFR YL++ S     VP++L  L   L T+ IS+ E ER F  +N I T  R SL   T S ++FI+ VGPPL  F P  YV S L + RH
Sbjct:  487 KMEERIFNKLTYQ---ELLKHMEVLDKSKWPCNPDI--CFGDKSIRHLCAFFNISQVQRVVSGFRGYLSDTSDEDNKVPERLKQLLDVLKTLIISTAECERSFSALNDILTNIRNSLSLETASKLIFIKTVGPPLELFKPESYVRSWLGKGRH 634          

HSP 2 Score: 65.855 bits (159), Expect = 1.618e-25
Identity = 35/100 (35.00%), Postives = 59/100 (59.00%), Query Frame = 3
Query:   36 DPTRDKEDLCKFEGLGLQRKITSTAFV*DL*LMYDALLELSEFSLNLQQRDMNLYKAYQKIKAPAQVFEEQPIIPDHYYKIVVTAAYNNLFRGVSLYKKR 335
            D +RD +    ++GL  + ++T T+FV ++ L++DAL+EL E SL LQ+R   L  A++ ++    VFE     P  ++ I   A  +  F+GV+L+K R
Sbjct:  374 DTSRDSKQRATYKGL--KNRLTDTSFVLNMGLLFDALVELKELSLELQKRSTTLMHAHKLVEQKCLVFESMSQNPGEHFLISQQAVRDAAFKGVALHKGR 471          
BLAST of Dimer_Tnp_hAT domain-containing protein vs. TrEMBL
Match: A0A0C2JR64 (Uncharacterized protein OS=Thelohanellus kitauei OX=669202 GN=RF11_11886 PE=4 SV=1)

