TNF receptor-associated factor

Overview
NameTNF receptor-associated factor
Smed IDSMED30009675
Length (bp)1061
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of TNF receptor-associated factor (SMED30009675) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for TNF receptor-associated factor (SMED30009675) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30009675

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30009675SMESG000054989.1 SmedASXL_012269SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
epidermal cellSMED30009675SMESG000054989.1 dd_Smed_v4_8127_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30009675SMESG000054989.1 dd_Smed_v6_8127_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30009675SMESG000054989.1 dd_Smed_v4_8127_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30009675SMESG000054989.1 dd_Smed_v4_8127_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of TNF receptor-associated factor vs. Ensembl Human
Match: TRAF3 (TNF receptor associated factor 3 [Source:HGNC Symbol;Acc:HGNC:12033])

HSP 1 Score: 133.65 bits (335), Expect = 1.740e-34
Identity = 70/183 (38.25%), Postives = 105/183 (57.38%), Query Frame = 1
Query:  514 DQSSSTQELERISNDIKF--LKNSIYNLKTVQKLPRSGKLIWKIENAK-----LFFENQIPLMSPQVYTSDYGYKLCLKAYPNGDGIGMGSHLSLYFAILKGEYDDLLAWPFRCKVKILLFNKDFKNRSKYEIYKPD-ESRAFQQPENESNIATGNPKFITLEAVQNNGFIIDNSIFIELYVD 1038
            DQ  S  ++     D++F  L+ + YN          G LIWKI + K           + L S   YT  +GYK+C + Y NGDG+G G+HLSL+F I++GEYD LL WPF+ KV ++L ++    R   + +KPD  S +F++P  E NIA+G P F+    ++N  +I D++IFI++ VD
Sbjct:  306 DQMLSVHDIRLADMDLRFQVLETASYN----------GVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPDPNSSSFKKPTGEMNIASGCPVFVAQTVLENGTYIKDDTIFIKVIVD 478          
BLAST of TNF receptor-associated factor vs. Ensembl Human
Match: TRAF3 (TNF receptor associated factor 3 [Source:HGNC Symbol;Acc:HGNC:12033])

HSP 1 Score: 134.035 bits (336), Expect = 2.616e-34
Identity = 70/183 (38.25%), Postives = 105/183 (57.38%), Query Frame = 1
Query:  514 DQSSSTQELERISNDIKF--LKNSIYNLKTVQKLPRSGKLIWKIENAK-----LFFENQIPLMSPQVYTSDYGYKLCLKAYPNGDGIGMGSHLSLYFAILKGEYDDLLAWPFRCKVKILLFNKDFKNRSKYEIYKPD-ESRAFQQPENESNIATGNPKFITLEAVQNNGFIIDNSIFIELYVD 1038
            DQ  S  ++     D++F  L+ + YN          G LIWKI + K           + L S   YT  +GYK+C + Y NGDG+G G+HLSL+F I++GEYD LL WPF+ KV ++L ++    R   + +KPD  S +F++P  E NIA+G P F+    ++N  +I D++IFI++ VD
Sbjct:  364 DQMLSVHDIRLADMDLRFQVLETASYN----------GVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPDPNSSSFKKPTGEMNIASGCPVFVAQTVLENGTYIKDDTIFIKVIVD 536          
BLAST of TNF receptor-associated factor vs. Ensembl Human
Match: TRAF3 (TNF receptor associated factor 3 [Source:HGNC Symbol;Acc:HGNC:12033])

HSP 1 Score: 134.035 bits (336), Expect = 2.616e-34
Identity = 70/183 (38.25%), Postives = 105/183 (57.38%), Query Frame = 1
Query:  514 DQSSSTQELERISNDIKF--LKNSIYNLKTVQKLPRSGKLIWKIENAK-----LFFENQIPLMSPQVYTSDYGYKLCLKAYPNGDGIGMGSHLSLYFAILKGEYDDLLAWPFRCKVKILLFNKDFKNRSKYEIYKPD-ESRAFQQPENESNIATGNPKFITLEAVQNNGFIIDNSIFIELYVD 1038
            DQ  S  ++     D++F  L+ + YN          G LIWKI + K           + L S   YT  +GYK+C + Y NGDG+G G+HLSL+F I++GEYD LL WPF+ KV ++L ++    R   + +KPD  S +F++P  E NIA+G P F+    ++N  +I D++IFI++ VD
Sbjct:  364 DQMLSVHDIRLADMDLRFQVLETASYN----------GVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPDPNSSSFKKPTGEMNIASGCPVFVAQTVLENGTYIKDDTIFIKVIVD 536          
BLAST of TNF receptor-associated factor vs. Ensembl Human
Match: TRAF3 (TNF receptor associated factor 3 [Source:HGNC Symbol;Acc:HGNC:12033])

HSP 1 Score: 134.035 bits (336), Expect = 2.662e-34
Identity = 70/183 (38.25%), Postives = 105/183 (57.38%), Query Frame = 1
Query:  514 DQSSSTQELERISNDIKF--LKNSIYNLKTVQKLPRSGKLIWKIENAK-----LFFENQIPLMSPQVYTSDYGYKLCLKAYPNGDGIGMGSHLSLYFAILKGEYDDLLAWPFRCKVKILLFNKDFKNRSKYEIYKPD-ESRAFQQPENESNIATGNPKFITLEAVQNNGFIIDNSIFIELYVD 1038
            DQ  S  ++     D++F  L+ + YN          G LIWKI + K           + L S   YT  +GYK+C + Y NGDG+G G+HLSL+F I++GEYD LL WPF+ KV ++L ++    R   + +KPD  S +F++P  E NIA+G P F+    ++N  +I D++IFI++ VD
Sbjct:  389 DQMLSVHDIRLADMDLRFQVLETASYN----------GVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPDPNSSSFKKPTGEMNIASGCPVFVAQTVLENGTYIKDDTIFIKVIVD 561          
BLAST of TNF receptor-associated factor vs. Ensembl Human
Match: TRAF3 (TNF receptor associated factor 3 [Source:HGNC Symbol;Acc:HGNC:12033])

HSP 1 Score: 134.035 bits (336), Expect = 2.662e-34
Identity = 70/183 (38.25%), Postives = 105/183 (57.38%), Query Frame = 1
Query:  514 DQSSSTQELERISNDIKF--LKNSIYNLKTVQKLPRSGKLIWKIENAK-----LFFENQIPLMSPQVYTSDYGYKLCLKAYPNGDGIGMGSHLSLYFAILKGEYDDLLAWPFRCKVKILLFNKDFKNRSKYEIYKPD-ESRAFQQPENESNIATGNPKFITLEAVQNNGFIIDNSIFIELYVD 1038
            DQ  S  ++     D++F  L+ + YN          G LIWKI + K           + L S   YT  +GYK+C + Y NGDG+G G+HLSL+F I++GEYD LL WPF+ KV ++L ++    R   + +KPD  S +F++P  E NIA+G P F+    ++N  +I D++IFI++ VD
Sbjct:  389 DQMLSVHDIRLADMDLRFQVLETASYN----------GVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPDPNSSSFKKPTGEMNIASGCPVFVAQTVLENGTYIKDDTIFIKVIVD 561          
BLAST of TNF receptor-associated factor vs. Ensembl Celegans
Match: trf-1 (TNF Receptor Associated Factor (TRAF) homolog; TRF-1 [Source:UniProtKB/TrEMBL;Acc:G5EG80])

HSP 1 Score: 96.6709 bits (239), Expect = 5.417e-22
Identity = 89/341 (26.10%), Postives = 143/341 (41.94%), Query Frame = 1
Query:   91 SKFNCSQCEESFYVEDLCEHSSKCAFNKSLMKESNGLCKYCYKMVSCPEGEHIHLTQFKPPECESFRANCP-NCKLND---VKIKEHFNLCPNKPKKCNLAKLGCNGKIIPDSILCTLGDGHKNLINSYFRKISMKISDITKVDFDQSSSTQELERISNDIKFLKNSIYNLKTVQKLPRSGKLIWKIE-------NAKLFFENQI---PLMSPQVYTSDYGYKLCLKAYPNGDGIGMGSHLSLYFAILKGEYDDLLAWPFRCKVKILLFNKDFKNRSKYEIYKPDESRAFQ-------QPENESNIATGNPKFITLEAVQNNGFIIDNSIFIELYVDQKKT 1050
            S   C +C   F   DL +H +KC  N+++       C +C K +   + E        P  C     +CP  C L D   ++I+ H   CPN    C     GC      +SI        ++L +   R +     +IT    D   + + +ER        +  I +           +LIWKI+        AK   +  I   P MS +     +GYK+   A   GDG   G  +SLY  +LKGE+D  L WPF   +KI L +++ +   +  I    + R  +       +P  E N A G+  F +L  +QN  ++ D+ I++++ VD+ +T
Sbjct:  107 SSLKCEKCGRQFAKNDLEKHRAKCELNRAV-------CSFCNKTIRDSDRER------HPKTCPQVIISCPFQCGLTDRPRLEIEAHCPSCPNVDNVCPFVPYGCTFAGGKESI-------QQHLSDEPVRHLMYLCDEIT----DLKGTYELMERDMGSFNDRQTRILSAAETCTEMFGPQLIWKIDKLQQRTNEAKSGADTTIFSVPFMSHR-----FGYKMMACACLFGDGSSAGKSISLYVLLLKGEFDPTLEWPFHRAIKISLLDQNPRPEDRVNITYVIDPRKLKANEKFLARPRGERNAAFGSQSFCSLAILQN--YVKDDKIYVQIDVDRCET 416          
BLAST of TNF receptor-associated factor vs. Ensembl Celegans
Match: trf-2 (TNF Receptor Associated Factor (TRAF) homolog [Source:UniProtKB/TrEMBL;Acc:Q9N586])

HSP 1 Score: 76.6406 bits (187), Expect = 1.587e-15
Identity = 41/117 (35.04%), Postives = 59/117 (50.43%), Query Frame = 1
Query:  694 YTSDYGYKLCLKAYPNGDGIGMGSHLSLYFAILKGEYDDLLAWPFRCKVKILLFNKDFKNRSKYEIY---KPDESRAFQQPENESNIATGNPKFITLEAVQNNGFIIDNSIFIELYV 1035
            Y+  YGYK+   A P GDG+    + S++  ++KGE+DD+L WPFRC V   + + D K      IY    P+     ++PE   N   G   F+ L  V    F  D  IFI++ V
Sbjct:  189 YSHGYGYKMMAVAAPYGDGLAFREYFSVFVCLMKGEWDDILEWPFRCDVTFSILSDDKKELLTKTIYVNEMPEIQEFLERPEGLRNGTFGFQNFLPLAKVTE--FAADGDIFIQIKV 303          
BLAST of TNF receptor-associated factor vs. Ensembl Fly
Match: Traf4 (gene:FBgn0026319 transcript:FBtr0334401)

HSP 1 Score: 105.531 bits (262), Expect = 6.595e-25
Identity = 89/321 (27.73%), Postives = 151/321 (47.04%), Query Frame = 1
Query:  166 FNKSLMKESNGLC--KYCYKMVSCPEGEHI---HLTQFKPPECESFRANCPNCK--LNDVKIKEHFNLCPNKPKKCNLAKLGCNGKIIPDSIL-CTLGDGHKNL-INSYFRKISMKISDITKV--DFDQSSSTQELE-------RISNDIKFLKNSIYNLKTVQKLPRSGKLIWKIEN-----AKLFFENQIPLMSPQVYTSDYGYKLCLKAYPNGDGIGMGSHLSLYFAILKGEYDDLLAWPFRCKVKILLFNKDFKNRSK--YEIYKPDES-RAFQQPENESN-IATGNPKFITLEAVQNNGFIIDNSIFIELYVDQKK 1047
            F+ + ++E NG C  +  Y    C  G+ I    +T  K  +C      C +C+   +   +  H   CP  P  C      C+   IP   L   L D  ++L ++  F++   +     ++     +S++   L        R    I+ LK+++  L     +  +G L+WKI +     A+   ++ + L+SP  YTS YGYKL    + NG+G G  +H+S+Y  +L GEYD LL WPF   +   LF +  ++      E + PD +   FQ+P NE + +  G P+FI+ E + +  FI  +++F+ + VD  K
Sbjct:  162 FSGAGLEEHNGSCGQEPVYCEAKC--GQRILRGRMTLHKSKDCAKRLRRCAHCQREFSADTLPLHAAQCPRAPLACPQR---CDAGPIPRGELEAHLRDECQSLAVSCSFKEAGCRFKGPRQMLEAHLESNAAAHLSLMVALSSRQGQQIQMLKSAVSKLS----INYTGTLLWKITDWSAKMAEARGKDGLELVSPPFYTSQYGYKLQASMFLNGNGPGENTHVSVYIKVLPGEYDALLKWPFSHSITFTLFEQGAQSGQGGVAESFVPDPTWENFQRPSNEPDQLGFGFPRFISHELLHSRPFIKGDTVFLRVKVDPSK 473          
BLAST of TNF receptor-associated factor vs. Ensembl Fly
Match: Traf4 (gene:FBgn0026319 transcript:FBtr0077429)

