hesl-3 protein

Overview
Namehesl-3 protein (AGZ94927.1)
Smed IDSMED30009683
Length (bp)1128
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of hesl-3 protein (SMED30009683) t-SNE clustered cells

Violin plots show distribution of expression levels for hesl-3 protein (SMED30009683) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30009683

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30009683SMESG000009969.1 SmedASXL_019516SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
central nervous systemSMED30009683SMESG000009969.1 KF487112smed_ncbi_20200123PMID:24173799
Cowles et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
progenitor cellSMED30009683SMESG000009969.1 KF487112smed_ncbi_20200123PMID:24173799
Cowles et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
stem cellSMED30009683SMESG000009969.1 KF487112smed_ncbi_20200123PMID:24173799
Cowles et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymaSMED30009683SMESG000009969.1 KF487112smed_ncbi_20200123PMID:24173799
Cowles et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
neuronSMED30009683SMESG000009969.1 Contig44122newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
neuronSMED30009683SMESG000009969.1 Contig44122uc_Smed_v2PMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of hesl-3 protein vs. Ensembl Human
Match: HEY2 (hes related family bHLH transcription factor with YRPW motif 2 [Source:HGNC Symbol;Acc:HGNC:4881])

HSP 1 Score: 87.4261 bits (215), Expect = 6.350e-19
Identity = 43/94 (45.74%), Postives = 60/94 (63.83%), Query Frame = 2
Query:  245 INNSLAELKELVPNAIAKQNTTKLEKAEILKLAVDHLKELKSKDSSKGYGGYTSIYESKIAGFRDCLNEVSKYLHR-EGITTQNPLYQGLMEHL 523
            INNSL+EL+ LVP A  KQ + KLEKAEIL++ VDHLK L++      +  +    +    GFR+CL EV++YL   EG+ + +PL   L+ HL
Sbjct:   18 INNSLSELRRLVPTAFEKQGSAKLEKAEILQMTVDHLKMLQATGGKGYFDAHALAMDFMSIGFRECLTEVARYLSSVEGLDSSDPLRVRLVSHL 111          
BLAST of hesl-3 protein vs. Ensembl Human
Match: HEY2 (hes related family bHLH transcription factor with YRPW motif 2 [Source:HGNC Symbol;Acc:HGNC:4881])

HSP 1 Score: 87.8113 bits (216), Expect = 1.049e-18
Identity = 43/94 (45.74%), Postives = 60/94 (63.83%), Query Frame = 2
Query:  245 INNSLAELKELVPNAIAKQNTTKLEKAEILKLAVDHLKELKSKDSSKGYGGYTSIYESKIAGFRDCLNEVSKYLHR-EGITTQNPLYQGLMEHL 523
            INNSL+EL+ LVP A  KQ + KLEKAEIL++ VDHLK L++      +  +    +    GFR+CL EV++YL   EG+ + +PL   L+ HL
Sbjct:   64 INNSLSELRRLVPTAFEKQGSAKLEKAEILQMTVDHLKMLQATGGKGYFDAHALAMDFMSIGFRECLTEVARYLSSVEGLDSSDPLRVRLVSHL 157          
BLAST of hesl-3 protein vs. Ensembl Human
Match: HEY1 (hes related family bHLH transcription factor with YRPW motif 1 [Source:HGNC Symbol;Acc:HGNC:4880])

HSP 1 Score: 84.3445 bits (207), Expect = 1.382e-18
Identity = 43/94 (45.74%), Postives = 60/94 (63.83%), Query Frame = 2
Query:  245 INNSLAELKELVPNAIAKQNTTKLEKAEILKLAVDHLKELKSKDSSKGYGGYTSIYESKIAGFRDCLNEVSKYLH-REGITTQNPLYQGLMEHL 523
            INNSL+EL+ LVP+A  KQ + KLEKAEIL++ VDHLK L +      +  +    + +  GFR+CL EV++YL   EG+   +PL   L+ HL
Sbjct:   27 INNSLSELRRLVPSAFEKQGSAKLEKAEILQMTVDHLKMLHTAGGKGYFDAHALAMDYRSLGFRECLAEVARYLSIIEGLDASDPLRVRLVSHL 120          
BLAST of hesl-3 protein vs. Ensembl Human
Match: HEY1 (hes related family bHLH transcription factor with YRPW motif 1 [Source:HGNC Symbol;Acc:HGNC:4880])

HSP 1 Score: 85.1149 bits (209), Expect = 5.658e-18
Identity = 43/94 (45.74%), Postives = 60/94 (63.83%), Query Frame = 2
Query:  245 INNSLAELKELVPNAIAKQNTTKLEKAEILKLAVDHLKELKSKDSSKGYGGYTSIYESKIAGFRDCLNEVSKYLH-REGITTQNPLYQGLMEHL 523
            INNSL+EL+ LVP+A  KQ + KLEKAEIL++ VDHLK L +      +  +    + +  GFR+CL EV++YL   EG+   +PL   L+ HL
Sbjct:   65 INNSLSELRRLVPSAFEKQGSAKLEKAEILQMTVDHLKMLHTAGGKGYFDAHALAMDYRSLGFRECLAEVARYLSIIEGLDASDPLRVRLVSHL 158          
BLAST of hesl-3 protein vs. Ensembl Human
Match: HEY1 (hes related family bHLH transcription factor with YRPW motif 1 [Source:HGNC Symbol;Acc:HGNC:4880])

HSP 1 Score: 79.337 bits (194), Expect = 5.802e-16
Identity = 43/98 (43.88%), Postives = 60/98 (61.22%), Query Frame = 2
Query:  245 INNSLAELKELVPNAIAKQ----NTTKLEKAEILKLAVDHLKELKSKDSSKGYGGYTSIYESKIAGFRDCLNEVSKYLH-REGITTQNPLYQGLMEHL 523
            INNSL+EL+ LVP+A  KQ     + KLEKAEIL++ VDHLK L +      +  +    + +  GFR+CL EV++YL   EG+   +PL   L+ HL
Sbjct:   65 INNSLSELRRLVPSAFEKQVMEQGSAKLEKAEILQMTVDHLKMLHTAGGKGYFDAHALAMDYRSLGFRECLAEVARYLSIIEGLDASDPLRVRLVSHL 162          
BLAST of hesl-3 protein vs. Ensembl Fly
Match: Hey (gene:FBgn0027788 transcript:FBtr0088869)

HSP 1 Score: 94.3597 bits (233), Expect = 4.569e-21
Identity = 53/100 (53.00%), Postives = 65/100 (65.00%), Query Frame = 2
Query:  245 INNSLAELKELVPNAIAKQNTTKLEKAEILKLAVDHLKELKSKD-SSKGYGGYTSIYESKIAGFRDCLNEVSKYLHR-EGITTQNPLYQGLMEHLQYFYQ 538
            IN+SL ELK LVP+A  KQ + KLEKAEIL+L V+HLK L+SK   S  Y       +  I GFR+C  EV++YL   EG+  Q+PL   LM HLQYF Q
Sbjct:  116 INSSLTELKRLVPSAYEKQGSAKLEKAEILQLTVEHLKSLQSKTLDSLSYDPQRVAMDYHIIGFRECAAEVARYLVTIEGMDIQDPLRLRLMSHLQYFVQ 215          
BLAST of hesl-3 protein vs. Ensembl Fly
Match: h (gene:FBgn0001168 transcript:FBtr0100153)

HSP 1 Score: 53.5286 bits (127), Expect = 1.174e-7
Identity = 32/75 (42.67%), Postives = 45/75 (60.00%), Query Frame = 2
Query:  245 INNSLAELKELVPNAIAKQNT--TKLEKAEILKLAVDHLKELKSKDSSKGYGGYTSIYESKIAGFRDCLNEVSKY 463
            INN L ELK L+ +A  K     +KLEKA+IL+  V HL+EL+ + ++        I     AGF DC+NEVS++
Sbjct:   47 INNCLNELKTLILDATKKDPARHSKLEKADILEKTVKHLQELQRQQAAMQQAADPKIVNKFKAGFADCVNEVSRF 121          
BLAST of hesl-3 protein vs. Ensembl Fly
Match: h (gene:FBgn0001168 transcript:FBtr0076569)

HSP 1 Score: 53.5286 bits (127), Expect = 1.174e-7
Identity = 32/75 (42.67%), Postives = 45/75 (60.00%), Query Frame = 2
Query:  245 INNSLAELKELVPNAIAKQNT--TKLEKAEILKLAVDHLKELKSKDSSKGYGGYTSIYESKIAGFRDCLNEVSKY 463
            INN L ELK L+ +A  K     +KLEKA+IL+  V HL+EL+ + ++        I     AGF DC+NEVS++
Sbjct:   47 INNCLNELKTLILDATKKDPARHSKLEKADILEKTVKHLQELQRQQAAMQQAADPKIVNKFKAGFADCVNEVSRF 121          
BLAST of hesl-3 protein vs. Ensembl Fly
Match: E(spl)mbeta-HLH (gene:FBgn0002733 transcript:FBtr0084982)