HSP 1 Score: 102.449 bits (254), Expect = 1.838e-22
Identity = 55/86 (63.95%), Postives = 65/86 (75.58%), Query Frame = 2
Query:  554 MIRGFREYLTEKSVPDKLLPLQIALITIPISSIEAERGFLKMNIITTKTRASLMTTTVSSILFIRLVGPPLTRFDPTRYVDS*LLR 811
            MIRGFREY T+K+ P+ LL L  A  TI ISS E ERGF +MN+I    RASLMT TVSS++FI LV PPLT F+P++YVDS LLR
Sbjct:   17 MIRGFREYFTKKTYPETLLLLIRATHTISISSSECERGFSQMNLIIPPIRASLMTKTVSSLIFITLVSPPLTFFEPSKYVDSWLLR 102          
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000039887.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02001836.1:502128:504635:1 gene:ENSAMXG00000030287.1 transcript:ENSAMXT00000039887.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 49.2914 bits (116), Expect = 8.129e-6
Identity = 24/58 (41.38%), Postives = 34/58 (58.62%), Query Frame = 2
Query:  626 LITIPISSIEAERGFLKMNIITTKTRASLMTTTVSSILFIRLVGPPLTRFDPTRYVDS 799
            ++ +PIS+ + ERGF   N I +K R SL  +TV  ++ I   GP L +FDP   V S
Sbjct:  565 MLVLPISAAQCERGFSAQNRIKSKVRNSLNVSTVEDLVRISSEGPSLEQFDPEPCVKS 622          
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000037733.1 (pep primary_assembly:ASM223467v1:17:413272:415622:1 gene:ENSORLG00000029136.1 transcript:ENSORLT00000037733.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 67.0106 bits (162), Expect = 2.614e-11
Identity = 50/135 (37.04%), Postives = 74/135 (54.81%), Query Frame = 2
Query:  470 PDNIDT-H*TFGKVEIXXXXXXXXXXXXXMIRGFREYLTE--KSVPDKLLPLQIALITIPISSIEAERGFLKMNIITTKTRASLMTTTVSSILFIRLVGPPLTRFDPTRYVDS*LLRSR---HSTIDTNSKECLS 856
            P+N D  +  FG+ E+  L  RL +NE+    G+ E+     +S+P  L  L +A+ T+  S+ + ERGF  MN I T  R ++ T  VS++LFI   GPP  ++DP  YV + L + R   H+T D   K  LS
Sbjct:  554 PENWDQDNPRFGEEEVRTLCERLNINEQEAHLGYVEFKASGGRSIPPPLKKLLLAVDTLSASNADCERGFSTMNNIMTDLRGTMTTKNVSNLLFISSFGPPFMKWDPMPYVKTWLGKGRRPAHTTSDCFHKNTLS 688          
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000039522.1 (pep primary_assembly:ASM223467v1:5:29857639:29864727:-1 gene:ENSORLG00000022850.1 transcript:ENSORLT00000039522.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 63.5438 bits (153), Expect = 3.083e-10
Identity = 44/119 (36.97%), Postives = 67/119 (56.30%), Query Frame = 2
Query:  470 PDNIDT-H*TFGKVEIXXXXXXXXXXXXXMIRGFREYLTE--KSVPDKLLPLQIALITIPISSIEAERGFLKMNIITTKTRASLMTTTVSSILFIRLVGPPLTRFDPTRYVDS*LLRSR 817
            P+N D  +  FG+ E+  L  RL +NE+    G+ E+     +S+P  L  L +A+ T+  S+ + ERGF  MN I T  R ++ T  VS++LFI   GPP  ++DP  YV + L + R
Sbjct:  586 PENWDQDNPRFGEEEVRTLCERLNINEQEAHLGYVEFKASGGRSIPPPLKKLLLAVDTLSASNADCERGFSTMNNIMTDLRGTMTTKNVSNLLFISSFGPPFMKWDPMPYVKTWLGKGR 704          
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000029584.1 (pep primary_assembly:ASM223467v1:15:12688806:12690917:1 gene:ENSORLG00000022188.1 transcript:ENSORLT00000029584.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 63.1586 bits (152), Expect = 4.020e-10
Identity = 44/119 (36.97%), Postives = 67/119 (56.30%), Query Frame = 2
Query:  470 PDNIDT-H*TFGKVEIXXXXXXXXXXXXXMIRGFREYLTE--KSVPDKLLPLQIALITIPISSIEAERGFLKMNIITTKTRASLMTTTVSSILFIRLVGPPLTRFDPTRYVDS*LLRSR 817
            P+N D  +  FG+ E+  L  RL +NE+    G+ E+     +S+P  L  L +A+ T+  S+ + ERGF  MN I T  R ++ T  VS++LFI   GPP  ++DP  YV + L + R
Sbjct:  514 PENWDQDNPRFGEEEVRTLCERLNINEQEAHLGYVEFKASGGRSIPPPLKKLLLAVDTLSASNADCERGFSTMNNIMTDLRGTMTTKNVSNLLFISSFGPPFMKWDPMPYVKTWLGKGR 632          
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000032713.1 (pep primary_assembly:ASM223467v1:10:29461654:29464517:-1 gene:ENSORLG00000027731.1 transcript:ENSORLT00000032713.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 62.003 bits (149), Expect = 9.166e-10
Identity = 33/87 (37.93%), Postives = 50/87 (57.47%), Query Frame = 2
Query:  563 GFREYLTE--KSVPDKLLPLQIALITIPISSIEAERGFLKMNIITTKTRASLMTTTVSSILFIRLVGPPLTRFDPTRYVDS*LLRSR 817
            G+ E+     +S+P  L  L +A+ T+  S+ + ERGF  MN I T  R ++ T  VS++LFI   GPP  ++DP  YV + L + R
Sbjct:  567 GYVEFKASGGRSIPPPLKKLLLAVDTLSASNADCERGFSTMNNIMTDLRGTMTTKNVSNLLFISSFGPPFMKWDPMPYVKTWLGKGR 653          
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000027469.1 (pep primary_assembly:ASM223467v1:13:14270076:14276603:-1 gene:ENSORLG00000029281.1 transcript:ENSORLT00000027469.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 60.077 bits (144), Expect = 3.850e-9
Identity = 31/77 (40.26%), Postives = 46/77 (59.74%), Query Frame = 2
Query:  587 KSVPDKLLPLQIALITIPISSIEAERGFLKMNIITTKTRASLMTTTVSSILFIRLVGPPLTRFDPTRYVDS*LLRSR 817
            +S+P  L  L +A+ T+  S+ + ERGF  MN I T  R ++ T  VS++LFI   GPP  ++DP  YV + L + R
Sbjct:  637 RSIPPPLKQLLLAVDTLSASNADCERGFSTMNNIMTDLRDTMTTKNVSNLLFISSFGPPCMKWDPMPYVKTWLGKGR 713          
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Planmine SMEST
Match: SMESG000041464.1 (SMESG000041464.1)

