SMED30009673

Overview
NameSMED30009673
Smed IDSMED30009673
Length (bp)2496
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30009673 (SMED30009673) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30009673 (SMED30009673) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30009673 (SMED30009673) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30009673 (SMED30009673) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30009673

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30009673h1SMcG0011393 dd_Smed_v4_5502_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30009673h1SMcG0011393 dd_Smed_v4_5502_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30009673h1SMcG0011393 dd_Smed_v4_5502_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30009673h1SMcG0011393 dd_Smed_v4_5502_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30009673 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.000940:68970..71553 +12280
Homology
BLAST of SMED30009673 vs. Ensembl Human
Match: TSR1 (TSR1 ribosome maturation factor [Source:HGNC Symbol;Acc:HGNC:25542])

HSP 1 Score: 188.734 bits (478), Expect = 2.535e-49
Identity = 123/394 (31.22%), Postives = 189/394 (47.97%), Query Frame = -1
Query:   40 KFKKSREESMFPDEVEVPYNEKAKEKFSKYRGMLGFKSTQWPIQANLPKCYEKISFFKNYKHERNRLCNMIDKTVREHNANFILPGSVFEMVLEKVSPSDIEKLQNIIRMNPGRHLIGSGLFVKEEKLSVLHFNEKRIAAVDDSVINKLAKLSPSTDSAIALGEEATSHYDVIDENYQLKPAAEPIESKETMLFQLGFRRFSSTPIYSELTAASDQPGDKGKSKFLNFMELNKHVVVSTYGPITFGPVNVLQFRIRQQDESVDRAYVSELVASGSLLSIDPTKPIIKRIRLTGQIYKVNKRSAMIRYMFFNTEDIEHFKDVRLHAPGNILGRILEPHGSHGYMKCHFDKKVSQNVIPYMPLYKRVFPKFTVENMYDNFPNAEQAEMEDEAMSNV 1221
            K+K+ R E MFPDEV+ P +  A+ +F KYRG+  F+++ W  + NLP+ Y +I  F+N+ + R        K++ +      + G+     +          +    R   G  LI   L   E+K+SVL               N + +  P                             EP+++KE ++F  GFRRF ++P++S+ TAA        K K   F+  +  +V + Y PITF P +VL F+ +          +  L+A+G L+S+DP + +IKR+ L+G  +K+  + A++RYMFFN ED+  FK V L       G I EP G+HG+MKC FD K+       M LYKRVFPK+T    YD +       ++ E  S V
Sbjct:  474 KYKQERLEEMFPDEVDTPRDVAARIRFQKYRGLKSFRTSPWDPKENLPQDYARIFQFQNFTNTR--------KSIFKEVEEKEVEGAEVGWYVTLHVSEVPVSVVECFRQ--GTPLIAFSLLPHEQKMSVL---------------NMVVRRDPGN--------------------------TEPVKAKEELIFHCGFRRFRASPLFSQHTAAD-------KHKLQRFLTADMALVATVYAPITFPPASVLLFKQKSNG-------MHSLIATGHLMSVDPDRMVIKRVVLSGHPFKIFTKMAVVRYMFFNREDVLWFKPVELRTKWGRRGHIKEPLGTHGHMKCSFDGKLKSQDTVLMNLYKRVFPKWT----YDPYVPEPVPWLKSEISSTV 798          

HSP 2 Score: 63.929 bits (154), Expect = 9.051e-10
Identity = 66/269 (24.54%), Postives = 118/269 (43.87%), Query Frame = -1
Query: 1519 KQQRENSIKENNQSERGNNTNAPLLCGVFPLFHCEHIEVILSLLKSSDPESI-IKKIDNIPNYSKLNCESLIMKSKKLKKNFAFASCKDFKDRFDYLDLAKVVDWCLFIL-PDDLDELIGDYTEDLFSSLIAQGMPSGCFITLKSDKSFKMKDDI---KYLESIIKIPLADSKIHCLSNTNDANKLMRHLAQNCKPHYXXXXXXXXXXXXXXXKRGYFLAQNIKY---EEDNM----RLTGCMRGFGIDLEKSEFIHLTGVGDFSIKEV 2289
            KQ++E  + E  Q   G     P    V PL     +   + LL+  D  ++ + ++ N  N+        ++   +LK  + F S +   D    LD+AKV D  LF+L P +  +  GDY     S L AQG+P+   + ++      +K  I   K L   ++      K+  L    +A  L+R LA   + H +   +           R Y  A  + +   EE+N+    +++G +RG  +++ +   +H+ G GDF +K++
Sbjct:   62 KQKKEAVLAEKRQL--GGKDGPPHQVLVVPLHSRISLPEAMQLLQDRDTGTVHLNELGNTQNF--------MLLCPRLKHRWFFTSARP-GDLHVVLDMAKVADTILFLLDPLEGWDSTGDYC---LSCLFAQGLPTYT-LAVQGISGLPLKKQIDTRKKLSKAVEKRFPHDKLLLLDTQQEAGMLLRQLANQKQQHLAFRDR-----------RAYLFAHAVDFVPSEENNLVGTLKISGYVRGQTLNVNR--LLHIVGYGDFQMKQI 302          
BLAST of SMED30009673 vs. Ensembl Human
Match: BMS1 (BMS1 ribosome biogenesis factor [Source:HGNC Symbol;Acc:HGNC:23505])

HSP 1 Score: 60.8474 bits (146), Expect = 1.209e-8
Identity = 43/179 (24.02%), Postives = 86/179 (48.04%), Query Frame = -1
Query:  136 IESKETMLFQLGFRRFSSTPIYSELTAASDQPGDKGKSKFLNFMELNKHVVVSTYGPITFGPVNVLQFRIRQQDESVDRAYVS-ELVASGSLLSIDPTKPIIKRIRLTGQIYKVNKRSAMIRYMFFNTEDIEHFKDVRLHAPGNILGRILEP-HGSHGYMKCHFDKKVSQNVIPYMPLY 666
            ++S++ ++F +G+RRF + P+Y       D     G+ + L +   + H   + +GPIT      L        +SV        + A+G +L +D +  I+K+++LTG  YK+ K ++ I+ MF +  ++  F+   +     I G+I +      G  +  F+ K+  + I +M  +
Sbjct:  936 LKSRDPIIFSVGWRRFQTIPLY----YIEDH---NGRQRLLKYTPQHMHCGAAFWGPITPQGTGFLAI------QSVSGIMPDFRIAATGVVLDLDKSIKIVKKLKLTGFPYKIFKNTSFIKGMFNSALEVAKFEGAVIRTVSGIRGQIKKALRAPEGAFRASFEDKLLMSDIVFMRTW 1101          
BLAST of SMED30009673 vs. Ensembl Human
Match: TSR1 (TSR1 ribosome maturation factor [Source:HGNC Symbol;Acc:HGNC:25542])

HSP 1 Score: 53.5286 bits (127), Expect = 9.148e-7
Identity = 68/266 (25.56%), Postives = 115/266 (43.23%), Query Frame = -1
Query: 1519 KQQRENSIKENNQSERGNNTNAPLLCGVFPLFHCEHIEVILSLLKSSDPESI-IKKIDNIPNYSKLNCESLIMKSKKLKKNFAFASCKDFKDRFDYLDLAKVVDWCLFILPDDLDELIG-DYTEDLFSSLIAQGMPSGCFITLKSDKSFKMKDDIKYLESIIKIPLADSKIHCLSNTNDANKLMRHLAQNCKPHYXXXXXXXXXXXXXXXKRGYFLAQNIKY---EEDNM----RLTGCMRGFGIDLEKSEFIHLTGVGDFSIKEV 2289
            KQ++E  + E  Q   G     P    V PL     +   + LL+  D  ++ + ++ N  N+        ++   +LK  + F S +   D    LD+AKV D  LF+L    D L G D T     +L  QG+ SG  + LK     K  D  K L   ++      K+  L    +A  L+R LA   + H +   +           R Y  A  + +   EE+N+    +++G +RG  +++ +   +H+ G GDF +K++
Sbjct:   62 KQKKEAVLAEKRQL--GGKDGPPHQVLVVPLHSRISLPEAMQLLQDRDTGTVHLNELGNTQNF--------MLLCPRLKHRWFFTSARP-GDLHVVLDMAKVADTILFLL----DPLEGWDST-----ALAVQGI-SG--LPLK-----KQIDTRKKLSKAVEKRFPHDKLLLLDTQQEAGMLLRQLANQKQQHLAFRDR-----------RAYLFAHAVDFVPSEENNLVGTLKISGYVRGQTLNVNR--LLHIVGYGDFQMKQI 286          
BLAST of SMED30009673 vs. Ensembl Celegans
Match: tag-151 (Pre-rRNA-processing protein TSR1 homolog [Source:UniProtKB/Swiss-Prot;Acc:Q19329])

HSP 1 Score: 186.422 bits (472), Expect = 4.864e-49
Identity = 125/389 (32.13%), Postives = 193/389 (49.61%), Query Frame = -1
Query:  115 KMSFATTAHSGFSVAQIMKFKKSREESMFPDEVEVPYNEKAKEKFSKYRGMLGFKSTQWPIQANLPKCYEKISFFKNYKHERNRLCNMI--DKTVREHNANFILPGSVFEMVLEKVSPSDIEKLQNIIRMNPGRHLIGSGLFVKEEKLSVLHFNEKRIAAVDDSVINKLAKLSPSTDSAIALGEEATSHYDVIDENYQLKPAAEPIESKETMLFQLGFRRFSSTPIYSELTAASDQPGDKGKSKFLNFMELNKHVVVSTYGPITFGPVNVLQFRIRQQDESVDRAYVSELVASGSLLSIDPTKPIIKRIRLTGQIYKVNKRSAMIRYMFFNTEDIEHFKDVRLHAPGNILGRILEPHGSHGYMKCHFDKKVSQNVIPYMPLYKRVFPKF 1275
            +M F        ++A++ K++K RE + +PDEV+ P +  A+  F KYRG+  F+++ W  + NLP  Y +I  F NY++ +  + + I  +    +  A+    G+   + +E V  + +E  ++       ++L+   L   E K+SVL               N + K  PS    I             D+N +              +F +GFR+F +  ++S     S+ PGDK   K   FM   K  V + Y PITF P  VL FR  Q D+        ELVA+GS+L  +P + ++KR  L G  YK+N+R+ ++RYMFFN EDIE FK V L+ P    G I E  G+HG MKC FD++++      + LYKRVFP +
Sbjct:  423 EMMFDDGIDEDINMAEVEKYRKERENAQWPDEVDTPMDMPARIAFQKYRGLKSFRTSTWDPKENLPLDYARIFQFANYRNTKKNVMSKIGGNDVDADSVADKKFNGAFASVFIENVPVAVLEAYKD------AKNLVLFQLLPHEHKMSVL---------------NMVLKKHPSCTIPI-----------TSDQNQKF-------------IFYVGFRQFEANAVFS-----SNTPGDK--FKLERFMPTEKTFVATVYAPITFNPATVLCFR--QDDKGR-----QELVATGSILDSNPDRIVLKRTVLAGHPYKINRRAVVVRYMFFNREDIEWFKPVELYTPSGRRGHIKEAVGTHGNMKCRFDQQLNAQDSVMLNLYKRVFPVW 752          

HSP 2 Score: 49.6766 bits (117), Expect = 8.862e-6
Identity = 77/332 (23.19%), Postives = 136/332 (40.96%), Query Frame = -1
Query: 1519 GHKGRKFTQANKPHXXXXXXXXXXXXXKNGKKTKAVNN------------SKDLRVHQAKQQRENSIKENNQSERGNNTNAPLLCGVFPLFHCEHIEVILSLLKSSDPESIIKKIDNIPNYSKLNC-ESLIMKSKKLKKNFA---FASCKDF----KDRFD-YLDLAKVVDWCLFILPDDLDELIGDYTEDLFSSLIAQGMPSGCFIT--LKSDKSFKMKDDI-KYLESII-KIPLADSKIHCLSNTNDANKLMRHLAQNCKPHYXXXXXXXXXXXXXXXKRGYFLAQNIK-YEEDNMRLTGCMRGF--GIDLEKSEFIHLTGVGDFSIKEV 2430
            GH+   F + +KPHK      +  +     +  + V              SKD R +Q K  R+   K  +  ER   +NAP L              ++SL   + P   IKK+          C E++I  +     +FA   F S   F    KD  D  LD  +  D   F+ P  +   + ++ E L + + A G+P+   +   L S  + K K+D+ K +E II K  ++++ +    +  D  +L+R L +  K              +++ +  Y L +N++  ++     T   +G+  G +   +  +HL G GDF I ++
Sbjct:    5 GHRAGVFKKPSKPHKSWKGKRTKGEITSENRGREGVKQLTRSAHSTHRTISKDARRNQLKMARDQ--KMADAMERRRTSNAPCLV------------TVVSLGVGARPTEFIKKL--------ATCDETIIQTTSPSTIDFAIPRFKSRVSFLTPDKDNVDGVLDAIRASDVLCFLWP--MSAELSEWDEQLLTIIKANGLPTIVSVVPGLGSIANHKKKEDVRKGIEFIISKWSMSNAGVMPADSVTDNLQLLRILNETKK-----------KPLTLQARHSYMLVENLECSDKTGETCTLVAQGYLRGPEWNANNLVHLPGFGDFQISKI 301          
BLAST of SMED30009673 vs. Ensembl Celegans
Match: tag-151 (Pre-rRNA-processing protein TSR1 homolog [Source:UniProtKB/Swiss-Prot;Acc:Q19329])

HSP 1 Score: 186.422 bits (472), Expect = 4.864e-49
Identity = 125/389 (32.13%), Postives = 193/389 (49.61%), Query Frame = -1
Query:  115 KMSFATTAHSGFSVAQIMKFKKSREESMFPDEVEVPYNEKAKEKFSKYRGMLGFKSTQWPIQANLPKCYEKISFFKNYKHERNRLCNMI--DKTVREHNANFILPGSVFEMVLEKVSPSDIEKLQNIIRMNPGRHLIGSGLFVKEEKLSVLHFNEKRIAAVDDSVINKLAKLSPSTDSAIALGEEATSHYDVIDENYQLKPAAEPIESKETMLFQLGFRRFSSTPIYSELTAASDQPGDKGKSKFLNFMELNKHVVVSTYGPITFGPVNVLQFRIRQQDESVDRAYVSELVASGSLLSIDPTKPIIKRIRLTGQIYKVNKRSAMIRYMFFNTEDIEHFKDVRLHAPGNILGRILEPHGSHGYMKCHFDKKVSQNVIPYMPLYKRVFPKF 1275
            +M F        ++A++ K++K RE + +PDEV+ P +  A+  F KYRG+  F+++ W  + NLP  Y +I  F NY++ +  + + I  +    +  A+    G+   + +E V  + +E  ++       ++L+   L   E K+SVL               N + K  PS    I             D+N +              +F +GFR+F +  ++S     S+ PGDK   K   FM   K  V + Y PITF P  VL FR  Q D+        ELVA+GS+L  +P + ++KR  L G  YK+N+R+ ++RYMFFN EDIE FK V L+ P    G I E  G+HG MKC FD++++      + LYKRVFP +
Sbjct:  423 EMMFDDGIDEDINMAEVEKYRKERENAQWPDEVDTPMDMPARIAFQKYRGLKSFRTSTWDPKENLPLDYARIFQFANYRNTKKNVMSKIGGNDVDADSVADKKFNGAFASVFIENVPVAVLEAYKD------AKNLVLFQLLPHEHKMSVL---------------NMVLKKHPSCTIPI-----------TSDQNQKF-------------IFYVGFRQFEANAVFS-----SNTPGDK--FKLERFMPTEKTFVATVYAPITFNPATVLCFR--QDDKGR-----QELVATGSILDSNPDRIVLKRTVLAGHPYKINRRAVVVRYMFFNREDIEWFKPVELYTPSGRRGHIKEAVGTHGNMKCRFDQQLNAQDSVMLNLYKRVFPVW 752          

HSP 2 Score: 49.6766 bits (117), Expect = 8.862e-6
Identity = 77/332 (23.19%), Postives = 136/332 (40.96%), Query Frame = -1
Query: 1519 GHKGRKFTQANKPHXXXXXXXXXXXXXKNGKKTKAVNN------------SKDLRVHQAKQQRENSIKENNQSERGNNTNAPLLCGVFPLFHCEHIEVILSLLKSSDPESIIKKIDNIPNYSKLNC-ESLIMKSKKLKKNFA---FASCKDF----KDRFD-YLDLAKVVDWCLFILPDDLDELIGDYTEDLFSSLIAQGMPSGCFIT--LKSDKSFKMKDDI-KYLESII-KIPLADSKIHCLSNTNDANKLMRHLAQNCKPHYXXXXXXXXXXXXXXXKRGYFLAQNIK-YEEDNMRLTGCMRGF--GIDLEKSEFIHLTGVGDFSIKEV 2430
            GH+   F + +KPHK      +  +     +  + V              SKD R +Q K  R+   K  +  ER   +NAP L              ++SL   + P   IKK+          C E++I  +     +FA   F S   F    KD  D  LD  +  D   F+ P  +   + ++ E L + + A G+P+   +   L S  + K K+D+ K +E II K  ++++ +    +  D  +L+R L +  K              +++ +  Y L +N++  ++     T   +G+  G +   +  +HL G GDF I ++
Sbjct:    5 GHRAGVFKKPSKPHKSWKGKRTKGEITSENRGREGVKQLTRSAHSTHRTISKDARRNQLKMARDQ--KMADAMERRRTSNAPCLV------------TVVSLGVGARPTEFIKKL--------ATCDETIIQTTSPSTIDFAIPRFKSRVSFLTPDKDNVDGVLDAIRASDVLCFLWP--MSAELSEWDEQLLTIIKANGLPTIVSVVPGLGSIANHKKKEDVRKGIEFIISKWSMSNAGVMPADSVTDNLQLLRILNETKK-----------KPLTLQARHSYMLVENLECSDKTGETCTLVAQGYLRGPEWNANNLVHLPGFGDFQISKI 301          
BLAST of SMED30009673 vs. Ensembl Celegans
Match: Y61A9LA.10 (pep chromosome:WBcel235:V:4607039:4615817:-1 gene:WBGene00022021.1 transcript:Y61A9LA.10.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y61A9LA.10)

HSP 1 Score: 59.3066 bits (142), Expect = 9.995e-9
Identity = 41/186 (22.04%), Postives = 87/186 (46.77%), Query Frame = -1
Query:  115 IESKETMLFQLGFRRFSSTPIYSELTAASDQPGDKGKSKFLNFMELNKHVVVSTYGPITFGPVNVLQFRIRQQDESVDRAYVSELVASGSLLSIDPTKPIIKRIRLTGQIYKVNKRSAMIRYMFFNTEDIEHFKDVRLHAPGNILGRILEP-HGSHGYMKCHFDKKVSQNVIPYMPLYKRV-FPKF 666
            ++S++ ++   G+RRF +  IYS      D      + +FL +   + H   S +GP+      +L  +        D+     +VA+G +L +D +  ++K+++L G   K+ K++A ++ MF +  ++  F+   +     I G+I +      G  +  F+ K+    I ++  +  V  P+F
Sbjct:  710 LKSRDPLIISCGWRRFQTIAIYS----VQDH---NMRLRFLKYTPEHMHCHASFFGPVCAQNTGLLAIQ-----SIADKTPGYRIVATGGVLDLDKSTQVVKKLKLIGHPEKIFKKTAFVKGMFNSALEVAKFEGATIRTVAGIRGQIKKAIKAPEGAFRATFEDKILMRDIVFLRSWVTVPIPRF 883          
BLAST of SMED30009673 vs. Ensembl Fly
Match: Tsr1 (gene:FBgn0037073 transcript:FBtr0078342)

