Zinc finger CCCH domain-containing protein 10

Overview
NameZinc finger CCCH domain-containing protein 10
Smed IDSMED30009681
Length (bp)3661
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Zinc finger CCCH domain-containing protein 10 (SMED30009681) t-SNE clustered cells

Violin plots show distribution of expression levels for Zinc finger CCCH domain-containing protein 10 (SMED30009681) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Zinc finger CCCH domain-containing protein 10 (SMED30009681) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Zinc finger CCCH domain-containing protein 10 (SMED30009681) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30009681

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymal cellSMED30009681h1SMcG0015826 dd_Smed_v4_7175_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Zinc finger CCCH domain-containing protein 10 vs. Ensembl Human
Match: ZC3H10 (zinc finger CCCH-type containing 10 [Source:HGNC Symbol;Acc:HGNC:25893])

HSP 1 Score: 95.5153 bits (236), Expect = 7.895e-20
Identity = 50/133 (37.59%), Postives = 74/133 (55.64%), Query Frame = 3
Query:  906 EYVCRDFIRNICRRGRKCKFKHPTSVKRPWPAKIETPNNPG--QFEVNFCHDYQNHGCNRPQCRFIHCNRPEQEFYYATGIL-------------LSSVFCNNI--QVPYCKDYLNNACTR-IKCKFLHLTKD 1250
            + +CRDF+RN+C+RG++C+++HP          +   +N G  + E  FCHD+QN  C+RP CRFIH ++ +++ Y  TG L             LS     N   +VP C+D+L   C R  KCKF HL +D
Sbjct:   39 DAICRDFLRNVCKRGKRCRYRHP---------DMSEVSNLGVSKNEFIFCHDFQNKECSRPNCRFIHGSKEDEDGYKKTGELPPRLRQKVAAGLGLSPADLPNGKEEVPICRDFLKGDCQRGAKCKFRHLQRD 162          
BLAST of Zinc finger CCCH domain-containing protein 10 vs. Ensembl Human
Match: ZC3H10 (zinc finger CCCH-type containing 10 [Source:HGNC Symbol;Acc:HGNC:25893])

HSP 1 Score: 49.6766 bits (117), Expect = 9.784e-7
Identity = 22/58 (37.93%), Postives = 36/58 (62.07%), Query Frame = 3
Query:  906 EYVCRDFIRNICRRGRKCKFKHPTSVKRPWPAKIETPNNPG--QFEVNFCHDYQNHGC 1073
            + +CRDF+RN+C+RG++C+++HP          +   +N G  + E  FCHD+QN  C
Sbjct:   39 DAICRDFLRNVCKRGKRCRYRHPD---------MSEVSNLGVSKNEFIFCHDFQNKEC 87          
BLAST of Zinc finger CCCH domain-containing protein 10 vs. Ensembl Celegans
Match: Y53G8AR.9 (pep chromosome:WBcel235:III:3317737:3321245:-1 gene:WBGene00021816.1 transcript:Y53G8AR.9.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y53G8AR.9)

HSP 1 Score: 81.2629 bits (199), Expect = 4.027e-16
Identity = 49/134 (36.57%), Postives = 70/134 (52.24%), Query Frame = 3
Query:  912 VCRDFIRNICRRGRKCKFKHPTSVKRPWPAKIETPNNP-GQFEVNFCHDYQNHGCNRPQCRFIHCNRPEQEFYYATGIL-------LSSVFCNNI--QVPYCKDYLNNACTRI--KCKFLHLTKDEIEQQNKNQ 1277
            VCRDF++NIC RG +CKF HP+          E P  P    + NFC DYQN GC R  CRF+H  R E E Y  T  L       +++V   +    +P CK++    C R   +C++ H+  D +E+  +N+
Sbjct:   58 VCRDFLKNICNRGSRCKFYHPS----------EAP--PISDHDYNFCIDYQNRGCQRDNCRFVHAPRDEVERYKTTRELTLILARAIAAVGHGDTIGGIPICKEFQTGRCARGVNRCRYWHVNVD-LERDRRNR 178          
BLAST of Zinc finger CCCH domain-containing protein 10 vs. Ensembl Zebrafish
Match: zc3h10 (zinc finger CCCH-type containing 10 [Source:ZFIN;Acc:ZDB-GENE-040426-2359])

HSP 1 Score: 98.9821 bits (245), Expect = 7.353e-21
Identity = 50/129 (38.76%), Postives = 71/129 (55.04%), Query Frame = 3
Query:  912 VCRDFIRNICRRGRKCKFKHPTSVKRPWPAKIETPNNPGQFEVNFCHDYQNHGCNRPQCRFIHCNRPEQEFYYATGIL---LSSVFCNNI------------QVPYCKDYLNNACTRI-KCKFLHLTKD 1250
            VCRDF+RN+C+RG++C+F+HP   + P    +    N    E  FCHD+QN  C RP CRF+H ++ ++++Y  TG L   L       +            +VP C+DYL   C R  KCKF H+ KD
Sbjct:   72 VCRDFLRNVCKRGKRCRFRHPDFNEVP---DLGVQKN----EFIFCHDHQNKECVRPNCRFVHGSKEDEDYYKKTGELPLRLRGKVAAGLGLSPTDLPFSRGEVPICRDYLKGECQRGNKCKFRHVRKD 193          
BLAST of Zinc finger CCCH domain-containing protein 10 vs. Ensembl Zebrafish
Match: zc3h10 (zinc finger CCCH-type containing 10 [Source:ZFIN;Acc:ZDB-GENE-040426-2359])

HSP 1 Score: 98.9821 bits (245), Expect = 7.353e-21
Identity = 50/129 (38.76%), Postives = 71/129 (55.04%), Query Frame = 3
Query:  912 VCRDFIRNICRRGRKCKFKHPTSVKRPWPAKIETPNNPGQFEVNFCHDYQNHGCNRPQCRFIHCNRPEQEFYYATGIL---LSSVFCNNI------------QVPYCKDYLNNACTRI-KCKFLHLTKD 1250
            VCRDF+RN+C+RG++C+F+HP   + P    +    N    E  FCHD+QN  C RP CRF+H ++ ++++Y  TG L   L       +            +VP C+DYL   C R  KCKF H+ KD
Sbjct:   72 VCRDFLRNVCKRGKRCRFRHPDFNEVP---DLGVQKN----EFIFCHDHQNKECVRPNCRFVHGSKEDEDYYKKTGELPLRLRGKVAAGLGLSPTDLPFSRGEVPICRDYLKGECQRGNKCKFRHVRKD 193          
BLAST of Zinc finger CCCH domain-containing protein 10 vs. Ensembl Xenopus
Match: gpr176 (G protein-coupled receptor 176 [Source:Xenbase;Acc:XB-GENE-5875770])