HSP 1 Score: 278.1 bits (710), Expect = 3.391e-92
Identity = 134/134 (100.00%), Postives = 134/134 (100.00%), Query Frame = 1
Query: 1069 MKAEKSAFVLVTNGSKFPGDLTKLIFLAYVERMWKFINLLIRIYPGKYSPTRFKGMIQKSDCLINLCPRLEWERTKILMKLEGESKVINSLKHLCRLSLISHFGCHYLYQLMKQSILPEQLLNYIISAICEESI 1470
            MKAEKSAFVLVTNGSKFPGDLTKLIFLAYVERMWKFINLLIRIYPGKYSPTRFKGMIQKSDCLINLCPRLEWERTKILMKLEGESKVINSLKHLCRLSLISHFGCHYLYQLMKQSILPEQLLNYIISAICEESI
Sbjct:    1 MKAEKSAFVLVTNGSKFPGDLTKLIFLAYVERMWKFINLLIRIYPGKYSPTRFKGMIQKSDCLINLCPRLEWERTKILMKLEGESKVINSLKHLCRLSLISHFGCHYLYQLMKQSILPEQLLNYIISAICEESI 134          
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Planmine SMEST
Match: SMESG000045502.1 (SMESG000045502.1)

HSP 1 Score: 131.724 bits (330), Expect = 2.327e-48
Identity = 76/95 (80.00%), Postives = 78/95 (82.11%), Query Frame = 2
Query:  365 KRFTKKLKESIEQRLLYNKDADLAYSARVLDLKQWPDNIDTH*TFGKVEIXXXXXXXXXXXXXMIRGFREYLTEKSVPDKLLPLQIALITIPISS 649
            K F KKL+ESIEQRLL NKDADLAYSARVLDLK WPDNI TH  FG  EI NL TRL LNE TMIRGFREYLTEK+VPDKLLPLQ A  TIPI S
Sbjct:   69 KAFYKKLRESIEQRLLSNKDADLAYSARVLDLKHWPDNIYTHLAFGDEEIRNLSTRLQLNETTMIRGFREYLTEKNVPDKLLPLQTAHNTIPIYS 163          

HSP 2 Score: 76.2554 bits (186), Expect = 2.327e-48
Identity = 37/59 (62.71%), Postives = 44/59 (74.58%), Query Frame = 3
Query:  165 SLNLQQRDMNLYKAYQKIKAPAQVFEEQPIIPDHYYKIVVTAAYNNLFRGVSLYKKRKL 341
             L+LQ+ DMNL+KA QKIKA  QVFEE+ IIP HYYKI   AAY N F+GVSL+K   +
Sbjct:    3 CLDLQECDMNLFKADQKIKALLQVFEERKIIPGHYYKIAAIAAYKNFFKGVSLHKNESI 61          

HSP 3 Score: 25.0238 bits (53), Expect = 2.327e-48
Identity = 13/20 (65.00%), Postives = 14/20 (70.00%), Query Frame = 1
Query:  328 KKES*NDP*IDVKAFYKKTK 387
            K ES  D  IDVKAFYKK +
Sbjct:   57 KNESITDSPIDVKAFYKKLR 76          
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Planmine SMEST
Match: SMESG000009287.1 (SMESG000009287.1)

HSP 1 Score: 58.9214 bits (141), Expect = 1.287e-10
Identity = 29/60 (48.33%), Postives = 40/60 (66.67%), Query Frame = 2
Query:  620 IALITIPISSIEAERGFLKMNIITTKTRASLMTTTVSSILFIRLVGPPLTRFDPTRYVDS 799
            +A I+ PISS EAERGF  MN+IT+K R SL    +S+++ I L+G P+  FD   +V S
Sbjct:   13 LANISCPISSSEAERGFSLMNLITSKLRTSLTVEHISNLMTINLLGKPIANFDAIPFVTS 72          
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Planmine SMEST
Match: SMESG000036664.1 (SMESG000036664.1)