HSP 1 Score: 187.578 bits (475), Expect = 3.780e-49
Identity = 121/397 (30.48%), Postives = 199/397 (50.13%), Query Frame = -1
Query:  106 DNDPMDEKMSFATTAHSGFSVAQIMKFKKSREESMFPDEVEVPYNEKAKEKFSKYRGMLGFKSTQWPIQANLPKCYEKISFFKNYKHERNRLCNMIDKTVREHNANFILPGSVFEMVLEKVSPSDIEKLQNIIRMNPGRHLIGSGLFVKEEKLSVLHFNEKRIAAVDDSVINKLAKLSPSTDSAIALGEEATSHYDVIDENYQLKPAAEPIESKETMLFQLGFRRFSSTPIYSELTAASDQPGDKGKSKFLNFMELNKHVVVSTYGPITFGPVNVLQFRIRQQDESVDRAYVSELVASGSLLSIDPTKPIIKRIRLTGQIYKVNKRSAMIRYMFFNTEDIEHFKDVRLHAPGNILGRILEPHGSHGYMKCHFDKKVSQNVIPYMPLYKRVFPKFTVE 1296
            +++  D++M F     +      + K +++R + ++PDE++ P +  A+E+F KYRG+  F+++ W  + NLP  Y +I  F+N+   + R+ N      +E     +LPG    + +  V  S     ++   M+   ++I  G+   E ++ V++   +R+                  DS +                        P++SKE ++ Q G+RRF   PIYS+ T      GDK   KF  +    + V  + Y PI F P  VL F++   D ++       LVA G LLS +P + ++KR+ L+G   ++N++SA IRYMFF  ED+E+FK V+L      LG I E  G+HG+MKC+FD ++      +M LYKRVFPK+T E
Sbjct:  460 NDEKYDQQMDFQEERET------LKKLQQARTDQLWPDEIDTPLDVPARERFQKYRGLESFRTSPWDAKENLPADYARIYQFQNFDRTKRRILN----EAKEFEG--VLPGLYVTLYVINVPESRWNAFKSAQLMD---NIIVYGMLPHEHQMCVMNVVLQRMP-----------------DSEV------------------------PLKSKEQLIIQCGYRRFVVNPIYSQHTN-----GDK--HKFERYFRPYETVCATFYAPIQFPPAPVLAFKV-NPDSTL------ALVARGRLLSCNPDRIVLKRVVLSGHPMRINRKSASIRYMFFYKEDVEYFKPVKLRTKCGRLGHIKESLGTHGHMKCYFDGQLRSYDTAFMYLYKRVFPKWTYE 786          
BLAST of SMED30009673 vs. Ensembl Fly
Match: CG7728 (gene:FBgn0036686 transcript:FBtr0075274)

HSP 1 Score: 70.8626 bits (172), Expect = 4.433e-12
Identity = 41/186 (22.04%), Postives = 96/186 (51.61%), Query Frame = -1
Query:  115 IESKETMLFQLGFRRFSSTPIYSELTAASDQPGDKGKSKFLNFMELNKHVVVSTYGPITFGPVNVLQFRIRQQDESVDRAYVSELVASGSLLSIDPTKPIIKRIRLTGQIYKVNKRSAMIRYMFFNTEDIEHFKDVRLHAPGNILGRILEPHGS-HGYMKCHFDKKVSQNVIPYMPLYKRV-FPKF 666
            +++ + ++  +G+RRF +  IY+++        D  + ++L +   +    ++ +GPIT      L  +  +QD+   R     + A+G +  +D +  I+K+++L G  +K+ K++A ++ MF ++ ++  F+  ++     I G+I + H +  G  +  F+ K+  + I +   + RV  P+F
Sbjct:  821 LKTGDPLIISMGWRRFQTVAIYAKVE-------DNFRQRYLKYTPNHVTCSMTFWGPITPQNTGFLALQTVRQDQEEMRRLGFRIAATGCVTEVDKSSQIMKKLKLVGHPFKIYKKTAFVKDMFNSSLEVAKFEGAKIKTVSGIRGQIKKAHHTPEGSYRATFEDKILLSDIVFCRTWFRVEVPRF 999          
BLAST of SMED30009673 vs. Ensembl Zebrafish
Match: tsr1 (TSR1 ribosome maturation factor [Source:ZFIN;Acc:ZDB-GENE-030131-3762])

HSP 1 Score: 199.134 bits (505), Expect = 6.293e-53
Identity = 127/372 (34.14%), Postives = 190/372 (51.08%), Query Frame = -1
Query:  112 IMKFKKSREESMFPDEVEVPYNEKAKEKFSKYRGMLGFKSTQWPIQANLPKCYEKISFFKNYKHERNRLCNMIDKTVREHNANFILPGSVFEMVLEKVSPSDIEKLQNIIRMNPGRHLIGSGLFVKEEKLSVLHFNEKRIAAVDDSVINKLAKLSPSTDSAIALGEEATSHYDVIDENYQLKPAAEPIESKETMLFQLGFRRFSSTPIYSELTAASDQPGDKGKSKFLNFMELNKHVVVSTYGPITFGPVNVLQFRIRQQDESVDRAYVSELVASGSLLSIDPTKPIIKRIRLTGQIYKVNKRSAMIRYMFFNTEDIEHFKDVRLHAPGNILGRILEPHGSHGYMKCHFDKKVSQNVIPYMPLYKRVFPKFT 1227
            + +++++R   MFPDEV+ P +  ++ +F +YRG+  F+S+ W    NLP  Y +I  F+N++  R R+  + D    E  A   + G    + +  V PS +E  Q       G+ L+   L   E+K+SV+               N L +  PS                            EPI+SKE ++FQ GFRRF ++ I+S+ T      GDK   K   F+  +   ++S Y PITF    VL F+  Q+D  +      +LVA+GSLLS DP + ++KRI L+G  +K+N+RSA++RYMFFN +DI  FK V L       G I E  G+HG+MKC FD ++       M LYKRV+P +T
Sbjct:  491 LRRYREARANEMFPDEVDTPLDVPSRTRFQRYRGLKSFRSSPWDPLENLPSNYSRIFQFQNFERMRRRI--LADAANEEDGA---MVGWYVTLHIVDVPPSVMESFQT------GKPLVLVSLLPHEQKMSVM---------------NVLVRQHPSN--------------------------TEPIKSKEELVFQCGFRRFRASAIFSQHTT-----GDK--HKLERFLRPDAPTIMSFYAPITFPTAGVLVFK--QRDNGM-----QDLVATGSLLSCDPRRVVLKRIVLSGHPFKINRRSAVVRYMFFNRDDILWFKPVELRTKWGRRGHIKEALGTHGHMKCVFDSQLRSQDTVLMNLYKRVYPHWT 796          

HSP 2 Score: 66.6254 bits (161), Expect = 1.034e-10
Identity = 69/322 (21.43%), Postives = 132/322 (40.99%), Query Frame = -1
Query: 1519 HKGRKFTQANKPHXXXXXXXXXXXXXKNGKKTKAVNNSKDLRVHQAKQQRENSIKENNQSER----------GNNTNAPLLCGVFPLFHCEHIEVILSLLKSSDPESIIKKIDNIPNYSKLNCESLIMKSKKLKKNFAFASCKDFKDRFDYLDLAKVVDWCLFILPDDLDELIGDYTEDLFSSLIAQGMPSGCFITLK-SDKSFKMK-DDIKYLESIIKIPLADSKIHCLSNTNDANKLMRHLAQNCKPHYXXXXXXXXXXXXXXXKRGYFLAQNIKYEEDNMRL-----TGCMRGF--GIDLEKSEFIHLTGVGDFSIKEV 2427
            H+   + Q NK HK     +      +N  +   V  +K  R    K+ R N+  +  ++++          G+    P L  V  L        +  +L+      ++++   +        +S  +   + K+ F F    D  D    LD+AK+ D  +F+L  D +E    Y E   S L AQG+PS   +    +D + K + +  + L  +++    ++++  +    DA  L+RHL+                +   + +R + LAQ   Y  +N +      T C+ G+  G  L+ +  +H+TG GDF + ++
Sbjct:   12 HRPGVYKQKNKQHKHGKHRTKGEIGRENKGRVAIVALTKKQRREMRKKDRRNTANQLRRNKKDLVLTEKRKLGSRDGPPHLVAVIALHSRVDAGAVTKMLRGEGVGGVVREDQGVTGAK----DSFGLVLPRFKQRFTFYR-PDTDDLHSLLDVAKIADSLVFVL--DSNEGWDSYGEYCLSCLFAQGLPSHALVCQGVADLAVKKRTESRRALSRLVESRFPEARLFPVDCDQDAVLLLRHLSAQ-----------KQRRLGFRSRRSHLLAQRATYVPNNSQSGTGLGTLCVSGYIRGCPLQVNRLVHITGHGDFQLSQI 315          
BLAST of SMED30009673 vs. Ensembl Zebrafish
Match: tsr1 (TSR1 ribosome maturation factor [Source:ZFIN;Acc:ZDB-GENE-030131-3762])

HSP 1 Score: 199.134 bits (505), Expect = 6.405e-53
Identity = 127/372 (34.14%), Postives = 190/372 (51.08%), Query Frame = -1
Query:  112 IMKFKKSREESMFPDEVEVPYNEKAKEKFSKYRGMLGFKSTQWPIQANLPKCYEKISFFKNYKHERNRLCNMIDKTVREHNANFILPGSVFEMVLEKVSPSDIEKLQNIIRMNPGRHLIGSGLFVKEEKLSVLHFNEKRIAAVDDSVINKLAKLSPSTDSAIALGEEATSHYDVIDENYQLKPAAEPIESKETMLFQLGFRRFSSTPIYSELTAASDQPGDKGKSKFLNFMELNKHVVVSTYGPITFGPVNVLQFRIRQQDESVDRAYVSELVASGSLLSIDPTKPIIKRIRLTGQIYKVNKRSAMIRYMFFNTEDIEHFKDVRLHAPGNILGRILEPHGSHGYMKCHFDKKVSQNVIPYMPLYKRVFPKFT 1227
            + +++++R   MFPDEV+ P +  ++ +F +YRG+  F+S+ W    NLP  Y +I  F+N++  R R+  + D    E  A   + G    + +  V PS +E  Q       G+ L+   L   E+K+SV+               N L +  PS                            EPI+SKE ++FQ GFRRF ++ I+S+ T      GDK   K   F+  +   ++S Y PITF    VL F+  Q+D  +      +LVA+GSLLS DP + ++KRI L+G  +K+N+RSA++RYMFFN +DI  FK V L       G I E  G+HG+MKC FD ++       M LYKRV+P +T
Sbjct:  505 LRRYREARANEMFPDEVDTPLDVPSRTRFQRYRGLKSFRSSPWDPLENLPSNYSRIFQFQNFERMRRRI--LADAANEEDGA---MVGWYVTLHIVDVPPSVMESFQT------GKPLVLVSLLPHEQKMSVM---------------NVLVRQHPSN--------------------------TEPIKSKEELVFQCGFRRFRASAIFSQHTT-----GDK--HKLERFLRPDAPTIMSFYAPITFPTAGVLVFK--QRDNGM-----QDLVATGSLLSCDPRRVVLKRIVLSGHPFKINRRSAVVRYMFFNRDDILWFKPVELRTKWGRRGHIKEALGTHGHMKCVFDSQLRSQDTVLMNLYKRVYPHWT 810          

HSP 2 Score: 66.2402 bits (160), Expect = 1.394e-10
Identity = 69/322 (21.43%), Postives = 132/322 (40.99%), Query Frame = -1
Query: 1519 HKGRKFTQANKPHXXXXXXXXXXXXXKNGKKTKAVNNSKDLRVHQAKQQRENSIKENNQSER----------GNNTNAPLLCGVFPLFHCEHIEVILSLLKSSDPESIIKKIDNIPNYSKLNCESLIMKSKKLKKNFAFASCKDFKDRFDYLDLAKVVDWCLFILPDDLDELIGDYTEDLFSSLIAQGMPSGCFITLK-SDKSFKMK-DDIKYLESIIKIPLADSKIHCLSNTNDANKLMRHLAQNCKPHYXXXXXXXXXXXXXXXKRGYFLAQNIKYEEDNMRL-----TGCMRGF--GIDLEKSEFIHLTGVGDFSIKEV 2427
            H+   + Q NK HK     +      +N  +   V  +K  R    K+ R N+  +  ++++          G+    P L  V  L        +  +L+      ++++   +        +S  +   + K+ F F    D  D    LD+AK+ D  +F+L  D +E    Y E   S L AQG+PS   +    +D + K + +  + L  +++    ++++  +    DA  L+RHL+                +   + +R + LAQ   Y  +N +      T C+ G+  G  L+ +  +H+TG GDF + ++
Sbjct:   12 HRPGVYKQKNKQHKHGKHRTKGEIGRENKGRVAIVALTKKQRREMRKKDRRNTANQLRRNKKDLVLTEKRKLGSRDGPPHLVAVIALHSRVDAGAVTKMLRGEGVGGVVREDQGVTGAK----DSFGLVLPRFKQRFTFYR-PDTDDLHSLLDVAKIADSLVFVL--DSNEGWDSYGEYCLSCLFAQGLPSHALVCQGVADLAVKKRTESRRALSRLVESRFPEARLFPVDCDQDAVLLLRHLSAQ-----------KQRRLGFRSRRSHLLAQRATYVPNNSQSGTGLGTLCVSGYIRGCPLQVNRLVHITGHGDFQLSQI 315          
BLAST of SMED30009673 vs. Ensembl Zebrafish
Match: tsr1 (TSR1 ribosome maturation factor [Source:ZFIN;Acc:ZDB-GENE-030131-3762])

HSP 1 Score: 65.0846 bits (157), Expect = 2.176e-10
Identity = 69/322 (21.43%), Postives = 132/322 (40.99%), Query Frame = -1
Query: 1519 HKGRKFTQANKPHXXXXXXXXXXXXXKNGKKTKAVNNSKDLRVHQAKQQRENSIKENNQSER----------GNNTNAPLLCGVFPLFHCEHIEVILSLLKSSDPESIIKKIDNIPNYSKLNCESLIMKSKKLKKNFAFASCKDFKDRFDYLDLAKVVDWCLFILPDDLDELIGDYTEDLFSSLIAQGMPSGCFITLK-SDKSFKMK-DDIKYLESIIKIPLADSKIHCLSNTNDANKLMRHLAQNCKPHYXXXXXXXXXXXXXXXKRGYFLAQNIKYEEDNMRL-----TGCMRGF--GIDLEKSEFIHLTGVGDFSIKEV 2427
            H+   + Q NK HK     +      +N  +   V  +K  R    K+ R N+  +  ++++          G+    P L  V  L        +  +L+      ++++   +        +S  +   + K+ F F    D  D    LD+AK+ D  +F+L  D +E    Y E   S L AQG+PS   +    +D + K + +  + L  +++    ++++  +    DA  L+RHL+                +   + +R + LAQ   Y  +N +      T C+ G+  G  L+ +  +H+TG GDF + ++
Sbjct:   12 HRPGVYKQKNKQHKHGKHRTKGEIGRENKGRVAIVALTKKQRREMRKKDRRNTANQLRRNKKDLVLTEKRKLGSRDGPPHLVAVIALHSRVDAGAVTKMLRGEGVGGVVREDQGVTGAK----DSFGLVLPRFKQRFTFYR-PDTDDLHSLLDVAKIADSLVFVL--DSNEGWDSYGEYCLSCLFAQGLPSHALVCQGVADLAVKKRTESRRALSRLVESRFPEARLFPVDCDQDAVLLLRHLSAQ-----------KQRRLGFRSRRSHLLAQRATYVPNNSQSGTGLGTLCVSGYIRGCPLQVNRLVHITGHGDFQLSQI 315          
BLAST of SMED30009673 vs. Ensembl Zebrafish
Match: BX248124.1 (pep chromosome:GRCz11:CHR_ALT_CTG12_1_21:29249650:29260427:1 gene:ENSDARG00000110171.1 transcript:ENSDART00000182481.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:BX248124.1)

HSP 1 Score: 55.4546 bits (132), Expect = 1.957e-7
Identity = 36/148 (24.32%), Postives = 70/148 (47.30%), Query Frame = -1
Query:  223 IESKETMLFQLGFRRFSSTPIYSELTAASDQPGDKGKSKFLNFMELNKHVVVSTYGPITFGPVNVLQFRIRQQDESVDRAYVSELVASGSLLSIDPTKPIIKRIRLTGQIYKVNKRSAMIRYMFFNTEDIEHFKDVRLHAPGNILGRI 666
            +++++ ++  LG+RRF + P+Y       D     G+ + L +   + H   + +GPIT      L     Q    V   +   + A+G +L +D +  I+K+++L G  YK+ K +  I+ MF    ++  F+   +     I G+I
Sbjct:   82 LKTRDPLILSLGWRRFQTIPLYY----IEDH---NGRHRLLKYTPEHMHCGATIWGPITPQGTGFLAV---QTIGGVKANF--RIAATGVVLDLDKSVSIVKKLKLIGYPYKIFKNTCFIQGMFNTILEVAKFEGASIRTVSGIKGQI 217          
BLAST of SMED30009673 vs. Ensembl Zebrafish
Match: bms1 (BMS1 ribosome biogenesis factor [Source:ZFIN;Acc:ZDB-GENE-060720-2])

HSP 1 Score: 55.0694 bits (131), Expect = 4.097e-7
Identity = 36/148 (24.32%), Postives = 70/148 (47.30%), Query Frame = -1
Query:  223 IESKETMLFQLGFRRFSSTPIYSELTAASDQPGDKGKSKFLNFMELNKHVVVSTYGPITFGPVNVLQFRIRQQDESVDRAYVSELVASGSLLSIDPTKPIIKRIRLTGQIYKVNKRSAMIRYMFFNTEDIEHFKDVRLHAPGNILGRI 666
            +++++ ++  LG+RRF + P+Y       D     G+ + L +   + H   + +GPIT      L     Q    V   +   + A+G +L +D +  I+K+++L G  YK+ K +  I+ MF    ++  F+   +     I G+I
Sbjct:  876 LKTRDPLILSLGWRRFQTIPLYY----IEDH---NGRHRLLKYTPEHMHCGATIWGPITPQGTGFLAV---QTIGGVKANF--RIAATGVVLDLDKSVSIVKKLKLIGYPYKIFKNTCFIQGMFNTILEVAKFEGASIRTVSGIKGQI 1011          
BLAST of SMED30009673 vs. Ensembl Xenopus
Match: ccdc124 (coiled-coil domain containing 124 [Source:Xenbase;Acc:XB-GENE-1015198])