HSP 1 Score: 105.145 bits (261), Expect = 9.332e-25
Identity = 89/321 (27.73%), Postives = 151/321 (47.04%), Query Frame = 1
Query:  166 FNKSLMKESNGLC--KYCYKMVSCPEGEHI---HLTQFKPPECESFRANCPNCK--LNDVKIKEHFNLCPNKPKKCNLAKLGCNGKIIPDSIL-CTLGDGHKNL-INSYFRKISMKISDITKV--DFDQSSSTQELE-------RISNDIKFLKNSIYNLKTVQKLPRSGKLIWKIEN-----AKLFFENQIPLMSPQVYTSDYGYKLCLKAYPNGDGIGMGSHLSLYFAILKGEYDDLLAWPFRCKVKILLFNKDFKNRSK--YEIYKPDES-RAFQQPENESN-IATGNPKFITLEAVQNNGFIIDNSIFIELYVDQKK 1047
            F+ + ++E NG C  +  Y    C  G+ I    +T  K  +C      C +C+   +   +  H   CP  P  C      C+   IP   L   L D  ++L ++  F++   +     ++     +S++   L        R    I+ LK+++  L     +  +G L+WKI +     A+   ++ + L+SP  YTS YGYKL    + NG+G G  +H+S+Y  +L GEYD LL WPF   +   LF +  ++      E + PD +   FQ+P NE + +  G P+FI+ E + +  FI  +++F+ + VD  K
Sbjct:  171 FSGAGLEEHNGSCGQEPVYCEAKC--GQRILRGRMTLHKSKDCAKRLRRCAHCQREFSADTLPLHAAQCPRAPLACPQR---CDAGPIPRGELEAHLRDECQSLAVSCSFKEAGCRFKGPRQMLEAHLESNAAAHLSLMVALSSRQGQQIQMLKSAVSKLS----INYTGTLLWKITDWSAKMAEARGKDGLELVSPPFYTSQYGYKLQASMFLNGNGPGENTHVSVYIKVLPGEYDALLKWPFSHSITFTLFEQGAQSGQGGVAESFVPDPTWENFQRPSNEPDQLGFGFPRFISHELLHSRPFIKGDTVFLRVKVDPSK 482          
BLAST of TNF receptor-associated factor vs. Ensembl Fly
Match: Traf-like (gene:FBgn0030748 transcript:FBtr0074275)

HSP 1 Score: 56.6102 bits (135), Expect = 1.710e-8
Identity = 40/143 (27.97%), Postives = 68/143 (47.55%), Query Frame = 1
Query:  619 GKLIWKIENAKLFFEN----QIPLMSPQVYTSDYGYKLCLKAYPNGDGIGMGSHLSLYFAILKGEYDDLLAWPFRCKVKILLFNKDFKNRSKYEIYKPDESRAFQQPENESNIATGNPKFITLEAVQNNGFIIDNSIFIELYV 1035
            G LIW+I++     E        L S       +GY L L  Y NG G   G ++     +L GEYD LLAWP R + +I++ ++   N +  E Y       F + +++  I +     I  + + +  ++ ++S+FIE+ V
Sbjct:  334 GHLIWRIKDYSKKLEESKQYDTILHSAMFSNKAFGYALRLDIYLNGKGTWKGRNMIACLNVLSGEYDPLLAWPCRLQAEIIIRDQ-CTNVADAEDYVKT---IFVRKKSDDFIQSNQYFHIPHKVITSRNYLRNDSMFIEVRV 472          
BLAST of TNF receptor-associated factor vs. Ensembl Fly
Match: Traf-like (gene:FBgn0030748 transcript:FBtr0074273)

HSP 1 Score: 55.8398 bits (133), Expect = 2.678e-8
Identity = 40/143 (27.97%), Postives = 68/143 (47.55%), Query Frame = 1
Query:  619 GKLIWKIENAKLFFEN----QIPLMSPQVYTSDYGYKLCLKAYPNGDGIGMGSHLSLYFAILKGEYDDLLAWPFRCKVKILLFNKDFKNRSKYEIYKPDESRAFQQPENESNIATGNPKFITLEAVQNNGFIIDNSIFIELYV 1035
            G LIW+I++     E        L S       +GY L L  Y NG G   G ++     +L GEYD LLAWP R + +I++ ++   N +  E Y       F + +++  I +     I  + + +  ++ ++S+FIE+ V
Sbjct:  312 GHLIWRIKDYSKKLEESKQYDTILHSAMFSNKAFGYALRLDIYLNGKGTWKGRNMIACLNVLSGEYDPLLAWPCRLQAEIIIRDQ-CTNVADAEDYVKT---IFVRKKSDDFIQSNQYFHIPHKVITSRNYLRNDSMFIEVRV 450          
BLAST of TNF receptor-associated factor vs. Ensembl Fly
Match: Traf-like (gene:FBgn0030748 transcript:FBtr0308606)

HSP 1 Score: 55.4546 bits (132), Expect = 3.559e-8
Identity = 40/143 (27.97%), Postives = 68/143 (47.55%), Query Frame = 1
Query:  619 GKLIWKIENAKLFFEN----QIPLMSPQVYTSDYGYKLCLKAYPNGDGIGMGSHLSLYFAILKGEYDDLLAWPFRCKVKILLFNKDFKNRSKYEIYKPDESRAFQQPENESNIATGNPKFITLEAVQNNGFIIDNSIFIELYV 1035
            G LIW+I++     E        L S       +GY L L  Y NG G   G ++     +L GEYD LLAWP R + +I++ ++   N +  E Y       F + +++  I +     I  + + +  ++ ++S+FIE+ V
Sbjct:  255 GHLIWRIKDYSKKLEESKQYDTILHSAMFSNKAFGYALRLDIYLNGKGTWKGRNMIACLNVLSGEYDPLLAWPCRLQAEIIIRDQ-CTNVADAEDYVKT---IFVRKKSDDFIQSNQYFHIPHKVITSRNYLRNDSMFIEVRV 393          
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Match: traf3 (TNF receptor-associated factor 3 [Source:ZFIN;Acc:ZDB-GENE-040801-257])

HSP 1 Score: 130.568 bits (327), Expect = 3.264e-33
Identity = 62/168 (36.90%), Postives = 102/168 (60.71%), Query Frame = 1
Query:  553 NDIKFLKNSIYNLKTVQKLPRSGKLIWKIENAK-----LFFENQIPLMSPQVYTSDYGYKLCLKAYPNGDGIGMGSHLSLYFAILKGEYDDLLAWPFRCKVKILLFNKDFKNRSKYEIYKPD-ESRAFQQPENESNIATGNPKFITLEAVQNNGFIIDNSIFIELYVD 1038
            +D++  +  +  L+ ++    +G LIWKI + K           + L S   YT  +GYK+C + Y NGDG+G G+HLSL+F +++GEYD LL WPF+ KV ++L ++    +   + +KPD  S +F++P  E NIA+G P F+    ++N  +I D++IFI++ VD
Sbjct:  400 HDVRLAEMDL-KLQVLETASFNGTLIWKIRDYKRRKQEAVVSKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVVMRGEYDALLQWPFKQKVTLMLMDQGPARKHLGDAFKPDPSSSSFRRPTGEMNIASGCPLFVAQTVLENGTYIKDDTIFIKVTVD 566          
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Match: traf2b (Tnf receptor-associated factor 2b [Source:ZFIN;Acc:ZDB-GENE-030131-5345])

HSP 1 Score: 123.635 bits (309), Expect = 6.309e-31
Identity = 71/183 (38.80%), Postives = 110/183 (60.11%), Query Frame = 1
Query:  520 SSSTQELERI--SNDIKFLKNSIYNLKTVQKLPRSGKLIWKIENAKLFFENQIP-----LMSPQVYTSDYGYKLCLKAYPNGDGIGMGSHLSLYFAILKGEYDDLLAWPFRCKVKILLFNKDFKNRSK-YEIYKPD-ESRAFQQPENESNIATGNPKFITLEAVQN-NGFIIDNSIFIELYVD 1038
            S+  ++LER   + D++ L  S  +L+ +Q     G  IWKI       ++ +      + SP  Y+S YGYK+CL+ Y NGDG G GSHLSL+F ++KG+YD LL WPF  KV ++L +++  NR    + ++PD  S +FQ+P +E NIA+G P F  L  +   + ++ D++IFI+  VD
Sbjct:  349 SNKVRQLERTLTTRDLQ-LAESEQSLRELQFCTYDGVFIWKIAEFSRRRQDAVAGRAPAMFSPAFYSSKYGYKMCLRLYLNGDGTGRGSHLSLFFVVMKGKYDALLKWPFSQKVTLMLLDQN--NREHIIDAFRPDVSSTSFQRPISEMNIASGCPLFCPLAKLAGKSSYLRDDTIFIKAIVD 528          
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Match: traf2b (Tnf receptor-associated factor 2b [Source:ZFIN;Acc:ZDB-GENE-030131-5345])

HSP 1 Score: 123.635 bits (309), Expect = 6.309e-31
Identity = 71/183 (38.80%), Postives = 110/183 (60.11%), Query Frame = 1
Query:  520 SSSTQELERI--SNDIKFLKNSIYNLKTVQKLPRSGKLIWKIENAKLFFENQIP-----LMSPQVYTSDYGYKLCLKAYPNGDGIGMGSHLSLYFAILKGEYDDLLAWPFRCKVKILLFNKDFKNRSK-YEIYKPD-ESRAFQQPENESNIATGNPKFITLEAVQN-NGFIIDNSIFIELYVD 1038
            S+  ++LER   + D++ L  S  +L+ +Q     G  IWKI       ++ +      + SP  Y+S YGYK+CL+ Y NGDG G GSHLSL+F ++KG+YD LL WPF  KV ++L +++  NR    + ++PD  S +FQ+P +E NIA+G P F  L  +   + ++ D++IFI+  VD
Sbjct:  349 SNKVRQLERTLTTRDLQ-LAESEQSLRELQFCTYDGVFIWKIAEFSRRRQDAVAGRAPAMFSPAFYSSKYGYKMCLRLYLNGDGTGRGSHLSLFFVVMKGKYDALLKWPFSQKVTLMLLDQN--NREHIIDAFRPDVSSTSFQRPISEMNIASGCPLFCPLAKLAGKSSYLRDDTIFIKAIVD 528          
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Match: traf2b (Tnf receptor-associated factor 2b [Source:ZFIN;Acc:ZDB-GENE-030131-5345])

HSP 1 Score: 123.635 bits (309), Expect = 8.445e-31
Identity = 71/183 (38.80%), Postives = 110/183 (60.11%), Query Frame = 1
Query:  520 SSSTQELERI--SNDIKFLKNSIYNLKTVQKLPRSGKLIWKIENAKLFFENQIP-----LMSPQVYTSDYGYKLCLKAYPNGDGIGMGSHLSLYFAILKGEYDDLLAWPFRCKVKILLFNKDFKNRSK-YEIYKPD-ESRAFQQPENESNIATGNPKFITLEAVQN-NGFIIDNSIFIELYVD 1038
            S+  ++LER   + D++ L  S  +L+ +Q     G  IWKI       ++ +      + SP  Y+S YGYK+CL+ Y NGDG G GSHLSL+F ++KG+YD LL WPF  KV ++L +++  NR    + ++PD  S +FQ+P +E NIA+G P F  L  +   + ++ D++IFI+  VD
Sbjct:  362 SNKVRQLERTLTTRDLQ-LAESEQSLRELQFCTYDGVFIWKIAEFSRRRQDAVAGRAPAMFSPAFYSSKYGYKMCLRLYLNGDGTGRGSHLSLFFVVMKGKYDALLKWPFSQKVTLMLLDQN--NREHIIDAFRPDVSSTSFQRPISEMNIASGCPLFCPLAKLAGKSSYLRDDTIFIKAIVD 541          
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Match: unm_sa808 (un-named sa808 [Source:ZFIN;Acc:ZDB-GENE-120727-21])

HSP 1 Score: 117.472 bits (293), Expect = 3.262e-30
Identity = 67/187 (35.83%), Postives = 105/187 (56.15%), Query Frame = 1
Query:  535 ELERISNDIKFLKNSIY-----------NLKTVQKLPRSGKLIWKIENAKLFFENQIP-----LMSPQVYTSDYGYKLCLKAYPNGDGIGMGSHLSLYFAILKGEYDDLLAWPFRCKVKILLFNKDFKNRSK-YEIYKPD-ESRAFQQPENESNIATGNPKFITLEAVQN-NGFIIDNSIFIELYVD 1038
            ++E +SN ++ L+  +             L+ +      G  IW+I +     ++ I      + SP  YTS YGYK+CL+ Y NGDG G G+HLSL+F +++G  D LL WPF  KV ++L ++   NR    + ++PD  S +FQ+P +E NIA+G P F  L  ++  N +I D++IFI+  VD
Sbjct:   93 KIEALSNKVRQLERQVGVKDLTVAEMEGRLREMSATTFDGVFIWRISDFTKKRQDAIAGRAPAMFSPAFYTSKYGYKMCLRIYLNGDGTGRGTHLSLFFVVMRGMSDALLKWPFNQKVTLMLLDQS--NREHIIDAFRPDITSSSFQRPVSEMNIASGCPLFCPLAKLEGKNSYIRDDTIFIKAIVD 277          
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Match: ssh2 (slingshot protein phosphatase 2 [Source:Xenbase;Acc:XB-GENE-993093])