HSP 1 Score: 97.8265 bits (242), Expect = 9.385e-21
Identity = 51/130 (39.23%), Postives = 72/130 (55.38%), Query Frame = 3
Query:  906 EYVCRDFIRNICRRGRKCKFKHPTSVKRPWPAKIETPNNPGQFEVNFCHDYQNHGCNRPQCRFIHCNRPEQEFYYATGIL-------------LS-SVFCNNIQVPYCKDYLNNACTR-IKCKFLHLTKD 1250
            E+VCRDF+RN+C+RG++C+FKHP +      + +    N    E  FCHD+QN  C R  CRFIH  + ++E Y  TG L             LS +   N  +VP C+D+L   C R  +CKF HL ++
Sbjct:   21 EHVCRDFLRNVCKRGKRCRFKHPDADD---VSDLGVQKN----EFVFCHDFQNKECVRLNCRFIHGTKDDEEHYKKTGELPPRLRHKVAAGLGLSPTDLPNKDEVPICRDFLKGDCQRGDRCKFRHLQRE 143          
BLAST of Zinc finger CCCH domain-containing protein 10 vs. Ensembl Mouse
Match: Zc3h10 (zinc finger CCCH type containing 10 [Source:MGI Symbol;Acc:MGI:2143670])

HSP 1 Score: 95.1301 bits (235), Expect = 6.857e-20
Identity = 50/133 (37.59%), Postives = 74/133 (55.64%), Query Frame = 3
Query:  906 EYVCRDFIRNICRRGRKCKFKHPTSVKRPWPAKIETPNNPG--QFEVNFCHDYQNHGCNRPQCRFIHCNRPEQEFYYATGIL-------------LSSVFCNNI--QVPYCKDYLNNACTR-IKCKFLHLTKD 1250
            + +CRDF+RN+C+RG++C+++HP          +   +N G  + E  FCHD+QN  C+RP CRFIH ++ +++ Y  TG L             LS     N   +VP C+D+L   C R  KCKF HL +D
Sbjct:   39 DAICRDFLRNVCKRGKRCRYRHP---------DMSEVSNLGVSKNEFIFCHDFQNKECSRPNCRFIHGSKEDEDGYKKTGELPPRLRQKVAAGLGLSPADLPNGKEEVPICRDFLKGDCQRGAKCKFRHLQRD 162          
BLAST of Zinc finger CCCH domain-containing protein 10 vs. Ensembl Mouse
Match: Zc3h10 (zinc finger CCCH type containing 10 [Source:MGI Symbol;Acc:MGI:2143670])

HSP 1 Score: 75.0998 bits (183), Expect = 2.398e-15
Identity = 33/80 (41.25%), Postives = 52/80 (65.00%), Query Frame = 3
Query:  912 VCRDFIRNICRRGRKCKFKHPTSVKRPWPAKIETPNNPG--QFEVNFCHDYQNHGCNRPQCRFIHCNRPEQEFYYATGIL 1145
            +CRDF+RN+C+RG++C+++HP          +   +N G  + E  FCHD+QN  C+RP CRFIH ++ +++ Y  TG L
Sbjct:   41 ICRDFLRNVCKRGKRCRYRHP---------DMSEVSNLGVSKNEFIFCHDFQNKECSRPNCRFIHGSKEDEDGYKKTGEL 111          
BLAST of Zinc finger CCCH domain-containing protein 10 vs. UniProt/SwissProt
Match: sp|Q96K80|ZC3HA_HUMAN (Zinc finger CCCH domain-containing protein 10 OS=Homo sapiens OX=9606 GN=ZC3H10 PE=1 SV=1)

HSP 1 Score: 95.5153 bits (236), Expect = 3.791e-19
Identity = 50/133 (37.59%), Postives = 74/133 (55.64%), Query Frame = 3
Query:  906 EYVCRDFIRNICRRGRKCKFKHPTSVKRPWPAKIETPNNPG--QFEVNFCHDYQNHGCNRPQCRFIHCNRPEQEFYYATGIL-------------LSSVFCNNI--QVPYCKDYLNNACTR-IKCKFLHLTKD 1250
            + +CRDF+RN+C+RG++C+++HP          +   +N G  + E  FCHD+QN  C+RP CRFIH ++ +++ Y  TG L             LS     N   +VP C+D+L   C R  KCKF HL +D
Sbjct:   39 DAICRDFLRNVCKRGKRCRYRHP---------DMSEVSNLGVSKNEFIFCHDFQNKECSRPNCRFIHGSKEDEDGYKKTGELPPRLRQKVAAGLGLSPADLPNGKEEVPICRDFLKGDCQRGAKCKFRHLQRD 162          
BLAST of Zinc finger CCCH domain-containing protein 10 vs. UniProt/SwissProt
Match: sp|Q8R205|ZC3HA_MOUSE (Zinc finger CCCH domain-containing protein 10 OS=Mus musculus OX=10090 GN=Zc3h10 PE=1 SV=1)

HSP 1 Score: 95.1301 bits (235), Expect = 4.796e-19
Identity = 50/133 (37.59%), Postives = 74/133 (55.64%), Query Frame = 3
Query:  906 EYVCRDFIRNICRRGRKCKFKHPTSVKRPWPAKIETPNNPG--QFEVNFCHDYQNHGCNRPQCRFIHCNRPEQEFYYATGIL-------------LSSVFCNNI--QVPYCKDYLNNACTR-IKCKFLHLTKD 1250
            + +CRDF+RN+C+RG++C+++HP          +   +N G  + E  FCHD+QN  C+RP CRFIH ++ +++ Y  TG L             LS     N   +VP C+D+L   C R  KCKF HL +D
Sbjct:   39 DAICRDFLRNVCKRGKRCRYRHP---------DMSEVSNLGVSKNEFIFCHDFQNKECSRPNCRFIHGSKEDEDGYKKTGELPPRLRQKVAAGLGLSPADLPNGKEEVPICRDFLKGDCQRGAKCKFRHLQRD 162          
BLAST of Zinc finger CCCH domain-containing protein 10 vs. TrEMBL
Match: A0A423TH25 (Zinc finger CCCH domain-containing protein 10 (Fragment) OS=Penaeus vannamei OX=6689 GN=C7M84_005697 PE=4 SV=1)