HSP 1 Score: 211.46 bits (537), Expect = 1.381e-57
Identity = 129/374 (34.49%), Postives = 197/374 (52.67%), Query Frame = -1
Query:  106 IMKFKKSREESMFPDEVEVPYNEKAKEKFSKYRGMLGFKSTQWPIQANLPKCYEKISFFKNYKHERNRLCNMIDKTVREHNANFILPGSVFEMVLEKVSPSDIEKLQNIIRMNPGRHLIGSGLFVKEEKLSVLHFNEKRIAAVDDSVINKLAKLSPSTDSAIALGEEATSHYDVIDENYQLKPAAEPIESKETMLFQLGFRRFSSTPIYSELTAASDQPGDKGKSKFLNFMELNKHVVVSTYGPITFGPVNVLQFRIRQQDESVDRAYVSELVASGSLLSIDPTKPIIKRIRLTGQIYKVNKRSAMIRYMFFNTEDIEHFKDVRLHAPGNILGRILEPHGSHGYMKCHFDKKVSQNVIPYMPLYKRVFPKFTVE 1227
            + K+K  R++ MFPDEV+ P ++ A+ +F KYRG+  F+++ W  + NLP+ Y +I  F ++   R R+     K   E +   ++ G    + +  V  S +E  ++      G  L+   L   E+K+SVL               N L +  P                             EPI++KE ++F  GFRRF ++P++S+ T+A     DK KS+   F+  +  VVV+ Y PITF P ++L F+ R          + +LVA+GSLL++DP + IIKRI L+G  +K+ KR+A++RYMFFN ED+  FK V L       G I EP G+HG+MKCHFD ++       M LYKRV+PK+T +
Sbjct:  371 LQKYKLQRQDEMFPDEVDTPRDQLARTRFQKYRGLKSFRTSPWDAKENLPRDYARIFQFHDFFRTRKRVL----KETEEKDEGAMV-GWYVTVHISAVPVSVMEHFKH------GLPLVLCSLLPHEQKMSVL---------------NMLVRRHPGN--------------------------TEPIKAKEELIFHCGFRRFRASPLFSQHTSA-----DKHKSE--RFLRSDTAVVVTVYAPITFPPASMLLFKQRHNG-------MHDLVATGSLLNVDPDRIIIKRIVLSGHPFKIMKRTAVVRYMFFNREDVLWFKPVELRTKWGRRGHIKEPLGTHGHMKCHFDGQLKSQDTVLMNLYKRVYPKWTFD 678          

HSP 2 Score: 64.3142 bits (155), Expect = 6.331e-10
Identity = 57/196 (29.08%), Postives = 95/196 (48.47%), Query Frame = -1
Query: 1519 LIMKSKKLKKNFAFASCKDFKDRFDYLDLAKVVDWCLFIL-PDDLDELIGDYTEDLFSSLIAQGMPSGCF-ITLKSDKSFKMKDDI-KYLESIIKIPLADSKIHCLSNTNDANKLMRHLAQNCKPHYXXXXXXXXXXXXXXXKRGYFLAQNIKYE-EDNMRLTGCMR--GF--GIDLEKSEFIHLTGVGDFSIKEV 2082
            L +   K+K+ ++F    +  D    LDLAKV D  LF+L P +  +  GDY     S L AQG+PS    +   +D + K + DI K+L  +I+    D+K+  L    +A  L+R +A   + H            + + +R Y LAQ   ++  D   L G ++  G+  G +L  +  +H+ G GDF + ++
Sbjct:   23 LALVCPKVKQRWSFIKA-NRDDLCSLLDLAKVADTLLFLLDPQEGWDSYGDYC---LSCLFAQGLPSFVLAVQGMNDIAIKKRADIKKHLSKVIENRFTDAKLFHLDTEQEAAVLIRQIATQKQRHL-----------AFRSRRSYMLAQRADFQPTDESGLVGTLKVSGYVRGQELNVNRLLHIVGHGDFQMSQI 203          
BLAST of SMED30009673 vs. Ensembl Xenopus
Match: ccdc124 (coiled-coil domain containing 124 [Source:Xenbase;Acc:XB-GENE-1015198])

HSP 1 Score: 210.69 bits (535), Expect = 5.623e-57
Identity = 129/372 (34.68%), Postives = 196/372 (52.69%), Query Frame = -1
Query:  112 IMKFKKSREESMFPDEVEVPYNEKAKEKFSKYRGMLGFKSTQWPIQANLPKCYEKISFFKNYKHERNRLCNMIDKTVREHNANFILPGSVFEMVLEKVSPSDIEKLQNIIRMNPGRHLIGSGLFVKEEKLSVLHFNEKRIAAVDDSVINKLAKLSPSTDSAIALGEEATSHYDVIDENYQLKPAAEPIESKETMLFQLGFRRFSSTPIYSELTAASDQPGDKGKSKFLNFMELNKHVVVSTYGPITFGPVNVLQFRIRQQDESVDRAYVSELVASGSLLSIDPTKPIIKRIRLTGQIYKVNKRSAMIRYMFFNTEDIEHFKDVRLHAPGNILGRILEPHGSHGYMKCHFDKKVSQNVIPYMPLYKRVFPKFT 1227
            + K+K  R++ MFPDEV+ P ++ A+ +F KYRG+  F+++ W  + NLP+ Y +I  F ++   R R+     K   E +   ++ G    + +  V  S +E  ++      G  L+   L   E+K+SVL               N L +  P                             EPI++KE ++F  GFRRF ++P++S+ T+A     DK KS+   F+  +  VVV+ Y PITF P ++L F+ R          + +LVA+GSLL++DP + IIKRI L+G  +K+ KR+A++RYMFFN ED+  FK V L       G I EP G+HG+MKCHFD ++       M LYKRV+PK+T
Sbjct:  447 LQKYKLQRQDEMFPDEVDTPRDQLARTRFQKYRGLKSFRTSPWDAKENLPRDYARIFQFHDFFRTRKRVL----KETEEKDEGAMV-GWYVTVHISAVPVSVMEHFKH------GLPLVLCSLLPHEQKMSVL---------------NMLVRRHPGN--------------------------TEPIKAKEELIFHCGFRRFRASPLFSQHTSA-----DKHKSE--RFLRSDTAVVVTVYAPITFPPASMLLFKQRHNG-------MHDLVATGSLLNVDPDRIIIKRIVLSGHPFKIMKRTAVVRYMFFNREDVLWFKPVELRTKWGRRGHIKEPLGTHGHMKCHFDGQLKSQDTVLMNLYKRVYPKWT 752          

HSP 2 Score: 73.9442 bits (180), Expect = 7.382e-13
Identity = 90/347 (25.94%), Postives = 151/347 (43.52%), Query Frame = -1
Query: 1450 GHKGRKFTQANKPHXXXXXXXXXXXXXKNGKKTKAVNNSK----DLR-------VHQAKQQRENSIKENNQSERGNNTNAPLLCGVFPLFHCEHIEVILSLLKSSDPESIIKKIDNIPNYSKLNCESLIMKSKKLKKNFAFASCKDFKDRFDYLDLAKVVDWCLFIL-PDDLDELIGDYTEDLFSSLIAQGMPSGCF-ITLKSDKSFKMKDDI-KYLESIIKIPLADSKIHCLSNTNDANKLMRHLAQNCKPHYXXXXXXXXXXXXXXXKRGYFLAQNIKYE-EDNMRLTGCMR--GF--GIDLEKSEFIHLTGVGDFSIKEV-SWISPEESNHFTEKDKVQSLKNF 2430
             H+   + Q NKPHK         +  +N  +  A + SK    DLR        +Q ++QR+ ++    +S  G     P L     L H   ++  +  L  ++   I+   D I     L C        K+K+ ++F    +  D    LDLAKV D  LF+L P +  +  GDY     S L AQG+PS    +   +D + K + DI K+L  +I+    D+K+  L    +A  L+R +A   + H            + + +R Y LAQ   ++  D   L G ++  G+  G +L  +  +H+ G GDF + ++ +   P   N    K K++S+ + 
Sbjct:    4 AHRPGAYKQQNKPHKTGRHRGRGAQDRENKGRVAAKSLSKKIKKDLRKLDRRHKANQIRRQRKEAVLAEKRS-LGTKDGPPHLVIAISL-HANAVKSDMFSLIQNNEGDILHVNDQIKGLLALVCP-------KVKQRWSFIKA-NRDDLCSLLDLAKVADTLLFLLDPQEGWDSYGDYC---LSCLFAQGLPSFVLAVQGMNDIAIKKRADIKKHLSKVIENRFTDAKLFHLDTEQEAAVLIRQIATQKQRHL-----------AFRSRRSYMLAQRADFQPTDESGLVGTLKVSGYVRGQELNVNRLLHIVGHGDFQMSQIDASPDPYPLNPRVHKPKIKSVTDM 326          
BLAST of SMED30009673 vs. Ensembl Xenopus
Match: ccdc124 (coiled-coil domain containing 124 [Source:Xenbase;Acc:XB-GENE-1015198])

HSP 1 Score: 211.075 bits (536), Expect = 6.190e-57
Identity = 129/372 (34.68%), Postives = 196/372 (52.69%), Query Frame = -1
Query:  112 IMKFKKSREESMFPDEVEVPYNEKAKEKFSKYRGMLGFKSTQWPIQANLPKCYEKISFFKNYKHERNRLCNMIDKTVREHNANFILPGSVFEMVLEKVSPSDIEKLQNIIRMNPGRHLIGSGLFVKEEKLSVLHFNEKRIAAVDDSVINKLAKLSPSTDSAIALGEEATSHYDVIDENYQLKPAAEPIESKETMLFQLGFRRFSSTPIYSELTAASDQPGDKGKSKFLNFMELNKHVVVSTYGPITFGPVNVLQFRIRQQDESVDRAYVSELVASGSLLSIDPTKPIIKRIRLTGQIYKVNKRSAMIRYMFFNTEDIEHFKDVRLHAPGNILGRILEPHGSHGYMKCHFDKKVSQNVIPYMPLYKRVFPKFT 1227
            + K+K  R++ MFPDEV+ P ++ A+ +F KYRG+  F+++ W  + NLP+ Y +I  F ++   R R+     K   E +   ++ G    + +  V  S +E  ++      G  L+   L   E+K+SVL               N L +  P                             EPI++KE ++F  GFRRF ++P++S+ T+A     DK KS+   F+  +  VVV+ Y PITF P ++L F+ R          + +LVA+GSLL++DP + IIKRI L+G  +K+ KR+A++RYMFFN ED+  FK V L       G I EP G+HG+MKCHFD ++       M LYKRV+PK+T
Sbjct:  480 LQKYKLQRQDEMFPDEVDTPRDQLARTRFQKYRGLKSFRTSPWDAKENLPRDYARIFQFHDFFRTRKRVL----KETEEKDEGAMV-GWYVTVHISAVPVSVMEHFKH------GLPLVLCSLLPHEQKMSVL---------------NMLVRRHPGN--------------------------TEPIKAKEELIFHCGFRRFRASPLFSQHTSA-----DKHKSE--RFLRSDTAVVVTVYAPITFPPASMLLFKQRHNG-------MHDLVATGSLLNVDPDRIIIKRIVLSGHPFKIMKRTAVVRYMFFNREDVLWFKPVELRTKWGRRGHIKEPLGTHGHMKCHFDGQLKSQDTVLMNLYKRVYPKWT 785          

HSP 2 Score: 74.3294 bits (181), Expect = 5.284e-13
Identity = 90/346 (26.01%), Postives = 152/346 (43.93%), Query Frame = -1
Query: 1453 GHKGRKFTQANKPHXXXXXXXXXXXXXKNGKKTKAVNNSK----DLR-------VHQAKQQRENSIKENNQSERGNNTNAPLLCGVFPLFHCEHIEVILSLLKSSDPESIIKKIDNIPNYSKLNCESLIMKSKKLKKNFAFASCKDFKDRFDYLDLAKVVDWCLFIL-PDDLDELIGDYTEDLFSSLIAQGMPSGCF-ITLKSDKSFKMKDDI-KYLESIIKIPLADSKIHCLSNTNDANKLMRHLAQNCKPHYXXXXXXXXXXXXXXXKRGYFLAQNIKYE-EDNMRLTGCMR--GF--GIDLEKSEFIHLTGVGDFSIKEV-SWISPEESNHFTEKDKVQSLKN 2430
             H+   + Q NKPHK         +  +N  +  A + SK    DLR        +Q ++QR+ ++    +S  G     P L     L H   ++  +  L  ++   I+   D I     L C        K+K+ ++F    +  D    LDLAKV D  LF+L P +  +  GDY     S L AQG+PS    +   +D + K + DI K+L  +I+    D+K+  L    +A  L+R +A   + H            + + +R Y LAQ   ++  D   L G ++  G+  G +L  +  +H+ G GDF + ++ +   P   N    K K++S+++
Sbjct:    9 AHRPGAYKQQNKPHKTGRHRGRGAQDRENKGRVAAKSLSKKIKKDLRKLDRRHKANQIRRQRKEAVLAEKRS-LGTKDGPPHLVIAISL-HANAVKSDMFSLIQNNEGDILHVNDQIKGLLALVCP-------KVKQRWSFIKA-NRDDLCSLLDLAKVADTLLFLLDPQEGWDSYGDYC---LSCLFAQGLPSFVLAVQGMNDIAIKKRADIKKHLSKVIENRFTDAKLFHLDTEQEAAVLIRQIATQKQRHL-----------AFRSRRSYMLAQRADFQPTDESGLVGTLKVSGYVRGQELNVNRLLHIVGHGDFQMSQIDASPDPYPLNPRVHKPKIKSVQD 330          
BLAST of SMED30009673 vs. Ensembl Xenopus
Match: ccdc124 (coiled-coil domain containing 124 [Source:Xenbase;Acc:XB-GENE-1015198])

HSP 1 Score: 211.075 bits (536), Expect = 6.592e-57
Identity = 129/374 (34.49%), Postives = 197/374 (52.67%), Query Frame = -1
Query:  106 IMKFKKSREESMFPDEVEVPYNEKAKEKFSKYRGMLGFKSTQWPIQANLPKCYEKISFFKNYKHERNRLCNMIDKTVREHNANFILPGSVFEMVLEKVSPSDIEKLQNIIRMNPGRHLIGSGLFVKEEKLSVLHFNEKRIAAVDDSVINKLAKLSPSTDSAIALGEEATSHYDVIDENYQLKPAAEPIESKETMLFQLGFRRFSSTPIYSELTAASDQPGDKGKSKFLNFMELNKHVVVSTYGPITFGPVNVLQFRIRQQDESVDRAYVSELVASGSLLSIDPTKPIIKRIRLTGQIYKVNKRSAMIRYMFFNTEDIEHFKDVRLHAPGNILGRILEPHGSHGYMKCHFDKKVSQNVIPYMPLYKRVFPKFTVE 1227
            + K+K  R++ MFPDEV+ P ++ A+ +F KYRG+  F+++ W  + NLP+ Y +I  F ++   R R+     K   E +   ++ G    + +  V  S +E  ++      G  L+   L   E+K+SVL               N L +  P                             EPI++KE ++F  GFRRF ++P++S+ T+A     DK KS+   F+  +  VVV+ Y PITF P ++L F+ R          + +LVA+GSLL++DP + IIKRI L+G  +K+ KR+A++RYMFFN ED+  FK V L       G I EP G+HG+MKCHFD ++       M LYKRV+PK+T +
Sbjct:  485 LQKYKLQRQDEMFPDEVDTPRDQLARTRFQKYRGLKSFRTSPWDAKENLPRDYARIFQFHDFFRTRKRVL----KETEEKDEGAMV-GWYVTVHISAVPVSVMEHFKH------GLPLVLCSLLPHEQKMSVL---------------NMLVRRHPGN--------------------------TEPIKAKEELIFHCGFRRFRASPLFSQHTSA-----DKHKSE--RFLRSDTAVVVTVYAPITFPPASMLLFKQRHNG-------MHDLVATGSLLNVDPDRIIIKRIVLSGHPFKIMKRTAVVRYMFFNREDVLWFKPVELRTKWGRRGHIKEPLGTHGHMKCHFDGQLKSQDTVLMNLYKRVYPKWTFD 792          

HSP 2 Score: 75.8702 bits (185), Expect = 1.756e-13
Identity = 93/362 (25.69%), Postives = 157/362 (43.37%), Query Frame = -1
Query: 1405 GHKGRKFTQANKPHXXXXXXXXXXXXXKNGKKTKAVNNSK----DLR-------VHQAKQQRENSIKENNQSERGNNTNAPLLCGVFPLFHCEHIEVILSLLKSSDPESIIKKIDNIPNYSKLNCESLIMKSKKLKKNFAFASCKDFKDRFDYLDLAKVVDWCLFIL-PDDLDELIGDYTEDLFSSLIAQGMPSGCF-ITLKSDKSFKMKDDI-KYLESIIKIPLADSKIHCLSNTNDANKLMRHLAQNCKPHYXXXXXXXXXXXXXXXKRGYFLAQNIKYE-EDNMRLTGCMR--GF--GIDLEKSEFIHLTGVGDFSIKEV-SWISPEESNHFTEKDKVQSLKNFVFKHEEINNEASDND 2430
             H+   + Q NKPHK         +  +N  +  A + SK    DLR        +Q ++QR+ ++    +S  G     P L     L H   ++  +  L  ++   I+   D I     L C        K+K+ ++F    +  D    LDLAKV D  LF+L P +  +  GDY     S L AQG+PS    +   +D + K + DI K+L  +I+    D+K+  L    +A  L+R +A   + H            + + +R Y LAQ   ++  D   L G ++  G+  G +L  +  +H+ G GDF + ++ +   P   N    K K++S+++     E  N+   + D
Sbjct:    9 AHRPGAYKQQNKPHKTGRHRGRGAQDRENKGRVAAKSLSKKIKKDLRKLDRRHKANQIRRQRKEAVLAEKRS-LGTKDGPPHLVIAISL-HANAVKSDMFSLIQNNEGDILHVNDQIKGLLALVCP-------KVKQRWSFIKA-NRDDLCSLLDLAKVADTLLFLLDPQEGWDSYGDYC---LSCLFAQGLPSFVLAVQGMNDIAIKKRADIKKHLSKVIENRFTDAKLFHLDTEQEAAVLIRQIATQKQRHL-----------AFRSRRSYMLAQRADFQPTDESGLVGTLKVSGYVRGQELNVNRLLHIVGHGDFQMSQIDASPDPYPLNPRVHKPKIKSVQDVEMSDELANSTDMEQD 346          
BLAST of SMED30009673 vs. Ensembl Xenopus
Match: ccdc124 (coiled-coil domain containing 124 [Source:Xenbase;Acc:XB-GENE-1015198])

HSP 1 Score: 210.69 bits (535), Expect = 8.263e-57
Identity = 129/374 (34.49%), Postives = 197/374 (52.67%), Query Frame = -1
Query:  106 IMKFKKSREESMFPDEVEVPYNEKAKEKFSKYRGMLGFKSTQWPIQANLPKCYEKISFFKNYKHERNRLCNMIDKTVREHNANFILPGSVFEMVLEKVSPSDIEKLQNIIRMNPGRHLIGSGLFVKEEKLSVLHFNEKRIAAVDDSVINKLAKLSPSTDSAIALGEEATSHYDVIDENYQLKPAAEPIESKETMLFQLGFRRFSSTPIYSELTAASDQPGDKGKSKFLNFMELNKHVVVSTYGPITFGPVNVLQFRIRQQDESVDRAYVSELVASGSLLSIDPTKPIIKRIRLTGQIYKVNKRSAMIRYMFFNTEDIEHFKDVRLHAPGNILGRILEPHGSHGYMKCHFDKKVSQNVIPYMPLYKRVFPKFTVE 1227
            + K+K  R++ MFPDEV+ P ++ A+ +F KYRG+  F+++ W  + NLP+ Y +I  F ++   R R+     K   E +   ++ G    + +  V  S +E  ++      G  L+   L   E+K+SVL               N L +  P                             EPI++KE ++F  GFRRF ++P++S+ T+A     DK KS+   F+  +  VVV+ Y PITF P ++L F+ R          + +LVA+GSLL++DP + IIKRI L+G  +K+ KR+A++RYMFFN ED+  FK V L       G I EP G+HG+MKCHFD ++       M LYKRV+PK+T +
Sbjct:  470 LQKYKLQRQDEMFPDEVDTPRDQLARTRFQKYRGLKSFRTSPWDAKENLPRDYARIFQFHDFFRTRKRVL----KETEEKDEGAMV-GWYVTVHISAVPVSVMEHFKH------GLPLVLCSLLPHEQKMSVL---------------NMLVRRHPGN--------------------------TEPIKAKEELIFHCGFRRFRASPLFSQHTSA-----DKHKSE--RFLRSDTAVVVTVYAPITFPPASMLLFKQRHNG-------MHDLVATGSLLNVDPDRIIIKRIVLSGHPFKIMKRTAVVRYMFFNREDVLWFKPVELRTKWGRRGHIKEPLGTHGHMKCHFDGQLKSQDTVLMNLYKRVYPKWTFD 777          