HSP 1 Score: 132.494 bits (332), Expect = 5.994e-34
Identity = 70/183 (38.25%), Postives = 105/183 (57.38%), Query Frame = 1
Query:  514 DQSSSTQELERISNDIKF--LKNSIYNLKTVQKLPRSGKLIWKIENAK-----LFFENQIPLMSPQVYTSDYGYKLCLKAYPNGDGIGMGSHLSLYFAILKGEYDDLLAWPFRCKVKILLFNKDFKNRSKYEIYKPD-ESRAFQQPENESNIATGNPKFITLEAVQNNGFIIDNSIFIELYVD 1038
            DQ  S  ++     D++F  L+ + YN          G LIWKI + K           + L S   YT  +GYK+C + Y NGDG+G G+HLSL+F I++GEYD LL WPF+ KV ++L ++    R   + +KPD  S +F++P  E NIA+G P F+    ++N  +I D++IFI++ VD
Sbjct:  357 DQMLSVHDIRLADMDLRFQVLETASYN----------GVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVSLMLMDQGPSRRHLGDAFKPDPNSSSFKKPTGEMNIASGCPVFVAQTVLENGTYIKDDTIFIKVIVD 529          
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Match: ssh2 (slingshot protein phosphatase 2 [Source:Xenbase;Acc:XB-GENE-993093])

HSP 1 Score: 132.88 bits (333), Expect = 6.298e-34
Identity = 70/183 (38.25%), Postives = 105/183 (57.38%), Query Frame = 1
Query:  514 DQSSSTQELERISNDIKF--LKNSIYNLKTVQKLPRSGKLIWKIENAK-----LFFENQIPLMSPQVYTSDYGYKLCLKAYPNGDGIGMGSHLSLYFAILKGEYDDLLAWPFRCKVKILLFNKDFKNRSKYEIYKPD-ESRAFQQPENESNIATGNPKFITLEAVQNNGFIIDNSIFIELYVD 1038
            DQ  S  ++     D++F  L+ + YN          G LIWKI + K           + L S   YT  +GYK+C + Y NGDG+G G+HLSL+F I++GEYD LL WPF+ KV ++L ++    R   + +KPD  S +F++P  E NIA+G P F+    ++N  +I D++IFI++ VD
Sbjct:  382 DQMLSVHDIRLADMDLRFQVLETASYN----------GVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVSLMLMDQGPSRRHLGDAFKPDPNSSSFKKPTGEMNIASGCPVFVAQTVLENGTYIKDDTIFIKVIVD 554          
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Match: slc12a1 (solute carrier family 12 member 1 [Source:Xenbase;Acc:XB-GENE-479925])

HSP 1 Score: 124.02 bits (310), Expect = 6.236e-31
Identity = 66/180 (36.67%), Postives = 108/180 (60.00%), Query Frame = 1
Query:  526 STQELERISNDIKFLKNSIYNLKTVQKLPRSGKLIWKIEN-----AKLFFENQIPLMSPQVYTSDYGYKLCLKAYPNGDGIGMGSHLSLYFAILKGEYDDLLAWPFRCKVKILLFNKDFKNRSKYEIYKPD-ESRAFQQPENESNIATGNPKFIT---LEAVQNNGFIIDNSIFIELYVD 1038
            S  +++  SN+ +F        + V+    +GKLIWKI +      +      + + S   YTS  GY+LC +AY NGDG G GS LSLYF ++KGE+D +L WPF+ KV ++L ++  K     ++++ D  S +F++P++E NIA+G P+F +   LE  +N  +I D+++FI++ VD
Sbjct:  360 SNHKMQMTSNEERF--------RLVEGTSYNGKLIWKITDYERKKREAMEGRAVSIFSQHFYTSWCGYRLCARAYLNGDGSGKGSFLSLYFVVMKGEFDSILLWPFKQKVTLMLLDQSGKKNHITDVFRADPNSSSFKRPDSEMNIASGCPRFASHAQLENPKNGCYIKDDTLFIKIVVD 531          
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Match: slc12a1 (solute carrier family 12 member 1 [Source:Xenbase;Acc:XB-GENE-479925])

HSP 1 Score: 123.25 bits (308), Expect = 8.044e-31
Identity = 66/180 (36.67%), Postives = 108/180 (60.00%), Query Frame = 1
Query:  526 STQELERISNDIKFLKNSIYNLKTVQKLPRSGKLIWKIEN-----AKLFFENQIPLMSPQVYTSDYGYKLCLKAYPNGDGIGMGSHLSLYFAILKGEYDDLLAWPFRCKVKILLFNKDFKNRSKYEIYKPD-ESRAFQQPENESNIATGNPKFIT---LEAVQNNGFIIDNSIFIELYVD 1038
            S  +++  SN+ +F        + V+    +GKLIWKI +      +      + + S   YTS  GY+LC +AY NGDG G GS LSLYF ++KGE+D +L WPF+ KV ++L ++  K     ++++ D  S +F++P++E NIA+G P+F +   LE  +N  +I D+++FI++ VD
Sbjct:  310 SNHKMQMTSNEERF--------RLVEGTSYNGKLIWKITDYERKKREAMEGRAVSIFSQHFYTSWCGYRLCARAYLNGDGSGKGSFLSLYFVVMKGEFDSILLWPFKQKVTLMLLDQSGKKNHITDVFRADPNSSSFKRPDSEMNIASGCPRFASHAQLENPKNGCYIKDDTLFIKIVVD 481          
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Match: slc12a1 (solute carrier family 12 member 1 [Source:Xenbase;Acc:XB-GENE-479925])

HSP 1 Score: 123.635 bits (309), Expect = 1.045e-30
Identity = 66/180 (36.67%), Postives = 108/180 (60.00%), Query Frame = 1
Query:  526 STQELERISNDIKFLKNSIYNLKTVQKLPRSGKLIWKIEN-----AKLFFENQIPLMSPQVYTSDYGYKLCLKAYPNGDGIGMGSHLSLYFAILKGEYDDLLAWPFRCKVKILLFNKDFKNRSKYEIYKPD-ESRAFQQPENESNIATGNPKFIT---LEAVQNNGFIIDNSIFIELYVD 1038
            S  +++  SN+ +F        + V+    +GKLIWKI +      +      + + S   YTS  GY+LC +AY NGDG G GS LSLYF ++KGE+D +L WPF+ KV ++L ++  K     ++++ D  S +F++P++E NIA+G P+F +   LE  +N  +I D+++FI++ VD
Sbjct:  361 SNHKMQMTSNEERF--------RLVEGTSYNGKLIWKITDYERKKREAMEGRAVSIFSQHFYTSWCGYRLCARAYLNGDGSGKGSFLSLYFVVMKGEFDSILLWPFKQKVTLMLLDQSGKKNHITDVFRADPNSSSFKRPDSEMNIASGCPRFASHAQLENPKNGCYIKDDTLFIKIVVD 532          
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Match: Traf5 (TNF receptor-associated factor 5 [Source:MGI Symbol;Acc:MGI:107548])

HSP 1 Score: 130.183 bits (326), Expect = 3.104e-35
Identity = 61/149 (40.94%), Postives = 98/149 (65.77%), Query Frame = 1
Query:  616 SGKLIWKIENAKL-----FFENQIPLMSPQVYTSDYGYKLCLKAYPNGDGIGMGSHLSLYFAILKGEYDDLLAWPFRCKVKILLFNKDFKNRSKYEIYKPD-ESRAFQQPENESNIATGNPKFITLEAVQN--NGFIIDNSIFIELYVD 1038
            SGKLIWK+ + ++        + + + S   YTS  GY+LC +AY NGDG G G+HLSLYF +++GE+D LL WPFR +V ++L ++  K     E +K D  S +F++P+ E NIA+G P+F++   ++N  N +I D+++F+++ VD
Sbjct:   95 SGKLIWKVTDYRVKKREAVEGHTVSVFSQPFYTSRCGYRLCARAYLNGDGSGKGTHLSLYFVVMRGEFDSLLQWPFRQRVTLMLLDQSGKKNHIVETFKADPNSSSFKRPDGEMNIASGCPRFVSHSTLENSKNTYIKDDTLFLKVAVD 243          
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Match: Traf5 (TNF receptor-associated factor 5 [Source:MGI Symbol;Acc:MGI:107548])

HSP 1 Score: 130.183 bits (326), Expect = 3.104e-35
Identity = 61/149 (40.94%), Postives = 98/149 (65.77%), Query Frame = 1
Query:  616 SGKLIWKIENAKL-----FFENQIPLMSPQVYTSDYGYKLCLKAYPNGDGIGMGSHLSLYFAILKGEYDDLLAWPFRCKVKILLFNKDFKNRSKYEIYKPD-ESRAFQQPENESNIATGNPKFITLEAVQN--NGFIIDNSIFIELYVD 1038
            SGKLIWK+ + ++        + + + S   YTS  GY+LC +AY NGDG G G+HLSLYF +++GE+D LL WPFR +V ++L ++  K     E +K D  S +F++P+ E NIA+G P+F++   ++N  N +I D+++F+++ VD
Sbjct:   95 SGKLIWKVTDYRVKKREAVEGHTVSVFSQPFYTSRCGYRLCARAYLNGDGSGKGTHLSLYFVVMRGEFDSLLQWPFRQRVTLMLLDQSGKKNHIVETFKADPNSSSFKRPDGEMNIASGCPRFVSHSTLENSKNTYIKDDTLFLKVAVD 243          
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Match: Traf3 (TNF receptor-associated factor 3 [Source:MGI Symbol;Acc:MGI:108041])

HSP 1 Score: 133.65 bits (335), Expect = 2.275e-34
Identity = 70/183 (38.25%), Postives = 105/183 (57.38%), Query Frame = 1
Query:  514 DQSSSTQELERISNDIKF--LKNSIYNLKTVQKLPRSGKLIWKIENAK-----LFFENQIPLMSPQVYTSDYGYKLCLKAYPNGDGIGMGSHLSLYFAILKGEYDDLLAWPFRCKVKILLFNKDFKNRSKYEIYKPD-ESRAFQQPENESNIATGNPKFITLEAVQNNGFIIDNSIFIELYVD 1038
            DQ  S  ++     D++F  L+ + YN          G LIWKI + K           + L S   YT  +GYK+C + Y NGDG+G G+HLSL+F I++GEYD LL WPF+ KV ++L ++    R   + +KPD  S +F++P  E NIA+G P F+    ++N  +I D++IFI++ VD
Sbjct:  388 DQMLSVHDIRLADMDLRFQVLETASYN----------GVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPDPNSSSFKKPTGEMNIASGCPVFVAQTVLENGTYIKDDTIFIKVIVD 560          
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Match: Traf3 (TNF receptor-associated factor 3 [Source:MGI Symbol;Acc:MGI:108041])

HSP 1 Score: 133.65 bits (335), Expect = 2.280e-34
Identity = 70/183 (38.25%), Postives = 105/183 (57.38%), Query Frame = 1
Query:  514 DQSSSTQELERISNDIKF--LKNSIYNLKTVQKLPRSGKLIWKIENAK-----LFFENQIPLMSPQVYTSDYGYKLCLKAYPNGDGIGMGSHLSLYFAILKGEYDDLLAWPFRCKVKILLFNKDFKNRSKYEIYKPD-ESRAFQQPENESNIATGNPKFITLEAVQNNGFIIDNSIFIELYVD 1038
            DQ  S  ++     D++F  L+ + YN          G LIWKI + K           + L S   YT  +GYK+C + Y NGDG+G G+HLSL+F I++GEYD LL WPF+ KV ++L ++    R   + +KPD  S +F++P  E NIA+G P F+    ++N  +I D++IFI++ VD
Sbjct:  363 DQMLSVHDIRLADMDLRFQVLETASYN----------GVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPDPNSSSFKKPTGEMNIASGCPVFVAQTVLENGTYIKDDTIFIKVIVD 535          
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Match: Traf3 (TNF receptor-associated factor 3 [Source:MGI Symbol;Acc:MGI:108041])

HSP 1 Score: 133.65 bits (335), Expect = 2.280e-34
Identity = 70/183 (38.25%), Postives = 105/183 (57.38%), Query Frame = 1
Query:  514 DQSSSTQELERISNDIKF--LKNSIYNLKTVQKLPRSGKLIWKIENAK-----LFFENQIPLMSPQVYTSDYGYKLCLKAYPNGDGIGMGSHLSLYFAILKGEYDDLLAWPFRCKVKILLFNKDFKNRSKYEIYKPD-ESRAFQQPENESNIATGNPKFITLEAVQNNGFIIDNSIFIELYVD 1038
            DQ  S  ++     D++F  L+ + YN          G LIWKI + K           + L S   YT  +GYK+C + Y NGDG+G G+HLSL+F I++GEYD LL WPF+ KV ++L ++    R   + +KPD  S +F++P  E NIA+G P F+    ++N  +I D++IFI++ VD
Sbjct:  363 DQMLSVHDIRLADMDLRFQVLETASYN----------GVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPDPNSSSFKKPTGEMNIASGCPVFVAQTVLENGTYIKDDTIFIKVIVD 535          
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Match: sp|Q13114|TRAF3_HUMAN (TNF receptor-associated factor 3 OS=Homo sapiens OX=9606 GN=TRAF3 PE=1 SV=2)

HSP 1 Score: 134.035 bits (336), Expect = 1.278e-33
Identity = 70/183 (38.25%), Postives = 105/183 (57.38%), Query Frame = 1
Query:  514 DQSSSTQELERISNDIKF--LKNSIYNLKTVQKLPRSGKLIWKIENAK-----LFFENQIPLMSPQVYTSDYGYKLCLKAYPNGDGIGMGSHLSLYFAILKGEYDDLLAWPFRCKVKILLFNKDFKNRSKYEIYKPD-ESRAFQQPENESNIATGNPKFITLEAVQNNGFIIDNSIFIELYVD 1038
            DQ  S  ++     D++F  L+ + YN          G LIWKI + K           + L S   YT  +GYK+C + Y NGDG+G G+HLSL+F I++GEYD LL WPF+ KV ++L ++    R   + +KPD  S +F++P  E NIA+G P F+    ++N  +I D++IFI++ VD
Sbjct:  389 DQMLSVHDIRLADMDLRFQVLETASYN----------GVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPDPNSSSFKKPTGEMNIASGCPVFVAQTVLENGTYIKDDTIFIKVIVD 561          
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Match: sp|Q60803|TRAF3_MOUSE (TNF receptor-associated factor 3 OS=Mus musculus OX=10090 GN=Traf3 PE=1 SV=2)