HSP 1 Score: 124.405 bits (311), Expect = 3.726e-26
Identity = 60/138 (43.48%), Postives = 79/138 (57.25%), Query Frame = 3
Query:  912 VCRDFIRNICRRGRKCKFKHPTSVKRPWPAKIETPNNPGQFEVNFCHDYQNHGCNRPQCRFIHCNRPEQEFYYATGILLSSVFCNNIQ------------VPYCKDYLNNACTRI---KCKFLHLTKDEIEQQNKNQE 1280
            +CRDF+RN+CRRG++CKFKHP     P P     PN P + ++ FCHDYQN  C+R  CRFIHC   ++++Y  TG +   +    I+            VP CKDYL   C+R    KCKF H+TK E E +   QE
Sbjct:   28 ICRDFLRNVCRRGKRCKFKHPEETD-PGP-----PNKPVKIDLTFCHDYQNGHCSRAMCRFIHCTCEDEDYYLRTGDIAPHILDQAIRKGQLGDVTLNGDVPICKDYLMGECSRRRGGKCKFRHITKTEYEAEIYGQE 159          
BLAST of Zinc finger CCCH domain-containing protein 10 vs. TrEMBL
Match: A0A087TFB7 (Zinc finger CCCH domain-containing protein 10 (Fragment) OS=Stegodyphus mimosarum OX=407821 GN=X975_19662 PE=4 SV=1)

HSP 1 Score: 120.168 bits (300), Expect = 2.055e-25
Identity = 53/145 (36.55%), Postives = 84/145 (57.93%), Query Frame = 3
Query:  861 KSDFSQLLNDEESNSEYVCRDFIRNICRRGRKCKFKHPTSVKRPWPAKIETPNNPGQFEVNFCHDYQNHGCNRPQCRFIHCNRPEQEFYYATGILLSSVF--------CNNIQVPYCKDYLNNACTRI-KCKFLHLTKDEIEQQN 1268
            ++D + L  D+  + E +CRDF+RN+C+RG+ C+FKHP           +     G+ E+ FCHD+QN  C RP C+F+HC + E+E + +TG L  +V           + ++P CKDYL   C R  +CKF HL+  E++ ++
Sbjct:    9 ETDNASLNGDDNDSKESICRDFLRNVCKRGKFCRFKHPEG---------DEAEALGKKELVFCHDFQNKECRRPNCKFVHCTKQEEEIFRSTGRLPGAVLESMGNKSHMQSAKIPICKDYLKGECRRAGRCKFRHLSAFELQMES 144          
BLAST of Zinc finger CCCH domain-containing protein 10 vs. TrEMBL
Match: A0A2J7QG93 (Zinc finger CCCH domain-containing protein 10 OS=Cryptotermes secundus OX=105785 GN=Zc3h10 PE=4 SV=1)

HSP 1 Score: 120.168 bits (300), Expect = 9.218e-25
Identity = 62/145 (42.76%), Postives = 80/145 (55.17%), Query Frame = 3
Query:  864 SDFSQLLNDEESNSEYVCRDFIRNICRRGRKCKFKHPTSVKRPWPAKIETPNNPGQFEVNFCHDYQNHGCNRPQCRFIHCNRPEQEFYYATGIL----LSSVFCNNI--------QVPYCKDYLNNACTR-IKCKFLHLTKDEIE 1259
            SDFS          + VCRDF+R +CRRG++CKF HP   ++         +  G+FE  FCHDYQN  C+RP CRF+HC R E+E+Y ATG L    L S     I        ++P CKD+L   C R  KC+F HL+  E E
Sbjct:   16 SDFS---------GDRVCRDFLRKVCRRGKRCKFVHPNEKEQ---------DAGGKFEYIFCHDYQNSKCSRPLCRFVHCTREEEEYYRATGELPRHVLESAVRKGITPDVSRPGELPVCKDHLKGECRRGGKCRFRHLSVREYE 142          
BLAST of Zinc finger CCCH domain-containing protein 10 vs. TrEMBL
Match: A0A210PFY5 (Zinc finger CCCH domain-containing protein 10 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT19487 PE=4 SV=1)

HSP 1 Score: 118.627 bits (296), Expect = 1.757e-24
Identity = 67/198 (33.84%), Postives = 102/198 (51.52%), Query Frame = 3
Query:  897 SNSEYVCRDFIRNICRRGRKCKFKHPTSVKRPWPAKIETPNNPGQFEVNFCHDYQNHGCNRPQCRFIHCNRPEQEFYYATGIL-----------LSSVFCNNI-----QVPYCKDYLNNACTR-IKCKFLHLTKDEIEQQNKNQEAVNNQAA--------DYGNFP-----HQSS--MEQNVIQPLPGTNANFYSNYH 1394
             N + +CRD++RN+C+RG++CK++HP S         E  +   +++  FCHD+QN GC+RP C+F+HC+R E+E Y  TG L           +     N++     ++P CKDYL   C R IKCKF HLT  E E + +  +  NN  +        D+  F      H SS    +   + L G N+N+  N +
Sbjct:   27 GNDDDICRDYLRNVCKRGKRCKYRHPHS---------EESSRERKYDYTFCHDFQNTGCHRPNCKFLHCSREEEEHYKQTGQLPVRLQQAAALGVGVTPTNDMPLLKGEIPICKDYLKMNCKRGIKCKFRHLTATEYEFELRKSDQRNNNNSQNYDPYEEDFDRFESFEYCHSSSGVKRRRTDRDLDGFNSNYVENRY 215          
BLAST of Zinc finger CCCH domain-containing protein 10 vs. TrEMBL
Match: A0A4Y2NB93 (Zinc finger CCCH domain-containing protein 10 OS=Araneus ventricosus OX=182803 GN=ZC3H10_1 PE=4 SV=1)