HSP 2 Score: 75.485 bits (184), Expect = 2.442e-13
Identity = 95/377 (25.20%), Postives = 162/377 (42.97%), Query Frame = -1
Query: 1378 GHKGRKFTQANKPHXXXXXXXXXXXXXKNGKKTKAVNNSK----DLR-------VHQAKQQRENSIKENNQSERGNNTNAPLLCGVFPLFHCEHIEVILSLLKSSDPESIIKKIDNIPNYSKLNCESLIMKSKKLKKNFAFASCKDFKDRFDYLDLAKVVDWCLFIL-PDDLDELIGDYTEDLFSSLIAQGMPSGCF-ITLKSDKSFKMKDDI-KYLESIIKIPLADSKIHCLSNTNDANKLMRHLAQNCKPHYXXXXXXXXXXXXXXXKRGYFLAQNIKYE-EDNMRLTGCMR--GF--GIDLEKSEFIHLTGVGDFSIKEV-SWISPEESNHFTEKDKVQSLKNFVFKHEEINNEASD------NDHESDEEMEC 2430
             H+   + Q NKPHK         +  +N  +  A + SK    DLR        +Q ++QR+ ++    +S  G     P L     L H   ++  +  L  ++   I+   D I     L C        K+K+ ++F    +  D    LDLAKV D  LF+L P +  +  GDY     S L AQG+PS    +   +D + K + DI K+L  +I+    D+K+  L    +A  L+R +A   + H            + + +R Y LAQ   ++  D   L G ++  G+  G +L  +  +H+ G GDF + ++ +   P   N    K K++S+++   +   I +   D       D  + E ++C
Sbjct:    4 AHRPGAYKQQNKPHKTGRHRGRGAQDRENKGRVAAKSLSKKIKKDLRKLDRRHKANQIRRQRKEAVLAEKRS-LGTKDGPPHLVIAISL-HANAVKSDMFSLIQNNEGDILHVNDQIKGLLALVCP-------KVKQRWSFIKA-NRDDLCSLLDLAKVADTLLFLLDPQEGWDSYGDYC---LSCLFAQGLPSFVLAVQGMNDIAIKKRADIKKHLSKVIENRFTDAKLFHLDTEQEAAVLIRQIATQKQRHL-----------AFRSRRSYMLAQRADFQPTDESGLVGTLKVSGYVRGQELNVNRLLHIVGHGDFQMSQIDASPDPYPLNPRVHKPKIKSVQDVEMEFLGITDMEQDIKVLMKADPSARESLQC 356          
BLAST of SMED30009673 vs. Ensembl Mouse
Match: Tsr1 (TSR1 20S rRNA accumulation [Source:MGI Symbol;Acc:MGI:2144566])

HSP 1 Score: 203.756 bits (517), Expect = 1.564e-54
Identity = 126/370 (34.05%), Postives = 186/370 (50.27%), Query Frame = -1
Query:  112 KFKKSREESMFPDEVEVPYNEKAKEKFSKYRGMLGFKSTQWPIQANLPKCYEKISFFKNYKHERNRLCNMIDKTVREHNANFILPGSVFEMVLEKVSPSDIEKLQNIIRMNPGRHLIGSGLFVKEEKLSVLHFNEKRIAAVDDSVINKLAKLSPSTDSAIALGEEATSHYDVIDENYQLKPAAEPIESKETMLFQLGFRRFSSTPIYSELTAASDQPGDKGKSKFLNFMELNKHVVVSTYGPITFGPVNVLQFRIRQQDESVDRAYVSELVASGSLLSIDPTKPIIKRIRLTGQIYKVNKRSAMIRYMFFNTEDIEHFKDVRLHAPGNILGRILEPHGSHGYMKCHFDKKVSQNVIPYMPLYKRVFPKFT 1221
            K+K+ R E MFPDE++ P +  A+ +F KYRG+  F+++ W  + NLP+ Y +I  F+N+ + R R    I K + E  A     G    + +  V  S +E  +       G  LI   L   E+K+SVL               N +   +P                             EP+++KE ++F  GFRRF ++P++S+ TAA        K KF  F+  +   VV+ + PITF P +VL F+ R       R  +  L+A+G L S+DP + +IKR+ L+G  +K+  + A++RYMFFN ED+  FK V L       G I EP G+HG+MKC FD K+       M LYKRVFPK+T
Sbjct:  473 KYKQERLEEMFPDEMDTPRDVAARIRFQKYRGLKSFRTSPWDPKENLPRDYARIFQFQNFVNTRKR----IFKEIEEKEAEGAEVGWYVTLHVSDVPVSVVEYFRQ------GAPLIAFSLLPYEQKMSVL---------------NMVVSRNPGN--------------------------TEPVKAKEELIFHCGFRRFRASPLFSQHTAAD-------KHKFQRFLTADAAFVVTVFAPITFPPASVLLFKQR-------RNGMHSLIATGHLFSVDPDRMVIKRVVLSGHPFKIFTKMAVVRYMFFNREDVMWFKPVELRTKWGRRGHIKEPLGTHGHMKCSFDGKLKSQDTVLMNLYKRVFPKWT 777          

HSP 2 Score: 56.225 bits (134), Expect = 1.855e-7
Identity = 63/268 (23.51%), Postives = 116/268 (43.28%), Query Frame = -1
Query: 1519 KQQRENSIKENNQSERGNNTNAPLLCGVFPLFHCEHIEVILSLLKSSDPESIIKKIDNIPNYSKLNCESLIMKSKKLKKNFAFASCKDFKDRFDYLDLAKVVDWCLFIL-PDDLDELIGDYTEDLFSSLIAQGMPSGCFITLKSDKSFKMKDDI---KYLESIIKIPLADSKIHCLSNTNDANKLMRHLAQNCKPHYXXXXXXXXXXXXXXXKRGYFLAQNIKY----EED---NMRLTGCMRGFGIDLEKSEFIHLTGVGDFSIKEV 2289
            KQ+RE+ + E  Q   G+    P    V PL     +     LL++ D       +  +    + + +S ++    LK  + F   +   D    LD+AKV D  LF+L P +  +  GDY     S L AQG+P+   + ++    F  K  I   K L  +++    + K+  L    ++  L+R LA   + H            + +++R Y  A    +    E D    ++++G +RG  +++  +  +H+ G GDF + ++
Sbjct:   62 KQKRESVLAEKRQL--GSKDGPPHQVLVVPLHSRISLPEAFKLLQNED-------LGTVYLSERGSTQSFMLLCPSLKHRWFFTYARP-GDLHTLLDMAKVADTILFLLDPLEGWDSTGDYC---LSCLFAQGLPTYT-LAVQGLSGFPPKKQIDARKKLSKMVEKRFPEDKLLLLDTQQESGMLLRQLANQKQRHL-----------AFRDRRAYLFAHVADFVPSEESDLVGTLKISGYVRGRTLNV--NSLLHIVGHGDFQMNQI 302          
BLAST of SMED30009673 vs. Ensembl Mouse
Match: Bms1 (BMS1, ribosome biogenesis factor [Source:MGI Symbol;Acc:MGI:2446132])

HSP 1 Score: 59.3066 bits (142), Expect = 2.363e-8
Identity = 42/179 (23.46%), Postives = 86/179 (48.04%), Query Frame = -1
Query:  136 IESKETMLFQLGFRRFSSTPIYSELTAASDQPGDKGKSKFLNFMELNKHVVVSTYGPITFGPVNVLQFRIRQQDESVDRAYVS-ELVASGSLLSIDPTKPIIKRIRLTGQIYKVNKRSAMIRYMFFNTEDIEHFKDVRLHAPGNILGRILEP-HGSHGYMKCHFDKKVSQNVIPYMPLY 666
            ++S++ ++F +G+RRF + P+Y       D     G+ + L +   + H   + +GPIT      L        +SV        + A+G +L +D +  I+K+++LTG  +K+ K ++ I+ MF +  ++  F+   +     I G+I +      G  +  F+ K+  + I +M  +
Sbjct:  940 LKSRDPIIFSVGWRRFQTIPLY----YIEDH---NGRQRLLKYTPQHMHCGATFWGPITPQGTGFLAI------QSVSGVMPEFRIAATGVVLDLDKSIKIVKKLKLTGFPFKIFKNTSFIKGMFNSALEVAKFEGAVIRTVSGIRGQIKKALRAPEGAFRASFEDKLLMSDIVFMRTW 1105          
BLAST of SMED30009673 vs. UniProt/SwissProt
Match: sp|Q5XGY1|TSR1_XENLA (Pre-rRNA-processing protein TSR1 homolog OS=Xenopus laevis OX=8355 GN=tsr1 PE=2 SV=1)

HSP 1 Score: 203.371 bits (516), Expect = 1.502e-53
Identity = 124/370 (33.51%), Postives = 194/370 (52.43%), Query Frame = -1
Query:  112 KFKKSREESMFPDEVEVPYNEKAKEKFSKYRGMLGFKSTQWPIQANLPKCYEKISFFKNYKHERNRLCNMIDKTVREHNANFILPGSVFEMVLEKVSPSDIEKLQNIIRMNPGRHLIGSGLFVKEEKLSVLHFNEKRIAAVDDSVINKLAKLSPSTDSAIALGEEATSHYDVIDENYQLKPAAEPIESKETMLFQLGFRRFSSTPIYSELTAASDQPGDKGKSKFLNFMELNKHVVVSTYGPITFGPVNVLQFRIRQQDESVDRAYVSELVASGSLLSIDPTKPIIKRIRLTGQIYKVNKRSAMIRYMFFNTEDIEHFKDVRLHAPGNILGRILEPHGSHGYMKCHFDKKVSQNVIPYMPLYKRVFPKFT 1221
            K+K  R++ +FPDEV+ P ++ A+ +F KYRG+  F+++ W ++ NLP+ Y +I  F ++   R R+         E      + G    + +  V  S +E  ++      G  L+   L   E+K+SV+               N L +  P  +                          EPI++KE ++F  GFRRF ++P++S+ ++A     DK KS+   F+  +  VVV+ Y PITF P +VL F+ R          + +LVA+GSLL+++P + +IKRI L+G  +K+ KR+A++RYMFFN ED+  FK V L       G I EP G+HG+MKCHFD ++       M LYKRV+PK+T
Sbjct:  486 KYKLQRQDEVFPDEVDTPRDQIARIRFQKYRGLKSFRTSPWDVKENLPRDYARIFQFHDFFRTRKRVFKE-----EEEKDEGAMVGWYVTVHISAVPVSVMEHFKH------GLPLVLCSLLPHEQKMSVM---------------NMLVRRHPGNN--------------------------EPIKAKEELIFHCGFRRFRASPLFSQHSSA-----DKHKSE--RFLRSDTSVVVTVYAPITFPPASVLVFKQRYNG-------MQDLVATGSLLNVNPDRIVIKRIVLSGHPFKIMKRTAVVRYMFFNREDVLWFKPVELRTKWGRRGHIKEPLGTHGHMKCHFDGQLKSQDTVLMNLYKRVYPKWT 789          

HSP 2 Score: 70.8626 bits (172), Expect = 3.603e-11
Identity = 82/325 (25.23%), Postives = 138/325 (42.46%), Query Frame = -1
Query: 1519 GHKGRKFTQANKPHXXXXXXXXXXXXXKNGKKTKAV----NNSKDLR-------VHQAKQQRENSIKENNQSERGNNTNAPLLCGVFPLFHCEHIEVILSLLKSSDPESIIKKIDNIPNYSKLNCESLIMKSKKLKKNFAFASCKDFKDRFDYLDLAKVVDWCLFIL-PDDLDELIGDYTEDLFSSLIAQGMPSGCFITLKSDK-SFKMKDDI-KYLESIIKIPLADSKIHCLSNTNDANKLMRHLAQNCKPHYXXXXXXXXXXXXXXXKRGYFLAQNIKYEEDN-------MRLTGCMRGFGIDLEKSEFIHLTGVGDFSIKEV 2430
             H+   + Q NKPHK         +  +N  +  A      N KDLR        +Q ++QR++++    +S  G     P L     L H   ++  L  L  ++   I+   D I     L C        K+K+ + F    +  D    LDLAKV D  LF+L P +  +  GDY     S L AQG+PS        +    K + DI K L  +I+    D+K+  L    +A  L+R ++   + H            + + +R Y LAQ   ++  +       ++L+G +RG  +++ +   +H+ G GDF + ++
Sbjct:    9 AHRPGAYKQQNKPHKSGRHRGRGAQDRENKGRVAAKILGKKNKKDLRKLDRRHKANQIRRQRKDAVLAEKRS-LGTKDGPPHLVIAISL-HARAVKDDLFSLVQNNEGDILHVNDQIKGLLALVC-------PKVKQRWCFIQA-NRDDLCSLLDLAKVADTLLFLLDPQEGWDSYGDYC---LSCLFAQGLPSYVLAVQGMNYIPIKKRADIKKQLSKVIENRFTDAKLFQLDTEQEAAVLIRQISTQKQRHL-----------AFRSRRSYMLAQRADFQPTDESGLVGTLKLSGYVRGQELNVNR--LVHIVGHGDFHMSQI 307          
BLAST of SMED30009673 vs. UniProt/SwissProt
Match: sp|Q5SWD9|TSR1_MOUSE (Pre-rRNA-processing protein TSR1 homolog OS=Mus musculus OX=10090 GN=Tsr1 PE=1 SV=1)

HSP 1 Score: 202.986 bits (515), Expect = 2.004e-53
Identity = 126/370 (34.05%), Postives = 186/370 (50.27%), Query Frame = -1
Query:  112 KFKKSREESMFPDEVEVPYNEKAKEKFSKYRGMLGFKSTQWPIQANLPKCYEKISFFKNYKHERNRLCNMIDKTVREHNANFILPGSVFEMVLEKVSPSDIEKLQNIIRMNPGRHLIGSGLFVKEEKLSVLHFNEKRIAAVDDSVINKLAKLSPSTDSAIALGEEATSHYDVIDENYQLKPAAEPIESKETMLFQLGFRRFSSTPIYSELTAASDQPGDKGKSKFLNFMELNKHVVVSTYGPITFGPVNVLQFRIRQQDESVDRAYVSELVASGSLLSIDPTKPIIKRIRLTGQIYKVNKRSAMIRYMFFNTEDIEHFKDVRLHAPGNILGRILEPHGSHGYMKCHFDKKVSQNVIPYMPLYKRVFPKFT 1221
            K+K+ R E MFPDE++ P +  A+ +F KYRG+  F+++ W  + NLP+ Y +I  F+N+ + R R    I K + E  A     G    + +  V  S +E  +       G  LI   L   E+K+SVL               N +   +P                             EP+++KE ++F  GFRRF ++P++S+ TAA        K KF  F+  +   VV+ + PITF P +VL F+ R       R  +  L+A+G L S+DP + +IKR+ L+G  +K+  + A++RYMFFN ED+  FK V L       G I EP G+HG+MKC FD K+       M LYKRVFPK+T
Sbjct:  473 KYKQERLEEMFPDEMDTPRDVAARIRFQKYRGLKSFRTSPWDPKENLPRDYARIFQFQNFVNTRKR----IFKEIEEKEAEGAEVGWYVTLHVSDVPVSVVEYFRQ------GAPLIAFSLLPYEQKMSVL---------------NMVVSRNPGN--------------------------TEPVKAKEELIFHCGFRRFRASPLFSQHTAAD-------KHKFQRFLTADAAFVVTVFAPITFPPASVLLFKQR-------RNGMHSLIATGHLFSVDPDRMVIKRVVLSGHPFKIFTKMAVVRYMFFNREDVMWFKPVELRTKWGRRGHIKEPLGTHGHMKCSFDGKLKSQDTVLMNLYKRVFPKWT 777          
BLAST of SMED30009673 vs. UniProt/SwissProt
Match: sp|Q2NL82|TSR1_HUMAN (Pre-rRNA-processing protein TSR1 homolog OS=Homo sapiens OX=9606 GN=TSR1 PE=1 SV=1)

HSP 1 Score: 188.734 bits (478), Expect = 1.217e-48
Identity = 123/394 (31.22%), Postives = 189/394 (47.97%), Query Frame = -1
Query:   40 KFKKSREESMFPDEVEVPYNEKAKEKFSKYRGMLGFKSTQWPIQANLPKCYEKISFFKNYKHERNRLCNMIDKTVREHNANFILPGSVFEMVLEKVSPSDIEKLQNIIRMNPGRHLIGSGLFVKEEKLSVLHFNEKRIAAVDDSVINKLAKLSPSTDSAIALGEEATSHYDVIDENYQLKPAAEPIESKETMLFQLGFRRFSSTPIYSELTAASDQPGDKGKSKFLNFMELNKHVVVSTYGPITFGPVNVLQFRIRQQDESVDRAYVSELVASGSLLSIDPTKPIIKRIRLTGQIYKVNKRSAMIRYMFFNTEDIEHFKDVRLHAPGNILGRILEPHGSHGYMKCHFDKKVSQNVIPYMPLYKRVFPKFTVENMYDNFPNAEQAEMEDEAMSNV 1221
            K+K+ R E MFPDEV+ P +  A+ +F KYRG+  F+++ W  + NLP+ Y +I  F+N+ + R        K++ +      + G+     +          +    R   G  LI   L   E+K+SVL               N + +  P                             EP+++KE ++F  GFRRF ++P++S+ TAA        K K   F+  +  +V + Y PITF P +VL F+ +          +  L+A+G L+S+DP + +IKR+ L+G  +K+  + A++RYMFFN ED+  FK V L       G I EP G+HG+MKC FD K+       M LYKRVFPK+T    YD +       ++ E  S V
Sbjct:  474 KYKQERLEEMFPDEVDTPRDVAARIRFQKYRGLKSFRTSPWDPKENLPQDYARIFQFQNFTNTR--------KSIFKEVEEKEVEGAEVGWYVTLHVSEVPVSVVECFRQ--GTPLIAFSLLPHEQKMSVL---------------NMVVRRDPGN--------------------------TEPVKAKEELIFHCGFRRFRASPLFSQHTAAD-------KHKLQRFLTADMALVATVYAPITFPPASVLLFKQKSNG-------MHSLIATGHLMSVDPDRMVIKRVVLSGHPFKIFTKMAVVRYMFFNREDVLWFKPVELRTKWGRRGHIKEPLGTHGHMKCSFDGKLKSQDTVLMNLYKRVFPKWT----YDPYVPEPVPWLKSEISSTV 798          