HSP 1 Score: 51.2174 bits (121), Expect = 2.850e-7
Identity = 41/124 (33.06%), Postives = 65/124 (52.42%), Query Frame = 2
Query:  245 INNSLAELKELVPNAIAKQN--TTKLEKAEILKLAVDHLKELKSKDS---SKGYGGYT-------SIYESKIAGFRDCLNEVSKYLHR-EGITTQNPLYQGLMEHLQY---FYQCILSQTPYQI 568
            IN  L ELK+++   + ++    T+LEKA+IL+L V+H+K+L+++     S   GG +       SI ES  AG+    NEVSK L    G++    L   LM HL +   + Q ++   P  +
Sbjct:   29 INKCLDELKDIMVECLTQEGEHITRLEKADILELTVEHMKKLRAQKQLRLSSVTGGVSPSADPKLSIAESFRAGYVHAANEVSKTLAAVPGVSVD--LGTQLMSHLGHRLNYLQVVVPSLPIGV 150          
BLAST of hesl-3 protein vs. Ensembl Fly
Match: dpn (gene:FBgn0010109 transcript:FBtr0088803)

HSP 1 Score: 51.2174 bits (121), Expect = 7.679e-7
Identity = 36/102 (35.29%), Postives = 56/102 (54.90%), Query Frame = 2
Query:  245 INNSLAELKELVPNAIAKQNT--TKLEKAEILKLAVDHLKELKSKDSSKGYGGYTSIYESKIAGFRDCLNEVSKYLHR-EGITTQNPLYQGLMEHLQYFYQC 541
            IN+ L ELK L+  A+ K     TKLEKA+IL++ V HL+ ++ +  +       S+ +    GF +C  EV++Y+ + +GI T   + Q L  HL    QC
Sbjct:   56 INHCLNELKSLILEAMKKDPARHTKLEKADILEMTVKHLQSVQRQQLNMAIQSDPSVVQKFKTGFVECAEEVNRYVSQMDGIDTG--VRQRLSAHLN---QC 152          
BLAST of hesl-3 protein vs. Ensembl Zebrafish
Match: hey2 (hes-related family bHLH transcription factor with YRPW motif 2 [Source:NCBI gene;Acc:58146])

HSP 1 Score: 87.0409 bits (214), Expect = 7.891e-19
Identity = 47/95 (49.47%), Postives = 64/95 (67.37%), Query Frame = 2
Query:  245 INNSLAELKELVPNAIAKQNTTKLEKAEILKLAVDHLKELKSKDSSKGYGGYTSIYESKIA-GFRDCLNEVSKYLHR-EGITTQNPLYQGLMEHL 523
            INNSL+EL+ LVP A  KQ + KLEKAEIL++ VDHLK L++    KGY    S+    ++ GFR+CL EV++YL   EG+ + +PL   L+ HL
Sbjct:   64 INNSLSELRRLVPTAFEKQGSAKLEKAEILQMTVDHLKMLQAT-GGKGYFDAHSLAMDFLSIGFRECLTEVARYLSSVEGLDSSDPLRVRLVSHL 157          
BLAST of hesl-3 protein vs. Ensembl Zebrafish
Match: heyl (hes related family bHLH transcription factor with YRPW motif like [Source:NCBI gene;Acc:335134])

HSP 1 Score: 84.7297 bits (208), Expect = 4.663e-18
Identity = 50/140 (35.71%), Postives = 78/140 (55.71%), Query Frame = 2
Query:  245 INNSLAELKELVPNAIAKQNTTKLEKAEILKLAVDHLKELKSKDSSKGYGGYTSIYESKIAGFRDCLNEVSKYLHR-EGITTQNPLYQGLMEHLQYFYQCI--LSQTPYQIEAPSAIDSAFRYSQMQTPLIT---FDPNT 646
            IN+SL+EL+ LVP+A  KQ ++KLEKAEIL++ VDHLK L +      +       + +  GFR+C+ EV +YL   EG+ + +P+   L+ HL +    +  L Q+P  +  P    ++F   Q  +P  +   F PN 
Sbjct:   59 INHSLSELRRLVPSAFEKQGSSKLEKAEILQMTVDHLKLLHAMGGKGYFDARALAVDYRTLGFRECVGEVVRYLSSLEGVESSDPIGARLVSHLSHCASELDPLLQSPAALPFPPWPWASFPQLQAASPPASSTPFPPNA 198          
BLAST of hesl-3 protein vs. Ensembl Zebrafish
Match: heyl (hes related family bHLH transcription factor with YRPW motif like [Source:NCBI gene;Acc:335134])

HSP 1 Score: 84.7297 bits (208), Expect = 4.663e-18
Identity = 50/140 (35.71%), Postives = 78/140 (55.71%), Query Frame = 2
Query:  245 INNSLAELKELVPNAIAKQNTTKLEKAEILKLAVDHLKELKSKDSSKGYGGYTSIYESKIAGFRDCLNEVSKYLHR-EGITTQNPLYQGLMEHLQYFYQCI--LSQTPYQIEAPSAIDSAFRYSQMQTPLIT---FDPNT 646
            IN+SL+EL+ LVP+A  KQ ++KLEKAEIL++ VDHLK L +      +       + +  GFR+C+ EV +YL   EG+ + +P+   L+ HL +    +  L Q+P  +  P    ++F   Q  +P  +   F PN 
Sbjct:   59 INHSLSELRRLVPSAFEKQGSSKLEKAEILQMTVDHLKLLHAMGGKGYFDARALAVDYRTLGFRECVGEVVRYLSSLEGVESSDPIGARLVSHLSHCASELDPLLQSPAALPFPPWPWASFPQLQAASPPASSTPFPPNA 198          
BLAST of hesl-3 protein vs. Ensembl Zebrafish
Match: hey1 (hes-related family bHLH transcription factor with YRPW motif 1 [Source:NCBI gene;Acc:58008])

HSP 1 Score: 82.4185 bits (202), Expect = 3.726e-17
Identity = 42/97 (43.30%), Postives = 60/97 (61.86%), Query Frame = 2
Query:  245 INNSLAELKELVPNAIAKQNTTKLEKAEILKLAVDHLKELKSKDSSKGYGGYTSIYESKIAGFRDCLNEVSKYLH-REGITTQNPLYQGLMEHLQYF 532
            INNSL+EL+ LVP+A  KQ + KLEKAEIL++ VDHLK L +      +  +    + +  GFR+CL E ++YL   EG+   +PL   L+ HL  +
Sbjct:   64 INNSLSELRRLVPSAFEKQGSAKLEKAEILQMTVDHLKMLHAAGGKGYFDAHALAMDYRGLGFRECLAETARYLSIIEGLDNTDPLRIRLVSHLNSY 160          
BLAST of hesl-3 protein vs. Ensembl Zebrafish
Match: her9 (hairy-related 9 [Source:ZFIN;Acc:ZDB-GENE-011213-1])

HSP 1 Score: 65.4698 bits (158), Expect = 1.298e-11
Identity = 47/131 (35.88%), Postives = 75/131 (57.25%), Query Frame = 2
Query:  140 DVEDNYSDYIKSNNPELDVEXXXXXXXXXXXXXXXINNSLAELKELVPNAIAKQNT--TKLEKAEILKLAVDHLKELKSKDSSKGYGGYTSIYESKIAGFRDCLNEVSKYLHR-EGITTQNPLYQGLMEHL 523
            D   N S++ KS+ P ++           KRRR RIN SL +LK L+ +A+ K ++  +KLEKA+IL++ V HL+ L+    S      T++     AGF +C+NEV+++L   EG+ T+  +   L+ HL
Sbjct:   26 DKPKNASEHRKSSKPIME-----------KRRRARINESLGQLKTLILDALKKDSSRHSKLEKADILEMTVKHLRNLQRVQMSAALSADTNVLSKYRAGFNECMNEVTRFLSTCEGVNTE--VRSRLLNHL 143          
BLAST of hesl-3 protein vs. Ensembl Xenopus
Match: st3gal1 (ST3 beta-galactoside alpha-2,3-sialyltransferase 1 [Source:Xenbase;Acc:XB-GENE-961931])