HSP 1 Score: 115.931 bits (289), Expect = 5.015e-24
Identity = 57/152 (37.50%), Postives = 85/152 (55.92%), Query Frame = 3
Query:  852 EALKSDFSQLLNDEESNS-EYVCRDFIRNICRRGRKCKFKHPTSVKRPWPAKIETPNNPGQFEVNFCHDYQNHGCNRPQCRFIHCNRPEQEFYYATGILLSSVF--CNNI------QVPYCKDYLNNACTRI-KCKFLHLTKDEIEQQNKNQ 1277
            ++ K      LN ++SNS + +CRDF+RN+C+RG+ CKFKHP   +             G+ ++ FCHD+QN  C RP C+F+HC + E+E + +TG L  +V     N       +VP CKDYL   C R  +CKF H++  E + +   Q
Sbjct:    5 KSFKDSEDSALNGDDSNSKDSICRDFLRNVCKRGKLCKFKHPEGYE---------AEALGKKDIVFCHDFQNKECRRPNCKFVHCTKQEEEIFRSTGRLPETVLESMGNAGHNSFSKVPICKDYLKGECRRAGRCKFRHMSNYEFQMEASGQ 147          
BLAST of Zinc finger CCCH domain-containing protein 10 vs. Ensembl Cavefish
Match: zc3h10 (zinc finger CCCH-type containing 10 [Source:NCBI gene;Acc:103021586])

HSP 1 Score: 94.3597 bits (233), Expect = 2.451e-19
Identity = 50/129 (38.76%), Postives = 70/129 (54.26%), Query Frame = 3
Query:  912 VCRDFIRNICRRGRKCKFKHPTSVKRPWPAKIETPNNPGQFEVNFCHDYQNHGCNRPQCRFIHCNRPEQEFYYATGIL-------------LSSVFC--NNIQVPYCKDYLNNACTRI-KCKFLHLTKD 1250
            VCRDF+RN+C+RG++C+F+HP   + P    +    N    E  FCHD+QN  C R  CRF+H ++ ++++Y  TG L             LS      N  + P C+DYL   C R  KCKF H+ KD
Sbjct:  100 VCRDFLRNVCKRGKRCRFRHPDFNEVP---DLGVQKN----EFIFCHDHQNKECVRINCRFVHGSKEDEDYYKKTGELPLWLRWKVAAGLGLSPADLPQNRGEAPICRDYLKGECQRGNKCKFRHVRKD 221          
BLAST of Zinc finger CCCH domain-containing protein 10 vs. Ensembl Sea Lamprey
Match: zc3h10 (zinc finger CCCH-type containing 10 [Source:ZFIN;Acc:ZDB-GENE-040426-2359])

HSP 1 Score: 96.6709 bits (239), Expect = 2.768e-21
Identity = 48/133 (36.09%), Postives = 71/133 (53.38%), Query Frame = 3
Query:  912 VCRDFIRNICRRGRKCKFKHPTSVKRPWPAKIETPNNPG--QFEVNFCHDYQNHGCNRPQCRFIHCNRPEQEFYY---------------ATGILLSSVFCNNIQVPYCKDYLNNACTRIK-CKFLHLTKDEI 1256
            +CRDF+RN+C+RG+ C++ HP         +     N G  + E++FCHD+QN  C RP C+F+H  + ++EFY                  G+ L  +     +VP C D LNN C R K CKF H+T++E 
Sbjct:   15 MCRDFLRNVCKRGKHCRYHHP---------EFSEVINMGVRRNELSFCHDFQNGSCTRPNCKFVHSPKQDEEFYRRHGELPAHLKQTVAAGLGLSLRDLQLRQGEVPVCHDNLNNGCLRGKRCKFRHVTREEF 138          
BLAST of Zinc finger CCCH domain-containing protein 10 vs. Ensembl Nematostella
Match: EDO41194 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S573])

HSP 1 Score: 76.2554 bits (186), Expect = 9.434e-15
Identity = 45/140 (32.14%), Postives = 65/140 (46.43%), Query Frame = 3
Query:  912 VCRDFIRNICRRGRKCKFKHPTSVKRPWPAKIETPNNPGQFEVNFCHDYQNHGCNRPQCRFIHCNRPEQEFYYATGILLSSV---------------------FCNNIQV----PYCKDYLNNACTRIK-CKFLHLTKDE 1253
            +CRD+ R +C RG KCKF+HP  +       IE  + P       C DYQN  CNR  C+++H +  +++ Y  TG+L                         F +  +     P CKD+LNN C+R   CKF H  +D+
Sbjct:   37 ICRDYQRGVCNRGGKCKFRHPEGMG------IELQSPP-----MICRDYQNGKCNRSTCKYMHISNDDEKVYLRTGVLPPRARFSAAPMPPAPMMRPAMSYPHFGHPTRAGRSDPICKDFLNNKCSRGNLCKFRHAFEDD 165          

HSP 2 Score: 55.8398 bits (133), Expect = 4.110e-8
Identity = 25/56 (44.64%), Postives = 38/56 (67.86%), Query Frame = 3
Query: 2349 FNMMKKSPEKNKTDQYSQIMEENEQLKRKLMDLQKQTNDLQTANELLLDQNARLRN 2516
            F+  ++     +   Y Q+ +ENE+L R++ DLQKQ +DL+  NE+LL+QNAR RN
Sbjct:  179 FSRKRRRDSSGEGGDYLQLKDENERLHRQVADLQKQISDLKATNEVLLEQNARYRN 234          
BLAST of Zinc finger CCCH domain-containing protein 10 vs. Ensembl Medaka
Match: zc3h10 (zinc finger CCCH-type containing 10 [Source:NCBI gene;Acc:101168702])

HSP 1 Score: 100.138 bits (248), Expect = 3.085e-21
Identity = 53/148 (35.81%), Postives = 76/148 (51.35%), Query Frame = 3
Query:  906 EYVCRDFIRNICRRGRKCKFKHPTSVKRPWPAKIETPNNPGQFEVNFCHDYQNHGCNRPQCRFIHCNRPEQEFYYATGIL---LSSVFCNNI------------QVPYCKDYLNNACTRI-KCKFLHLTKD-EIEQQNKNQEAVNNQA 1298
            + +CRDFIRN+C+RG++C+F+HP   + P    +    N    E  FCHD+QN  C R  CRF+H +R ++++Y  TG L   L       +            +VP C+D+L   C R  KCKF H+ KD E E       A+  Q 
Sbjct:   68 DGICRDFIRNVCKRGKRCRFRHPDVNEVP---DLGVQKN----EFIFCHDHQNKECLRASCRFVHGSREDEDYYKKTGALPPRLRGKVAARLGLSPMDLPHSRGEVPICRDFLKGECQRGNKCKFRHVKKDYEYEPSWAGVGAIMGQG 208          
BLAST of Zinc finger CCCH domain-containing protein 10 vs. Planmine SMEST
Match: SMESG000042104.1 (SMESG000042104.1)