HSP 2 Score: 63.929 bits (154), Expect = 4.347e-9
Identity = 66/269 (24.54%), Postives = 118/269 (43.87%), Query Frame = -1
Query: 1519 KQQRENSIKENNQSERGNNTNAPLLCGVFPLFHCEHIEVILSLLKSSDPESI-IKKIDNIPNYSKLNCESLIMKSKKLKKNFAFASCKDFKDRFDYLDLAKVVDWCLFIL-PDDLDELIGDYTEDLFSSLIAQGMPSGCFITLKSDKSFKMKDDI---KYLESIIKIPLADSKIHCLSNTNDANKLMRHLAQNCKPHYXXXXXXXXXXXXXXXKRGYFLAQNIKY---EEDNM----RLTGCMRGFGIDLEKSEFIHLTGVGDFSIKEV 2289
            KQ++E  + E  Q   G     P    V PL     +   + LL+  D  ++ + ++ N  N+        ++   +LK  + F S +   D    LD+AKV D  LF+L P +  +  GDY     S L AQG+P+   + ++      +K  I   K L   ++      K+  L    +A  L+R LA   + H +   +           R Y  A  + +   EE+N+    +++G +RG  +++ +   +H+ G GDF +K++
Sbjct:   62 KQKKEAVLAEKRQL--GGKDGPPHQVLVVPLHSRISLPEAMQLLQDRDTGTVHLNELGNTQNF--------MLLCPRLKHRWFFTSARP-GDLHVVLDMAKVADTILFLLDPLEGWDSTGDYC---LSCLFAQGLPTYT-LAVQGISGLPLKKQIDTRKKLSKAVEKRFPHDKLLLLDTQQEAGMLLRQLANQKQQHLAFRDR-----------RAYLFAHAVDFVPSEENNLVGTLKISGYVRGQTLNVNR--LLHIVGYGDFQMKQI 302          
BLAST of SMED30009673 vs. UniProt/SwissProt
Match: sp|Q61WR2|TSR1_CAEBR (Pre-rRNA-processing protein TSR1 homolog OS=Caenorhabditis briggsae OX=6238 GN=tag-151 PE=3 SV=1)

HSP 1 Score: 187.963 bits (476), Expect = 1.861e-48
Identity = 129/402 (32.09%), Postives = 197/402 (49.00%), Query Frame = -1
Query:  121 PMDEKMSFATTAHS----------GFSVAQIMKFKKSREESMFPDEVEVPYNEKAKEKFSKYRGMLGFKSTQWPIQANLPKCYEKISFFKNYKHERNRLCNMIDKTVREHNANFI---LPGSVFEMVLEKVSPSDIEKLQNIIRMNPGRHLIGSGLFVKEEKLSVLHFNEKRIAAVDDSVINKLAKLSPSTDSAIALGEEATSHYDVIDENYQLKPAAEPIESKETMLFQLGFRRFSSTPIYSELTAASDQPGDKGKSKFLNFMELNKHVVVSTYGPITFGPVNVLQFRIRQQDESVDRAYVSELVASGSLLSIDPTKPIIKRIRLTGQIYKVNKRSAMIRYMFFNTEDIEHFKDVRLHAPGNILGRILEPHGSHGYMKCHFDKKVSQNVIPYMPLYKRVFP 1287
            PMD K     T  S            ++A++ K++K RE + +PDEV+ P ++ A+ +F KYRG+  F+++ W  + NLP  Y +I  F NYK+ +  + + I     +     I     G    + +E V  S +E  +        ++L+   L   E+K+S+L               N + K  PS    + +G E        D+ +               +F +GFR+F +  + S     S+ PGDK   K   FM   K  V + Y PITF P  VL FR  Q D+        ELVA+GS+L  +P + ++KR  L+G  YK+N+R+ ++RYMFFN EDI+ FK V L+ P    G I E  G+HG+MKC FD++++      + LYKRVFP
Sbjct:  412 PMDLKSEAGETTASEMMFHDEIDEDINLAEVEKYRKERENAQWPDEVDTPIDQPARIRFQKYRGLKSFRTSTWDAKENLPVDYARIFQFANYKNTKKNVMSKIGGNDVDAGDAVIDKKFNGVFASVYIENVPVSVMEAYKET------KNLVLFQLLPHEQKMSIL---------------NMVLKKHPS--CTVPIGSE--------DQKF---------------IFYVGFRQFEAHAVLS-----SNTPGDK--FKLERFMPTEKTFVATVYAPITFNPATVLCFR--QDDKGR-----QELVATGSVLDTNPDRIVLKRTVLSGHPYKINRRAVVVRYMFFNREDIDWFKPVELYTPSGRRGHIKEAVGTHGHMKCRFDQQLNAQDSVMLNLYKRVFP 753          
BLAST of SMED30009673 vs. UniProt/SwissProt
Match: sp|Q9VP47|TSR1_DROME (Pre-rRNA-processing protein TSR1 homolog OS=Drosophila melanogaster OX=7227 GN=Tsr1 PE=1 SV=1)

HSP 1 Score: 187.578 bits (475), Expect = 3.789e-48
Identity = 121/397 (30.48%), Postives = 199/397 (50.13%), Query Frame = -1
Query:  106 DNDPMDEKMSFATTAHSGFSVAQIMKFKKSREESMFPDEVEVPYNEKAKEKFSKYRGMLGFKSTQWPIQANLPKCYEKISFFKNYKHERNRLCNMIDKTVREHNANFILPGSVFEMVLEKVSPSDIEKLQNIIRMNPGRHLIGSGLFVKEEKLSVLHFNEKRIAAVDDSVINKLAKLSPSTDSAIALGEEATSHYDVIDENYQLKPAAEPIESKETMLFQLGFRRFSSTPIYSELTAASDQPGDKGKSKFLNFMELNKHVVVSTYGPITFGPVNVLQFRIRQQDESVDRAYVSELVASGSLLSIDPTKPIIKRIRLTGQIYKVNKRSAMIRYMFFNTEDIEHFKDVRLHAPGNILGRILEPHGSHGYMKCHFDKKVSQNVIPYMPLYKRVFPKFTVE 1296
            +++  D++M F     +      + K +++R + ++PDE++ P +  A+E+F KYRG+  F+++ W  + NLP  Y +I  F+N+   + R+ N      +E     +LPG    + +  V  S     ++   M+   ++I  G+   E ++ V++   +R+                  DS +                        P++SKE ++ Q G+RRF   PIYS+ T      GDK   KF  +    + V  + Y PI F P  VL F++   D ++       LVA G LLS +P + ++KR+ L+G   ++N++SA IRYMFF  ED+E+FK V+L      LG I E  G+HG+MKC+FD ++      +M LYKRVFPK+T E
Sbjct:  460 NDEKYDQQMDFQEERET------LKKLQQARTDQLWPDEIDTPLDVPARERFQKYRGLESFRTSPWDAKENLPADYARIYQFQNFDRTKRRILN----EAKEFEG--VLPGLYVTLYVINVPESRWNAFKSAQLMD---NIIVYGMLPHEHQMCVMNVVLQRMP-----------------DSEV------------------------PLKSKEQLIIQCGYRRFVVNPIYSQHTN-----GDK--HKFERYFRPYETVCATFYAPIQFPPAPVLAFKV-NPDSTL------ALVARGRLLSCNPDRIVLKRVVLSGHPMRINRKSASIRYMFFYKEDVEYFKPVKLRTKCGRLGHIKESLGTHGHMKCYFDGQLRSYDTAFMYLYKRVFPKWTYE 786          
BLAST of SMED30009673 vs. TrEMBL
Match: A0A094ZZ14 (Pre-rRNA-processing protein TSR1-like protein OS=Schistosoma haematobium OX=6185 GN=MS3_08660 PE=4 SV=1)

HSP 1 Score: 328.561 bits (841), Expect = 2.846e-95
Identity = 271/891 (30.42%), Postives = 422/891 (47.36%), Query Frame = -1
Query:   88 HKGRKFTQANKPHXXXXXXXXXXXXXKNGKKTKAVN-NSKDLRVHQAKQQRENSIKENNQSERGNNTNAPLLCGVFPLFHCEHIEVILSLLKSSDPES-IIKKIDNIPNYSKLNCESLIMKSKKLKKNFAFASCKDFKDRFDYLDLAKVVDWCLFILPDDLDELIGDYTEDLFSSLIAQGMPSGCFITLKSDKSFK-MKDDIKYLESIIKIPLADSKIHCLSNTNDANKLMRHLAQ------NCKPHYXXXXXXXXXXXXXXXKRGYFLAQNIKYEEDN--------MRLTGCMRG--------FGIDLEKSEFI------HLTGVGDFSIKEVSWISPEESNHFTEKDKVQSLKNFVFKH------------------EEINNEAS-DNDHESDEEMECSGXXXXXXXXXXXXXXXXXXDIGSIDSDNDPMDEKMSFATTAHSGFSVAQIMKFKKSREESMFPDEVEVPYNEKAKEKFSKYRGMLGFKSTQWPIQAN-LPKCYEKISFFKNYKHERNRLCNMIDKTVREHNANFILPGSVF---------EMVLEKVSPSDIEKL--------QNIIR--MNPGRH-LIGSGLFVKEEKLSVLHFNEKR----IAAVDDSVI-----NKLAKLSPSTDSAIAL--GEEATS---------HYDVIDENYQLKPA----------------AEPIESKETMLFQLGFRRFSSTPIYSELTAASDQPGDKGKSKFLNFMELNKHVVVST-YGPITFGPVNVLQFRIR---QQDESVDRAYVSELVASGSLLSIDPTKPIIKRIRLTGQIYKVNKRSAMIRYMFFNTEDIEHFKDVRLHAPGNILGRILEPHGSHGYMKCHFDKKVSQNVIPYMPLYKRVFPKFTVENMYDNF 2427
            H+     Q NK HK   K S    KP    K K +N + + L   Q + Q+   +K N ++ RG   N P+ C + PL       +   L ++ +P + +IKK D + N        + ++S+ L K F    C    D F  LDLA   DW + ++P +  E I D   +L +++ AQG  +  +  L S+ + K +K  ++Y     + P+ +S IH L+++ +A  L+RH+A       + K   +     +   ++    R   L  +I+   +N          ++ C+RG           +LE++  +      HLTG GDF + E  WI         +   + +++N   K+                  + +++E S D+ HES  E + + +E  +     +       +  SI S         + A +A S FS AQ+ KF+ +R E MFPDEVE P N  A E+F KY G+  F+ + WP + N LPK Y+ I+ F+NY   R  +   I++ + +  + +   G+VF         E++L+ VS    E +         N  R   +P  H LI   L   E ++SV HF   R    I AV D V+     NK+ + S   +   AL  GEEA++         H  +I   Y++                   AEPI+SK+ ML Q G RRF + PIYS  +        + K+KF +F   ++   V+T Y P+ + PVNVLQFRIR    +D  +   YV ELVA+GSL S+DP+  IIKRI L+G  YK+N+R  ++RYMF N  D+ HF+ ++L      +G I EP G+HG+MKC FD+ +  N +  MPLYKRVFPK+  E +   +
Sbjct:    6 HRSGPLKQQNKKHKGARKSSDKNPKPHRVTKNKILNKDQRRLLSKQLRIQKRLEVK-NLEASRGTKGN-PIACVLIPLSSSVPTHLAQLLFQTCEPNTEVIKKPDCLQNV-------VTIRSQILNKYFNLI-CAYSDDLFGCLDLANFADWLVLLVPSNPSE-IPDSVHELLTAIYAQGFTNASYAVLSSNSNLKELKQILEY-----RFPVPESTIHQLNSSANALNLLRHIASTNPSSFHVKGKNAKVAGQSTVAHTGARYRTRLLVDSIELISENNAHDDITKSEVSVCLRGHLHGAPLILFEELEQNGSVLVGPQVHLTGWGDFPLIEAKWIDNYHLQQAWQISDLNTVENISTKYILPSTSVNLTNENEDCEEDSLSDEMSVDDSHESTSENQWNATEATSDHLESELSGNSDIECASIASHT-----AHTMAASATSTFSSAQLAKFRAARMEEMFPDEVETPSNIPASERFVKYCGLPRFQGSVWPAEKNWLPKHYQNIACFRNYHRNRRTMIRYIEQKLADFQSAYKSTGNVFKCIPSGVDVELLLQPVSRDLGESILSHHTFPQPNEARKPSDPRPHPLIVWSLLPHETQMSVCHFTMFRRASAIHAVSDLVVIANAANKITESSSKDNGICALEFGEEASTQVEREDKSIHDALISHRYKIDGKKSGKALYDPKMPIPLEAEPIKSKDLMLIQAGIRRFVAAPIYSTPS------NPREKAKFESFFPASESSTVATVYAPVMYSPVNVLQFRIRVTEDEDGELSSPYVGELVATGSLRSVDPSHLIIKRIFLSGHPYKINQRHVVVRYMFHNPADVLHFQPIQLQTKSGAVGHIKEPIGTHGHMKCVFDRPILANDVALMPLYKRVFPKYVYEPVVSKY 869          
BLAST of SMED30009673 vs. TrEMBL
Match: G4VQZ7 (Putative ribosome biogenesis protein tsr1 (20S rRNA accumulation protein 1) OS=Schistosoma mansoni OX=6183 GN=Smp_038930 PE=4 SV=1)

HSP 1 Score: 322.783 bits (826), Expect = 3.716e-93
Identity = 275/888 (30.97%), Postives = 420/888 (47.30%), Query Frame = -1
Query:   88 HKGRKFTQANKPHXXXXXXXXXXXXXKNGKKTKAVN-NSKDLRVHQAKQQRENSIKENNQSERGNNTNAPLLCGVFPLFHCEHIEVILSLLKSSDPES-IIKKIDNIPNYSKLNCESLIMKSKKLKKNFAFASCKDFKDRFDYLDLAKVVDWCLFILPDDLDELIGDYTEDLFSSLIAQGMPSGCFITLKSDKSFKMKDDIKYLESII--KIPLADSKIHCLSNTNDANKLMRHLAQ------NCKPHYXXXXXXXXXXXXXXXKRGYFLAQNIKYEEDN------------MRLTGCMRGFGI----DLEKS------EFIHLTGVGDFSIKEVSWISPEESNHFTEKDKVQSL---KNFVFK------HEEINNEASDNDHES-DEEMECSGXXXXXXXXXXXXXXXXXXDIGSIDSDNDPMD-------EKMSFATTAHSGFSVAQIMKFKKSREESMFPDEVEVPYNEKAKEKFSKYRGMLGFKSTQWPIQAN-LPKCYEKISFFKNYKHERNRLCNMIDKTVREHNA---------NFILPGSVFEMVLEKVSPSDIEKL--------QNIIR--MNPGRH-LIGSGLFVKEEKLSVLHFNEKR----IAAVDDSVI-----NKLAKLSPSTDSAIALGEEAT---------------SHYDVIDENYQLK----------PAAEPIESKETMLFQLGFRRFSSTPIYSELTAASDQPGDKGKSKFLNFMELNKHVVVST-YGPITFGPVNVLQFRIR---QQDESVDRAYVSELVASGSLLSIDPTKPIIKRIRLTGQIYKVNKRSAMIRYMFFNTEDIEHFKDVRLHAPGNILGRILEPHGSHGYMKCHFDKKVSQNVIPYMPLYKRVFPKFTVENMYDNF 2427
            H+     Q NK HK   + +          K K +N + + L   Q + Q+   +K+   S RG   N P+ C + PL       +   L ++ +P + +IKK    P     N   + + S+ L K F    C    D F  LDLA   DW + ++P +  E I D   +L +++ AQG  +  +  L S        ++K L+ I+  + P+ +S IH L+++ +A  L+RH+A       + K   +     +   ++    R   L  +I    +N            + L G +RG  +    +L+++        +HLTG GDF + E  WI   +S H  +K ++  L   KN   K        ++ NE  D + +S  +EM    S    +++  D+  E    + S  S N  ++          + A +A S FS AQ+ KF+ +R E MFPDEVE P N  A E+F KY G+  F+S+ WP + N LPK Y+ I+ F+NY   R  +   I++ +    +          +I PG   E++L  VS    E +         N  R   +P  H L+   L   E ++SV HF   R    I AV D ++     NK+ +   +   A+  GEEA+               SH + ID  +  K          P AEPI+SK+ ML Q G RRF + PIYS    A   P  + K+KF  F   ++   V+T Y P+ + PVN+LQFRIR    +D  +   YV ELVA+GSL S+DP+  IIKRI L+G  YK+N+R  ++RYMF N  D+ HF+ V+L +    +G I EP G+HG+MKC FD+ +  N +  MPLYKRVFPK+  E +   +
Sbjct:    6 HRSGPLKQQNKKHKGVKRSTDRNPNSHRVTKNKILNKDQRRLLSKQLRIQKRLEVKKLEAS-RGTKEN-PIACVLIPLSSSVPTHLAQLLFQTCEPNTEVIKK----PKSCLQNV--VTIHSRILNKYFDLI-CAYSDDLFGCLDLANFADWLILLVPSNPTE-IPDSVHELLTAIYAQGFTNASYAVLSSS------SNLKELKQILERRFPVPESTIHQLNSSTNALHLLRHIASTNPSSFHAKGKNAKVAGQSTVAHTGARYRTRLLVDSIDLISENNAHDAITESEVAVCLRGRLRGAPLFLFEELDQNGSVLVGPRVHLTGWGDFPLIEAKWI---DSYHLQQKWQISDLNAVKNISTKCIPKSTSVKLTNENEDCEEDSLSDEMSVDDSHQSTNENHWDATEEISDHLESELSGNSDIEYTSIASHTAHTMAASATSTFSSAQLAKFRAARMEEMFPDEVETPPNTPASERFVKYCGLPRFQSSVWPAEKNWLPKHYQNIACFRNYHRNRRTMIRYIEQKLANFQSEYKPTGNIFKYIPPGVDVELLLRPVSRDLGESILSHHTFPQPNEARKPSDPRPHPLLVWSLLPHETQMSVCHFTMFRRASAIHAVSDLIVIANAANKITESRENGICALEFGEEASTQVEREDKSIHDALISHRNKIDGKHNGKALYDPKMPIPPEAEPIKSKDLMLIQAGIRRFVAAPIYS----APSNP--REKAKFEPFFPASESSTVATVYAPVMYSPVNILQFRIRVTEDEDGELSSPYVGELVATGSLRSVDPSHLIIKRIFLSGHPYKINQRHVVVRYMFHNPADVIHFQSVQLQSKSGAVGHIKEPVGTHGHMKCVFDRPILANDVALMPLYKRVFPKYVYEPVVSKY 868          
BLAST of SMED30009673 vs. TrEMBL
Match: A0A183MS93 (DUF663 domain-containing protein OS=Schistosoma margrebowiei OX=48269 GN=SMRZ_LOCUS18921 PE=4 SV=1)