HSP 1 Score: 88.1965 bits (217), Expect = 6.832e-19
Identity = 58/135 (42.96%), Postives = 82/135 (60.74%), Query Frame = 2
Query:  146 EDNYSDY-----IKSNNPELDVEXXXXXXXXX---XXXXXXINNSLAELKELVPNAIAKQNTTKLEKAEILKLAVDHLKELKSKDSSKGYGGYTSIYESKIAGFRDCLNEVSKYLHR-EGITTQNPLYQGLMEHL 523
            E+NYS +     I+SN+P    +   R+ +     KRRRDRINNSL+EL+ LVP A  KQ + KLEKAEIL++ VDHLK L++      +  +    +    GFR+CL EV++YL   EG+ + +PL   L+ HL
Sbjct:   23 ENNYSGHSSGSLIRSNSPTTTSQIMARKKRRGIIEKRRRDRINNSLSELRRLVPTAFEKQGSAKLEKAEILQMTVDHLKMLQATGGKGYFDAHALAMDFMSIGFRECLTEVARYLGSVEGLDSSDPLRVRLVSHL 157          
BLAST of hesl-3 protein vs. Ensembl Xenopus
Match: hey1 (hes related family bHLH transcription factor with YRPW motif 1 [Source:NCBI gene;Acc:493293])

HSP 1 Score: 87.0409 bits (214), Expect = 1.063e-18
Identity = 44/94 (46.81%), Postives = 61/94 (64.89%), Query Frame = 2
Query:  245 INNSLAELKELVPNAIAKQNTTKLEKAEILKLAVDHLKELKSKDSSKGYGGYTSIYESKIAGFRDCLNEVSKYLH-REGITTQNPLYQGLMEHL 523
            INNSL+EL+ LVP+A  KQ + KLEKAEIL++ VDHLK L +      +  +    + +  GFR+CL EV++YL   EG+ T +PL   L+ HL
Sbjct:   64 INNSLSELRRLVPSAFEKQGSAKLEKAEILQMTVDHLKMLHTAGGKGYFDAHALAMDYRSLGFRECLAEVARYLSIIEGMDTTDPLRVRLVSHL 157          
BLAST of hesl-3 protein vs. Ensembl Xenopus
Match: hes4 (hes family bHLH transcription factor 4 [Source:NCBI gene;Acc:394465])

HSP 1 Score: 63.5438 bits (153), Expect = 9.427e-11
Identity = 41/125 (32.80%), Postives = 68/125 (54.40%), Query Frame = 2
Query:  245 INNSLAELKELVPNAIAKQNT--TKLEKAEILKLAVDHLKELKSKDSSKGYGGYTSIYESKIAGFRDCLNEVSKYLHR-EGITTQNPLYQGLMEHLQYFYQCIL---------SQTPYQIEAPSA 583
            IN SL +LK L+ +A+ K ++  +KLEKA+IL++ V HL+ L+    +       S+     AGF +C+NEV+++L   EG+ T+  +   L+ HL      I+         SQ P  ++ PS+
Sbjct:   50 INESLGQLKTLILDALKKDSSRHSKLEKADILEMTVKHLRNLQRVQMTAALTADPSVLGKYRAGFNECMNEVTRFLSTCEGVNTE--VRTRLLGHLSSCLGQIVAMNYQQPPSSQQPLHVQLPSS 172          
BLAST of hesl-3 protein vs. Ensembl Xenopus
Match: ccdc63 (coiled-coil domain containing 63 [Source:Xenbase;Acc:XB-GENE-5873552])

HSP 1 Score: 60.8474 bits (146), Expect = 6.332e-10
Identity = 35/96 (36.46%), Postives = 57/96 (59.38%), Query Frame = 2
Query:  245 INNSLAELKELVPNAIAKQNT--TKLEKAEILKLAVDHLKELKSKDSSKGYGGYTSIYESKIAGFRDCLNEVSKYLHR-EGITTQNPLYQGLMEHL 523
            IN SL +LK L+ +A+ K ++  +KLEKA+IL++ V HL+ L+    +       S+     AGF +C+NEV+++L   EG+ T   +   L+ HL
Sbjct:   50 INESLGQLKTLILDALKKDSSRHSKLEKADILEMTVKHLRNLQRVQMTAALSTDPSVLGKYRAGFSECMNEVTRFLSTCEGVNTD--VRTRLLGHL 143          
BLAST of hesl-3 protein vs. Ensembl Xenopus
Match: HELT (helt bHLH transcription factor [Source:NCBI gene;Acc:100486939])

HSP 1 Score: 55.4546 bits (132), Expect = 3.735e-8
Identity = 30/75 (40.00%), Postives = 43/75 (57.33%), Query Frame = 2
Query:  245 INNSLAELKELVPNAIAKQNTTKLEKAEILKLAVDHLKELKSKDSSKGYGGYTSIYESKIAGFRDCLNEVSKYLH 469
            IN  L+EL + VP A+AKQN+ KLEKAEIL++ V +L+ L + D  +G               +D L+E + Y H
Sbjct:   42 INRCLSELGKTVPMALAKQNSGKLEKAEILEMTVQYLRALHATDLPRGRD-------------KDLLSEFANYFH 103          
BLAST of hesl-3 protein vs. Ensembl Mouse
Match: Hey2 (hairy/enhancer-of-split related with YRPW motif 2 [Source:MGI Symbol;Acc:MGI:1341884])

HSP 1 Score: 85.8853 bits (211), Expect = 2.660e-18
Identity = 43/94 (45.74%), Postives = 59/94 (62.77%), Query Frame = 2
Query:  245 INNSLAELKELVPNAIAKQNTTKLEKAEILKLAVDHLKELKSKDSSKGYGGYTSIYESKIAGFRDCLNEVSKYLHR-EGITTQNPLYQGLMEHL 523
            INNSL+EL+ LVP A  KQ + KLEKAEIL++ VDHLK L++      +  +    +    GFR+CL EV++YL   EG+   +PL   L+ HL
Sbjct:   64 INNSLSELRRLVPTAFEKQGSAKLEKAEILQMTVDHLKMLQATGGKGYFDAHALATDFMSIGFRECLTEVARYLSSVEGLDPSDPLRVRLVSHL 157          
BLAST of hesl-3 protein vs. Ensembl Mouse
Match: Hey1 (hairy/enhancer-of-split related with YRPW motif 1 [Source:MGI Symbol;Acc:MGI:1341800])

HSP 1 Score: 84.7297 bits (208), Expect = 4.633e-18
Identity = 43/94 (45.74%), Postives = 60/94 (63.83%), Query Frame = 2
Query:  245 INNSLAELKELVPNAIAKQNTTKLEKAEILKLAVDHLKELKSKDSSKGYGGYTSIYESKIAGFRDCLNEVSKYLH-REGITTQNPLYQGLMEHL 523
            INNSL+EL+ LVP+A  KQ + KLEKAEIL++ VDHLK L +      +  +    + +  GFR+CL EV++YL   EG+   +PL   L+ HL
Sbjct:   65 INNSLSELRRLVPSAFEKQGSAKLEKAEILQMTVDHLKMLHTAGGKGYFDAHALAMDYRSLGFRECLAEVARYLSIIEGLDASDPLRVRLVSHL 158          
BLAST of hesl-3 protein vs. Ensembl Mouse
Match: Heyl (hairy/enhancer-of-split related with YRPW motif-like [Source:MGI Symbol;Acc:MGI:1860511])

HSP 1 Score: 78.9518 bits (193), Expect = 6.945e-16
Identity = 40/98 (40.82%), Postives = 62/98 (63.27%), Query Frame = 2
Query:  245 INNSLAELKELVPNAIAKQNTTKLEKAEILKLAVDHLKELKSKDSSKGYGGYTSIYESKIAGFRDCLNEVSKYLH-REGITTQ-NPLYQGLMEHLQYF 532
            IN+SL+EL+ LVP A  KQ ++KLEKAE+L++ VDHLK L +   +  +       + +  GFR+CL EV +YL   EG ++  +P+   L+ HL+ +
Sbjct:   59 INSSLSELRRLVPTAFEKQGSSKLEKAEVLQMTVDHLKMLHASGGTGFFDARALAVDFRSIGFRECLTEVIRYLGVLEGPSSHADPVRIRLLSHLKSY 156          
BLAST of hesl-3 protein vs. Ensembl Mouse
Match: Hes1 (hes family bHLH transcription factor 1 [Source:MGI Symbol;Acc:MGI:104853])

HSP 1 Score: 60.8474 bits (146), Expect = 4.540e-10
Identity = 35/96 (36.46%), Postives = 59/96 (61.46%), Query Frame = 2
Query:  245 INNSLAELKELVPNAIAKQNT--TKLEKAEILKLAVDHLKELKSKDSSKGYGGYTSIYESKIAGFRDCLNEVSKYLHR-EGITTQNPLYQGLMEHL 523
            IN SL++LK L+ +A+ K ++  +KLEKA+IL++ V HL+ L+    +       S+     AGF +C+NEV+++L   EG+ T+  +   L+ HL
Sbjct:   50 INESLSQLKTLILDALKKDSSRHSKLEKADILEMTVKHLRNLQRAQMTAALSTDPSVLGKYRAGFSECMNEVTRFLSTCEGVNTE--VRTRLLGHL 143          
BLAST of hesl-3 protein vs. Ensembl Mouse
Match: Helt (helt bHLH transcription factor [Source:MGI Symbol;Acc:MGI:3040955])