HSP 1 Score: 1660.58 bits (4299), Expect = 0.000e+0
Identity = 840/856 (98.13%), Postives = 845/856 (98.71%), Query Frame = 3
Query:  702 KKPQNRADSFKSTEDYTADCETYDFMSDGQKEEIEFSPQLKKSSNYQDSYEALKSDFSQLLNDEESNSEYVCRDFIRNICRRGRKCKFKHPTSVKRPWPAKIETPNNPGQFEVNFCHDYQNHGCNRPQCRFIHCNRPEQEFYYATGILLSSVFCNNIQVPYCKDYLNNACTRIKCKFLHLTKDEIEQQNKNQEAVNNQAADYGNFPHQSSMEQNVIQPLPGTNANFYSNYHDHYXXXXXXXXXXXXTISIGNSLPLTNAQFTVSLPLGSVSYSTSQQQLIAQPSLTNVQYIHDPILSSVTHEVGSINSDVLTQLPVSNQHNIVNQIHPQPQQVVYSSIIHNPGVSLPQHHTIQPQFTLISSDNQNHSQLLSAPLPVGSSNTSAHIINPVAVAHPNPSQNQQYTISQQPPVGMSIFSVATPCSLLSASPTTAEVMHSFQQQQMRSFDQKDQACIVQKGIQPNTNLDITMNDNSHINSTLTPIYIQHNLPSTVPVTQYRVTALETTTTPGLVIHNALDPNNLQLLQTTNTSNNPPDRVITSSNVNIDHKSKFNMMKKSPEKNKTDQYSQIMEENEQLKRKLMDLQKQTNDLQTANELLLDQNARLRNFKTCCNVQTNNIPLDSKSNSIDTEDRSHISLNQIFSNPISNQSLISKQSEAVSNSMSEMATITLTVPIGITHSNPSIDHSSTGSNSLASHNNELIVNKLKIPNAEISYLRSNNDESVYKSVCTTTECTDYISPTLVSSALRSIQKSVMPTLHALVASSNVIKSEDYSLXXXXXXXXXXXXXXXXXXSFKMDNNCNESGNIEIPMRSSSCPVTCTYKSVPEQTIKCHESTSSTKVCCLRLSNFNQTPQLCFQ 3269
            K  QN  D FKSTEDYTADCETYDFMSDGQKEEIEFSPQLKKSSNYQDSYEALKSDFSQLLNDEESNSEYVCRDFIRNICRRGRKCKFKHPTSVKRPWPAKIETPNNPGQFEVNFCHDYQNHGCNRPQCRFIHCNRPEQEFYYATGILLSSVFCNNIQVPYCKDYLNNACTRIKCKFLHLTKDEI+QQNKNQEAVNNQAADYGNFPHQSSMEQNVIQPLPGTNANFYSNYHDHYPSSQQM+VMPSQTISIGNSLPLTNAQFTVSLPLGSVSYSTSQQQLIAQPSLTNVQYIHDPILSSVTHEVGSINSDVLTQLPVSNQHNIVNQIHPQPQQVVYSSIIHNPGVSLPQHHTIQPQFTLISSDNQNHSQLLSAPLPVGSSNTSAHIINPVAVAHPNPSQNQQYTISQQPPVGMSIFSVATPCSLLSASPTTAEVMHSFQQQQMRSFDQKDQACIVQKGIQPNTNLDITMNDNSHINSTLTPIYIQHNLPSTVPVTQYRVTALETTTTPGLVIHNALDPNNLQLLQTTNTSNNPPDRVITSSNVNIDHKSKFNMMKKSPEKNKTDQYSQIMEENEQLKRKLMDLQKQTNDLQTANELLLDQNARLRNFKTCCNVQTNNIPLDSKSNSIDTEDRSHISLNQIFSNPISNQSLISKQSEAVSNSMSEMATITLTVPIGITHSNPSIDHSSTGSNSLASHNNELIVNKLKIPNAEISYLRSNNDESVYKSVCTTTECTDYISPTLVSSALRSIQKSVMPTLHALVASSNVIKSEDYSL    +Q Q+QQQ+QQQQQSFKMDNNCNESGNIEIPMRSSSCPVTCTYKSVPEQTIKCHESTSSTKVCCLRLSNFN TPQLCFQ
Sbjct:   12 KNHQNSTDGFKSTEDYTADCETYDFMSDGQKEEIEFSPQLKKSSNYQDSYEALKSDFSQLLNDEESNSEYVCRDFIRNICRRGRKCKFKHPTSVKRPWPAKIETPNNPGQFEVNFCHDYQNHGCNRPQCRFIHCNRPEQEFYYATGILLSSVFCNNIQVPYCKDYLNNACTRIKCKFLHLTKDEIDQQNKNQEAVNNQAADYGNFPHQSSMEQNVIQPLPGTNANFYSNYHDHYPSSQQMNVMPSQTISIGNSLPLTNAQFTVSLPLGSVSYSTSQQQLIAQPSLTNVQYIHDPILSSVTHEVGSINSDVLTQLPVSNQHNIVNQIHPQPQQVVYSSIIHNPGVSLPQHHTIQPQFTLISSDNQNHSQLLSAPLPVGSSNTSAHIINPVAVAHPNPSQNQQYTISQQPPVGMSIFSVATPCSLLSASPTTAEVMHSFQQQQMRSFDQKDQACIVQKGIQPNTNLDITMNDNSHINSTLTPIYIQHNLPSTVPVTQYRVTALETTTTPGLVIHNALDPNNLQLLQTTNTSNNPPDRVITSSNVNIDHKSKFNMMKKSPEKNKTDQYSQIMEENEQLKRKLMDLQKQTNDLQTANELLLDQNARLRNFKTCCNVQTNNIPLDSKSNSIDTEDRSHISLNQIFSNPISNQSLISKQSEAVSNSMSEMATITLTVPIGITHSNPSIDHSSTGSNSLASHNNELIVNKLKIPNAEISYLRSNNDESVYKSVCTTTECTDYISPTLVSSALRSIQKSVMPTLHALVASSNVIKSEDYSL----KQHQQQQQKQQQQQSFKMDNNCNESGNIEIPMRSSSCPVTCTYKSVPEQTIKCHESTSSTKVCCLRLSNFNPTPQLCFQ 863          
BLAST of Zinc finger CCCH domain-containing protein 10 vs. Planmine SMEST
Match: SMESG000014878.1 (SMESG000014878.1)