HSP 1 Score: 133.65 bits (335), Expect = 1.591e-33
Identity = 70/183 (38.25%), Postives = 105/183 (57.38%), Query Frame = 1
Query:  514 DQSSSTQELERISNDIKF--LKNSIYNLKTVQKLPRSGKLIWKIENAK-----LFFENQIPLMSPQVYTSDYGYKLCLKAYPNGDGIGMGSHLSLYFAILKGEYDDLLAWPFRCKVKILLFNKDFKNRSKYEIYKPD-ESRAFQQPENESNIATGNPKFITLEAVQNNGFIIDNSIFIELYVD 1038
            DQ  S  ++     D++F  L+ + YN          G LIWKI + K           + L S   YT  +GYK+C + Y NGDG+G G+HLSL+F I++GEYD LL WPF+ KV ++L ++    R   + +KPD  S +F++P  E NIA+G P F+    ++N  +I D++IFI++ VD
Sbjct:  388 DQMLSVHDIRLADMDLRFQVLETASYN----------GVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPDPNSSSFKKPTGEMNIASGCPVFVAQTVLENGTYIKDDTIFIKVIVD 560          
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Match: sp|O00463|TRAF5_HUMAN (TNF receptor-associated factor 5 OS=Homo sapiens OX=9606 GN=TRAF5 PE=1 SV=2)

HSP 1 Score: 132.109 bits (331), Expect = 5.723e-33
Identity = 71/205 (34.63%), Postives = 120/205 (58.54%), Query Frame = 1
Query:  448 NLINSYFRKISMKISDITKVDFDQSSSTQELERISNDIKFLKNSIYNLKTVQKLPRSGKLIWKIENAKL-----FFENQIPLMSPQVYTSDYGYKLCLKAYPNGDGIGMGSHLSLYFAILKGEYDDLLAWPFRCKVKILLFNKDFKNRSKYEIYKPD-ESRAFQQPENESNIATGNPKFITLEAVQN--NGFIIDNSIFIELYVD 1038
             L+ +  +++++   +  K D   +    +L +     K L+ + YN          GKLIWK+ + K+        + + + S   YTS  GY+LC +AY NGDG G GSHLSLYF +++GE+D LL WPFR +V ++L ++  K ++  E +KPD  S +F++P+ E NIA+G P+F+    ++N  N +I D+++F+++ VD
Sbjct:  357 TLLENNDQRLAVLEEETNKHDTHINIHKAQLSKNEERFKLLEGTCYN----------GKLIWKVTDYKMKKREAVDGHTVSIFSQSFYTSRCGYRLCARAYLNGDGSGRGSHLSLYFVVMRGEFDSLLQWPFRQRVTLMLLDQSGK-KNIMETFKPDPNSSSFKRPDGEMNIASGCPRFVAHSVLENAKNAYIKDDTLFLKVAVD 550          
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Match: sp|P70191|TRAF5_MOUSE (TNF receptor-associated factor 5 OS=Mus musculus OX=10090 GN=Traf5 PE=1 SV=1)

HSP 1 Score: 130.954 bits (328), Expect = 1.672e-32
Identity = 61/149 (40.94%), Postives = 98/149 (65.77%), Query Frame = 1
Query:  616 SGKLIWKIENAKL-----FFENQIPLMSPQVYTSDYGYKLCLKAYPNGDGIGMGSHLSLYFAILKGEYDDLLAWPFRCKVKILLFNKDFKNRSKYEIYKPD-ESRAFQQPENESNIATGNPKFITLEAVQN--NGFIIDNSIFIELYVD 1038
            SGKLIWK+ + ++        + + + S   YTS  GY+LC +AY NGDG G G+HLSLYF +++GE+D LL WPFR +V ++L ++  K     E +K D  S +F++P+ E NIA+G P+F++   ++N  N +I D+++F+++ VD
Sbjct:  403 SGKLIWKVTDYRVKKREAVEGHTVSVFSQPFYTSRCGYRLCARAYLNGDGSGKGTHLSLYFVVMRGEFDSLLQWPFRQRVTLMLLDQSGKKNHIVETFKADPNSSSFKRPDGEMNIASGCPRFVSHSTLENSKNTYIKDDTLFLKVAVD 551          
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Match: sp|P39428|TRAF1_MOUSE (TNF receptor-associated factor 1 OS=Mus musculus OX=10090 GN=Traf1 PE=1 SV=2)

HSP 1 Score: 125.561 bits (314), Expect = 2.835e-31
Identity = 63/160 (39.38%), Postives = 103/160 (64.38%), Query Frame = 1
Query:  583 YNLKTVQKLPRSGKLIWKIENA-KLFFEN----QIPLMSPQVYTSDYGYKLCLKAYPNGDGIGMGSHLSLYFAILKGEYDDLLAWPFRCKVKILLFNKDFKNRSKYEIYKPDESRA-FQQPENESNIATGNPKFITLEAVQN--NGFIIDNSIFIELYVD 1038
            ++L+ +++    G  +WKI N  K   E+     + L SP  YT+ YGYKLCL+ Y NGDG G  +HLSL+  I++GEYD LL WPFR KV  +L +++ +  +  + ++PD S A FQ+P++E+N+A+G P F  L  +Q+  + ++ D+++F++  VD
Sbjct:  248 HSLRLMEEASFDGTFLWKITNVTKRCHESVCGRTVSLFSPAFYTAKYGYKLCLRLYLNGDGSGKKTHLSLFIVIMRGEYDALLPWPFRNKVTFMLLDQNNREHA-IDAFRPDLSSASFQRPQSETNVASGCPLFFPLSKLQSPKHAYVKDDTMFLKCIVD 406          
BLAST of TNF receptor-associated factor vs. TrEMBL
Match: D5JG59 (TNF receptor-associated factor-2-like protein A OS=Dugesia japonica OX=6161 GN=TRAF-2A PE=2 SV=1)

HSP 1 Score: 153.295 bits (386), Expect = 1.337e-39
Identity = 106/344 (30.81%), Postives = 175/344 (50.87%), Query Frame = 1
Query:   94 KFNCSQCEESFYVEDLCEHSSKCAFNKSLMKESNGLCKYCYKMVSCPEGEHIHLTQFKPPECESFRANCPN-C-KLNDVKIKEHFNLCPNKPKKCNLAKLGCN-GKIIPDSILCTLGDGHKNLINSYFRKI---SMKISD----------ITKVDFDQSSSTQELE-RISNDIKFLK-----NSIYNLKTVQKLPRSGKLIWKIENAKLFFEN-----QIPLMSPQVYTSDYGYKLCLKAYPNGDGIGMGSHLSLYFAILKGEYDDLLAWPFRCKVKILLFNKDFKNRSKYEIYKPDESRA-FQQPENESNIATGNPKFITLEAVQNNGFIIDN-SIFIELYVD 1038
            +  C +C   F  ++   H      +K  M+  N  C YC   +   +   IHL   +   C  +   C N C +   V +K+H  +CPNK  +C   +  C   K+  + ++  L + + N  +S   K+     KI D          ITK  F+ +  + E   +I   I+ LK      SI  +     + R+   IWK  + ++   +     ++ + S   YTS++GYK+CL+ YP GDG+G G+HLS++FAI+KGE+DDLL+WPF+ KV + + +++  ++   + +KPD   A +Q+P +E NIA+G PKFI L  + NN     N +IF+++ VD
Sbjct:   12 EITCEKCGIKFGAKEKANHDK----DKCEMRMVN--CDYCGITMKSKDLNIIHLNPDRDELCSKYVGICSNNCNETRKVNLKDHLKICPNKKLECPFHQFDCKIDKMTKEKLMKHLDEEYFNHTSSLINKVKDLESKIIDLESELHNQILITKELFEMNKKSSESRLKIEKTIEELKKKAPATSIQTIDNKNVIFRNASFIWKFTDFEVRRVDAESGGRVSVTSDAFYTSEFGYKMCLRVYPAGDGVGKGTHLSVFFAIMKGEFDDLLSWPFKQKVTLSILDQESGSKPHSDTFKPDARSACYQKPTDECNIASGFPKFILLSLIMNNSIYCKNDTIFLKIAVD 349          
BLAST of TNF receptor-associated factor vs. TrEMBL
Match: T1DBK6 (TRAF-4 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1)

HSP 1 Score: 150.984 bits (380), Expect = 5.046e-38
Identity = 104/330 (31.52%), Postives = 177/330 (53.64%), Query Frame = 1
Query:  103 CSQCEESFYVEDLCEHSSKCAFNKSLMKESNGLCKYCYKMVSCPEGEHIHLTQFKPPECESFRANCPNCKLNDVKIK--EHFNLCPNKPKKCNLAKLGCNGKIIPDSI---LCTLGDGHKNLINSYFRKISMK---ISDITKVDFDQSSSTQE-LERISNDIKFLKNSIYNLKTVQK----LPRSGKLIWKIENAKLFFENQI-----PLMSPQVYTSDYGYKLCLKAYPNGDGIGMGSHLSLYFAILKGEYDDLLAWPFRCKVKILLFNKDFKNRSKYEIYKPD-ESRAFQQPENESNIATGNPKFITLEAVQNNGFIIDNSIFIELYV 1035
            CS C   + +++   H +    N+ L++E   LC+YC  +++  E    HL       C  + A CP     + K+    H   C NKP +C L    C   I  D +   L T    H   I +  RK+  +   + +   +  +++   +  LE +  D+     SI    ++++    + R+GK +WKI++     EN +      ++S   YTSD+GYK+C+K YP GDG+G G+HLS++F I+KG+YDD+L WPF+ KV I +F+   K+ +  + +KPD +S  +Q+PE E NIA+G+PKFI+   ++N  F+  ++++I++ V
Sbjct:  125 CSLCGMEYIIKEESNHLA----NECLLREV--LCQYCRTLLTFKEYNESHLCFESRDLCGKYEAICPYGCTGESKVNLLHHRKSCENKPLECPLHVFDCKQLIPKDQMTEHLNTSSYEHTLTIVTELRKLEKQNKHMEERMNILIEENQLLKATLEVMKLDLPKNSGSISRDTSLKRANKTIFRNGKYMWKIKSFSKLRENAMRGKNPTILSEAFYTSDFGYKMCMKIYPCGDGVGKGTHLSIFFVIMKGDYDDILPWPFKNKVIITIFDDFSKSTNLSDTFKPDPKSICYQRPEEEYNIASGSPKFISFSELKN--FLKKDTLYIQINV 446          
BLAST of TNF receptor-associated factor vs. TrEMBL
Match: S4RA88 (TNF receptor-associated factor OS=Petromyzon marinus OX=7757 PE=3 SV=1)

HSP 1 Score: 139.043 bits (349), Expect = 1.098e-33
Identity = 60/172 (34.88%), Postives = 106/172 (61.63%), Query Frame = 1
Query:  541 ERISNDIKFLKNSIYNLKTVQKLPRSGKLIWKIEN-----AKLFFENQIPLMSPQVYTSDYGYKLCLKAYPNGDGIGMGSHLSLYFAILKGEYDDLLAWPFRCKVKILLFNKDFKNRSKYEIYKPD-ESRAFQQPENESNIATGNPKFITLEAVQNNGFIIDNSIFIELYVD 1038
            +R++     L  +   L+ ++    SGKL+WKI +      +      + L S   YTS +GYK+C +AY NGDG+G G+HLSL+F +++GEYD LL WPFR +V + L ++    R   + + PD  S +F++P+ + N+A+G P F++  A++ + +++D+++F+ + VD
Sbjct:  242 QRLTMHDGLLDTAERRLQVLETAGYSGKLVWKIRDYARRKQEAASGRTLSLYSQPFYTSPFGYKMCARAYLNGDGVGRGTHLSLFFVVMRGEYDALLEWPFRRRVTLSLLDQGAARRHLSDTFTPDPASGSFRRPDGDMNVASGCPLFVSHVALEGSSYLVDDTVFVRVVVD 413          
BLAST of TNF receptor-associated factor vs. TrEMBL
Match: A0A3L7HLH9 (TNF receptor-associated factor OS=Cricetulus griseus OX=10029 GN=CgPICR_019395 PE=3 SV=1)