HSP 1 Score: 52.373 bits (124), Expect = 2.252e-7
Identity = 34/100 (34.00%), Postives = 55/100 (55.00%), Query Frame = 2
Query:  245 INNSLAELKELVPNAIAKQNTTKLEKAEILKLAVDHLKELKSKDSSKG-----YGGYTSIYESKIAGFRDCLNEVSKYLHR-EGITTQNPLYQGLMEHLQ 526
            IN  L EL + VP A+AKQ++ KLEKAEIL++ V +L+ L S D  +G        + + +     G+ +C+  +  YL   E + T++  Y  ++  LQ
Sbjct:   26 INRCLNELGKTVPMALAKQSSGKLEKAEILEMTVQYLRALHSADFPRGREKELLAEFANYFHY---GYHECMKNLVHYLTTVERMETKDTKYARILAFLQ 122          
BLAST of hesl-3 protein vs. UniProt/SwissProt
Match: sp|Q7KM13|HEY_DROME (Hairy/enhancer-of-split related with YRPW motif protein OS=Drosophila melanogaster OX=7227 GN=Hey PE=2 SV=1)

HSP 1 Score: 94.3597 bits (233), Expect = 4.580e-20
Identity = 53/100 (53.00%), Postives = 65/100 (65.00%), Query Frame = 2
Query:  245 INNSLAELKELVPNAIAKQNTTKLEKAEILKLAVDHLKELKSKD-SSKGYGGYTSIYESKIAGFRDCLNEVSKYLHR-EGITTQNPLYQGLMEHLQYFYQ 538
            IN+SL ELK LVP+A  KQ + KLEKAEIL+L V+HLK L+SK   S  Y       +  I GFR+C  EV++YL   EG+  Q+PL   LM HLQYF Q
Sbjct:  116 INSSLTELKRLVPSAYEKQGSAKLEKAEILQLTVEHLKSLQSKTLDSLSYDPQRVAMDYHIIGFRECAAEVARYLVTIEGMDIQDPLRLRLMSHLQYFVQ 215          
BLAST of hesl-3 protein vs. UniProt/SwissProt
Match: sp|Q9I8A3|HEY1_XENLA (Hairy/enhancer-of-split related with YRPW motif protein 1 OS=Xenopus laevis OX=8355 GN=hey1 PE=1 SV=1)

HSP 1 Score: 87.0409 bits (214), Expect = 4.935e-18
Identity = 44/94 (46.81%), Postives = 61/94 (64.89%), Query Frame = 2
Query:  245 INNSLAELKELVPNAIAKQNTTKLEKAEILKLAVDHLKELKSKDSSKGYGGYTSIYESKIAGFRDCLNEVSKYLH-REGITTQNPLYQGLMEHL 523
            INNSL+EL+ LVP+A  KQ + KLEKAEIL++ VDHLK L +      +  +    + +  GFR+CL EV++YL   EG+ T +PL   L+ HL
Sbjct:   60 INNSLSELRRLVPSAFEKQGSAKLEKAEILQMTVDHLKMLHTAGGKGYFDAHALAMDYRSLGFRECLAEVARYLSIIEGMETADPLRVRLVSHL 153          
BLAST of hesl-3 protein vs. UniProt/SwissProt
Match: sp|Q9UBP5|HEY2_HUMAN (Hairy/enhancer-of-split related with YRPW motif protein 2 OS=Homo sapiens OX=9606 GN=HEY2 PE=1 SV=1)

HSP 1 Score: 87.8113 bits (216), Expect = 5.036e-18
Identity = 43/94 (45.74%), Postives = 60/94 (63.83%), Query Frame = 2
Query:  245 INNSLAELKELVPNAIAKQNTTKLEKAEILKLAVDHLKELKSKDSSKGYGGYTSIYESKIAGFRDCLNEVSKYLHR-EGITTQNPLYQGLMEHL 523
            INNSL+EL+ LVP A  KQ + KLEKAEIL++ VDHLK L++      +  +    +    GFR+CL EV++YL   EG+ + +PL   L+ HL
Sbjct:   64 INNSLSELRRLVPTAFEKQGSAKLEKAEILQMTVDHLKMLQATGGKGYFDAHALAMDFMSIGFRECLTEVARYLSSVEGLDSSDPLRVRLVSHL 157          
BLAST of hesl-3 protein vs. UniProt/SwissProt
Match: sp|Q66KK8|HEY1_XENTR (Hairy/enhancer-of-split related with YRPW motif protein 1 OS=Xenopus tropicalis OX=8364 GN=hey1 PE=2 SV=1)

HSP 1 Score: 87.0409 bits (214), Expect = 5.633e-18
Identity = 44/94 (46.81%), Postives = 61/94 (64.89%), Query Frame = 2
Query:  245 INNSLAELKELVPNAIAKQNTTKLEKAEILKLAVDHLKELKSKDSSKGYGGYTSIYESKIAGFRDCLNEVSKYLH-REGITTQNPLYQGLMEHL 523
            INNSL+EL+ LVP+A  KQ + KLEKAEIL++ VDHLK L +      +  +    + +  GFR+CL EV++YL   EG+ T +PL   L+ HL
Sbjct:   64 INNSLSELRRLVPSAFEKQGSAKLEKAEILQMTVDHLKMLHTAGGKGYFDAHALAMDYRSLGFRECLAEVARYLSIIEGMDTTDPLRVRLVSHL 157          
BLAST of hesl-3 protein vs. UniProt/SwissProt
Match: sp|Q9I9L0|HEY2_DANRE (Hairy/enhancer-of-split related with YRPW motif protein 2 OS=Danio rerio OX=7955 GN=hey2 PE=2 SV=2)

HSP 1 Score: 87.0409 bits (214), Expect = 5.957e-18
Identity = 47/95 (49.47%), Postives = 64/95 (67.37%), Query Frame = 2
Query:  245 INNSLAELKELVPNAIAKQNTTKLEKAEILKLAVDHLKELKSKDSSKGYGGYTSIYESKIA-GFRDCLNEVSKYLHR-EGITTQNPLYQGLMEHL 523
            INNSL+EL+ LVP A  KQ + KLEKAEIL++ VDHLK L++    KGY    S+    ++ GFR+CL EV++YL   EG+ + +PL   L+ HL
Sbjct:   64 INNSLSELRRLVPTAFEKQGSAKLEKAEILQMTVDHLKMLQAT-GGKGYFDAHSLAMDFLSIGFRECLTEVARYLSSVEGLDSSDPLRVRLVSHL 157          
BLAST of hesl-3 protein vs. TrEMBL
Match: A0A1Z1R175 (Hes-like 3 (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 548.51 bits (1412), Expect = 0.000e+0
Identity = 294/298 (98.66%), Postives = 294/298 (98.66%), Query Frame = 2
Query:  107 KLKLEPDQYHSDVEDNYSDYIKSNNPELDVEXXXXXXXXXXXXXXXINNSLAELKELVPNAIAKQNTTKLEKAEILKLAVDHLKELKSKDSSKGYGGYTSIYESKIAGFRDCLNEVSKYLHREGITTQNPLYQGLMEHLQYFYQCILSQTPYQIEAPSAIDSAFRYSQMQTPLITFDPNTVPNYHENYQKLTSWSSNAIASSYQNQPNHYQAQTSNYQSNFLFQRNAHQQYPTNIATPLIAANANPNSVFKCSSTPSRISLTTNXXXXXXXXXXXXGLDFPSFCNDSINFFQSRQEIP 1000
            KLKLEPDQYHSDVEDNYSDYIKSNNPELDVEKKKRRGKIEKRRRDRINNSLAELKELVPNAIAKQNTTKLEKAEILKL VDHLKELKSKDSSKGYGGYTSIYESKIAGFRDCLNEVSKYLHREGITTQNPLYQGLMEHLQYFYQCILSQTPYQIEAPSAIDSAFRYSQMQTPLITFDPNTVPNYHENYQKLTSWSSNAIASSYQNQPNHYQAQTSNYQSNFLFQRNAHQQYPTNIATPLIAANANPNSVFKCSSTPSRI LTTNPSQIQP IQQ SGLDFPSFCNDSINFFQSRQEIP
Sbjct:    1 KLKLEPDQYHSDVEDNYSDYIKSNNPELDVEKKKRRGKIEKRRRDRINNSLAELKELVPNAIAKQNTTKLEKAEILKLVVDHLKELKSKDSSKGYGGYTSIYESKIAGFRDCLNEVSKYLHREGITTQNPLYQGLMEHLQYFYQCILSQTPYQIEAPSAIDSAFRYSQMQTPLITFDPNTVPNYHENYQKLTSWSSNAIASSYQNQPNHYQAQTSNYQSNFLFQRNAHQQYPTNIATPLIAANANPNSVFKCSSTPSRIGLTTNPSQIQPSIQQLSGLDFPSFCNDSINFFQSRQEIP 298          
BLAST of hesl-3 protein vs. TrEMBL
Match: U5YQ74 (Hesl-3 protein (Fragment) OS=Schmidtea mediterranea OX=79327 GN=hesl-3 PE=2 SV=1)