HSP 1 Score: 320.857 bits (821), Expect = 7.512e-92
Identity = 253/830 (30.48%), Postives = 398/830 (47.95%), Query Frame = -1
Query:   88 ENNQSERGNNTNAPLLCGVFPLFHCEHIEVILSLLKSSDPES-IIKKIDNIPNYSKLNCESLIMKSKKLKKNFAFASCKDFKDRFDYLDLAKVVDWCLFILPDDLDELIGDYTEDLFSSLIAQGMPSGCFITLKSDKSFK-MKDDIKYLESIIKIPLADSKIHCLSNTNDANKLMRHLAQ------NCKPHYXXXXXXXXXXXXXXXKRGYFLAQNIKYEEDN--------MRLTGCMRG--------FGIDLEKS------EFIHLTGVGDFSIKEVSWISPEESNHFTEKDKVQSLKNFVFKH------EEINNEASDNDHES-DEEMECSGXXXXXXXXXXXXXXXXXXDIGSIDSDNDPMD-------EKMSFATTAHSGFSVAQIMKFKKSREESMFPDEVEVPYNEKAKEKFSKYRGMLGFKSTQWPIQAN-LPKCYEKISFFKNYKHERNRLCNMIDKTVREHNANFILPGSVF---------EMVLEKVSPSDIEKL--------QNIIR--MNPGRH-LIGSGLFVKEEKLSVLHFNEKR----IAAVDDSVI-----NKLAKLSPSTDSAIAL--GEEATS---------HYDVIDENYQLKPA----------------AEPIESKETMLFQLGFRRFSSTPIYSELTAASDQPGDKGKSKFLNFMELNKHVVVST-YGPITFGPVNVLQFRIR---QQDESVDRAYVSELVASGSLLSIDPTKPIIKRIRLTGQIYKVNKRSAMIRYMFFNTEDIEHFKDVRLHAPGNILGRILEPHGSHGYMKCHFDKKVSQNVIPYMPLYKRVFPKFTVENMYDNF 2262
            +N ++ RG   N P+ C + PL       +   L ++ +P + +IKK D + N        + ++S+ L K F    C    D F  LDLA   DW + ++P +  E I D   +L +++ AQG  +  +  L S+ + K +K  ++Y     + P+ +S IH L+++ +A  L+RH+A       + K   +     +   ++    R   L  +I+    N          ++ C+RG           +LE++        +HLTG GDF + E  WI         +   + +++N   K+        + NE  D + +S  +EM    S +   ++  ++       + S  S N  ++          + A +A S FS AQ+ KF+ +R E MFPDEVE P N  A E+F KY G+  F+ + WP + N LPK Y+ I+ F+NY   R  +   I++ + +  + +   G+VF         E++L+ VS    E +         N  R   +P  H LI   L   E ++SV HF   R    I AV D V+     NK+ + S   +   AL  GEEA++         H  +I   Y++                   AEPI+SK+ ML Q G RRF + PIYS  +        + K+KF +F   ++   V+T Y P+ + PVNVLQFRIR    +D  +   YV ELVA+GSL S+DP+  IIKRI L+G  YK+N+R  ++RYMF N  D+ HF+ ++L      +G I EP G+HG+MKC FD+ +  N +  MPLYKRVFPK+  E +   +
Sbjct:  136 KNLEASRGTKGN-PIACVLIPLSSSIPTHLAQLLFQTCEPNTEVIKKPDCLQNV-------VTIRSQILNKYFNLI-CAYSDDLFGCLDLANFADWLILLVPSNPSE-IPDSVHELLTAIYAQGFTNASYAVLSSNSNLKELKQILEY-----RFPVPESTIHQLNSSANALNLLRHIASTNPSSFHVKGKNAKVAGQSTVAHTGARYRTRLLVDSIELISKNNAHDDITKSEVSVCLRGRLHGAPLILFEELEQNGSVLVGPHVHLTGWGDFPLIEAKWIDNYHLQQTWQISDLNTVENISTKYIPPSTSVNLTNENEDCEEDSLSDEMSVDDSRESTSENQWNASEAISDHLESELSGNSDIECASIASHTAHTMAASATSTFSSAQLAKFRAARMEEMFPDEVETPSNIPASERFVKYCGLPRFQGSVWPAEKNWLPKHYQNIACFRNYHRNRRTMIRYIEQKLADFQSAYKSTGNVFKYIPSGVDVELLLQPVSRDLGESILSHHTFPQPNEARKPSDPRPHPLIVWSLLPHETQMSVCHFTMFRRASAIHAVSDLVVIANAANKITESSSKDNGICALEFGEEASTQVEREDKSIHDALISHRYKIDGKKSGKALYDPKMPIPLEAEPIKSKDLMLIQAGIRRFVAAPIYSTPS------NPREKAKFESFFPASESSTVATVYAPVMYSPVNVLQFRIRVTEDEDGELSSPYVGELVATGSLRSVDPSHLIIKRIFLSGHPYKINQRHVVVRYMFHNPADVLHFQPIQLQTKSGAVGHIKEPVGTHGHMKCVFDRPILANDVALMPLYKRVFPKYVYEPVVSKY 944          
BLAST of SMED30009673 vs. TrEMBL
Match: A0A0X3PDR3 (DUF663 domain-containing protein OS=Schistocephalus solidus OX=70667 GN=TR82994 PE=4 SV=1)

HSP 1 Score: 305.834 bits (782), Expect = 1.914e-87
Identity = 253/848 (29.83%), Postives = 400/848 (47.17%), Query Frame = -1
Query:  103 MGHKGRKFTQANKPHXXXXXXXXXXXXXKNGKKTKAVNNSKDLRVHQAKQQRENSIKENNQSERGNNTNAPLLCGVFPLFHCEHIEVILSLLKSSDPESI-----IKKIDNIPNYSKLNCESLIMKSKKLKKNFAFASCKDFKDRFDYLDLAKVVDWCLFILPDDLDEL-IGDYTEDLFSSLIAQGMPSGCFITLKSDKSFKMKDDIKYLESI-IKIPLADSKIHCLSNTNDANKLMRHLAQNCKP-------HYXXXXXXXXXXXXXXXKRGYFLAQNIK---YEEDN----MRLTGCMRGFGI---DLEKS---------EFIHLTGVGDFSIKEVSWIS-----------PEESNHFTEK----DKVQSLKNFVFKHEEINNEASD--NDHESDEEMECSGXXXXXXXXXXXXXXXXXXDIGSIDSDNDPMDEKMSFATTAHSGFSVAQIMKFKKSREESMFPDEVEVPYNEKAKEKFSKYRGMLGFKSTQWPIQAN--LPKCYEKISFFKNYKHERNRLCNMIDKTVREHNANFI---------LP-GSVFEMVLEKVSPSDIEKLQNIIRMNPGRH--------LIGSGLFVKEEKLSVLHFNEKRIAAVDDSVINKLAKLSPSTDSAIALGEEATSHYDVIDENYQLKPAAEPIESKETMLFQLGFRRFSSTPIYSELTAASDQPGDKGKSKFLNFMELNKHVVVSTYGPITFGPVNVLQFRIRQQDESVDRAYV-SELVASGSLLSIDPTKPIIKRIRLTGQIYKVNKRSAMIRYMFFNTEDIEHFKDVRLHAPGNILGRILEPHGSHGYMKCHFDKKVSQNVIPYMPLYKRVFPKFTVEN 2433
            + H      Q+NK HK + K  ++ K     +K +A + SK LR H AKQQR+  +K  + ++R +    PL+C + PL     + +  +LL S D  S      ++  +     + LNC S+       K+ FA  + + F D    LDLA++ DW +F+LP D+ ++  G Y+E L S+L AQG+P   F  + +     + D  + L  + +K  + + K+  L++T DA  L+RHLAQ+ K        +Y +SK +     +    R   L ++I    YEE+     M++ G +RG+ +   D+ +S          F+HLTG GDF +++  W             P   N +       D + S  + V+   +I+++  D  N    D+EM       +   +S+D   +   +     S       K        S     +  K K +  E  FPDEVE+P    A+ +F+KYRG+  F    WP + +  LP  Y KI  F NY H R  +       +R+     +         +P GS+  +    + P D +    +I  +  R         L+   L   E  LSVLH            V+ K AK     +   A      + +D           A+PI +KE  LFQ+G RRF + PIYS+ + A++   +    KF  F   +  +V S Y P+ + P+ VLQFR+R  +    R  V  +L A GS+LS+DP++ IIKR+ L+G  YK+NKRS + RYMF+  ED+E+FK V+LH     +G I +  G+HG MKC FD+++  + +  MPLYKR+FPK T ++
Sbjct:    4 LRHVSGSLKQSNKKHKGEKKRLNSQKVTLRVQKVEA-HKSKKLRKHLAKQQRQAKLKMVSSNQRFSR---PLMCLLLPLHEGVDLHLTQTLLASGDRSSTSNSSGLQFTNKGFQVNYLNCPSI-------KREFALVNGR-FDDLLGNLDLARLADWIIFVLPGDIRKVEPGSYSE-LLSALYAQGLPPSVFCVMSN-----ISDTRELLAQLQMKFTVNEGKVRVLNSTADAFSLLRHLAQSQKKPTFCIADNYLSSKDALKVGITSTRLRCGMLVEDISTEPYEENEGEVYMKVGGILRGWDLPLYDISQSFTEQTRGGCPFLHLTGWGDFPLRKADWTEYRTGGIKAHQVPPRPNSWIATSGPDDSLASTLSAVWNEMQIDDDEEDESNPETDDDEMSDHEEVAEIPSASDDEADDLDLEESDATSKKTCSFGKQDIVHKIPSSALTTEAEKAKAAYLEYQFPDEVEIPPGVSARTRFAKYRGLPSFSKCTWPTKDDNSLPFEYGKIFRFANYPHNRRTIVKYTLSQLRKLATGEVTDPLGYPLRIPSGSLATLT---IGPMDRQLASALISAHTQRSDGARLVQPLVVWSLLPYERCLSVLHL-----------VMQKRAK-----ELTEAPSNPKGNTFD-----------ADPIMAKEPTLFQVGIRRFIAAPIYSQPSKAANT--NSKAEKFFTFA--SSPIVASMYAPVAYAPLPVLQFRLRSSETGDSRRVVLGDLAAVGSVLSVDPSRAIIKRVLLSGNPYKINKRSVVARYMFYTPEDVEYFKPVQLHTKSGAVGHIKQSVGTHGLMKCLFDRQILASDVILMPLYKRIFPKMTYDS 799          
BLAST of SMED30009673 vs. TrEMBL
Match: A0A5K3EJQ2 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 300.442 bits (768), Expect = 6.060e-86
Identity = 236/780 (30.26%), Postives = 373/780 (47.82%), Query Frame = -1
Query:  103 LCGVFPLFHCEHIEVILS--LLKSSDPESIIKKIDNIPNYSKLNCESLIMKSKKLKKNFAFASCKDFKDRFDYLDLAKVVDWCLFILPDDLDELIGDYTEDLFSSLIAQGMPSGCFITLK--SDKSFKMKDDIKYLESIIKIPLADSKIHCLSNTNDANKLMRHLAQNCKP-------HYXXXXXXXXXXXXXXXKRGYFL--AQNIKYEEDN-----MRLTGCMRGFGIDL------------EKSEFIHLTGVGDFSIKEVSWISPEESNHFTEKDKVQSLKNFVFKHEEINN------------------------------EASDNDHES---DEEMECS-GXXXXXXXXXXXXXXXXXXDIGSIDSDNDPMDEKMSFATTAHSGFSVAQIMKFKKSREESMFPDEVEVPYNEKAKEKFSKYRGMLGFKSTQWPIQ--ANLPKCYEKISFFKNYKHERNRLCNMIDKTVRE-----HNANFILP-GSVFEMVLEKVSPSDIEKLQNIIRMNP--GRHLIGSGLFVKEEKLSVLHFNEKRIAAVDDSVINKLAKLSPSTDSAIALGEEATSHYDVIDENYQLKPAAEPIESKETMLFQLGFRRFSSTPIYSELTAASDQPGDKGKSKFLNFMELNKHVVVST-YGPITFGPVNVLQFRIRQQDESVDRAYVSELVASGSLLSIDPTKPIIKRIRLTGQIYKVNKRSAMIRYMFFNTEDIEHFKDVRLHAPGNILGRILEPHGSHGYMKCHFDKKVSQNVIPYMPLYKRVFPKFTVEN 2217
            +C + PL  C+ ++V L+  +L   DP S++ ++  I    K + ++  + +  L+K F   + K + D F  LDLA++ DW +F+LP ++ ++  D   +L S L +QGMP   F+ +   SD++    + +  L+S  K P++D KI  L++ +DA  L+R  +Q+ K         Y  +  +     +    R   L  A NI   E+N     + L G +RG+ + L                ++H+TG GDF ++  +W        +T + +V      +F+     N                              E S+ +  +   DEE E   G      D    +     S+IGS  S +   +  +S    AH   +VA+  K K ++ E  FPDE+E P N  A+E+F+KYRG+  F    WP +  ++LP  Y KI  F NY H R  +     + +R+           +P GS+  + L  + P  +         NP   R L    L   E  +SVLHF               + K  P     IA G+ +    DV  +N    P  +PI SKE MLFQ+G RRF ++PIYS+ +  + +      SK   F  ++   +V+T Y P+ + P  VLQF I    ES  +  V  LVA+GS+LS+DPT+ I+KRI L+G  YK+NKRSA++RYMF   EDI++FK ++++     +G I +  G+HG MKC FD++++ + +  MPLYKRVFPK T + 
Sbjct:    1 MCLLLPL--CDLVDVTLAQVMLSKGDPNSLMHELPKI-QLQKNSYKASYLYNPALRKAFCLVNGK-YNDLFGSLDLARLSDWIIFVLPGEISKIDPDSYSELLSVLYSQGMPPSVFVVMSNLSDRN----EILSVLQS--KFPVSDGKIRLLNSNHDAQSLLRFFSQSQKKPVLSSAKSYLVTPNALQVGTAATRLRSGMLVEAINIYPHEENEGEVYLGLEGLLRGWDLPLFDVATSFTGQPPTGCPYVHITGWGDFPVRAATW------TEYTPRPRVAQAAPQIFEWRATTNLNEGIGESLAVAWNEMNLDDDGDVVDTDDSEYSNKETAAMSIDEEDEIQVGDVPSDSDEESINLDVGESEIGSSKSTHFEKNHSIS-KNYAHKPMTVAE--KIKAAKVEIQFPDEIETPSNVPARERFAKYRGLPSFSKCTWPTENDSSLPYEYSKIFRFANYSHNRRTVIKHTLRQLRQLVTEKSTKPLSIPSGSIASLTLGPL-PQALGDSILEFHTNPHEPRPLTIWSLLPYEHCMSVLHFT--------------MQKRQPDWRDIIATGDGS----DV--KNVGFDP--DPIMSKEPMLFQVGIRRFIASPIYSQESKTTSR-----NSKMERFFTISSSPIVATVYAPVVYAPQTVLQFPIGPSQES-SKVVVCSLVATGSVLSVDPTRAIVKRILLSGHPYKINKRSAIVRYMFHTPEDIDYFKPIQMYTKSGAVGHIKQSVGTHGLMKCLFDRQLNASDVVLMPLYKRVFPKVTFDQ 732          
BLAST of SMED30009673 vs. Ensembl Cavefish
Match: ENSAMXT00000049358.1 (pep primary_assembly:Astyanax_mexicanus-2.0:1:25304268:25307921:-1 gene:ENSAMXG00000029293.1 transcript:ENSAMXT00000049358.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 147.902 bits (372), Expect = 4.203e-40
Identity = 87/212 (41.04%), Postives = 124/212 (58.49%), Query Frame = -1
Query:   58 AAEPIESKETMLFQLGFRRFSSTPIYSELTAASDQPGDKGKSKFLNFMELNKHVVVSTYGPITFGPVNVLQFRIRQQDESVDRAYVSELVASGSLLSIDPTKPIIKRIRLTGQIYKVNKRSAMIRYMFFNTEDIEHFKDVRLHAPGNILGRILEPHGSHGYMKCHFDKKVSQNVIPYMPLYKRVFPKFTVENMYDNF-----PNAEQAEMED 678
              EPI SKE ++FQ GFRRF +  ++S+ T+     GDK K +   F+  +   VVS Y PITF    VL F+  Q+D  +      +LVA+GSLLS +P + ++KRI L+G  +K+N+RSA++RYMFFN +DI  FK V L       G I +  G+HG+MKC FD ++       M LYKR +P++T    YD +     P  +Q E E+
Sbjct:   11 CTEPIPSKEELIFQCGFRRFRAAGLFSQHTS-----GDKHKME--RFLRDDAPTVVSLYAPITFPTAGVLLFK--QRDNGM-----QDLVATGSLLSCNPRRVVLKRIVLSGHPFKINRRSAVVRYMFFNRDDIMWFKPVELRTKWGRRGHIKDALGTHGHMKCVFDSQLRSQDTVLMNLYKRAYPRWT----YDPYVPPALPWVKQEEPEN 204          
BLAST of SMED30009673 vs. Ensembl Cavefish
Match: tsr1 (TSR1 ribosome maturation factor [Source:ZFIN;Acc:ZDB-GENE-030131-3762])

HSP 1 Score: 59.3066 bits (142), Expect = 1.075e-8
Identity = 63/281 (22.42%), Postives = 116/281 (41.28%), Query Frame = -1
Query: 1516 RVHQAKQQRENS--IKENNQSERGNNTNAPLLCGVFPLFHCEHIEVILSLLKSSDPESIIKKIDNIPNYSKLNCESLIMKSKKLKKNFAFASCKDFKDRFDYLDLAKVVDWCLFILPDDLDELIGDYTEDLFSSLIAQGMPSGCFITLK-SDKSFKMK-DDIKYLESIIKIPLADSKIHCLSNTNDANKLMRHLAQNCKPHYXXXXXXXXXXXXXXXKRGYFLAQNIKYEEDN--------------MRLTGCMRGFGIDLEKSEFIHLTGVGDFSIKEVS 2304
            R H+A Q R N   +  N +   G+    P L  V  L        +  +L+      ++ +   +    K   +S  +   + K+ F F    D  D    LD+AKV D  +F+L  +  E    Y +   S L AQG+PS   +    +D   K + +  + L  + +    D+++  L +  DA  L+RHL    +            + + + +R + L Q+  Y  ++              +R++G +RG    L+ +  +H+ G GDF + ++S
Sbjct:   61 RRHKANQLRRNKKDMVLNEKRRLGSRDGPPHLVAVVSLHAAVDAGAVTQILRGEGIGRVLHEDQGV----KGAKDSFGLVLPRFKQRFTFYRS-DTADLHSLLDVAKVADSLVFVL--ESTEGWDSYGDYCLSCLFAQGLPSHALVCQGIADLPVKKRAESRRALSRLTEARFPDARLFPLDSDQDAVLLLRHLGAQKQ-----------RRLAFRSRRSHMLVQSASYTLNSTLNDTDRPPTGLGTLRVSGYVRG--CPLQVNRLVHIAGHGDFQLSQIS 321          
BLAST of SMED30009673 vs. Ensembl Cavefish
Match: bms1 (BMS1 ribosome biogenesis factor [Source:ZFIN;Acc:ZDB-GENE-060720-2])

HSP 1 Score: 58.9214 bits (141), Expect = 2.133e-8
Identity = 43/192 (22.40%), Postives = 89/192 (46.35%), Query Frame = -1
Query:   94 IESKETMLFQLGFRRFSSTPIYSELTAASDQPGDKGKSKFLNFMELNKHVVVSTYGPITFGPVNVLQFRIRQQDESVDRAYVSELVASGSLLSIDPTKPIIKRIRLTGQIYKVNKRSAMIRYMFFNTEDIEHFKDVRLHAPGNILGRILEP-HGSHGYMKCHFDKKVSQNVIPYMPLYKRVFPKFTVENMYD 666
            +++++ ++  LG+RRF + P+Y       D     G+ + L +   + H   S +GPIT      L  +     ++  R     + A+G +L +D +  ++K+++L G  YK+ K +  ++ MF    ++  F+   L     I G+I +      G  +  F+ +V  + I ++    R +   TV  +Y+
Sbjct:  910 LKTRDPLILSLGWRRFQTIPLYH----IEDH---NGRHRLLKYTPEHMHCGASIWGPITPQGTGFLAVQTVAGTQANFR-----IAATGVVLDLDKSVTVVKKLKLIGYPYKIYKNTCFVQGMFNTVLEVAKFEGASLRTVSGIKGQIKKALRTPPGAYRATFEDRVLMSDIVFL----RSWYPVTVPQLYN 1085          
BLAST of SMED30009673 vs. Ensembl Sea Lamprey
Match: TSR1 (TSR1 ribosome maturation factor [Source:HGNC Symbol;Acc:HGNC:25542])