HSP 1 Score: 140.584 bits (353), Expect = 1.199e-33
Identity = 102/373 (27.35%), Postives = 170/373 (45.58%), Query Frame = 1
Query:  112 CEESFYVEDLCEH-SSKCAFNKSLMKESNGLCKYCYKMVSCPEGEHIHLTQFKPPECESFRANCPNCKLNDV---KIKEHFNLCPNKPKKCNLAKLGCNGK------------IIPDSILCTLGDG---HKNLINSYFRKIS---------MKISDITKVDFDQSSSTQELERISNDIKFLKNSIYNL----------------------------KTVQKLPRSGKLIWKIEN-----AKLFFENQIPLMSPQVYTSDYGYKLCLKAYPNGDGIGMGSHLSLYFAILKGEYDDLLAWPFRCKVKILLFNKDFKNRSKYEIYKPD-ESRAFQQPENESNIATGNPKFITLEAVQN--NGFIIDNSIFIELYVD 1038
            C E+   +DL EH S+ C F +         C YC + V   +     L   +   C ++  +CPN  L  +   ++ EH  +CP   + C     GC  K             + D +L  L       +  + S+  K +         ++I +  +  FD  S  + ++ +   +  L+ S   L                            K ++    SGKLIWK+ +      K    + + + S   YTS  GY+LC +AY NGDG G G+HLSLYF +++GE+D LL WPFR +V ++L ++  K     E +K D  S +F++P+ E NIA+G P+F++   ++N  N +I D+++F+++ VD
Sbjct:  150 CREAMLRKDLKEHLSAYCQFREER-------CLYCKRDVVVTD-----LQDHEENLCPAYPVSCPNKCLRTIPRTEVNEHLAVCPEAEQDCPFQHYGCTVKGKRGNLQEHEQAALRDHMLLVLEKNFQLEQQALTSHIDKSAWLEAQVRQLLQIVNQQQNRFDLHSLVEAIDSVKQKVTLLEASDQRLVVLEGETSKHDAHINIHKAQLNKNEERFKLLEGACYSGKLIWKVTDYKAKKRKAVEGHVVSVFSQPFYTSRCGYRLCARAYLNGDGSGKGTHLSLYFVVMRGEFDSLLQWPFRQRVTLMLLDQSGKKNHIVETFKADPNSSSFRRPDGEMNIASGCPRFVSHSTLENSKNTYIKDDTLFLKVAVD 510          
BLAST of TNF receptor-associated factor vs. TrEMBL
Match: A0A1W3JIE7 (TNF receptor-associated factor 3-like OS=Ciona intestinalis OX=7719 GN=LOC100178442 PE=4 SV=2)

HSP 1 Score: 132.494 bits (332), Expect = 5.939e-33
Identity = 59/150 (39.33%), Postives = 94/150 (62.67%), Query Frame = 1
Query:  616 SGKLIWKIEN-----AKLFFENQIPLMSPQVYTSDYGYKLCLKAYPNGDGIGMGSHLSLYFAILKGEYDDLLAWPFRCKVKILLFNKDFKNRSKYEIYKPD-ESRAFQQPENESNIATGNPKFITLEAVQNNGFIIDNSIFIELYVDQKK 1047
            SG LIWKI +      +      + L S   YTS YGYK+C + Y NGDG+G G+H+SL+F ++KGEYD LL WPFR KV ++L ++    R   + ++PD  S +F++P ++ NIA+G P F+    ++ + ++  ++IF+ ++VD  K
Sbjct:   90 SGSLIWKIRDFSRRKREAVSGRALSLYSQPFYTSRYGYKMCARVYLNGDGMGKGTHMSLFFVVMKGEYDALLTWPFRQKVTLMLLDQGMDRRHLSDTFRPDPTSSSFKKPTSDMNIASGCPLFVAHNVIEGSSYVKKDTIFLRIHVDMSK 239          
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Match: ENSAMXT00000035169.1 (pep primary_assembly:Astyanax_mexicanus-2.0:9:3354744:3362219:1 gene:ENSAMXG00000029095.1 transcript:ENSAMXT00000035169.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 125.561 bits (314), Expect = 1.043e-34
Identity = 60/146 (41.10%), Postives = 92/146 (63.01%), Query Frame = 1
Query:  619 GKLIWKIEN-----AKLFFENQIPLMSPQVYTSDYGYKLCLKAYPNGDGIGMGSHLSLYFAILKGEYDDLLAWPFRCKVKILLFNKDFKNRSKYEIYKPDE-SRAFQQPENESNIATGNPKFITLEAVQNNGFIIDNSIFIELYVD 1038
            G LIWKI +     A+      + L S   YT  +GYK+C + Y NGDG+G G+HLSL+F +++GEYD LL WPF+ KV ++L ++    +   + +KPD  S +F++P  E NIA+G P F+    ++N  +I D++IFI++ VD
Sbjct:    4 GTLIWKIRDYKRRKAEAVASKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVVMRGEYDALLPWPFKQKVTLMLMDQGPARKHLGDAFKPDPNSSSFRRPTGEMNIASGCPLFVAQTVLENGTYIKDDTIFIKVTVD 149          
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Match: traf2b (TNF receptor associated factor 2 [Source:NCBI gene;Acc:103028261])

HSP 1 Score: 124.02 bits (310), Expect = 3.953e-31
Identity = 71/217 (32.72%), Postives = 121/217 (55.76%), Query Frame = 1
Query:  445 KNLINSYFRKISMKISDITKVDFDQSSSTQELERISNDIKFLKNSIY-----------NLKTVQKLPRSGKLIWKIEN----AKLFFENQIPLM-SPQVYTSDYGYKLCLKAYPNGDGIGMGSHLSLYFAILKGEYDDLLAWPFRCKVKILLFNKDFKNRSK-YEIYKPD-ESRAFQQPENESNIATGNPKFITLEAVQN-NGFIIDNSIFIELYVD 1038
            +N++    R++   +  +  +   Q    +++E +SN ++ L+ ++             L+ +Q     G  +WKI +     +     + P M SP  Y+S YGYK+CL+ Y NGDG G GSHLSL+F +++G+YD LL WPF  KV ++L +++  NR    + ++PD  S +FQ+P +E NIA+G P F  L  +   + ++ D++IFI+  VD
Sbjct:  313 ENIVCVLNREVERTVLRLEALTRQQQLDQEKIENLSNKVRQLERTLTMRDLQLAESEQALRELQFCTYDGVFVWKISDFSRRRQDALAGRAPAMFSPAFYSSKYGYKMCLRLYLNGDGTGRGSHLSLFFVVMRGKYDALLKWPFSQKVTLMLLDQN--NREHIIDAFRPDISSTSFQRPISEMNIASGCPLFCPLAKLAGKSSYLRDDTIFIKAIVD 527          
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Match: traf2a (TNF receptor-associated factor 2-like [Source:NCBI gene;Acc:103036375])

HSP 1 Score: 120.168 bits (300), Expect = 4.441e-30
Identity = 99/369 (26.83%), Postives = 168/369 (45.53%), Query Frame = 1
Query:  103 CSQCEESFYVEDLCEHSSKCAFNKSLMKESNGLCKYCYKMVSCPEGEHIHLTQFKPPE--CESFRANCPNC---KLNDVKIKEHFNLCPNKPKKCNLAKLGCNGKI---------IPDSILCT-----LGDGHKNLINSYFRKISMKISDITKV------DFDQSSSTQE------------LERISNDIKFLKNSIYNLKTVQKLPRSGKL------------IWKIEN----AKLFFENQIPLM-SPQVYTSDYGYKLCLKAYPNGDGIGMGSHLSLYFAILKGEYDDLLAWPFRCKVKILLFNKDFKNRSK-YEIYKPD-ESRAFQQPENESNIATGNPKFITLEAVQN-NGFIIDNSIFIELYVD 1038
            C  C+E     +L  H+ +    ++L       CKYC         E  H    K  +  C  +   C  C   K+   K  +H  LC      C    +GC+  +          P  +L T     L       ++   +++ +K+     +      + ++S++T E            +E ++N ++ L+ ++  L+ +  +   GK+            +WKI +     +     + P M SP  YTS YGYK+CL+ Y NGDG G G+HLSL+F +++G  D LL WPF  KV ++L +++  NR    + ++PD  S +FQ+P ++ NIA+G P F  L  + + N +I D++IFI+  VD
Sbjct:  104 CPSCKELLRANELERHNERECPERTLN------CKYC--------KEPFHFKNIKAHDEICPKYPMICEGCAKKKIPREKYVDHIKLCTKFRTPCRFHVVGCDMSVSKPQWNLILTPRDLLYTSFTVPLSQTKVAELSRRCQELELKVGTFENIVCVLNREMERSATTMEAYNRQHRLDQDKIEILNNKVRQLERTV-GLRDLSIVEMEGKMREMSAATYDGVFVWKISDFSKKRQDAVAGRAPAMFSPAFYTSKYGYKMCLRIYLNGDGTGRGTHLSLFFVVMRGHSDALLKWPFNQKVTLMLLDQN--NREHIIDAFRPDISSSSFQRPVSDMNIASGCPLFCPLSKLDSKNSYIRDDTIFIKAIVD 455          
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Match: traf2a (TNF receptor-associated factor 2-like [Source:NCBI gene;Acc:103036375])

HSP 1 Score: 117.087 bits (292), Expect = 1.244e-28
Identity = 62/148 (41.89%), Postives = 92/148 (62.16%), Query Frame = 1
Query:  619 GKLIWKIEN----AKLFFENQIPLM-SPQVYTSDYGYKLCLKAYPNGDGIGMGSHLSLYFAILKGEYDDLLAWPFRCKVKILLFNKDFKNRSK-YEIYKPD-ESRAFQQPENESNIATGNPKFITLEAVQN-NGFIIDNSIFIELYVD 1038
            G  +WKI +     +     + P M SP  YTS YGYK+CL+ Y NGDG G G+HLSL+F +++G  D LL WPF  KV ++L +++  NR    + ++PD  S +FQ+P ++ NIA+G P F  L  + + N +I D++IFI+  VD
Sbjct:  423 GVFVWKISDFSKKRQDAVAGRAPAMFSPAFYTSKYGYKMCLRIYLNGDGTGRGTHLSLFFVVMRGHSDALLKWPFNQKVTLMLLDQN--NREHIIDAFRPDISSSSFQRPVSDMNIASGCPLFCPLSKLDSKNSYIRDDTIFIKAIVD 568          
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Match: traf5 (TNF receptor-associated factor 5 [Source:NCBI gene;Acc:103031120])

HSP 1 Score: 115.931 bits (289), Expect = 2.832e-28
Identity = 61/165 (36.97%), Postives = 97/165 (58.79%), Query Frame = 1
Query:  559 IKFLKNSIYNLKTVQKLPRSGKLIWKIENAKLFFENQIPLMSPQVYTSDYGYKLCLKAYPNGDGIGMGSHLSLYFAILKGEYDDLLAWPFRCKVKILLFNKDFKNRSKYEI-YKPD-ESRAFQQPENESNIATGNPKFIT---LEAVQNNGFIIDNSIFIELYVD 1038
            ++ L+ S    + ++     GKLIWK+ +     E    L SP  YTS  GYKL  + Y  G+G   G+HLSLY  +++G++D LL WPFR  V + + ++   NR+   + + PD  S  F++P +E+N A G P+FIT   LEA +N  ++ D+++FI++ VD
Sbjct:  380 VQQLQCSEQRFQQLESTSYDGKLIWKVHDYHRKKEAGTALNSPPFYTSHSGYKLSARVYLGGEGTARGTHLSLYVMLMRGDFDSLLPWPFRQNVTLAVLDQS-GNRNHVSLSFTPDLASNNFRRPTSETNAALGFPRFITHADLEAPRNAAYVRDDTLFIKVKVD 543          
BLAST of TNF receptor-associated factor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002130.1 (pep scaffold:Pmarinus_7.0:GL484662:8457:12718:-1 gene:ENSPMAG00000001936.1 transcript:ENSPMAT00000002130.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 139.043 bits (349), Expect = 8.433e-38
Identity = 60/172 (34.88%), Postives = 106/172 (61.63%), Query Frame = 1
Query:  541 ERISNDIKFLKNSIYNLKTVQKLPRSGKLIWKIEN-----AKLFFENQIPLMSPQVYTSDYGYKLCLKAYPNGDGIGMGSHLSLYFAILKGEYDDLLAWPFRCKVKILLFNKDFKNRSKYEIYKPD-ESRAFQQPENESNIATGNPKFITLEAVQNNGFIIDNSIFIELYVD 1038
            +R++     L  +   L+ ++    SGKL+WKI +      +      + L S   YTS +GYK+C +AY NGDG+G G+HLSL+F +++GEYD LL WPFR +V + L ++    R   + + PD  S +F++P+ + N+A+G P F++  A++ + +++D+++F+ + VD
Sbjct:  242 QRLTMHDGLLDTAERRLQVLETAGYSGKLVWKIRDYARRKQEAASGRTLSLYSQPFYTSPFGYKMCARAYLNGDGVGRGTHLSLFFVVMRGEYDALLEWPFRRRVTLSLLDQGAARRHLSDTFTPDPASGSFRRPDGDMNVASGCPLFVSHVALEGSSYLVDDTVFVRVVVD 413          
BLAST of TNF receptor-associated factor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000074.1 (pep scaffold:Pmarinus_7.0:GL482142:165593:173010:-1 gene:ENSPMAG00000000066.1 transcript:ENSPMAT00000000074.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 136.346 bits (342), Expect = 1.745e-36
Identity = 62/182 (34.07%), Postives = 112/182 (61.54%), Query Frame = 1
Query:  511 FDQSSSTQELERISNDIKFLKNSIYNLKTVQKLPRSGKLIWKIENAKLFFENQIP-----LMSPQVYTSDYGYKLCLKAYPNGDGIGMGSHLSLYFAILKGEYDDLLAWPFRCKVKILLFNKDFKNRSKYEIYKPD-ESRAFQQPENESNIATGNPKFITLEAVQNNGFIIDNSIFIELYVD 1038
             D + S  + +  ++D +  +  +   + ++    +GKL+WKI +     ++ +      L S   YTS +GY++C +AY NGDG+G G+HLSL+F +++GEYD LL WPFR +V + L ++    R   + +KPD  S +F++P ++ NIA+G P F++  A+++  ++ D++IFI++ VD
Sbjct:  290 LDSALSRHDTQLFAHDTRLAEMDL-RFQVLETASYNGKLVWKIRDYARRKQDAVSGRTLSLYSQPFYTSPFGYRMCARAYLNGDGVGRGTHLSLFFVVMRGEYDALLPWPFRQRVTLTLLDQGAARRQLSDTFKPDPASSSFRRPTSDMNIASGCPLFVSHVALESASYLQDDTIFIKVVVD 470          
BLAST of TNF receptor-associated factor vs. Ensembl Sea Lamprey
Match: traf6 (TNF receptor-associated factor 6 [Source:NCBI gene;Acc:554561])