HSP 1 Score: 527.709 bits (1358), Expect = 0.000e+0
Identity = 286/289 (98.96%), Postives = 286/289 (98.96%), Query Frame = 2
Query:  134 HSDVEDNYSDYIKSNNPELDVEXXXXXXXXXXXXXXXINNSLAELKELVPNAIAKQNTTKLEKAEILKLAVDHLKELKSKDSSKGYGGYTSIYESKIAGFRDCLNEVSKYLHREGITTQNPLYQGLMEHLQYFYQCILSQTPYQIEAPSAIDSAFRYSQMQTPLITFDPNTVPNYHENYQKLTSWSSNAIASSYQNQPNHYQAQTSNYQSNFLFQRNAHQQYPTNIATPLIAANANPNSVFKCSSTPSRISLTTNXXXXXXXXXXXXGLDFPSFCNDSINFFQSRQEIP 1000
             SDVEDNYSDYIKSNNPELDVEKKKRRGKIEKRRRDRINNSLAELKELVPNAIAKQNTTKLEKAEILKLAVDHLKELKSKDSSKGYGGYTSIYESKIAGFRDCLNEVSKYLHREGITTQNPLYQGLMEHLQYFYQCILSQTPYQIEAPSAIDSAFRYSQMQTPLITFDPNTVPNYHENYQKLTSWSSNAIASSYQNQPNHYQAQTSNYQSNFLFQRNAHQQYPTNIATPLIAANANPNSVFKCSSTPSRI LTTNPSQIQP IQQPSGLDFPSFCNDSINFFQSRQEIP
Sbjct:    8 QSDVEDNYSDYIKSNNPELDVEKKKRRGKIEKRRRDRINNSLAELKELVPNAIAKQNTTKLEKAEILKLAVDHLKELKSKDSSKGYGGYTSIYESKIAGFRDCLNEVSKYLHREGITTQNPLYQGLMEHLQYFYQCILSQTPYQIEAPSAIDSAFRYSQMQTPLITFDPNTVPNYHENYQKLTSWSSNAIASSYQNQPNHYQAQTSNYQSNFLFQRNAHQQYPTNIATPLIAANANPNSVFKCSSTPSRIGLTTNPSQIQPSIQQPSGLDFPSFCNDSINFFQSRQEIP 296          
BLAST of hesl-3 protein vs. TrEMBL
Match: A0A482WBV5 (Hairy/enhancer-of-split related with YRPW motif protein OS=Asbolus verrucosus OX=1661398 GN=BDFB_008507 PE=4 SV=1)

HSP 1 Score: 98.5969 bits (244), Expect = 1.694e-19
Identity = 58/140 (41.43%), Postives = 80/140 (57.14%), Query Frame = 2
Query:  245 INNSLAELKELVPNAIAKQNTTKLEKAEILKLAVDHLKELKSKD-SSKGYGGYTSIYESKIAGFRDCLNEVSKYLHR-EGITTQNPLYQGLMEHLQYFYQCILSQTPYQIEAPSAIDSAFRYSQMQTPLITFDPNTVPNY 658
            IN SL+ELK LVP+A  KQ + KLEKAEIL++ VDHLK + +K   S  Y  +    +    GFR+C+ EV++YL R EG+  QNPL   L  HL    QC  +Q     +  ++    +  +Q   PL T  P+ VPN+
Sbjct:   83 INMSLSELKRLVPSAFEKQGSAKLEKAEILQMTVDHLKMIHAKGLDSFAYDPHKYAMDYHGMGFRECVAEVARYLERIEGLDVQNPLRLRLTSHL----QCCAAQRELATKQATSTPWGYGSTQPYPPLNTLPPSPVPNH 218          
BLAST of hesl-3 protein vs. TrEMBL
Match: A0A0M4EIR0 (Hey OS=Drosophila busckii OX=30019 GN=Dbus_chr2Rg609 PE=4 SV=1)

HSP 1 Score: 98.9821 bits (245), Expect = 2.964e-19
Identity = 61/131 (46.56%), Postives = 76/131 (58.02%), Query Frame = 2
Query:  245 INNSLAELKELVPNAIAKQNTTKLEKAEILKLAVDHLKELKSKD-SSKGYGGYTSIYESKIAGFRDCLNEVSKYLHR-EGITTQNPLYQGLMEHLQYF-----------YQCILSQTPYQIEAPSAIDSAF 598
            IN+SL ELK LVP+A  KQ + KLEKAEIL+L V+HLK L+SK   S  Y       +  I GFR+C  EV++YL   EG+  Q+PL   LM HLQYF           YQ   + TPYQ   P+   SA+
Sbjct:   98 INSSLTELKRLVPSAYEKQGSAKLEKAEILQLTVEHLKNLQSKTLDSLSYDPQRVAMDYSIIGFRECAAEVARYLVTIEGMDIQDPLRLRLMSHLQYFAQQRELSASGGYQPSCAATPYQSYGPTGNASAY 228          
BLAST of hesl-3 protein vs. TrEMBL
Match: A0A336M4E3 (CSON002785 protein OS=Culicoides sonorensis OX=179676 GN=CSON002785 PE=4 SV=1)

HSP 1 Score: 97.8265 bits (242), Expect = 3.837e-19
Identity = 53/98 (54.08%), Postives = 64/98 (65.31%), Query Frame = 2
Query:  245 INNSLAELKELVPNAIAKQNTTKLEKAEILKLAVDHLKELKSKDSSK-GYGGYTSIYESKIAGFRDCLNEVSKYLHR-EGITTQNPLYQGLMEHLQYF 532
            INNSL ELK LVP+   KQ ++KLEKAEIL+L VDHLK L +K +   GY       E  I GFR+C+ EV++YL   EG+  QNPL   LM HLQ F
Sbjct:   69 INNSLTELKRLVPSCFEKQGSSKLEKAEILQLTVDHLKTLHAKGNDVYGYDHQRFALEYHITGFRECITEVARYLATIEGMDIQNPLRLRLMSHLQCF 166          
BLAST of hesl-3 protein vs. Ensembl Cavefish
Match: hey2 (hes related family bHLH transcription factor with YRPW motif 2 [Source:NCBI gene;Acc:103023949])

HSP 1 Score: 87.8113 bits (216), Expect = 3.559e-19
Identity = 47/95 (49.47%), Postives = 64/95 (67.37%), Query Frame = 2
Query:  245 INNSLAELKELVPNAIAKQNTTKLEKAEILKLAVDHLKELKSKDSSKGYGGYTSIYESKIA-GFRDCLNEVSKYLHR-EGITTQNPLYQGLMEHL 523
            INNSL+EL+ LVP A  KQ + KLEKAEIL++ VDHLK L++    KG+    S+    I+ GFR+CL EV++YL   EG+ + +PL   L+ HL
Sbjct:   51 INNSLSELRRLVPTAFEKQGSAKLEKAEILQMTVDHLKMLQA-TGGKGFFDVQSLAMDFISIGFRECLTEVARYLSSVEGLDSADPLRVRLVSHL 144          
BLAST of hesl-3 protein vs. Ensembl Cavefish
Match: hey2 (hes related family bHLH transcription factor with YRPW motif 2 [Source:NCBI gene;Acc:103023949])

HSP 1 Score: 87.4261 bits (215), Expect = 4.656e-19
Identity = 47/95 (49.47%), Postives = 64/95 (67.37%), Query Frame = 2
Query:  245 INNSLAELKELVPNAIAKQNTTKLEKAEILKLAVDHLKELKSKDSSKGYGGYTSIYESKIA-GFRDCLNEVSKYLHR-EGITTQNPLYQGLMEHL 523
            INNSL+EL+ LVP A  KQ + KLEKAEIL++ VDHLK L++    KG+    S+    I+ GFR+CL EV++YL   EG+ + +PL   L+ HL
Sbjct:   64 INNSLSELRRLVPTAFEKQGSAKLEKAEILQMTVDHLKMLQAT-GGKGFFDVQSLAMDFISIGFRECLTEVARYLSSVEGLDSADPLRVRLVSHL 157          
BLAST of hesl-3 protein vs. Ensembl Cavefish
Match: hey1 (hes related family bHLH transcription factor with YRPW motif 1 [Source:NCBI gene;Acc:103045133])