HSP 1 Score: 175.637 bits (444), Expect = 9.768e-49
Identity = 117/373 (31.37%), Postives = 178/373 (47.72%), Query Frame = -1
Query:  103 KFKKSREESMFPDEVEVPYNEKAKEKFSKYRGMLGFKSTQWPIQANLPKCYEKISFFKNYKHERNRLCNMIDKTVREHNANFILPGSVFEMVLEKVSPSDIEKLQNIIRMNPGRHLIGSGLFVKEEKLSVLHFNEKRIAAVDDSVINKLAKLSPSTDSAIALGEEATSHYDVIDENYQLKPAAEPIESKETMLFQLGFRRFSSTPIYSELTAASDQPGDKGKSKFLNFMELNKHVVVSTYGPITFGPVNVLQFRIRQQDESVDRAYVSELVASGSLLSIDPTKPIIKRIRLTGQIYKVNKRSAMIRYMFFNTEDIEHFKDVRLHAPGNILGRILEPHGSHGYMKCHFDKKVSQNVIPYMPLYKRVFPKFTVEN 1221
            K+++ R + MFPDEV+ P +   + +F KYRG+  F+++ W  + NLP  Y +I  F+N+   R R+  + D    E  A   L  +V  + +    P D+     +    P   L+  GL   E K+SV+HF  +R                                              E +++KE ++F  GFRR  + PI+S+ T      GDK K +   ++  +  +V + Y PI F P +VL F+              EL+A+GSLL  DP + ++KR+ L+G  +K+NK+ A +RYMFF  EDI  FK V L       G I EP G+HG+MKC FD ++       M LYKRVFP ++ + 
Sbjct:   44 KYREERLDRMFPDEVDTPKDVSCRVRFQKYRGLKSFRTSPWDPKENLPLEYGRIFQFQNFAAARKRV--LRDSQQDEEAAALGLYVTVHILNV----PLDL-----LEGRQPDAPLVLFGLLPHEHKMSVVHFAVRRHPG-----------------------------------------CTEVVKAKEELVFHCGFRRLRAKPIFSQHTG-----GDKHKME--RYLRSDVPIVATVYAPIMFPPASVLVFKQHPGGSQ-------ELLATGSLLKPDPNRVVVKRLVLSGHPFKINKKVATLRYMFFTREDIMWFKPVELRTKWGRRGHIKEPLGTHGHMKCVFDGQLKSQDTVLMNLYKRVFPPWSYDT 350          
BLAST of SMED30009673 vs. Ensembl Yeast
Match: TSR1 (Protein required for processing of 20S pre-rRNA in the cytoplasm; associates with pre-40S ribosomal particles; inhibits the premature association of 60S subunits with assembling 40S subunits in the cytoplasm; similar to Bms1p; relocalizes from nucleus to cytoplasm upon DNA replication stress [Source:SGD;Acc:S000002218])

HSP 1 Score: 122.479 bits (306), Expect = 4.824e-29
Identity = 99/375 (26.40%), Postives = 169/375 (45.07%), Query Frame = -1
Query:  121 QIMKFKK-SREESMFPDEVEVPYNEKAKEKFSKYRGMLGFKSTQWPIQANLPKC---YEKISFFKNYKHERNRLCNMIDKTVREHNANFILPGSVFEMVLEKVSPSDIEKLQNIIRMNPGRHLIGS-GLFVKEEKLSVLHFNEKRIAAVDDSVINKLAKLSPSTDSAIALGEEATSHYDVIDENYQLKPAAEPIESKETMLFQLGFRRFSSTPIYSELTAASDQPGDKGKSKFLNFMELNKHVVVSTYGPITFGPVNVLQFRIRQQDESVDRAYVSELVASGSLLSIDPTKPIIKRIRLTGQIYKVNKRSAMIRYMFFNTEDIEHFKDVRLHAPGNILGRILEPHGSHGYMKCHFDKKVSQNVIPYMPLYKRVFP 1230
            Q+ +F+   +E+  FPDE+E+  +E A E+  +YRG+    +  W +    P     ++++    NYK+ +NR+   I +T  E  A   + G    M + +     +EK+Q+     P + L    GL + E K +V++F+ +R    D                                         +P+ S+E ++ Q G RR++  P++S+    S+ P +    K+  F+  +   V +   P+ F     + F+    D     A   EL+  G+ L+ D ++ + KR  LTG  ++ +K    +RYMFF  ED+E FK + L       G I E  G+HGY K  FD K+S   +  M LYKR++P
Sbjct:  468 QLREFRDMEKEDREFPDEIELEPSESAIERLKRYRGLKNLYNCDWQVDEKDPSSPAEWKRLLRIGNYKNTKNRI---IKETKNEAQA---IAGDRIRMFI-RFPKFLLEKIQD-----PKQLLFAVYGLLLHEHKNAVVNFSLQRWEQYD-----------------------------------------KPVPSQEPIVVQYGVRRYTIQPLFSQ---GSNSPNNV--HKYERFLHPDTVSVATCIAPVDFTQSPAIFFKPSPTD-----AKNIELIGHGTFLNADHSRILAKRAILTGHPFRFHKTVVTVRYMFFRPEDVEWFKSIPLFTKSGRSGFIKESLGTHGYFKATFDGKLSAQDVVAMSLYKRMWP 779          

HSP 2 Score: 55.4546 bits (132), Expect = 3.123e-8
Identity = 76/297 (25.59%), Postives = 137/297 (46.13%), Query Frame = -1
Query: 1507 NGKKTKAVNNSKDLRVHQAKQQRENSIK---ENNQSERGNNTNAPLLCGVFPLFHCEHIEVILSLLKSSDPESI-IKKIDNIPNYSKLNCESLIMKSKKLKKNFAFASCKDFKDRFDYLDLAKVVDWCLFILPDDLDELIGDYTEDLFSSLIAQGMPSGCFITLKSDKSF-----KMKDDIKY-LESIIK--IPLADSKIHCLSNTNDANKLMRHLAQNCKPHYXXXXXXXXXXXXXXXKRGYFLAQNIKYEE-----DNMRLTGCMRGFGIDLEKSEFIHLTGVGDFSIKEVSWIS 2346
             GK  K V  SK  R ++AKQ R   I    EN +   G N  A ++  V  +   + ++++  LLK +D E I ++++D+   ++        +  KK K N       D  +  + LD AKV D+ +F L   + E+  ++ E +  +L  QG+ S  +I + S+ S      K + D+K  LES  K   P ++ +++ L   +DA  ++R L Q                 + ++ RGY +A  + + E      ++ + G +RG G +  +   +H+   GDF + ++  IS
Sbjct:   42 TGKPDKQV--SKLQRKNKAKQLRAQRILDSIENRKLFEGKNGAAKIITIVPLVNDLDPLDILYKLLKCADDEGIMVQEVDSKRIFN--------VHIKKFKSNLKII-IPDMTNFLNILDCAKVADFVVFGL-SGVQEVDEEFGEQIIRALELQGIAS--YIGVISNLSAVHEKEKFQLDVKQSLESYFKHFFP-SEERVYNLEKNSDALNVLRTLCQRLP-----------RSINWRDNRGYVVADFVDFVETSPDSGDLVIEGTVRGIGFNANR--LVHIPDFGDFQLNKIEKIS 310          
BLAST of SMED30009673 vs. Ensembl Yeast
Match: BMS1 (GTPase required for ribosomal subunit synthesis and rRNA processing; required for synthesis of 40S ribosomal subunits and for processing the 35S pre-rRNA at sites A0, A1, and A2; interacts with Rcl1p, which stimulates its GTPase and U3 snoRNA binding activities; has similarity to Tsr1p [Source:SGD;Acc:S000006138])

HSP 1 Score: 48.1358 bits (113), Expect = 5.285e-6
Identity = 37/172 (21.51%), Postives = 79/172 (45.93%), Query Frame = -1
Query:  169 IESKETMLFQLGFRRFSSTPIYSELTAASDQPGDKGKSKFLNFMELNKHVVVSTYGPIT-----FGPVNVLQFRIRQQDESVDRAYVSELVASGSLLSIDPTKPIIKRIRLTGQIYKVNKRSAMIRYMFFNTEDIEHFKDVRLHAPGNILGRILEPHGS-HGYMKCHFDKKV 666
            +++ + ++  LG+RRF + PIY+   + +       +++ L +   + +   + YGP+      F  V ++         + D      + A+G +  ID    I+K+++L G  YK+ K +A I+ MF +  ++  F+  ++     I G I        G+ +  F+ K+
Sbjct:  839 LKTNDPLVLSLGWRRFQTLPIYTTTDSRT-------RTRMLKYTPEHTYCNAAFYGPLCSPNTPFCGVQIVA--------NSDTGNGFRIAATGIVEEIDVNIEIVKKLKLVGFPYKIFKNTAFIKDMFSSAMEVARFEGAQIKTVSGIRGEIKRALSKPEGHYRAAFEDKI 995          
BLAST of SMED30009673 vs. Ensembl Nematostella
Match: EDO37178 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SGF5])

HSP 1 Score: 209.149 bits (531), Expect = 5.188e-57
Identity = 128/375 (34.13%), Postives = 189/375 (50.40%), Query Frame = -1
Query:  106 QIMKFKKSREESMFPDEVEVPYNEKAKEKFSKYRGMLGFKSTQWPIQANLPKCYEKISFFKNYKHERNRLCNMIDKTVREHNANFILPGSVFEMVLEKVSPSDIEKLQNIIRMNPGRHLIGSGLFVKEEKLSVLHFNEKRIAAVDDSVINKLAKLSPSTDSAIALGEEATSHYDVIDENYQLKPAAEPIESKETMLFQLGFRRFSSTPIYSELTAASDQPGDKGKSKFLNFMELNKHVVVSTYGPITFGPVNVLQFRIRQQDESVDRAYVSELVASGSLLSIDPTKPIIKRIRLTGQIYKVNKRSAMIRYMFFNTEDIEHFKDVRLHAPGNILGRILEPHGSHGYMKCHFDKKVSQNVIPYMPLYKRVFPKFTVE 1230
            Q+ K + +RE  MFPDE++ P +  A+ +F K+RG+  F+++ W  + NLP  Y +I  F+N+   + R+ +       E +    +PG    + +  V  + I+   +       + L+  GL   E+K+SV+HF  KR+ +  D                                         PI+SKE ++F  G+RRF++ PI+S+ T+     GDK   K+  F+  +   V S Y PI F P  V+ F   +Q  S        LVA+GSL  +DP + I K+I L+G  YK+NKRSA+IRY+FFN EDI  FK V L+      G I EP G+HG+MKC FD  +       M LYKRVFPK+T E
Sbjct:  470 QLEKLRAARENEMFPDELDTPLDTAARVRFQKFRGLKSFRTSPWDPKENLPSDYARIFQFENFNRTKKRVLSA------EEDTEGAMPGCFVTVHIVNVPKAFIDSFDS------SKPLVVFGLLPHEQKMSVVHFVIKRLPSYTD-----------------------------------------PIKSKERLVFHCGYRRFTACPIFSQHTS-----GDK--HKYERFLPQDAITVASMYAPIMFPPCPVMVFNADRQTGS------HTLVATGSLYKVDPNRIIAKKIVLSGHPYKINKRSAVIRYLFFNREDIMWFKPVELYTKHGRRGHIKEPLGTHGHMKCSFDGALKAQDTVCMNLYKRVFPKWTYE 778          

HSP 2 Score: 80.8777 bits (198), Expect = 1.047e-15
Identity = 72/277 (25.99%), Postives = 119/277 (42.96%), Query Frame = -1
Query: 1507 RVHQAKQQRENSIKENNQSER--GNNTNAPLLCGVFPLFHCEHIEVILSLLKSSDPESIIKKIDNIPNYSKLNCESLIMKSKKLKKNFAFASCKDFKDRFDYLDLAKVVDWCLFILPDDLDELIGDYTEDLFSSLIAQGMPSG--CFITLKSDKSFKMKDDIKYLESIIKIPLADSKIHCLSNTNDANKLMRHLAQNCKPHYXXXXXXXXXXXXXXXKRGYFLAQNIKYEED-------NMRLTGCMRGFGIDLEKSEFIHLTGVGDFSIKEVSWIS 2304
            R H AKQ RE    E  + +R  G   + P +  + PL    ++   L LL+  D E+ I   D +            + S +LKK F F   K   D +  LD AKV D  LF++  D    + D+TE+  S ++AQG+P+       L+     K  D  K +  +++      K H L    DA   +R ++                    +++R + +AQ + +E D        +++TG +R  G  L  +  +HL G GDF I ++  ++
Sbjct:   58 RRHHAKQVREKKRGEILEQKRKIGKQGSPPHVIAILPLSSTCNVSSALQLLRECDEEASIFPADAL----------TTLVSHQLKKRFMFLPLK-HGDMYSILDAAKVADTILFLV--DASNPVDDHTENTISCILAQGLPATFHAIQGLEQCPPKKRNDIKKAIHKLVEKRFPKDKPHSLDTKQDALTTLRLVSNQ-----------QQRSIRFRDQRPHLVAQGVVFEPDANDVSKGTLKVTGFVR--GQTLSANRLVHLAGYGDFQISQIDSVA 308          
BLAST of SMED30009673 vs. Ensembl Nematostella
Match: EDO39967 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S8M5])

HSP 1 Score: 62.3882 bits (150), Expect = 6.892e-10
Identity = 42/188 (22.34%), Postives = 89/188 (47.34%), Query Frame = -1
Query:  115 IESKETMLFQLGFRRFSSTPIYSELTAASDQPGDKGKSKFLNFMELNKHVVVSTYGPITFGPVNVLQFRIRQQDESVDRAYVSELVASGSLLSIDPTKPIIKRIRLTGQIYKVNKRSAMIRYMFFNTEDIEHFKDVRLHAPGNILGRILE----PHGSHGYMKCHFDKKVSQNVIPYMPLYKRVFPKF 666
            +++++ ++  +G+RR+ +  +YS            G+ + L +   + H + + YGPI      +L  +    +    R     + A+G++L +D +  I+K+++LTG  YK+ K +A I+ MF +  ++  F+   + +   I G+I      P G  G+     DK +  +++     Y    PK+
Sbjct:  700 LKTRDPLVVSVGWRRYQTIALYS-------MQDHNGRHRLLKYTPEHLHCISTMYGPIAPPGTGLLAVQCVSGNTPDFR-----IAATGTVLQLDKSVEIVKKLKLTGTPYKIYKNTAFIKGMFNSALEVAKFEGATIRSVSGIRGQIKRALKSPEG--GFRATFEDKLLISDIVFVRTWYPVTVPKY 873          
BLAST of SMED30009673 vs. Ensembl Medaka
Match: tsr1 (TSR1 ribosome maturation factor [Source:NCBI gene;Acc:101164828])

HSP 1 Score: 205.682 bits (522), Expect = 3.240e-55
Identity = 129/377 (34.22%), Postives = 187/377 (49.60%), Query Frame = -1
Query:   88 FKKSREESMFPDEVEVPYNEKAKEKFSKYRGMLGFKSTQWPIQANLPKCYEKISFFKNYKHERNRLCNMIDKTVREHNANFILPGSVFEMVLEKVSPSDIEKLQNIIRMNPGRHLIGSGLFVKEEKLSVLHFNEKRIAAVDDSVINKLAKLSPSTDSAIALGEEATSHYDVIDENYQLKPAAEPIESKETMLFQLGFRRFSSTPIYSELTAASDQPGDKGKSKFLNFMELNKHVVVSTYGPITFGPVNVLQFRIRQQDESVDRAYVSELVASGSLLSIDPTKPIIKRIRLTGQIYKVNKRSAMIRYMFFNTEDIEHFKDVRLHAPGNILGRILEPHGSHGYMKCHFDKKVSQNVIPYMPLYKRVFPKFTVENMYDNF 1218
            ++++R   MFPDEV+ P +  A+ +F +YRG+  F+++ W    NLP  Y +I  F++++  R R+                L G    + +  V  S IE +Q+      G+ L+   L   E+K+SV+H                L +  PS                            EPI+SKE ++F  GFRRF ++PI+S+ T+A        K K   F+  +   VVS Y PITF P  VL F+ R          V +LVA+GSLLS DP + ++KRI L+G  +K+N+RSA++RYMFFN EDI  FK V L       G I E  G+HG+MKC FD ++       M LYKRV+P +T    YD +
Sbjct:  506 YREARSHEMFPDEVDTPLDTPARTRFQRYRGLKSFRTSPWDPMENLPHNYSRIFQFQSFERTRRRILAEAAAE-----DEGALSGWYVTLHIINVPFSVIESVQS------GKPLVLVSLLPHEQKMSVMHV---------------LVQRHPSN--------------------------TEPIKSKEELVFHCGFRRFRASPIFSQHTSAD-------KHKMERFLRPDAPTVVSLYAPITFPPAGVLLFKQRTDG-------VQDLVATGSLLSCDPQRVVLKRIVLSGHPFKINRRSAVVRYMFFNREDIMWFKPVELRTKWGRRGHIKEALGTHGHMKCVFDNQLRSQDTVLMNLYKRVYPHWT----YDPY 812          

HSP 2 Score: 67.3958 bits (163), Expect = 4.464e-11
Identity = 81/331 (24.47%), Postives = 132/331 (39.88%), Query Frame = -1
Query: 1519 KIMGHKGRKFTQANKPHXXXXXXXXXXXXXKNGKKTKAV----NNSKDL----RVHQAKQQRENS--IKENNQSERGNNTNAPLLCGVFPLFHCEHIEVILSLLKSSDPESIIKKIDNIPNYSKLNCESLIMKSKKLKKNFAFASCKDFKDRFDYLDLAKVVDWCLFILPDDLDELIGDYTEDLFSSLIAQGMPSGCFITLK-SDKSFKMK-DDIKYLESIIKIPLADSKIHCLSNTNDANKLMRHLAQNCKPHYXXXXXXXXXXXXXXXKRGYFLAQNIKY------EEDNMRLTG----CMRGF--GIDLEKSEFIHLTGVGDFSIKEV 2439
            K  GH+   + Q NK HK     +    + +N  +           K+L    R H+A Q R N   +    +   G+    P L  V  L        +  LL+      I+++   I   S  +   LI+   KL+  F   S  D       LD+AK+ D  +F++  D  E    Y E   S L AQG+PS   +    SD   K + +  + L  I ++   D+++  L +  DA  L+RHL                 K   + +R + +AQN+ +      E  +   TG    C+ G+  G  L     +H++G GDF + ++
Sbjct:   10 KQQGHRAGIYKQKNKVHKHGKHRTKGDIERENKGRVSVTALTKKQRKELKKMDRRHKANQLRRNKKDMILTEKRRLGSRDGPPHLVVVVSLHAGADAGAVTKLLREEGSGGIVQQEGCISGVS--DSFGLILPRFKLRFTFLSQSTADM---HSLLDVAKIADTLVFVM--DSAEGWDSYGEYCLSCLFAQGLPSHALVCQGMSDVPVKKRVESRRALSKIAEVRFPDARLFPLDSEQDATLLLRHLGSQ-----------RQRKLGFRSRRSHLIAQNVTFSPNGPVEGTDSGRTGLGTLCVSGYVRGHLLGVHRLVHISGHGDFQLSQI 322          
BLAST of SMED30009673 vs. Ensembl Medaka
Match: bms1 (BMS1 ribosome biogenesis factor [Source:NCBI gene;Acc:101157817])