HSP 1 Score: 53.9138 bits (128), Expect = 2.559e-8
Identity = 47/210 (22.38%), Postives = 92/210 (43.81%), Query Frame = 1
Query:  466 FRKISMKISDITKVDFDQSSSTQELE-RISNDIKFLKNSIYNLKTVQKLPR--SGKLIWKIENAKLFFENQIPLMSPQVYTSDYGYKLCLK-------------AYPNGDGIGMGSHLSLYFAILKGEYDDLLAWPFRCKVKILLFN---KDFKNRSKYEIYKPDESRAFQQPENESNI-ATGNPKFITLEAVQNNGFIIDNSIFIELYV 1035
             R++S K  +   +  + +   + LE R++     L   I+  + V++  R   G L     +  +  +    + S   YT   GY+LCL+             A P+    G   HL+L+  +L+G+YD  L WPF+ +++I + +   +D  + ++     P  S AFQ+P    N    G   F+ +  + +  ++ D+ + +   V
Sbjct:  355 IRELSAKTDNQQGLLAEATRLVRSLEARVAESESRLCAGIFTWR-VERFSRLLPGGLASGFASDGMHPDAPAVMHSSGFYTGVPGYRLCLRLQVLSGREVPAGAASPSVLLAGRQPHLALFVHLLQGDYDHRLPWPFKGRIRISVVDQCERDSVHVTEMMDADPQLS-AFQRPSVHRNPKGFGYMNFMDINTLHHRSYLRDDCLVVRCEV 562          
BLAST of TNF receptor-associated factor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008091.1 (pep scaffold:Pmarinus_7.0:GL477915:34322:50582:-1 gene:ENSPMAG00000007312.1 transcript:ENSPMAT00000008091.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 48.521 bits (114), Expect = 1.264e-6
Identity = 35/115 (30.43%), Postives = 54/115 (46.96%), Query Frame = 1
Query:  526 STQELER----ISNDIKFLKNSIYNLKTVQKLPRSGKLIWKIEN-------AKLFFENQIPLMSPQVYTSDYGYKLCLKAYPNGDGIGMGSHLSLYFAILKGEYDDLLAWPFRCK 837
            S QE ER    ++  +  L+N+ YN          G  +WKI++       A    E    + SP  +T+ YGY+L L+   +G+      H+S Y  +  G YD  LAWP++ K
Sbjct:  300 SDQETERSILGLTRRLAELENTAYN----------GMFLWKIKHVINRLREAGNGAERPPQIDSPAFFTTRYGYRLRLRLCRSGE------HVSAYAMLGPGPYDATLAWPYQLK 398          
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Match: EDO49464 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RG36])

HSP 1 Score: 125.946 bits (315), Expect = 2.770e-32
Identity = 61/168 (36.31%), Postives = 101/168 (60.12%), Query Frame = 1
Query:  553 NDIKFLKNSIYNLKTVQKLPRSGKLIWKIENAKLFFENQIP-----LMSPQVYTSDYGYKLCLKAYPNGDGIGMGSHLSLYFAILKGEYDDLLAWPFRCKVKILLFNKDFKNRSKYEIYKPD-ESRAFQQPENESNIATGNPKFITLEAVQNNGFIIDNSIFIELYVD 1038
            +DI+  ++ +  L+ ++     G  IWKI+     ++  +      + SP  Y   YGYK C + YPNGDG+G GSHLSL+F +++GE+D LL WPFR KV   L ++D +     + ++PD  S +F++P +  NIA+G P FI+   +Q   ++ D+++FI++ VD
Sbjct:  357 HDIQLAEHDL-KLQMLEATSYDGTYIWKIDEYTRRYQEGVSGKTPSIYSPPFYVGRYGYKACARVYPNGDGMGKGSHLSLFFVLMRGEFDALLPWPFRQKVTFKLLDQD-RVHDIGDTFRPDPTSSSFKRPTSNMNIASGCPLFISHTNLQTRAYVRDDTMFIKIAVD 522          
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Match: EDO38873 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SBN4])

HSP 1 Score: 116.701 bits (291), Expect = 3.638e-29
Identity = 58/158 (36.71%), Postives = 93/158 (58.86%), Query Frame = 1
Query:  586 NLKTVQKLPRSGKLIWKIEN-----AKLFFENQIPLMSPQVYTSDYGYKLCLKAYPNGDGIGMGSHLSLYFAILKGEYDDLLAWPFRCKVKILLFNKDFKNRSKYEIYKPD-ESRAFQQPENESNIATGNPKFITLEAVQNNGFIIDNSIFIELYVDQ 1041
             L T+Q       L+WKI N     ++          SP  +T  +GYK+C + Y NGDG+G   H+SL+F I++GE+D LL WPFR KV ++L ++D       + ++PD  S +FQ+P  E NIA+G P F + E +  + +I D+++F+++ VD+
Sbjct:  322 RLNTLQGTTFDSVLLWKITNVANKRSEATSGRVTSFYSPCFFTGPHGYKMCARIYLNGDGMGRNHHVSLFFVIMRGEFDALLRWPFRQKVTLMLLDQD-NVEHVIDAFRPDPSSSSFQRPRAEMNIASGCPLFCSHEQLTQHAYIRDDTMFLKIIVDK 478          
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Match: EDO37750 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SER6])

HSP 1 Score: 113.235 bits (282), Expect = 6.587e-28
Identity = 86/358 (24.02%), Postives = 166/358 (46.37%), Query Frame = 1
Query:   25 CSEKMT--EIKANFKKPKNNQISNSKFNCSQ-CEESFYVEDLCEHSSKCAFNKSLMKESNGLCKYCYKMVSCPEGEHIHLTQFKPPECESFRANCPN-CKLNDV---KIKEHFNL-CPNKPKKCNLAKLGCNGKIIPDSILCTLGDGHKNLINSYFRKISMKISDITKVDFDQSSSTQELERISNDIKFLKNSIYNLKTVQKLPRSGKLIWKIENAKLFFENQ-----IPLMSPQVYTSDYGYKLCLKAYPNGDGIGMGSHLSLYFAILKGEYDDLLAWPFRCKVKILLFNKDFKNRSKYEI---YKPDES-RAFQQP-ENESNIATGNPKFITLEAVQNNGFIIDNSIFIELYVDQK 1044
            C  +M+  +++ + +      + +    C + C E   V+D   H  +   N+ +       C+YC   +   + +  H +      C SF  +CPN C +  +   +++ H +  C +   +C    +GC+ K  P           ++L       +   +  ++++   Q      L+ I    K   +S              KL+W+I++    F+         L SP  YTS+YGYK  +  +P G+G G G+HLSLY  +L GEYD LL WPF  ++ + L ++    R+K  I   + PD + ++FQ+P +N +++  G P+F++   +++ G++ D+ +F+++ +D K
Sbjct:  144 CKAEMSYEQLRVSLRYRNEGALVSDHVTCPRNCGERMRVQDKARHMREDCLNRWV------FCQYCNTEIVFRDRQTHHQS------CPSFPLSCPNNCGVAQIPRGEVELHLSRDCRSNIMQCPFRHVGCH-KQFPQ----------RSLQRHIEESVQQHLELVSELAIQQQKEINSLKEIVRHCKPYHDS--------------KLLWRIDDFWEAFDEGKRKPGTELHSPVFYTSNYGYKFKVVLFPYGNGSGEGTHLSLYIRLLPGEYDSLLPWPFEGQITLTLLDQSTDKRAKRHISQSFSPDPNWKSFQRPSKNSTSLGFGYPQFVSHRGLESIGYVRDDVLFLKVTIDCK 464          
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Match: EDO49545 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGK7])

HSP 1 Score: 109.768 bits (273), Expect = 5.671e-27
Identity = 84/294 (28.57%), Postives = 133/294 (45.24%), Query Frame = 1
Query:  202 CKYCYKMVSCPEGEHIHLTQFKPPECESFRANCPN-CKLNDVKIKE---HFNLCPNKPKKCNLAKLGCNGKIIPDSILCTLGDGHKNLINSYFRKISMKISDITKVDFDQSSSTQELERISNDIKFLKNSIYNLKTVQKLPRSGKLIWKIENAKLFFEN------QIPLMSPQVYTSDYGYKLCLKAYPNGDGIGMGSHLSLYFAILKGEYDDLLAWPFRCKVKILLFNKDFKNRSKYEIYKPDESR-----AFQQPENESNIATGNPKFITLEAVQNNGFIIDNSIFIELYVD 1038
            C +C +M +  +G+    T  K   C+     C N C   D+  +E   H + CP     C    +GC  K   D+    L +  KN ++++      KI +      ++S S                          L  +G  +WKI N K  ++       ++ + SP  YTS YGYKL LKAY NG   G G+HLSLY  I+KG+YD LL WPF+ K+   L ++  K   +  +  P+ S       F +P  + N+  GNP F+  E +++  ++ D+ +FI+  V+
Sbjct:  152 CHFCTEMYTYKDGK----THMK--SCKRLPIECVNKCGAKDIPREEMPFHMSECPLAVHPCMYRDIGCPFKGRRDA----LEEHCKNAVHTHLNIACQKIRE------NESRS--------------------------LCTNGIFLWKISNYKHQYDQAVASPEELAIFSPPFYTSQYGYKLRLKAYLNGRDRGKGTHLSLYIIIMKGDYDALLEWPFKQKITFYLIDQSEKQNHRTHLLSPNRSLPNIKVVFNRPTVKENLGIGNPCFVPNEVLESGEYVKDDVMFIKAVVE 403          
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Match: EDO40665 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S6K0])

HSP 1 Score: 108.612 bits (270), Expect = 9.157e-27
Identity = 57/156 (36.54%), Postives = 89/156 (57.05%), Query Frame = 1
Query:  601 QKLPRSGKLIWKIENAKLFFENQIP------LMSPQVYTSDYGYKLCLKAYPNGDGIGMGSHLSLYFAILKGEYDDLLAWPFRCKVKILLFNK--DFKNRS--KYEIYKPDESRAFQQPENESNIATGNPKFITLEAVQNNGFIIDNSIFIELYVD 1038
            +K+  +GK +WKI N    F+          L SP  YT  YGYKL  +A+ NG G G G+HLSLY  I+KG+YD +L WPF+ +V  +L ++  DF +R    + +     S  F +P    ++  G PKF++ E +++  F+ DN++FI + V+
Sbjct:  223 EKICTNGKFLWKISNYTQLFQQSATKKEKEKLCSPPFYTGQYGYKLRAEAFLNGLGQGKGTHLSLYVVIMKGDYDSVLPWPFQQRVDFILIDQDDDFTSRQNKTWRLTCDRNSDYFGRPNKAKSLGFGCPKFVSQETLKSRNFVRDNTVFIMIEVE 378          
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Match: traf3 (TNF receptor associated factor 3 [Source:NCBI gene;Acc:101161601])

HSP 1 Score: 129.028 bits (323), Expect = 2.478e-33
Identity = 67/183 (36.61%), Postives = 107/183 (58.47%), Query Frame = 1
Query:  514 DQSSSTQELERISNDIKF--LKNSIYNLKTVQKLPRSGKLIWKIENAKLFFENQIP-----LMSPQVYTSDYGYKLCLKAYPNGDGIGMGSHLSLYFAILKGEYDDLLAWPFRCKVKILLFNKDFKNRSKYEIYKPD-ESRAFQQPENESNIATGNPKFITLEAVQNNGFIIDNSIFIELYVD 1038
            D   S  E+     D++F  L+ + YN          G LIWKI + K   ++ +      L S   YT  +GYK+C + Y NGDG+G G+HLSL+F +++GEYD LL WPF+ KV ++L ++    +   + +KPD  S +F++P  E NIA+G P F++   +++  +I D++IFI++ VD
Sbjct:  271 DDMLSVHEIRLADMDLRFQVLETASYN----------GTLIWKIRDYKRRKQDAVAGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVVMRGEYDALLPWPFKQKVTLMLMDQGPSRKHLGDAFKPDPSSSSFRRPVAEMNIASGCPLFVSQSVLESGTYIKDDTIFIKVTVD 443          
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Match: traf2b (TNF receptor associated factor 2 [Source:NCBI gene;Acc:101159764])

HSP 1 Score: 118.242 bits (295), Expect = 4.316e-29
Identity = 68/188 (36.17%), Postives = 109/188 (57.98%), Query Frame = 1
Query:  532 QELERISNDIKFLKNSI----YNLKTVQKLPRS-------GKLIWKIEN----AKLFFENQIPLM-SPQVYTSDYGYKLCLKAYPNGDGIGMGSHLSLYFAILKGEYDDLLAWPFRCKVKILLFNKDFKNRSK-YEIYKPD-ESRAFQQPENESNIATGNPKFITLEAVQNNG-FIIDNSIFIELYVD 1038
            +++E +SN I+ L+ S+      L   +++ R        G  +WKI +     +     + P M SP  Y+S YGYK+CL+ Y NGDG G G+HLSL+F +++ +YD LL WPF  KV ++L +++  NR    + ++PD  S +FQ+P +E NIA+G P F  L  +     ++ D++IFI+  VD
Sbjct:  327 EKIENLSNKIRQLERSLTVKDLQLSEAEQMVRELQYCTYDGIFVWKITDFSHRRQEAVSGRAPAMFSPAFYSSKYGYKMCLRLYLNGDGTGRGTHLSLFFVVMRSKYDALLKWPFSQKVTLMLLDQN--NREHIIDAFRPDITSTSFQRPVSEMNIASGCPLFCPLAKLAGKSPYLRDDTIFIKAIVD 512          
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Match: traf2b (TNF receptor associated factor 2 [Source:NCBI gene;Acc:101159764])