HSP 1 Score: 82.8037 bits (203), Expect = 1.995e-17
Identity = 42/94 (44.68%), Postives = 60/94 (63.83%), Query Frame = 2
Query:  245 INNSLAELKELVPNAIAKQNTTKLEKAEILKLAVDHLKELKSKDSSKGYGGYTSIYESKIAGFRDCLNEVSKYLH-REGITTQNPLYQGLMEHL 523
            INNSL+EL+ LVP+A+ KQ + KLEKAEIL++ VDHLK L +      +  +    + +  GFR+CL E ++YL   EG+   +PL   L+ HL
Sbjct:   64 INNSLSELRRLVPSALEKQGSAKLEKAEILQMTVDHLKMLHAAGGKGYFDAHALAMDYRGLGFRECLAETARYLSIIEGLENTDPLRIRLVSHL 157          
BLAST of hesl-3 protein vs. Ensembl Cavefish
Match: heyl (hairy/enhancer-of-split related with YRPW motif-like protein [Source:NCBI gene;Acc:103024849])

HSP 1 Score: 83.1889 bits (204), Expect = 2.032e-17
Identity = 43/97 (44.33%), Postives = 65/97 (67.01%), Query Frame = 2
Query:  245 INNSLAELKELVPNAIAKQNTTKLEKAEILKLAVDHLKELKSKDSSKGYGGYTSI-YESKIAGFRDCLNEVSKYLHR-EGITTQNPLYQGLMEHLQY 529
            IN+SL+EL+ LVP+A  KQ ++KLEKAEIL++ VDHLK L +    KGY    ++  + +  GFR+C+ EV +YL   EG+ + +P+   L+ HL +
Sbjct:   59 INHSLSELRRLVPSAFEKQGSSKLEKAEILQMTVDHLKLLHAM-GGKGYFDARALAVDYRTLGFRECVGEVVRYLSSLEGVESADPIGARLVSHLSH 154          
BLAST of hesl-3 protein vs. Ensembl Cavefish
Match: heyl (hairy/enhancer-of-split related with YRPW motif-like protein [Source:NCBI gene;Acc:103024849])

HSP 1 Score: 82.8037 bits (203), Expect = 2.214e-17
Identity = 40/96 (41.67%), Postives = 61/96 (63.54%), Query Frame = 2
Query:  245 INNSLAELKELVPNAIAKQNTTKLEKAEILKLAVDHLKELKSKDSSKGYGGYTSIYESKIAGFRDCLNEVSKYLHR-EGITTQNPLYQGLMEHLQY 529
            IN+SL+EL+ LVP+A  KQ ++KLEKAEIL++ VDHLK L +      +       + +  GFR+C+ EV +YL   EG+ + +P+   L+ HL +
Sbjct:   59 INHSLSELRRLVPSAFEKQGSSKLEKAEILQMTVDHLKLLHAMGGKGYFDARALAVDYRTLGFRECVGEVVRYLSSLEGVESADPIGARLVSHLSH 154          
BLAST of hesl-3 protein vs. Ensembl Sea Lamprey
Match: her9 (hairy-related 9 [Source:ZFIN;Acc:ZDB-GENE-011213-1])

HSP 1 Score: 46.9802 bits (110), Expect = 6.439e-7
Identity = 35/100 (35.00%), Postives = 54/100 (54.00%), Query Frame = 2
Query:  245 INNSLAELKELVPNAIAKQNT--TKLEKAEILKLAVDHLKELKSKDSSKGYG----GYTSIYESKIAGFRDCLNEVSKYLH-REGITTQNPLYQGLMEHL 523
            IN+SL +LK L+   + K ++  +KLEKA+IL+L V HL+ L     S        G    Y    AG+ +C+NEV+++L   EG+     +   L+ HL
Sbjct:   32 INDSLNQLKALILETLRKDSSRHSKLEKADILELTVKHLRSLHRLHISAALCAADPGVLGRYR---AGYSECVNEVTRFLSTSEGV--HAAVRTRLLAHL 126          
BLAST of hesl-3 protein vs. Ensembl Sea Lamprey
Match: her9 (hairy-related 9 [Source:ZFIN;Acc:ZDB-GENE-011213-1])

HSP 1 Score: 46.9802 bits (110), Expect = 8.125e-7
Identity = 35/100 (35.00%), Postives = 54/100 (54.00%), Query Frame = 2
Query:  245 INNSLAELKELVPNAIAKQNT--TKLEKAEILKLAVDHLKELKSKDSSKGYG----GYTSIYESKIAGFRDCLNEVSKYLH-REGITTQNPLYQGLMEHL 523
            IN+SL +LK L+   + K ++  +KLEKA+IL+L V HL+ L     S        G    Y    AG+ +C+NEV+++L   EG+     +   L+ HL
Sbjct:   56 INDSLNQLKALILETLRKDSSRHSKLEKADILELTVKHLRSLHRLHISAALCAADPGVLGRYR---AGYSECVNEVTRFLSTSEGV--HAAVRTRLLAHL 150          
BLAST of hesl-3 protein vs. Ensembl Nematostella
Match: HES1 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S1H6])

HSP 1 Score: 69.707 bits (169), Expect = 3.931e-15
Identity = 34/74 (45.95%), Postives = 49/74 (66.22%), Query Frame = 2
Query:  245 INNSLAELKELVPNAIAKQNTTKLEKAEILKLAVDHLKELKSKDSSKGYGGYTSIYESKIAGFRDCLNEVSKYL 466
            IN  L EL+ LVP A+ K+ ++KLEKAEIL L V+HLK L+S          + + + + AGF++CL EV+KY+
Sbjct:   17 INRCLVELRRLVPTALEKEGSSKLEKAEILHLTVEHLKWLRSTSGQS----RSDVTDYRAAGFQECLTEVAKYM 86          
BLAST of hesl-3 protein vs. Ensembl Nematostella
Match: HES2 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RYX7])

HSP 1 Score: 54.6842 bits (130), Expect = 2.178e-9
Identity = 42/120 (35.00%), Postives = 64/120 (53.33%), Query Frame = 2
Query:  245 INNSLAELKELVPNAIAKQNT--TKLEKAEILKLAVDHLKELKSKDSSKGYGGYTSIYESKI----AGFRDCLNEVSKYLHREGITTQNPLYQGLMEHLQYFYQCILSQTPYQIEAPSAI 586
            IN+SL ELK LV  ++ K  +  +K+EKA+IL+++V +LKE++ +++S  Y G  S     I    AGF  C  EV+K L        + L   L+ HL   +Q   + TP     PS +
Sbjct:    6 INDSLNELKSLVLQSLNKDASRYSKMEKADILEMSVQYLKEIRKQENS--YNGKLSFKAHSIAEYRAGFNYCAQEVTKNLTTLESPATDKLRSNLLNHLANCFQG--NTTPGAATTPSGV 121          
BLAST of hesl-3 protein vs. Ensembl Nematostella
Match: EDO34999 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SMU2])

HSP 1 Score: 56.225 bits (134), Expect = 1.038e-8
Identity = 38/120 (31.67%), Postives = 66/120 (55.00%), Query Frame = 2
Query:  245 INNSLAELKELVPNAI-AKQNTTKLEKAEILKLAVDHLK-------ELKSKDSSKG--------YGGYTSIYESK--IAGFRDCLNEVSKYL-HREGITTQNPLYQGLMEHLQYFYQCIL 547
            IN+ L+EL +L+P+A   KQ + KLEKAEIL+L V+++K       +++   + KG        +    ++ E +    G+ DC  EV ++L   E +  Q P +Q LM HL++ +  ++
Sbjct:   61 INSCLSELAQLIPSAQNGKQGSGKLEKAEILELTVEYVKKNLQNPNQIQQDGTDKGANEKDNNQHKPVVTMAELRKYWMGYSDCTAEVLRFLVAVEAMDPQQPCFQRLMAHLRHRHNLMV 180          
BLAST of hesl-3 protein vs. Ensembl Medaka
Match: hey1 (hes related family bHLH transcription factor with YRPW motif 1 [Source:NCBI gene;Acc:100049375])

HSP 1 Score: 83.5741 bits (205), Expect = 1.253e-17
Identity = 42/94 (44.68%), Postives = 60/94 (63.83%), Query Frame = 2
Query:  245 INNSLAELKELVPNAIAKQNTTKLEKAEILKLAVDHLKELKSKDSSKGYGGYTSIYESKIAGFRDCLNEVSKYLH-REGITTQNPLYQGLMEHL 523
            INNSL+EL+ LVP+A  KQ + KLEKAEIL++ VDHLK L +      +  +    + +  GFR+CL E ++YL   EG+ + +PL   L+ HL
Sbjct:   64 INNSLSELRRLVPSAYEKQGSAKLEKAEILQMTVDHLKMLHAAGGKGYFDAHALAMDYRGLGFRECLAETARYLSIIEGLDSTDPLRMRLVSHL 157          
BLAST of hesl-3 protein vs. Ensembl Medaka
Match: ENSORLT00000010378.2 (hairy/enhancer-of-split related with YRPW motif protein 1 [Source:NCBI gene;Acc:101163844])