HSP 1 Score: 51.6026 bits (122), Expect = 1.821e-7
Identity = 44/151 (29.14%), Postives = 74/151 (49.01%), Query Frame = 2
Query:  449 VLDLKQWPDNIDTH*TFGKVEIXXXXXXXXXXXXXMIRGFREYLTEKSV--PDKLLPLQIALITIPISSIEAERGFLKMNIITTKTRASLMTTTVSSILFIRLVGPPLTRFDPTRYVDS*LLRSRHSTIDT---NS---KECLSDENLVKL 877
            +L+ K+WP NI      GK ++N                F+++   ++   P+ +  ++  +  I +S+ EAERGF  +N I +  R  L+ T +  ++ I+++G P+  FDP  YV +  LR      DT   NS   K  L++E L KL
Sbjct:   35 LLEFKKWPKNITAPWLDGKRQLNY---------------FQDFTNNRNSEPPESIKRVKKIIKIIAVSNAEAERGFSIINNIASDERNKLLVTNLLCLISIKILGKPVIAFDPVPYVKT-WLRGHREPNDTRVKNSVARKYSLNEEELWKL 169          
The following BLAST results are available for this feature:
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
KIAA15864.944e-837.93KIAA1586 [Source:HGNC Symbol;Acc:HGNC:21360][more]
KIAA15865.464e-837.93KIAA1586 [Source:HGNC Symbol;Acc:HGNC:21360][more]
back to top
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Dimer_Tnp_hAT domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 1
Match NameE-valueIdentityDescription
sp|Q9HCI6|K1586_HUMAN2.624e-737.93E3 SUMO-protein ligase KIAA1586 OS=Homo sapiens OX... [more]
back to top
BLAST of Dimer_Tnp_hAT domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0C2MSD43.442e-5759.54Uncharacterized protein OS=Thelohanellus kitauei O... [more]
A0A0C2MTG03.846e-3162.16Uncharacterized protein OS=Thelohanellus kitauei O... [more]
A0A1B6M3106.330e-3146.54Uncharacterized protein (Fragment) OS=Graphocephal... [more]
H3AKH71.618e-2537.91Dimer_Tnp_hAT domain-containing protein OS=Latimer... [more]
A0A0C2JR641.838e-2263.95Uncharacterized protein OS=Thelohanellus kitauei O... [more]
back to top
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSAMXT00000039887.18.129e-641.38pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
back to top
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000037733.12.614e-1137.04pep primary_assembly:ASM223467v1:17:413272:415622:... [more]
ENSORLT00000039522.13.083e-1036.97pep primary_assembly:ASM223467v1:5:29857639:298647... [more]
ENSORLT00000029584.14.020e-1036.97pep primary_assembly:ASM223467v1:15:12688806:12690... [more]
ENSORLT00000032713.19.166e-1037.93pep primary_assembly:ASM223467v1:10:29461654:29464... [more]
ENSORLT00000027469.13.850e-940.26pep primary_assembly:ASM223467v1:13:14270076:14276... [more]
back to top
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000041464.13.391e-92100.00SMESG000041464.1[more]
SMESG000045502.12.327e-4880.00SMESG000045502.1[more]
SMESG000009287.11.287e-1048.33SMESG000009287.1[more]
SMESG000036664.11.821e-729.14SMESG000036664.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30009701 ID=SMED30009701|Name=Dimer_Tnp_hAT domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1610bp
GGGAAAGTTACTAAGTTTTGGTTAAGCCAAAACATGATCCAACCAGAGAC
AAAGAAGATTTATGCAAATTTGAAGGTTTGGGTTTGCAGCGAAAAATTAC
TTCTACTGCATTTGTATAAGACCTCTGATTGATGTACGATGCCCTCCTAG
AATTGTCAGAGTTTAGTTTGAATTTGCAACAGCGCGACATGAACCTTTAC
AAAGCATATCAAAAGATCAAAGCTCCTGCACAGGTTTTTGAAGAACAACC
AATCATTCCAGACCATTATTATAAAATTGTGGTTACTGCTGCATATAATA
ACCTTTTCAGAGGAGTTTCACTTTACAAAAAAAGAAAGTTAAAATGATCC
ATAAATTGATGTGAAAGCGTTTTACAAAAAAACTAAAAGAATCAATTGAG
CAAAGGTTGCTGTACAATAAAGATGCTGATTTAGCATATTCAGCTCGAGT
GCTTGATCTAAAACAATGGCCAGACAATATTGATACGCACTAGACGTTTG
GAAAAGTAGAAATTAACAACTTGTTAACAAGATTATAGTTAAACGAAAGA
ACAATGATTCGAGGATTTCGTGAATATCTCACCGAAAAAAGTGTTCCTGA
TAAACTTCTTCCTTTACAAATTGCTCTCATTACAATCCCAATTTCTTCAA
TTGAAGCTGAGCGAGGGTTTTTGAAAATGAATATTATCACTACCAAGACA
AGAGCTTCATTGATGACAACAACTGTATCTTCGATTTTATTTATAAGATT
AGTTGGACCCCCACTCACACGTTTTGATCCCACAAGATATGTTGATTCGT
GATTGCTTCGTAGCAGACACTCGACCATAGATACCAACAGCAAAGAATGT
TTGTCAGACGAGAACTTGGTCAAACTTTGAGCAATGTAGTTATAAAGATT
TTGCTGAGAAATGGAGCTAATATGTCCTATTTAATCCGAAATTATTCTCC
GGTTCGAATGGCATTGGATAAGGATCTCGATGATGTAATTCAGTTGTTTG
TTAACTATGGACTGAATATTAATTCGGCAGTTGTAAATGGAATTCATCCA
TTGCTATACTCAGTCATCATGAAGGCGGAAAAGTCGGCATTTGTGCTTGT
CACAAATGGCTCTAAATTTCCCGGAGATTTAACGAAGTTAATTTTTTTAG
CATATGTGGAACGAATGTGGAAATTTATCAATCTCTTGATTCGGATTTAT
CCTGGAAAATATTCGCCGACGAGATTCAAAGGCATGATTCAAAAAAGTGA
TTGTTTAATAAATCTTTGCCCCAGATTAGAGTGGGAAAGAACTAAGATTC
TAATGAAACTTGAGGGAGAATCAAAAGTTATTAATTCTCTCAAACATTTG
TGTCGGCTGTCCTTGATATCCCATTTTGGTTGTCACTATCTTTATCAGTT
AATGAAACAGTCAATTTTACCCGAACAATTATTAAATTATATCATTTCCG
CAATCTGCGAGGAGAGCATATAAATGGCTTGAAGATTCTTAGAAAATTAA
TATTTTTTATTTAATTTACGTTGAAAATGATAAATTGTTATTTTGTTTGA
TTCTGTATAACATTTACCGATTCACCATGGCAACGTCAACTCTTTTATCC
TTAAAGTGAC
back to top