HSP 1 Score: 119.013 bits (297), Expect = 2.269e-30
Identity = 61/82 (74.39%), Postives = 66/82 (80.49%), Query Frame = 3
Query:  702 KKPQNRADSFKSTEDYTADCETYDFMSDGQKEEIEFSPQLKKSSNYQDSYEALKSDFSQLLNDEESNSEYVCRDFIRNICRR 947
            K  QN  D FK+TE+YTADCETYD MSDGQKEEIEFSPQL KSSNYQDS EALKSDFSQLLNDEESNS++       NI R+
Sbjct:   18 KNHQNSTDGFKNTENYTADCETYDLMSDGQKEEIEFSPQLTKSSNYQDSNEALKSDFSQLLNDEESNSKFT------NIVRK 93          
BLAST of Zinc finger CCCH domain-containing protein 10 vs. Planmine SMEST
Match: SMESG000019968.1 (SMESG000019968.1)

HSP 1 Score: 48.521 bits (114), Expect = 5.208e-11
Identity = 27/55 (49.09%), Postives = 34/55 (61.82%), Query Frame = 1
Query:  250 LICCAWSLSSMFVN*EKSIDSLIVFFFKNKYFKSFLEGMTEKTVDKRVLNSYEIC 414
            LI  +WSLSS F N  KS+D L+    KN Y KSFL  M ++TVDK + N  + C
Sbjct:    5 LIYRSWSLSSTFANSVKSVDKLVELLIKNGYSKSFLLLMIKETVDKLIKNLKDPC 59          

HSP 2 Score: 39.6614 bits (91), Expect = 5.208e-11
Identity = 25/68 (36.76%), Postives = 36/68 (52.94%), Query Frame = 2
Query:  467 MEPKY-------EGFREFKHKIIKTVEKTQFRIVSIFCKVSNISTNKSITTFFLF*IRVLIFK*WCGG 649
            +EPKY       EGF  +K K+ K +   +++IVS  CKV N+  NKS T   L     L+++  C G
Sbjct:   87 IEPKYVLVLPYSEGFTNYKRKLSKQMGNLEYKIVSNSCKVGNMFINKSKTPVGL--CSDLVYQFTCNG 152          
BLAST of Zinc finger CCCH domain-containing protein 10 vs. Planmine SMEST
Match: SMESG000007021.1 (SMESG000007021.1)

HSP 1 Score: 49.2914 bits (116), Expect = 5.522e-11
Identity = 30/74 (40.54%), Postives = 40/74 (54.05%), Query Frame = 1
Query:  250 LICCAWSLSSMFVN*EKSIDSLIVFFFKNKYFKSFLEGMTEKTVDKRVLNSYEICADLYGGNVLIDFEISTSYG 471
            LI  +W+LSS F N  KS+D L+    KN Y KSFL  M ++TVDK + N  + C      N+    E+S   G
Sbjct:  194 LIYRSWALSSTFANSVKSVDKLVELLIKNGYSKSFLLLMIKETVDKLIKNPKDPCCGKSECNLSDGCELSVDLG 267          

HSP 2 Score: 38.891 bits (89), Expect = 5.522e-11
Identity = 25/68 (36.76%), Postives = 36/68 (52.94%), Query Frame = 2
Query:  467 MEPKY-------EGFREFKHKIIKTVEKTQFRIVSIFCKVSNISTNKSITTFFLF*IRVLIFK*WCGG 649
            +EPKY       EGF  +K K+ K +   +++IVS  CKV N+  NKS T   L     L+++  C G
Sbjct:  276 IEPKYVLVLPYSEGFTNYKRKLGKLIGNLEYKIVSNSCKVRNMFINKSKTPVGL--CSDLVYQFTCNG 341          
BLAST of Zinc finger CCCH domain-containing protein 10 vs. Planmine SMEST
Match: SMESG000019968.1 (SMESG000019968.1)

HSP 1 Score: 48.1358 bits (113), Expect = 5.558e-11
Identity = 27/55 (49.09%), Postives = 34/55 (61.82%), Query Frame = 1
Query:  250 LICCAWSLSSMFVN*EKSIDSLIVFFFKNKYFKSFLEGMTEKTVDKRVLNSYEIC 414
            LI  +WSLSS F N  KS+D L+    KN Y KSFL  M ++TVDK + N  + C
Sbjct:    5 LIYRSWSLSSTFANSVKSVDKLVELLIKNGYSKSFLLLMIKETVDKLIKNLKDPC 59          