HSP 1 Score: 79.337 bits (194), Expect = 3.467e-16
Identity = 46/95 (48.42%), Postives = 61/95 (64.21%), Query Frame = 2
Query:  245 INNSLAELKELVPNAIAKQNTTKLEKAEILKLAVDHLKELKSKDSSKGY-GGYTSIYESKIAGFRDCLNEVSKYLH-REGITTQNPLYQGLMEHL 523
            INNSL+EL+ LVP+A  KQ + KLEKAEIL++ VDHLK L +  S KGY   +    + +  GFR+CL E ++YL   EG  T + L   L+ HL
Sbjct:   63 INNSLSELRRLVPSAFEKQGSAKLEKAEILQMTVDHLKMLHAA-SGKGYFEAHALAKDYRSLGFRECLAETARYLSVVEGRDTTDSLRVRLVSHL 156          
BLAST of hesl-3 protein vs. Ensembl Medaka
Match: heyl (hairy/enhancer-of-split related with YRPW motif-like protein [Source:NCBI gene;Acc:101170445])

HSP 1 Score: 79.337 bits (194), Expect = 4.788e-16
Identity = 49/127 (38.58%), Postives = 73/127 (57.48%), Query Frame = 2
Query:  245 INNSLAELKELVPNAIAKQNTTKLEKAEILKLAVDHLKELKSKDSSKGYGGYTSI-YESKIAGFRDCLNEVSKYLHREGITTQNPLYQGLMEHLQYFYQCILSQTPYQIEAPSAIDSAFRYSQMQTP 622
            IN+SL+EL+ LVP+A  KQ ++KLEKAEIL++ VDHLK L +    KGY    ++  + +  GFR+C+ EV +YL      + +P+   L+ HL +   C     P  ++ P+A       S MQ P
Sbjct:  116 INHSLSELRRLVPSAFEKQGSSKLEKAEILQMTVDHLKLLHA-IGGKGYFDTRALAVDYRTLGFRECVGEVVRYLSSLEGESPDPIGARLVSHLSH---CASELDPLLLQCPAA-------SAMQFP 231          
BLAST of hesl-3 protein vs. Ensembl Medaka
Match: ENSORLT00000043193.1 (hairy/enhancer-of-split related with YRPW motif protein 2 [Source:NCBI gene;Acc:101169991])

HSP 1 Score: 71.633 bits (174), Expect = 9.664e-14
Identity = 40/86 (46.51%), Postives = 57/86 (66.28%), Query Frame = 2
Query:  245 INNSLAELKELVPNAIAKQNTTKLEKAEILKLAVDHLKELKSKDSSKG-YGGYTSIYESKIAGFRDCLNEVSKYL-HREGITTQNP 496
            IN+SL+EL+ LVP A  KQ + KLEKAEIL++ VDHLK L+++   KG   G     +    GFR+C+ EVS++L   EG+ + +P
Sbjct:   62 INSSLSELRRLVPTASEKQGSAKLEKAEILQMTVDHLKMLQAE---KGNLEGPALALDFLSLGFRECVTEVSRFLSSMEGLDSSSP 144          
BLAST of hesl-3 protein vs. Ensembl Medaka
Match: ENSORLT00000035222.1 (hairy/enhancer-of-split related with YRPW motif protein 2 [Source:NCBI gene;Acc:101169991])

HSP 1 Score: 71.2478 bits (173), Expect = 1.267e-13
Identity = 38/85 (44.71%), Postives = 56/85 (65.88%), Query Frame = 2
Query:  245 INNSLAELKELVPNAIAKQNTTKLEKAEILKLAVDHLKELKSKDSSKGYGGYTSIYESKIAGFRDCLNEVSKYL-HREGITTQNP 496
            IN+SL+EL+ LVP A  KQ + KLEKAEIL++ VDHLK L+++  +    G     +    GFR+C+ EVS++L   EG+ + +P
Sbjct:   55 INSSLSELRRLVPTASEKQGSAKLEKAEILQMTVDHLKMLQAEKGN--LEGPALALDFLSLGFRECVTEVSRFLSSMEGLDSSSP 137          
BLAST of hesl-3 protein vs. Planmine SMEST
Match: SMESG000009969.1 (SMESG000009969.1)