protein sequence of SMED30009701-orf-1

>SMED30009701-orf-1 ID=SMED30009701-orf-1|Name=SMED30009701-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=209bp
MFVRRELGQTLSNVVIKILLRNGANMSYLIRNYSPVRMALDKDLDDVIQL
FVNYGLNINSAVVNGIHPLLYSVIMKAEKSAFVLVTNGSKFPGDLTKLIF
LAYVERMWKFINLLIRIYPGKYSPTRFKGMIQKSDCLINLCPRLEWERTK
ILMKLEGESKVINSLKHLCRLSLISHFGCHYLYQLMKQSILPEQLLNYII
SAICEESI*
back to top

protein sequence of SMED30009701-orf-2

>SMED30009701-orf-2 ID=SMED30009701-orf-2|Name=SMED30009701-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=113bp
MVECLLRSNHESTYLVGSKRVSGGPTNLINKIEDTVVVINEALVLVVIIF
IFKNPRSASIEEIGIVMRAICKGRSLSGTLFSVRYSRNPRIIVLSFNYNL
VNKLLISTFPNV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0046983protein dimerization activity
GO:0003676nucleic acid binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036770Ankyrin_rpt-contain_sf
IPR036036SOCS_box-like_dom_sf
IPR020683Ankyrin_rpt-contain_dom
IPR001496SOCS_box
Vocabulary: biological process
TermDefinition
GO:0035556intracellular signal transduction
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR036770Ankyrin repeat-containing domain superfamilyGENE3DG3DSA:1.25.40.20coord: 10..96
e-value: 3.1E-6
score: 28.6
IPR036770Ankyrin repeat-containing domain superfamilySUPERFAMILYSSF48403Ankyrin repeatcoord: 15..91
IPR001496SOCS box domainPROSITEPS50225SOCScoord: 150..199
score: 9.088
IPR020683Ankyrin repeat-containing domainPROSITEPS50297ANK_REP_REGIONcoord: 31..89
score: 9.304
IPR036036SOCS box-like domain superfamilySUPERFAMILYSSF158235SOCS box-likecoord: 159..200