HSP 2 Score: 39.6614 bits (91), Expect = 5.558e-11
Identity = 25/68 (36.76%), Postives = 36/68 (52.94%), Query Frame = 2
Query:  467 MEPKY-------EGFREFKHKIIKTVEKTQFRIVSIFCKVSNISTNKSITTFFLF*IRVLIFK*WCGG 649
            +EPKY       EGF  +K K+ K +   +++IVS  CKV N+  NKS T   L     L+++  C G
Sbjct:   87 IEPKYVLVLPYSEGFTNYKRKLSKQMGNLEYKIVSNSCKVGNMFINKSKTPVGL--CSDLVYQFTCNG 152          
The following BLAST results are available for this feature:
BLAST of Zinc finger CCCH domain-containing protein 10 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ZC3H107.895e-2037.59zinc finger CCCH-type containing 10 [Source:HGNC S... [more]
ZC3H109.784e-737.93zinc finger CCCH-type containing 10 [Source:HGNC S... [more]
back to top
BLAST of Zinc finger CCCH domain-containing protein 10 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Y53G8AR.94.027e-1636.57pep chromosome:WBcel235:III:3317737:3321245:-1 gen... [more]
back to top
BLAST of Zinc finger CCCH domain-containing protein 10 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Zinc finger CCCH domain-containing protein 10 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
zc3h107.353e-2138.76zinc finger CCCH-type containing 10 [Source:ZFIN;A... [more]
zc3h107.353e-2138.76zinc finger CCCH-type containing 10 [Source:ZFIN;A... [more]
back to top
BLAST of Zinc finger CCCH domain-containing protein 10 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
gpr1769.385e-2139.23G protein-coupled receptor 176 [Source:Xenbase;Acc... [more]
back to top
BLAST of Zinc finger CCCH domain-containing protein 10 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Zc3h106.857e-2037.59zinc finger CCCH type containing 10 [Source:MGI Sy... [more]
Zc3h102.398e-1541.25zinc finger CCCH type containing 10 [Source:MGI Sy... [more]
back to top
BLAST of Zinc finger CCCH domain-containing protein 10 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 2
Match NameE-valueIdentityDescription
sp|Q96K80|ZC3HA_HUMAN3.791e-1937.59Zinc finger CCCH domain-containing protein 10 OS=H... [more]
sp|Q8R205|ZC3HA_MOUSE4.796e-1937.59Zinc finger CCCH domain-containing protein 10 OS=M... [more]
back to top
BLAST of Zinc finger CCCH domain-containing protein 10 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A423TH253.726e-2643.48Zinc finger CCCH domain-containing protein 10 (Fra... [more]
A0A087TFB72.055e-2536.55Zinc finger CCCH domain-containing protein 10 (Fra... [more]
A0A2J7QG939.218e-2542.76Zinc finger CCCH domain-containing protein 10 OS=C... [more]
A0A210PFY51.757e-2433.84Zinc finger CCCH domain-containing protein 10 OS=M... [more]
A0A4Y2NB935.015e-2437.50Zinc finger CCCH domain-containing protein 10 OS=A... [more]
back to top
BLAST of Zinc finger CCCH domain-containing protein 10 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
zc3h102.451e-1938.76zinc finger CCCH-type containing 10 [Source:NCBI g... [more]
back to top
BLAST of Zinc finger CCCH domain-containing protein 10 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
zc3h102.768e-2136.09zinc finger CCCH-type containing 10 [Source:ZFIN;A... [more]
back to top
BLAST of Zinc finger CCCH domain-containing protein 10 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Zinc finger CCCH domain-containing protein 10 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO411949.434e-1532.14Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Zinc finger CCCH domain-containing protein 10 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
zc3h103.085e-2135.81zinc finger CCCH-type containing 10 [Source:NCBI g... [more]
back to top
BLAST of Zinc finger CCCH domain-containing protein 10 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000042104.10.000e+098.13SMESG000042104.1[more]
SMESG000014878.12.269e-3074.39SMESG000014878.1[more]
SMESG000019968.15.208e-1149.09SMESG000019968.1[more]
SMESG000007021.15.522e-1140.54SMESG000007021.1[more]
SMESG000019968.15.558e-1149.09SMESG000019968.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30009681 ID=SMED30009681|Name=Zinc finger CCCH domain-containing protein 10|organism=Schmidtea mediterranea sexual|type=transcript|length=3661bp
CATAATTCCTAAGGAATGTCACAAAAATATGATGCCATTTCTTTGGGGCA
CTTGGACTACGTTTTTGTTGAAATTCCTAGAATCACAAAATGTTTGAAAA
TAATAAAAACAAATAAAAATAGTAAATTAGTAAAGGCGAAAAAATGAAAT
AAATAATTATTATTAAATAAACCAAATAAATAAAATAAATAAAGTTAAAT
TAAAAAAAAACAGCTAAGTATGTTCTCTCGTATAGTGTGAGAGGATTGGT
TGATATGTTGTGCGTGGTCTTTATCATCTATGTTTGTTAATTAAGAGAAA
AGTATTGATTCTTTGATTGTGTTCTTTTTTAAAAATAAATATTTCAAATC
TTTTCTTGAGGGTATGACAGAAAAGACTGTTGATAAAAGAGTTTTAAATT
CTTACGAAATTTGTGCTGATTTGTATGGTGGTAATGTTCTAATTGATTTT
GAAATCAGTACATCATATGGAGCCAAAATATGAAGGTTTCAGAGAATTTA
AACACAAGATCATCAAAACTGTAGAGAAAACTCAGTTTAGGATTGTTTCG
ATTTTCTGCAAAGTTAGTAATATATCAACTAATAAGTCCATAACTACATT
TTTTTTGTTCTGAATTCGTGTTTTAATTTTCAAGTAATGGTGTGGTGGAC
TAATTAAGAACCAAAACCCATCCGATGGAAATATCCATCGCAAATTGATA
GAAAAAGCCTCAGAATAGAGCAGACAGTTTTAAAAGTACAGAAGACTATA
CAGCTGATTGTGAAACATATGATTTTATGAGCGATGGCCAGAAGGAAGAA
ATCGAATTTTCACCCCAATTAAAAAAGTCATCAAATTATCAAGATTCTTA
TGAAGCTCTTAAAAGTGATTTTTCTCAGCTATTAAATGATGAAGAATCTA
ATTCTGAGTATGTATGCCGTGATTTTATAAGAAATATTTGTCGTAGAGGA
CGCAAATGCAAGTTCAAACACCCTACATCTGTTAAAAGACCATGGCCTGC
AAAAATTGAAACGCCTAATAATCCAGGTCAGTTTGAAGTAAATTTTTGTC
ACGATTATCAAAATCATGGTTGTAATCGTCCCCAATGTCGATTTATTCAC
TGTAACAGGCCAGAACAGGAATTTTATTATGCCACGGGAATTTTGCTTTC
AAGTGTTTTCTGTAATAACATTCAAGTTCCATATTGCAAAGATTATTTAA
ATAACGCTTGTACACGAATCAAATGCAAATTTTTACACTTGACAAAAGAT
GAAATTGAGCAGCAAAATAAAAATCAAGAAGCTGTGAATAATCAAGCAGC
TGATTATGGTAATTTTCCTCATCAATCATCAATGGAACAAAATGTTATTC
AACCTTTACCTGGTACAAATGCAAATTTCTATTCAAATTACCACGACCAT
TACCCGTCCTCTCAACAAATGAGTGTTATGCCTTCACAGACAATATCAAT
TGGAAATAGTTTACCCTTAACAAATGCACAATTTACAGTTTCGTTACCCC
TTGGATCTGTTTCATATTCTACTTCACAACAACAGCTAATAGCACAGCCT
AGTTTAACCAATGTTCAATATATTCACGATCCTATTCTCAGTTCTGTAAC
TCACGAAGTCGGATCCATAAATTCTGATGTTTTGACTCAACTTCCCGTAT
CTAATCAGCATAATATTGTCAATCAGATTCATCCCCAACCGCAACAGGTG
GTTTACAGCAGCATTATTCACAATCCTGGAGTGTCCTTGCCTCAACATCA
TACAATCCAACCACAATTCACTCTAATTTCATCGGATAACCAAAACCATT
CTCAATTGTTATCGGCTCCTTTACCGGTTGGCAGCAGTAACACTTCAGCC
CATATCATTAATCCAGTTGCCGTGGCTCATCCTAATCCTAGTCAGAATCA
ACAATATACAATTAGCCAGCAACCTCCTGTAGGAATGTCTATATTCTCTG
TTGCTACTCCATGCTCATTGCTATCTGCATCTCCAACAACAGCCGAAGTC
ATGCATTCATTTCAACAACAGCAAATGAGGTCATTCGATCAAAAAGACCA
AGCTTGTATTGTTCAAAAAGGTATTCAACCCAACACAAATCTTGATATAA
CCATGAATGATAACAGCCACATAAATTCAACCCTAACCCCAATATATATC
CAACACAACTTGCCATCTACAGTCCCCGTTACACAGTATCGAGTAACAGC
ATTAGAAACAACTACAACTCCTGGATTAGTTATCCACAATGCTCTTGATC
CAAATAATTTGCAATTACTTCAAACAACAAACACATCAAATAATCCTCCC
GATCGAGTTATTACTTCTTCCAATGTTAATATTGATCACAAATCCAAATT
TAATATGATGAAGAAGTCCCCAGAAAAAAACAAAACCGATCAATATTCAC
AGATAATGGAAGAAAATGAACAGTTGAAACGGAAATTAATGGATCTGCAA
AAGCAGACCAATGACCTTCAAACGGCAAATGAATTACTATTGGATCAAAA
TGCTCGATTGAGAAATTTCAAAACCTGCTGTAACGTACAGACAAATAATA
TTCCATTGGACTCCAAATCTAATTCTATTGATACTGAAGATCGGTCTCAT
ATTTCCCTCAACCAGATCTTTTCCAATCCAATCAGCAATCAATCTCTGAT
ATCTAAACAAAGTGAAGCTGTTTCTAATTCGATGTCAGAAATGGCTACTA
TAACATTAACCGTTCCAATAGGAATAACCCACAGCAACCCATCAATCGAT
CATTCTTCAACTGGATCTAATTCATTGGCCTCTCATAACAATGAACTCAT
CGTTAACAAATTGAAAATACCTAATGCTGAAATCAGTTATTTGCGTTCTA
ATAACGATGAATCGGTTTACAAAAGCGTCTGCACGACAACCGAATGTACT
GATTACATATCCCCGACTCTTGTGTCCAGTGCTCTGAGAAGTATTCAAAA
ATCAGTTATGCCGACTTTGCACGCTCTTGTAGCTTCATCAAACGTAATTA
AATCCGAAGATTATTCCTTGAAACAGCATCAGCAGCAACAACAGAAACAA
CAACAACAACAGCAACAGCAGCAGTCATTTAAAATGGATAATAATTGCAA
TGAATCTGGAAATATAGAAATACCTATGAGGTCTTCTTCATGTCCCGTTA
CCTGTACCTATAAGTCAGTACCGGAACAAACGATTAAGTGTCACGAATCC
ACTTCGTCAACTAAAGTCTGTTGTTTACGGCTTAGCAATTTCAATCAAAC
TCCACAACTCTGTTTTCAATAACTCTAATAATAATTATATTTATTGTGCT
TTTCATTGTGTTTTTGCGGTCGATATTATTGAATTAAATGTGCTTTTGTG
ATTTGAAAATCTAATAAAAGATTGTATTATTGGTGATTGTTTGAGCAATT
ATTATTTTATTGTTTTATTCATGCTTGCATAAATTTTTGGTTTTGTTATT
TAAATATCAATTATCTTTTATTATTAGCCAATTAAATACGTTTGCTTGAT
TTTCGGCAACAAAGACTAAAAAGTTCTGATCTTTTAATTTCATAGCTTAA
TATTATTATTATTTATATTACTATTACTATTACTATTTCATGTATATATA
TATATCACAATGCATTATGTAATCACTGGCAATTTCAATAAATAAAAGTG
ATAATAGAGGC
back to top