HSP 1 Score: 570.466 bits (1469), Expect = 0.000e+0
Identity = 307/307 (100.00%), Postives = 307/307 (100.00%), Query Frame = 2
Query:   80 MHLDIPENKKLKLEPDQYHSDVEDNYSDYIKSNNPELDVEXXXXXXXXXXXXXXXINNSLAELKELVPNAIAKQNTTKLEKAEILKLAVDHLKELKSKDSSKGYGGYTSIYESKIAGFRDCLNEVSKYLHREGITTQNPLYQGLMEHLQYFYQCILSQTPYQIEAPSAIDSAFRYSQMQTPLITFDPNTVPNYHENYQKLTSWSSNAIASSYQNQPNHYQAQTSNYQSNFLFQRNAHQQYPTNIATPLIAANANPNSVFKCSSTPSRISLTTNXXXXXXXXXXXXGLDFPSFCNDSINFFQSRQEIP 1000
            MHLDIPENKKLKLEPDQYHSDVEDNYSDYIKSNNPELDVEKKKRRGKIEKRRRDRINNSLAELKELVPNAIAKQNTTKLEKAEILKLAVDHLKELKSKDSSKGYGGYTSIYESKIAGFRDCLNEVSKYLHREGITTQNPLYQGLMEHLQYFYQCILSQTPYQIEAPSAIDSAFRYSQMQTPLITFDPNTVPNYHENYQKLTSWSSNAIASSYQNQPNHYQAQTSNYQSNFLFQRNAHQQYPTNIATPLIAANANPNSVFKCSSTPSRISLTTNPSQIQPLIQQPSGLDFPSFCNDSINFFQSRQEIP
Sbjct:    1 MHLDIPENKKLKLEPDQYHSDVEDNYSDYIKSNNPELDVEKKKRRGKIEKRRRDRINNSLAELKELVPNAIAKQNTTKLEKAEILKLAVDHLKELKSKDSSKGYGGYTSIYESKIAGFRDCLNEVSKYLHREGITTQNPLYQGLMEHLQYFYQCILSQTPYQIEAPSAIDSAFRYSQMQTPLITFDPNTVPNYHENYQKLTSWSSNAIASSYQNQPNHYQAQTSNYQSNFLFQRNAHQQYPTNIATPLIAANANPNSVFKCSSTPSRISLTTNPSQIQPLIQQPSGLDFPSFCNDSINFFQSRQEIP 307          
The following BLAST results are available for this feature:
BLAST of hesl-3 protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
HEY26.350e-1945.74hes related family bHLH transcription factor with ... [more]
HEY21.049e-1845.74hes related family bHLH transcription factor with ... [more]
HEY11.382e-1845.74hes related family bHLH transcription factor with ... [more]
HEY15.658e-1845.74hes related family bHLH transcription factor with ... [more]
HEY15.802e-1643.88hes related family bHLH transcription factor with ... [more]
back to top
BLAST of hesl-3 protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of hesl-3 protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Hey4.569e-2153.00gene:FBgn0027788 transcript:FBtr0088869[more]
h1.174e-742.67gene:FBgn0001168 transcript:FBtr0100153[more]
h1.174e-742.67gene:FBgn0001168 transcript:FBtr0076569[more]
E(spl)mbeta-HLH2.850e-733.06gene:FBgn0002733 transcript:FBtr0084982[more]
dpn7.679e-735.29gene:FBgn0010109 transcript:FBtr0088803[more]
back to top
BLAST of hesl-3 protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hey27.891e-1949.47hes-related family bHLH transcription factor with ... [more]
heyl4.663e-1835.71hes related family bHLH transcription factor with ... [more]
heyl4.663e-1835.71hes related family bHLH transcription factor with ... [more]
hey13.726e-1743.30hes-related family bHLH transcription factor with ... [more]
her91.298e-1135.88hairy-related 9 [Source:ZFIN;Acc:ZDB-GENE-011213-1... [more]
back to top
BLAST of hesl-3 protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
st3gal16.832e-1942.96ST3 beta-galactoside alpha-2,3-sialyltransferase 1... [more]
hey11.063e-1846.81hes related family bHLH transcription factor with ... [more]
hes49.427e-1132.80hes family bHLH transcription factor 4 [Source:NCB... [more]
ccdc636.332e-1036.46coiled-coil domain containing 63 [Source:Xenbase;A... [more]
HELT3.735e-840.00helt bHLH transcription factor [Source:NCBI gene;A... [more]
back to top
BLAST of hesl-3 protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Hey22.660e-1845.74hairy/enhancer-of-split related with YRPW motif 2 ... [more]
Hey14.633e-1845.74hairy/enhancer-of-split related with YRPW motif 1 ... [more]
Heyl6.945e-1640.82hairy/enhancer-of-split related with YRPW motif-li... [more]
Hes14.540e-1036.46hes family bHLH transcription factor 1 [Source:MGI... [more]
Helt2.252e-734.00helt bHLH transcription factor [Source:MGI Symbol;... [more]
back to top
BLAST of hesl-3 protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q7KM13|HEY_DROME4.580e-2053.00Hairy/enhancer-of-split related with YRPW motif pr... [more]
sp|Q9I8A3|HEY1_XENLA4.935e-1846.81Hairy/enhancer-of-split related with YRPW motif pr... [more]
sp|Q9UBP5|HEY2_HUMAN5.036e-1845.74Hairy/enhancer-of-split related with YRPW motif pr... [more]
sp|Q66KK8|HEY1_XENTR5.633e-1846.81Hairy/enhancer-of-split related with YRPW motif pr... [more]
sp|Q9I9L0|HEY2_DANRE5.957e-1849.47Hairy/enhancer-of-split related with YRPW motif pr... [more]
back to top
BLAST of hesl-3 protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1Z1R1750.000e+098.66Hes-like 3 (Fragment) OS=Schmidtea mediterranea OX... [more]
U5YQ740.000e+098.96Hesl-3 protein (Fragment) OS=Schmidtea mediterrane... [more]
A0A482WBV51.694e-1941.43Hairy/enhancer-of-split related with YRPW motif pr... [more]
A0A0M4EIR02.964e-1946.56Hey OS=Drosophila busckii OX=30019 GN=Dbus_chr2Rg6... [more]
A0A336M4E33.837e-1954.08CSON002785 protein OS=Culicoides sonorensis OX=179... [more]
back to top
BLAST of hesl-3 protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hey23.559e-1949.47hes related family bHLH transcription factor with ... [more]
hey24.656e-1949.47hes related family bHLH transcription factor with ... [more]
hey11.995e-1744.68hes related family bHLH transcription factor with ... [more]
heyl2.032e-1744.33hairy/enhancer-of-split related with YRPW motif-li... [more]
heyl2.214e-1741.67hairy/enhancer-of-split related with YRPW motif-li... [more]
back to top
BLAST of hesl-3 protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
her96.439e-735.00hairy-related 9 [Source:ZFIN;Acc:ZDB-GENE-011213-1... [more]
her98.125e-735.00hairy-related 9 [Source:ZFIN;Acc:ZDB-GENE-011213-1... [more]
back to top
BLAST of hesl-3 protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of hesl-3 protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
HES13.931e-1545.95Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
HES22.178e-935.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO349991.038e-831.67Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of hesl-3 protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hey11.253e-1744.68hes related family bHLH transcription factor with ... [more]
ENSORLT00000010378.23.467e-1648.42hairy/enhancer-of-split related with YRPW motif pr... [more]
heyl4.788e-1638.58hairy/enhancer-of-split related with YRPW motif-li... [more]
ENSORLT00000043193.19.664e-1446.51hairy/enhancer-of-split related with YRPW motif pr... [more]
ENSORLT00000035222.11.267e-1344.71hairy/enhancer-of-split related with YRPW motif pr... [more]
back to top
BLAST of hesl-3 protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000009969.10.000e+0100.00SMESG000009969.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30009683
GenBankAGZ94927.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30009683 ID=SMED30009683|Name=hesl-3 protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1128bp
GCGCATACGTTCATAGAATAATAACAGTGTGGTTAAACATATTTTCCCGA
TATTTGACAGAAGGTCTTACACGTGTTCTATGCATCTTGATATTCCAGAA
AACAAGAAACTCAAACTTGAGCCAGATCAATATCACAGCGATGTGGAAGA
CAATTACTCAGATTATATTAAAAGCAACAATCCAGAACTCGATGTAGAAA
AGAAAAAACGCCGAGGAAAAATCGAAAAGCGCAGACGAGACCGAATTAAC
AACAGCCTGGCAGAGCTCAAAGAATTGGTACCGAATGCAATAGCAAAACA
GAATACGACAAAATTGGAGAAAGCTGAAATCCTAAAGCTGGCCGTTGATC
ACTTGAAAGAATTAAAGAGCAAAGATTCGAGTAAAGGTTATGGAGGATAT
ACAAGCATTTATGAGAGCAAAATTGCAGGATTTAGAGATTGTTTAAATGA
AGTCTCAAAGTACCTTCATAGGGAAGGAATCACGACTCAAAATCCACTCT
ATCAAGGCTTGATGGAGCACCTGCAGTATTTCTATCAATGTATCCTTTCA
CAAACCCCTTATCAGATTGAAGCACCATCAGCGATTGATTCGGCTTTTCG
ATATTCACAAATGCAAACTCCTTTAATTACATTCGACCCGAACACTGTGC
CAAATTATCATGAAAACTATCAAAAGCTGACTTCGTGGAGCAGCAATGCA
ATTGCGTCTTCATATCAAAACCAGCCGAATCATTATCAAGCTCAAACCAG
CAATTACCAATCAAATTTCCTTTTCCAACGGAACGCGCATCAGCAGTATC
CGACAAACATTGCGACTCCGTTGATAGCAGCGAACGCAAATCCGAATTCC
GTATTCAAGTGCTCATCGACTCCATCTCGGATCAGTTTGACAACGAATCC
GTCTCAAATTCAACCGCTAATCCAGCAGCCATCTGGACTGGATTTCCCCT
CGTTTTGCAATGATTCGATTAATTTCTTCCAGTCCAGACAAGAAATACCG
TAACATGCAAAAGTGAAAACAAAGCCTGCAATTCACTCTCCTCCACCTCC
TCCCTTCCGCTCCCCCCCCCCCTTATTTTATCTATCCCTATCTCTACCGA
ATTGAATAGATTTATTAAAATATCTACA
back to top

protein sequence of SMED30009683-orf-1

>SMED30009683-orf-1 ID=SMED30009683-orf-1|Name=SMED30009683-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=308bp
MHLDIPENKKLKLEPDQYHSDVEDNYSDYIKSNNPELDVEKKKRRGKIEK
RRRDRINNSLAELKELVPNAIAKQNTTKLEKAEILKLAVDHLKELKSKDS
SKGYGGYTSIYESKIAGFRDCLNEVSKYLHREGITTQNPLYQGLMEHLQY
FYQCILSQTPYQIEAPSAIDSAFRYSQMQTPLITFDPNTVPNYHENYQKL
TSWSSNAIASSYQNQPNHYQAQTSNYQSNFLFQRNAHQQYPTNIATPLIA
ANANPNSVFKCSSTPSRISLTTNPSQIQPLIQQPSGLDFPSFCNDSINFF
QSRQEIP*
back to top
Aliases
The feature 'hesl-3 protein' has the following synonyms
Synonym
hesl-3
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000103central nervous system
PLANA:0000120progenitor cell
PLANA:0000121stem cell
PLANA:0002109X1 cell
PLANA:0002142parenchyma
Vocabulary: INTERPRO
TermDefinition
IPR036638HLH_DNA-bd_sf
IPR011598bHLH_dom
IPR003650Orange_dom
Vocabulary: molecular function
TermDefinition
GO:0046983protein dimerization activity
GO:0003677DNA binding
Vocabulary: biological process
TermDefinition
GO:0006355regulation of transcription, DNA-templated
GO:0006351transcription, DNA-templated
GO:0007219Notch signaling pathway
GO:0007275multicellular organism development
GO:0045746negative regulation of Notch signaling pathway
GO:0048664neuron fate determination
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR011598Myc-type, basic helix-loop-helix (bHLH) domainSMARTSM00353finuluscoord: 46..101
e-value: 2.5E-13
score: 60.3
IPR011598Myc-type, basic helix-loop-helix (bHLH) domainPFAMPF00010HLHcoord: 41..96
e-value: 7.8E-16
score: 57.8
IPR011598Myc-type, basic helix-loop-helix (bHLH) domainPROSITEPS50888BHLHcoord: 40..95
score: 16.907
IPR011598Myc-type, basic helix-loop-helix (bHLH) domainCDDcd00083HLHcoord: 38..96
e-value: 1.04878E-16
score: 71.0911
IPR036638Helix-loop-helix DNA-binding domain superfamilyGENE3DG3DSA:4.10.280.10coord: 36..98
e-value: 3.3E-19
score: 70.6
IPR036638Helix-loop-helix DNA-binding domain superfamilySUPERFAMILYSSF47459HLH, helix-loop-helix DNA-binding domaincoord: 41..97
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..27
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..26
NoneNo IPR availablePANTHERPTHR10985BASIC HELIX-LOOP-HELIX TRANSCRIPTION FACTOR, HES-RELATEDcoord: 37..261
NoneNo IPR availablePANTHERPTHR10985:SF126HAIRY/ENHANCER-OF-SPLIT RELATED WITH YRPW MOTIF PROTEINcoord: 37..261
NoneNo IPR availableSUPERFAMILYSSF158457Orange domain-likecoord: 110..152
IPR003650Orange domainPROSITEPS51054ORANGEcoord: 116..148
score: 8.194