HSP 1 Score: 117.857 bits (294), Expect = 4.907e-29
Identity = 68/188 (36.17%), Postives = 109/188 (57.98%), Query Frame = 1
Query:  532 QELERISNDIKFLKNSI----YNLKTVQKLPRS-------GKLIWKIEN----AKLFFENQIPLM-SPQVYTSDYGYKLCLKAYPNGDGIGMGSHLSLYFAILKGEYDDLLAWPFRCKVKILLFNKDFKNRSK-YEIYKPD-ESRAFQQPENESNIATGNPKFITLEAVQNNG-FIIDNSIFIELYVD 1038
            +++E +SN I+ L+ S+      L   +++ R        G  +WKI +     +     + P M SP  Y+S YGYK+CL+ Y NGDG G G+HLSL+F +++ +YD LL WPF  KV ++L +++  NR    + ++PD  S +FQ+P +E NIA+G P F  L  +     ++ D++IFI+  VD
Sbjct:  334 EKIENLSNKIRQLERSLTVKDLQLSEAEQMVRELQYCTYDGIFVWKITDFSHRRQEAVSGRAPAMFSPAFYSSKYGYKMCLRLYLNGDGTGRGTHLSLFFVVMRSKYDALLKWPFSQKVTLMLLDQN--NREHIIDAFRPDITSTSFQRPVSEMNIASGCPLFCPLAKLAGKSPYLRDDTIFIKAIVD 519          
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Match: ENSORLT00000020861.2 (TNF receptor-associated factor 2 [Source:NCBI gene;Acc:101167626])

HSP 1 Score: 118.242 bits (295), Expect = 5.482e-29
Identity = 68/187 (36.36%), Postives = 106/187 (56.68%), Query Frame = 1
Query:  535 ELERISNDIKFLKNSIY-----------NLKTVQKLPRSGKLIWKIEN----AKLFFENQIPLM-SPQVYTSDYGYKLCLKAYPNGDGIGMGSHLSLYFAILKGEYDDLLAWPFRCKVKILLFNKDFKNRSK-YEIYKPD-ESRAFQQPENESNIATGNPKFITLEAVQN-NGFIIDNSIFIELYVD 1038
            ++E +SN ++ L+ ++             +K +      G  IWKI +     +     + P M SP  YTS YGYK+CL+ Y NGDG G G+HLSL+F +++G  D LL WPF  KV ++L +++  NR    + ++PD  S +FQ+P ++ NIA+G P F  L  + + N +I D +IFI+  VD
Sbjct:  381 KIEILSNKVRQLERTVSLRDLSIVEMEGKMKDMSAATYDGIFIWKISDFTKKRQDAMAGRAPAMFSPAFYTSKYGYKMCLRIYLNGDGTGRGTHLSLFFVVMRGHSDALLKWPFNQKVTLMLLDQN--NREHIIDAFRPDISSSSFQRPVSDMNIASGCPLFCPLSKLDSKNSYIRDETIFIKAIVD 565          
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Match: unm_sa808 (TNF receptor-associated factor 2 [Source:NCBI gene;Acc:101155367])

HSP 1 Score: 117.472 bits (293), Expect = 1.306e-28
Identity = 69/187 (36.90%), Postives = 104/187 (55.61%), Query Frame = 1
Query:  535 ELERISNDIKFLKNSIY-----------NLKTVQKLPRSGKLIWKIEN----AKLFFENQIPLM-SPQVYTSDYGYKLCLKAYPNGDGIGMGSHLSLYFAILKGEYDDLLAWPFRCKVKILLFNKDFKNRSK-YEIYKPD-ESRAFQQPENESNIATGNPKFITLEAV-QNNGFIIDNSIFIELYVD 1038
            ++E +SN ++ L+ ++             L+ +      G  IW+I +     +     + P M SP  YTS YGYK+CL+ Y NGDG G G+HLSL+F +++G  D LL WPF  KV ++L   D  NR    + ++PD  S +FQ+P +E NIA+G P F  L  +   N +I D++IFI+  VD
Sbjct:  408 KIEALSNKVRQLERTVGLKDLTVAEMEGRLREMAATTFDGVFIWRISDFAKKRQDAVAGRAPAMFSPAFYTSKYGYKMCLRIYLNGDGTGRGTHLSLFFVVMRGLSDALLKWPFNQKVTLMLL--DQSNREHIIDAFRPDVTSSSFQRPVSEMNIASGCPLFCPLSKLDAKNSYIRDDTIFIKAIVD 592          
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Match: SMESG000054989.1 (SMESG000054989.1)

HSP 1 Score: 689.878 bits (1779), Expect = 0.000e+0
Identity = 337/340 (99.12%), Postives = 338/340 (99.41%), Query Frame = 1
Query:   37 MTEIKANFKKPKNNQISNSKFNCSQCEESFYVEDLCEHSSKCAFNKSLMKESNGLCKYCYKMVSCPEGEHIHLTQFKPPECESFRANCPNCKLNDVKIKEHFNLCPNKPKKCNLAKLGCNGKIIPDSILCTLGDGHKNLINSYFRKISMKISDITKVDFDQSSSTQELERISNDIKFLKNSIYNLKTVQKLPRSGKLIWKIENAKLFFENQIPLMSPQVYTSDYGYKLCLKAYPNGDGIGMGSHLSLYFAILKGEYDDLLAWPFRCKVKILLFNKDFKNRSKYEIYKPDESRAFQQPENESNIATGNPKFITLEAVQNNGFIIDNSIFIELYVDQKKTYL 1056
            MTEIKANFKKPKNNQISNSKFNCSQCEESFYVEDLCEHSSKCAFNKSL  ESNGLCKYCYKMVSCPEGEHIHLTQFKPPECESFRANCPNCKLNDVKIKEHFNLCPNKPKKCNL+KLGCNGKIIPDSILCTLGDGHKNLINSYFRKISMKISDITKVDFDQSSSTQELERISNDIKFLKNSIYNLKTVQKLPRSGKLIWKIENAKLFFENQIPLMSPQVYTSDYGYKLCLKAYPNGDGIGMGSHLSLYFAILKGEYDDLLAWPFRCKVKILLFNKDFKNRSKYEIYKPDESRAFQQPENESNIATGNPKFITLEAVQNNGFIIDNSIFIELYVDQKKTYL
Sbjct:    1 MTEIKANFKKPKNNQISNSKFNCSQCEESFYVEDLCEHSSKCAFNKSLTNESNGLCKYCYKMVSCPEGEHIHLTQFKPPECESFRANCPNCKLNDVKIKEHFNLCPNKPKKCNLSKLGCNGKIIPDSILCTLGDGHKNLINSYFRKISMKISDITKVDFDQSSSTQELERISNDIKFLKNSIYNLKTVQKLPRSGKLIWKIENAKLFFENQIPLMSPQVYTSDYGYKLCLKAYPNGDGIGMGSHLSLYFAILKGEYDDLLAWPFRCKVKILLFNKDFKNRSKYEIYKPDESRAFQQPENESNIATGNPKFITLEAVQNNGFIIDNSIFIELYVDQKKTYL 340          
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Match: SMESG000027153.1 (SMESG000027153.1)

HSP 1 Score: 160.614 bits (405), Expect = 6.554e-45
Identity = 109/344 (31.69%), Postives = 188/344 (54.65%), Query Frame = 1
Query:   94 KFNCSQCEESFYVEDLCEHSSKCAFNKSLMKESNGLCKYCYKMVSCPEGEHIHLTQFKPPECESFRANCPN-CKLND-VKIKEHFNLCPNKPKKCNLAKLGCN-GKIIPDSILCTLGD---GHKNLINSYFRKISMKISDITKVDFDQSSSTQEL----ERISNDIKFLKNSIYNLKT------VQKLP------RSGKLIWKI---ENAKLFFEN--QIPLMSPQVYTSDYGYKLCLKAYPNGDGIGMGSHLSLYFAILKGEYDDLLAWPFRCKVKILLFNKDFKNRSKYEIYKPDESRA-FQQPENESNIATGNPKFITLEAVQNNGFIIDN-SIFIELYVD 1038
            + +C++C+     +D   H      NK  M++    C+YC + +S  + + IHL   +   C  + A CPN C ++  V +KEH  LC  K  +C    L CN  K+  ++++  L +    H + + S  + +   I ++T    +Q   T+EL    ++ S  +   + +I  LKT      +Q +       R+   IWK    E+ ++  E+  ++ + S   YTS++GYK+CL+ YP GDG+G G+HLS++FAI+KGE+DDLL+WPF+ KV + + +++   +   + +KPD   A +Q+P +E NIA+G+PKFI L  + NN     N +I++++ VD
Sbjct:  123 EISCNKCQSKLQAKDKESHDK----NKCEMRKLK--CEYCLEEMSFRDLKSIHLNSDREDFCVKYTAICPNNCDVHTKVCLKEHLKLCSKKKLECPFHSLNCNVDKMTKENLMKHLNEEYVSHTSNLISKIKDMENTIKNLTDELENQKVLTKELLDMNKKSSLSVLKTQETIEKLKTKSFPTPIQAVENKSVIFRNATFIWKFTDFESKRIDAESGRKVSVTSDPFYTSEFGYKMCLRIYPAGDGVGKGTHLSVFFAIMKGEFDDLLSWPFKQKVTLSIMDQEAGTKHHSDTFKPDARSACYQKPVDECNIASGSPKFILLSLIMNNSLYCKNDTIYLKIAVD 460          
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Match: SMESG000027123.1 (SMESG000027123.1)

HSP 1 Score: 138.272 bits (347), Expect = 7.902e-37
Identity = 92/295 (31.19%), Postives = 163/295 (55.25%), Query Frame = 1
Query:  202 CKYCYKMVSCPEGEHIHLTQFKPPECESFRANCPN--CKLNDVKIKEHFNLCPNKPKKCNLAKLGCNGKIIPDSILCTLGDGHKNLINSYFRKISMKISDITKVDFDQSSS----TQELERISNDIKFLKNSIYN-LKTVQKLP--RSGKLIWKIENAKLFFEN-----QIPLMSPQVYTSDYGYKLCLKAYPNGDGIGMGSHLSLYFAILKGEYDDLLAWPFRCKVKILLFNKDFKNRSKYEIYKPD-ESRAFQQPENESNIATGNPKFITLEAVQNNGFIIDN-SIFIELYVD 1038
            C++C+K ++      +HL   K   C  +  +CPN   +  ++ +K H   C N+ K  +      + +   ++ L  L      L+N   + +  K+ +   +  + S+     T++  +++  I  L+    N +K + K    R+G  IWKI++ K   +N     ++ + S   YTS++GYKLCL+ YP+GDG+G G+HLS++FA++KGEYDDLL WPFR K+ + L +++   +   + +KPD +S  FQ+P  +SNIA+G+PKF ++  +  N     N +I+I++ VD
Sbjct:  150 CEFCHKTMTIKYLNEMHLNTTKNELCSEYVGHCPNNCGETKELNLKLHLETCLNR-KSDDQNDTNYHIQEFSNTQLSNLL-KQIALLNQTSKDLLTKLENQDVIIREMSTKYIALTEDNIKLTKKINALEAERSNPVKIIAKTNDFRNGSFIWKIKDLKSQIQNAERSERLSITSDPFYTSEFGYKLCLRVYPSGDGLGKGTHLSVFFALMKGEYDDLLPWPFRQKLTLSLLDQENFTKHYSDTFKPDPKSPCFQRPILDSNIASGSPKFYSISHLSFNSIYYKNDTIYIKITVD 442          
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Match: SMESG000047778.1 (SMESG000047778.1)

HSP 1 Score: 124.79 bits (312), Expect = 6.175e-32
Identity = 109/335 (32.54%), Postives = 160/335 (47.76%), Query Frame = 1
Query:   79 QISNSKFNCSQCEESFYVEDLCEHSSKCAFNKSLMKESNGLCKYCYKMVSCPEGEHIHLTQFKPPE-CESFRANCPNCKLNDVK---IKEHFNLCPNKPKKCNLAKLGCNGKIIPDSILCTLGDGHKNLINSYFRKISMKISDITKVDFDQSSSTQELERISNDIKFLKNSIYNLKT-VQKLP----RSGKLIWKIEN-----AKLFFENQIPLMSPQVYTSDYGYKLCLKAYPNGDGIGMGSHLSLYFAILKGEYDDLLAWPFRCKVKILLFNKDFKNRSKYEIYKP-DESRAFQQPENESNIATGNPKFITLEAV-QNNGFIIDNSIFIELYV 1035
            Q   S  NC +C     ++   +H +    N+S+       C  C K++   + E+IHL    P E CE+F  +CP  K +D K   IK H     NK +                           +L NS    I        K+   + S   EL R ++ ++ L     NLK  + K+          +WKIE+      K      + L+S   YT + GYK+ LK Y  GDGIG G+HLS+Y AI KG+YD LL WPF  K KI + N++  N+   E +KP  ES ++Q+P+ E N+ATGNP+F+ L+ + QN+ F  D+ +FI+L V
Sbjct:  149 QCPESVINCKKCFVKILLKTQFDHETVNCINRSVT------CAMCQKVMPAFQYENIHLNIENPLELCENFTRSCPY-KCSDEKYHNIKRHLIEYHNKEEN--------------------------SLKNSSLEIIEKIDKYYKKIKKIEKSCV-ELNRNTDSVELLNIEKTNLKQLISKVSCYKHVGSTFVWKIEHFTDTVKKSKSGQNLSLLSQPFYTKEIGYKMFLKIYSFGDGIGKGTHLSIYMAIGKGKYDSLLTWPFSQKFKISILNQN-GNKDITECFKPTSESLSYQRPDGEINLATGNPRFVDLKTLYQNDDFTKDDILFIKLEV 448          
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Match: SMESG000039089.1 (SMESG000039089.1)