protein sequence of SMED30009681-orf-1

>SMED30009681-orf-1 ID=SMED30009681-orf-1|Name=SMED30009681-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=832bp
MSDGQKEEIEFSPQLKKSSNYQDSYEALKSDFSQLLNDEESNSEYVCRDF
IRNICRRGRKCKFKHPTSVKRPWPAKIETPNNPGQFEVNFCHDYQNHGCN
RPQCRFIHCNRPEQEFYYATGILLSSVFCNNIQVPYCKDYLNNACTRIKC
KFLHLTKDEIEQQNKNQEAVNNQAADYGNFPHQSSMEQNVIQPLPGTNAN
FYSNYHDHYPSSQQMSVMPSQTISIGNSLPLTNAQFTVSLPLGSVSYSTS
QQQLIAQPSLTNVQYIHDPILSSVTHEVGSINSDVLTQLPVSNQHNIVNQ
IHPQPQQVVYSSIIHNPGVSLPQHHTIQPQFTLISSDNQNHSQLLSAPLP
VGSSNTSAHIINPVAVAHPNPSQNQQYTISQQPPVGMSIFSVATPCSLLS
ASPTTAEVMHSFQQQQMRSFDQKDQACIVQKGIQPNTNLDITMNDNSHIN
STLTPIYIQHNLPSTVPVTQYRVTALETTTTPGLVIHNALDPNNLQLLQT
TNTSNNPPDRVITSSNVNIDHKSKFNMMKKSPEKNKTDQYSQIMEENEQL
KRKLMDLQKQTNDLQTANELLLDQNARLRNFKTCCNVQTNNIPLDSKSNS
IDTEDRSHISLNQIFSNPISNQSLISKQSEAVSNSMSEMATITLTVPIGI
THSNPSIDHSSTGSNSLASHNNELIVNKLKIPNAEISYLRSNNDESVYKS
VCTTTECTDYISPTLVSSALRSIQKSVMPTLHALVASSNVIKSEDYSLKQ
HQQQQQKQQQQQQQQQSFKMDNNCNESGNIEIPMRSSSCPVTCTYKSVPE
QTIKCHESTSSTKVCCLRLSNFNQTPQLCFQ*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR000571Znf_CCCH
Vocabulary: molecular function
TermDefinition
GO:0046872metal ion binding