HSP 1 Score: 124.79 bits (312), Expect = 9.386e-32
Identity = 89/305 (29.18%), Postives = 146/305 (47.87%), Query Frame = 1
Query:  250 HLTQFKPPECESFRANCP-NCKL-NDVKIKEHFNLCPNKPKKCNLAKLGCNGKIIPDSILC----TLGDGHKNLINSYFRKISMKISDITKVDFDQSSSTQELERISNDIKFLKNSIYNLKTVQKLP-------------------------------RSGKLIWKIEN-----AKLFFENQIPLMSPQVYTSDYGYKLCLKAYPNGDGIGMGSHLSLYFAILKGEYDDLLAWPFRCKVKILLFNKDFKNRSKYEIYKPD-ESRAFQQPENESNIATGNPKFITLEAVQNNGFIIDNSIFIELYV 1035
            HL  +    C      CP  C +   V +  H   C  KP +C   +LGC  K++ +  L     T    H   +   F K+  +I+ + +    +SS T +LE +SN    +   I N+  +                                   R+G  IWK+E+     A     N+I + S   YT ++GYK+ +K YP GDG+G  +HLS++F ++KG++DDLL WPF+ KV + + ++  K     + +KPD  S  +QQP  E NIA+G+PKFI+   +Q   ++ +++IF+++ V
Sbjct:  163 HLDLYADNICPKLVDKCPYGCDIVGAVNLLAHRKECVKKPVRCPFVELGC-SKVLTNQQLSDHMKTEFPAHIRTLVEEFIKMKKEITSL-ETKLIESSKTIKLE-LSNFQNEISTKISNIDQMSNSSLSLQSSSSLTLQSSASSMANILKSNDEKINYRNGVFIWKVEHFPELKANAERGNRISVTSEPFYTKEFGYKMSMKIYPAGDGVGKSTHLSVFFTLMKGDFDDLLVWPFKNKVTLTILDQKNKTSDYSDTFKPDPRSTCYQQPTEEYNIASGSPKFISFTQLQEY-YMKNDTIFLKIVV 463          
The following BLAST results are available for this feature:
BLAST of TNF receptor-associated factor vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TRAF31.740e-3438.25TNF receptor associated factor 3 [Source:HGNC Symb... [more]
TRAF32.616e-3438.25TNF receptor associated factor 3 [Source:HGNC Symb... [more]
TRAF32.616e-3438.25TNF receptor associated factor 3 [Source:HGNC Symb... [more]
TRAF32.662e-3438.25TNF receptor associated factor 3 [Source:HGNC Symb... [more]
TRAF32.662e-3438.25TNF receptor associated factor 3 [Source:HGNC Symb... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
trf-15.417e-2226.10TNF Receptor Associated Factor (TRAF) homolog; TRF... [more]
trf-21.587e-1535.04TNF Receptor Associated Factor (TRAF) homolog [So... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Traf46.595e-2527.73gene:FBgn0026319 transcript:FBtr0334401[more]
Traf49.332e-2527.73gene:FBgn0026319 transcript:FBtr0077429[more]
Traf-like1.710e-827.97gene:FBgn0030748 transcript:FBtr0074275[more]
Traf-like2.678e-827.97gene:FBgn0030748 transcript:FBtr0074273[more]
Traf-like3.559e-827.97gene:FBgn0030748 transcript:FBtr0308606[more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
traf33.264e-3336.90TNF receptor-associated factor 3 [Source:ZFIN;Acc:... [more]
traf2b6.309e-3138.80Tnf receptor-associated factor 2b [Source:ZFIN;Acc... [more]
traf2b6.309e-3138.80Tnf receptor-associated factor 2b [Source:ZFIN;Acc... [more]
traf2b8.445e-3138.80Tnf receptor-associated factor 2b [Source:ZFIN;Acc... [more]
unm_sa8083.262e-3035.83un-named sa808 [Source:ZFIN;Acc:ZDB-GENE-120727-21... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ssh25.994e-3438.25slingshot protein phosphatase 2 [Source:Xenbase;Ac... [more]
ssh26.298e-3438.25slingshot protein phosphatase 2 [Source:Xenbase;Ac... [more]
slc12a16.236e-3136.67solute carrier family 12 member 1 [Source:Xenbase;... [more]
slc12a18.044e-3136.67solute carrier family 12 member 1 [Source:Xenbase;... [more]
slc12a11.045e-3036.67solute carrier family 12 member 1 [Source:Xenbase;... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Traf53.104e-3540.94TNF receptor-associated factor 5 [Source:MGI Symbo... [more]
Traf53.104e-3540.94TNF receptor-associated factor 5 [Source:MGI Symbo... [more]
Traf32.275e-3438.25TNF receptor-associated factor 3 [Source:MGI Symbo... [more]
Traf32.280e-3438.25TNF receptor-associated factor 3 [Source:MGI Symbo... [more]
Traf32.280e-3438.25TNF receptor-associated factor 3 [Source:MGI Symbo... [more]
back to top
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q13114|TRAF3_HUMAN1.278e-3338.25TNF receptor-associated factor 3 OS=Homo sapiens O... [more]
sp|Q60803|TRAF3_MOUSE1.591e-3338.25TNF receptor-associated factor 3 OS=Mus musculus O... [more]
sp|O00463|TRAF5_HUMAN5.723e-3334.63TNF receptor-associated factor 5 OS=Homo sapiens O... [more]
sp|P70191|TRAF5_MOUSE1.672e-3240.94TNF receptor-associated factor 5 OS=Mus musculus O... [more]
sp|P39428|TRAF1_MOUSE2.835e-3139.38TNF receptor-associated factor 1 OS=Mus musculus O... [more]
back to top
BLAST of TNF receptor-associated factor vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
D5JG591.337e-3930.81TNF receptor-associated factor-2-like protein A OS... [more]
T1DBK65.046e-3831.52TRAF-4 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1[more]
S4RA881.098e-3334.88TNF receptor-associated factor OS=Petromyzon marin... [more]
A0A3L7HLH91.199e-3327.35TNF receptor-associated factor OS=Cricetulus grise... [more]
A0A1W3JIE75.939e-3339.33TNF receptor-associated factor 3-like OS=Ciona int... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000035169.11.043e-3441.10pep primary_assembly:Astyanax_mexicanus-2.0:9:3354... [more]
traf2b3.953e-3132.72TNF receptor associated factor 2 [Source:NCBI gene... [more]
traf2a4.441e-3026.83TNF receptor-associated factor 2-like [Source:NCBI... [more]
traf2a1.244e-2841.89TNF receptor-associated factor 2-like [Source:NCBI... [more]
traf52.832e-2836.97TNF receptor-associated factor 5 [Source:NCBI gene... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ENSPMAT00000002130.18.433e-3834.88pep scaffold:Pmarinus_7.0:GL484662:8457:12718:-1 g... [more]
ENSPMAT00000000074.11.745e-3634.07pep scaffold:Pmarinus_7.0:GL482142:165593:173010:-... [more]
traf62.559e-822.38TNF receptor-associated factor 6 [Source:NCBI gene... [more]
ENSPMAT00000008091.11.264e-630.43pep scaffold:Pmarinus_7.0:GL477915:34322:50582:-1 ... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO494642.770e-3236.31Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO388733.638e-2936.71Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO377506.587e-2824.02Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO495455.671e-2728.57Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO406659.157e-2736.54Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
traf32.478e-3336.61TNF receptor associated factor 3 [Source:NCBI gene... [more]
traf2b4.316e-2936.17TNF receptor associated factor 2 [Source:NCBI gene... [more]
traf2b4.907e-2936.17TNF receptor associated factor 2 [Source:NCBI gene... [more]
ENSORLT00000020861.25.482e-2936.36TNF receptor-associated factor 2 [Source:NCBI gene... [more]
unm_sa8081.306e-2836.90TNF receptor-associated factor 2 [Source:NCBI gene... [more]
back to top
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000054989.10.000e+099.12SMESG000054989.1[more]
SMESG000027153.16.554e-4531.69SMESG000027153.1[more]
SMESG000027123.17.902e-3731.19SMESG000027123.1[more]
SMESG000047778.16.175e-3232.54SMESG000047778.1[more]
SMESG000039089.19.386e-3229.18SMESG000039089.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30009675 ID=SMED30009675|Name=TNF receptor-associated factor|organism=Schmidtea mediterranea sexual|type=transcript|length=1061bp
ATCAGTTGATAATCAGATCAATTGTGTAGTGAAAAAATGACTGAAATTAA
AGCAAATTTCAAAAAACCTAAAAACAATCAAATTTCTAATTCAAAATTCA
ATTGTTCGCAATGCGAAGAATCATTTTATGTGGAGGACCTTTGTGAGCAC
TCTTCCAAATGTGCATTCAACAAAAGCTTAATGAAGGAATCAAATGGATT
ATGCAAATATTGTTACAAGATGGTCAGTTGTCCAGAAGGTGAGCATATTC
ATCTAACACAATTTAAGCCTCCCGAATGTGAATCTTTTCGAGCGAATTGT
CCTAACTGTAAACTAAATGATGTAAAAATTAAAGAACACTTTAATCTCTG
TCCAAATAAACCGAAAAAATGTAATTTGGCAAAATTAGGCTGTAATGGCA
AAATCATACCTGACTCAATACTATGCACCCTTGGAGATGGTCACAAAAAC
TTAATAAACTCCTATTTCAGAAAGATTTCTATGAAAATTAGTGACATTAC
AAAAGTTGACTTTGATCAATCTAGCAGTACTCAAGAGTTAGAAAGAATTT
CCAATGATATCAAATTTTTAAAAAATTCAATTTACAATCTGAAAACAGTA
CAAAAACTTCCGAGAAGTGGAAAGTTAATCTGGAAAATTGAAAATGCAAA
ATTATTTTTTGAAAATCAAATCCCGTTAATGAGTCCACAGGTCTACACTT
CTGATTACGGATATAAATTATGTTTGAAAGCATACCCAAATGGAGATGGA
ATTGGTATGGGGAGTCACTTATCTTTATATTTTGCTATACTTAAAGGAGA
ATACGATGATTTACTTGCTTGGCCTTTTAGATGTAAAGTGAAAATATTAT
TATTCAACAAAGATTTTAAGAACCGATCAAAATATGAAATTTACAAACCG
GATGAGTCAAGAGCCTTCCAACAACCGGAGAACGAGTCAAACATAGCAAC
CGGAAATCCGAAATTCATAACATTGGAGGCAGTACAAAATAATGGGTTCA
TTATAGACAATAGTATATTTATCGAACTTTATGTGGATCAGAAAAAGACA
TATCTCTGAAG
back to top

protein sequence of SMED30009675-orf-1

>SMED30009675-orf-1 ID=SMED30009675-orf-1|Name=SMED30009675-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=341bp
MTEIKANFKKPKNNQISNSKFNCSQCEESFYVEDLCEHSSKCAFNKSLMK
ESNGLCKYCYKMVSCPEGEHIHLTQFKPPECESFRANCPNCKLNDVKIKE
HFNLCPNKPKKCNLAKLGCNGKIIPDSILCTLGDGHKNLINSYFRKISMK
ISDITKVDFDQSSSTQELERISNDIKFLKNSIYNLKTVQKLPRSGKLIWK
IENAKLFFENQIPLMSPQVYTSDYGYKLCLKAYPNGDGIGMGSHLSLYFA
ILKGEYDDLLAWPFRCKVKILLFNKDFKNRSKYEIYKPDESRAFQQPENE
SNIATGNPKFITLEAVQNNGFIIDNSIFIELYVDQKKTYL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0005164tumor necrosis factor receptor binding
GO:0005515protein binding
GO:0008270zinc ion binding
GO:0046872metal ion binding
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
Vocabulary: biological process
TermDefinition
GO:0007165signal transduction
GO:0042981regulation of apoptotic process
GO:0043123positive regulation of I-kappaB kinase/NF-kappaB signaling
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR043211TNF_rcpt-assoc_TRAF
IPR002083MATH/TRAF_dom
IPR008974TRAF-like
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002083MATH/TRAF domainSMARTSM00061math_3coord: 196..316
e-value: 4.9E-6
score: 36.1
IPR002083MATH/TRAF domainPROSITEPS50144MATHcoord: 194..333
score: 20.672
IPR008974TRAF-likeGENE3DG3DSA:2.60.210.10coord: 147..335
e-value: 6.7E-45
score: 155.0
IPR008974TRAF-likeSUPERFAMILYSSF49599TRAF domain-likecoord: 194..335
NoneNo IPR availablePANTHERPTHR10131:SF127coord: 13..335
IPR043211TNF receptor-associated factor TRAFPANTHERPTHR10131TNF RECEPTOR ASSOCIATED FACTORcoord: 13..335