HSP 1 Score: 60.077 bits (144), Expect = 1.007e-8
Identity = 36/149 (24.16%), Postives = 73/149 (48.99%), Query Frame = -1
Query:  223 IESKETMLFQLGFRRFSSTPIYSELTAASDQPGDKGKSKFLNFMELNKHVVVSTYGPITFGPVNVLQFRIRQQDESVDRAYVS-ELVASGSLLSIDPTKPIIKRIRLTGQIYKVNKRSAMIRYMFFNTEDIEHFKDVRLHAPGNILGRI 666
            +++++ ++  LG+RRF + P+Y       D     G+ + L +  L+ H   S +GPIT      L        +SV     +  + A+G +L +D +  I+K+++L G  YK+ K ++ ++ MF    ++  F+   +     + G+I
Sbjct:  844 LKTRDPLILSLGWRRFQTIPLYH----IEDH---NGRHRLLKYTPLHMHCGASIWGPITPQGTGFLAL------QSVAGVKANFRIAATGVVLDLDKSVTIVKKLKLIGYPYKIFKNTSFVKGMFNTVLEVAKFEGASVRTVSGVRGQI 979          
BLAST of SMED30009673 vs. Ensembl Medaka
Match: bms1 (BMS1 ribosome biogenesis factor [Source:NCBI gene;Acc:101157817])

HSP 1 Score: 60.077 bits (144), Expect = 1.019e-8
Identity = 36/149 (24.16%), Postives = 73/149 (48.99%), Query Frame = -1
Query:  223 IESKETMLFQLGFRRFSSTPIYSELTAASDQPGDKGKSKFLNFMELNKHVVVSTYGPITFGPVNVLQFRIRQQDESVDRAYVS-ELVASGSLLSIDPTKPIIKRIRLTGQIYKVNKRSAMIRYMFFNTEDIEHFKDVRLHAPGNILGRI 666
            +++++ ++  LG+RRF + P+Y       D     G+ + L +  L+ H   S +GPIT      L        +SV     +  + A+G +L +D +  I+K+++L G  YK+ K ++ ++ MF    ++  F+   +     + G+I
Sbjct:  844 LKTRDPLILSLGWRRFQTIPLYH----IEDH---NGRHRLLKYTPLHMHCGASIWGPITPQGTGFLAL------QSVAGVKANFRIAATGVVLDLDKSVTIVKKLKLIGYPYKIFKNTSFVKGMFNTVLEVAKFEGASVRTVSGVRGQI 979          
BLAST of SMED30009673 vs. Planmine SMEST
Match: SMESG000040843.1 (SMESG000040843.1)

HSP 1 Score: 1531.15 bits (3963), Expect = 0.000e+0
Identity = 797/803 (99.25%), Postives = 800/803 (99.63%), Query Frame = -1
Query:   25 MGHKGRKFTQANKPHXXXXXXXXXXXXXKNGKKTKAVNNSKDLRVHQAKQQRENSIKENNQSERGNNTNAPLLCGVFPLFHCEHIEVILSLLKSSDPESIIKKIDNIPNYSKLNCESLIMKSKKLKKNFAFASCKDFKDRFDYLDLAKVVDWCLFILPDDLDELIGDYTEDLFSSLIAQGMPSGCFITLKSDKSFKMKDDIKYLESIIKIPLADSKIHCLSNTNDANKLMRHLAQNCKPHYXXXXXXXXXXXXXXXKRGYFLAQNIKYEEDNMRLTGCMRGFGIDLEKSEFIHLTGVGDFSIKEVSWISPEESNHFTEKDKVQSLKNFVFKHEEINNEASDNDHESDEEMECSGXXXXXXXXXXXXXXXXXXDIGSIDSDNDPMDEKMSFATTAHSGFSVAQIMKFKKSREESMFPDEVEVPYNEKAKEKFSKYRGMLGFKSTQWPIQANLPKCYEKISFFKNYKHERNRLCNMIDKTVREHNANFILPGSVFEMVLEKVSPSDIEKLQNIIRMNPGRHLIGSGLFVKEEKLSVLHFNEKRIAAVDDSVINKLAKLSPSTDSAIALGEEATSHYDVIDENYQLKPAAEPIESKETMLFQLGFRRFSSTPIYSELTAASDQPGDKGKSKFLNFMELNKHVVVSTYGPITFGPVNVLQFRIRQQDESVDRAYVSELVASGSLLSIDPTKPIIKRIRLTGQIYKVNKRSAMIRYMFFNTEDIEHFKDVRLHAPGNILGRILEPHGSHGYMKCHFDKKVSQNVIPYMPLYKRVFPKFTVENMYDNFPNAEQAEMEDEAMSNVMDTLF 2433
            MGHKGRKFTQANKPHKDKSKPSSAIKKPKNGKKTKAVNNSKDLRVHQAKQQRENSIKENNQSERGNNTNAPLLCGVFPLFHCEHIEVILSLLKSSDPESIIKKIDNIPNYSKLNCESLIMKSKKLKKNFAFASCKDFKDRFDYLDLAKVVDWCLFILPDDLDELIGDYTEDLFSSLIAQGMPSGCFITLKSDKSFKMKDDIKYLESIIKIPLADSKIHCLSN+NDANKLMRHLAQNCKPHYSASKKSNVSK SIKEKRGYFLAQNIKYEEDNMRLTGCMRGFGIDLEKSEFIHLTGVGDFSIKEVSWISPEESNHFTEKDKVQSLKNFVFKHEEINNEASDNDHESDEEM+CSGSEDDAHDSSEDSEMEEVSDIGSIDSDNDPMDEKMSFATTAHSGFSVAQIMKFKKSREESMFPDEVEVPYNEKAKEKFSKYRGMLGFKSTQWPIQANLPKCYEKISFFKNYKHERNRLCNMIDKTVREHNANFILPGSVFEMVLEKVSPSDIEKLQNIIRMNPGRHLIGSGLFVKE+KLSVLHFNEKRIAAVDDSVINKLAKLSPSTDSAIALGEEATSHYDVIDENYQLKPAAEPIESKETMLFQLGFRRFSSTPIYSELTAASDQPGDKGKSKFLNFMELNKHVVVSTYGPITFGPVNVLQFRIRQQDES DRAYVSELVASGSLLSIDPTKPIIKRIRLTGQIYKVNKRSAMIRYMFFNTEDIEHFKDVRLHAPGNILGRILEPHGSHGYMKCHFDKKVSQNVIPYMPLYKRVFPKFTVENMYDNFPN EQAEMEDEAMSNVMDTLF
Sbjct:    1 MGHKGRKFTQANKPHKDKSKPSSAIKKPKNGKKTKAVNNSKDLRVHQAKQQRENSIKENNQSERGNNTNAPLLCGVFPLFHCEHIEVILSLLKSSDPESIIKKIDNIPNYSKLNCESLIMKSKKLKKNFAFASCKDFKDRFDYLDLAKVVDWCLFILPDDLDELIGDYTEDLFSSLIAQGMPSGCFITLKSDKSFKMKDDIKYLESIIKIPLADSKIHCLSNSNDANKLMRHLAQNCKPHYSASKKSNVSKTSIKEKRGYFLAQNIKYEEDNMRLTGCMRGFGIDLEKSEFIHLTGVGDFSIKEVSWISPEESNHFTEKDKVQSLKNFVFKHEEINNEASDNDHESDEEMKCSGSEDDAHDSSEDSEMEEVSDIGSIDSDNDPMDEKMSFATTAHSGFSVAQIMKFKKSREESMFPDEVEVPYNEKAKEKFSKYRGMLGFKSTQWPIQANLPKCYEKISFFKNYKHERNRLCNMIDKTVREHNANFILPGSVFEMVLEKVSPSDIEKLQNIIRMNPGRHLIGSGLFVKEDKLSVLHFNEKRIAAVDDSVINKLAKLSPSTDSAIALGEEATSHYDVIDENYQLKPAAEPIESKETMLFQLGFRRFSSTPIYSELTAASDQPGDKGKSKFLNFMELNKHVVVSTYGPITFGPVNVLQFRIRQQDESADRAYVSELVASGSLLSIDPTKPIIKRIRLTGQIYKVNKRSAMIRYMFFNTEDIEHFKDVRLHAPGNILGRILEPHGSHGYMKCHFDKKVSQNVIPYMPLYKRVFPKFTVENMYDNFPNVEQAEMEDEAMSNVMDTLF 803          
The following BLAST results are available for this feature:
BLAST of SMED30009673 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
TSR12.535e-4931.22TSR1 ribosome maturation factor [Source:HGNC Symbo... [more]
BMS11.209e-824.02BMS1 ribosome biogenesis factor [Source:HGNC Symbo... [more]
TSR19.148e-725.56TSR1 ribosome maturation factor [Source:HGNC Symbo... [more]
back to top
BLAST of SMED30009673 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
tag-1514.864e-4932.13Pre-rRNA-processing protein TSR1 homolog [Source:... [more]
tag-1514.864e-4932.13Pre-rRNA-processing protein TSR1 homolog [Source:... [more]
Y61A9LA.109.995e-922.04pep chromosome:WBcel235:V:4607039:4615817:-1 gene:... [more]
back to top
BLAST of SMED30009673 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Tsr13.780e-4930.48gene:FBgn0037073 transcript:FBtr0078342[more]
CG77284.433e-1222.04gene:FBgn0036686 transcript:FBtr0075274[more]
back to top
BLAST of SMED30009673 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tsr16.293e-5334.14TSR1 ribosome maturation factor [Source:ZFIN;Acc:Z... [more]
tsr16.405e-5334.14TSR1 ribosome maturation factor [Source:ZFIN;Acc:Z... [more]
tsr12.176e-1021.43TSR1 ribosome maturation factor [Source:ZFIN;Acc:Z... [more]
BX248124.11.957e-724.32pep chromosome:GRCz11:CHR_ALT_CTG12_1_21:29249650:... [more]
bms14.097e-724.32BMS1 ribosome biogenesis factor [Source:ZFIN;Acc:Z... [more]
back to top
BLAST of SMED30009673 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ccdc1241.381e-5734.49coiled-coil domain containing 124 [Source:Xenbase;... [more]
ccdc1245.623e-5734.68coiled-coil domain containing 124 [Source:Xenbase;... [more]
ccdc1246.190e-5734.68coiled-coil domain containing 124 [Source:Xenbase;... [more]
ccdc1246.592e-5734.49coiled-coil domain containing 124 [Source:Xenbase;... [more]
ccdc1248.263e-5734.49coiled-coil domain containing 124 [Source:Xenbase;... [more]
back to top
BLAST of SMED30009673 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Tsr11.564e-5434.05TSR1 20S rRNA accumulation [Source:MGI Symbol;Acc:... [more]
Bms12.363e-823.46BMS1, ribosome biogenesis factor [Source:MGI Symbo... [more]
back to top
BLAST of SMED30009673 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5XGY1|TSR1_XENLA1.502e-5333.51Pre-rRNA-processing protein TSR1 homolog OS=Xenopu... [more]
sp|Q5SWD9|TSR1_MOUSE2.004e-5334.05Pre-rRNA-processing protein TSR1 homolog OS=Mus mu... [more]
sp|Q2NL82|TSR1_HUMAN1.217e-4831.22Pre-rRNA-processing protein TSR1 homolog OS=Homo s... [more]
sp|Q61WR2|TSR1_CAEBR1.861e-4832.09Pre-rRNA-processing protein TSR1 homolog OS=Caenor... [more]
sp|Q9VP47|TSR1_DROME3.789e-4830.48Pre-rRNA-processing protein TSR1 homolog OS=Drosop... [more]
back to top
BLAST of SMED30009673 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A094ZZ142.846e-9530.42Pre-rRNA-processing protein TSR1-like protein OS=S... [more]
G4VQZ73.716e-9330.97Putative ribosome biogenesis protein tsr1 (20S rRN... [more]
A0A183MS937.512e-9230.48DUF663 domain-containing protein OS=Schistosoma ma... [more]
A0A0X3PDR31.914e-8729.83DUF663 domain-containing protein OS=Schistocephalu... [more]
A0A5K3EJQ26.060e-8630.26Uncharacterized protein OS=Mesocestoides corti OX=... [more]
back to top
BLAST of SMED30009673 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSAMXT00000049358.14.203e-4041.04pep primary_assembly:Astyanax_mexicanus-2.0:1:2530... [more]
tsr11.075e-822.42TSR1 ribosome maturation factor [Source:ZFIN;Acc:Z... [more]
bms12.133e-822.40BMS1 ribosome biogenesis factor [Source:ZFIN;Acc:Z... [more]
back to top
BLAST of SMED30009673 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
TSR19.768e-4931.37TSR1 ribosome maturation factor [Source:HGNC Symbo... [more]
back to top
BLAST of SMED30009673 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
TSR14.824e-2926.40Protein required for processing of 20S pre-rRNA in... [more]
BMS15.285e-621.51GTPase required for ribosomal subunit synthesis an... [more]
back to top
BLAST of SMED30009673 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO371785.188e-5734.13Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO399676.892e-1022.34Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED30009673 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
tsr13.240e-5534.22TSR1 ribosome maturation factor [Source:NCBI gene;... [more]
bms11.007e-824.16BMS1 ribosome biogenesis factor [Source:NCBI gene;... [more]
bms11.019e-824.16BMS1 ribosome biogenesis factor [Source:NCBI gene;... [more]
back to top
BLAST of SMED30009673 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000040843.10.000e+099.25SMESG000040843.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30009673 ID=SMED30009673|Name=SMED30009673|organism=Schmidtea mediterranea sexual|type=transcript|length=2496bp
TTTTTAAAACCAAAAACTTTATTAAAATAAAGTGTCCATAACATTAGACA
TTGCTTCATCTTCCATTTCTGCTTGTTCAGCATTTGGGAAATTGTCGTAC
ATGTTCTCCACTGTGAATTTTGGGAAAACCCTCTTATACAACGGCATATA
AGGAATAACATTCTGTGATACTTTTTTGTCAAAATGGCATTTCATGTACC
CATGGGAGCCATGAGGCTCAAGAATTCTCCCTAAAATGTTTCCCGGTGCA
TGAAGACGGACATCTTTAAAATGCTCGATATCTTCCGTATTGAAGAACAT
ATATCTGATCATTGCCGATCGCTTGTTCACCTTATAAATTTGTCCGGTTA
ATCGAATCCTTTTTATAATTGGTTTCGTCGGATCGATTGATAGCAGCGAG
CCACTGGCGACCAATTCTGATACATATGCCCGATCTACTGACTCATCCTG
TTGGCGTATGCGAAACTGGAGAACATTCACTGGACCGAAAGTTATCGGCC
CGTAAGTCGAGACAACAACGTGCTTATTCAACTCCATAAAATTCAAAAAT
TTGCTCTTTCCTTTATCGCCTGGCTGATCGGAAGCGGCCGTTAATTCTGA
ATATATCGGAGTCGATGAAAACCGCCGGAAACCGAGTTGGAAAAGCATTG
TTTCTTTGCTTTCAATAGGTTCCGCGGCTGGCTTTAATTGATAATTTTCA
TCGATTACGTCATAGTGAGAGGTTGCCTCTTCACCTAATGCTATTGCACT
GTCTGTACTCGGAGATAACTTCGCCAATTTATTGATTACTGAATCATCAA
CAGCAGCAATCCTTTTCTCATTAAAATGCAATACACTCAACTTCTCTTCC
TTTACAAACAAACCCGAGCCAATCAAATGCCGTCCTGGATTCATTCGGAT
AATATTCTGTAGCTTCTCTATATCCGATGGGGAAACCTTTTCCAAAACCA
TTTCAAATACACTGCCTGGTAAAATGAAATTGGCATTGTGTTCTCGCACA
GTTTTATCGATCATGTTACATAATCTGTTGCGTTCATGTTTATAATTCTT
GAAAAAGGAAATTTTTTCGTAGCATTTCGGTAAATTCGCTTGAATGGGCC
ATTGAGTGGATTTGAATCCCAACATGCCTCTGTATTTACTGAATTTTTCC
TTGGCTTTTTCATTGTACGGTACTTCAACTTCATCTGGAAACATCGATTC
TTCTCGAGACTTCTTGAATTTCATTATCTGAGCCACTGAAAATCCACTAT
GAGCTGTAGTAGCAAATGACATTTTCTCATCCATAGGATCATTATCACTG
TCGATGCTTCCAATATCGCTTACTTCTTCCATTTCCGAATCTTCACTGGA
ATCGTGAGCATCATCTTCAGATCCAGAGCATTCCATTTCTTCATCTGATT
CATGGTCATTATCAGATGCTTCATTATTGATTTCCTCATGTTTAAAAACA
AAATTCTTCAATGATTGCACTTTATCCTTTTCAGTGAAATGATTAGATTC
TTCCGGAGATATCCAGCTGACTTCTTTTATAGAAAAATCTCCAACTCCAG
TCAAATGAATGAATTCGCTTTTTTCTAAATCAATTCCAAAACCTCTCATG
CATCCAGTTAATCGCATGTTATCTTCTTCATATTTTATATTCTGAGCTAA
AAAATATCCACGTTTTTCTTTTATGGAATTTTTTGAAACATTTGATTTTT
TTGATGCCGAATAATGCGGTTTACAGTTTTGTGCTAAATGCCGCATTAAT
TTATTTGCATCGTTAGTGTTGCTCAGGCAATGAATTTTACTATCCGCTAA
TGGTATTTTTATAATCGATTCCAAATATTTAATATCGTCCTTCATTTTAA
AGGACTTGTCACTTTTAAGAGTTATAAAACAGCCAGATGGCATTCCTTGA
GCAATCAAAGATGAAAATAAGTCTTCAGTGTAATCTCCAATTAATTCATC
CAAATCATCTGGTAAAATAAATAAACACCAATCCACAACTTTCGCCAAAT
CCAGATAATCAAATCGATCTTTAAAATCTTTACATGAAGCAAATGCAAAA
TTTTTCTTTAATTTCTTGGACTTCATAATTAAGCTTTCACAGTTTAATTT
AGAATAATTCGGAATATTATCTATTTTTTTGATAATAGATTCCGGATCAG
AAGATTTTAAAAGAGAAAGTATGACTTCAATATGTTCACAGTGAAATAAC
GGAAAAACTCCACATAATAATGGTGCATTAGTGTTATTACCTCGTTCACT
CTGGTTATTTTCTTTTATAGAATTTTCCCTTTGTTGCTTTGCTTGATGTA
CCCTTAAATCTTTAGAATTATTTACAGCTTTTGTTTTTTTACCATTCTTG
GGCTTTTTAATTGCAGATGATGGCTTGCTTTTATCTTTATGTGGCTTGTT
AGCTTGAGTGAATTTTCTACCTTTATGACCCATAATTTTATTCACGATAT
AATTTAGCCAAAAATAAGATTATTTAAACAAATCTTTTAAATAAAA
back to top

protein sequence of SMED30009673-orf-1

>SMED30009673-orf-1 ID=SMED30009673-orf-1|Name=SMED30009673-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=804bp
MGHKGRKFTQANKPHKDKSKPSSAIKKPKNGKKTKAVNNSKDLRVHQAKQ
QRENSIKENNQSERGNNTNAPLLCGVFPLFHCEHIEVILSLLKSSDPESI
IKKIDNIPNYSKLNCESLIMKSKKLKKNFAFASCKDFKDRFDYLDLAKVV
DWCLFILPDDLDELIGDYTEDLFSSLIAQGMPSGCFITLKSDKSFKMKDD
IKYLESIIKIPLADSKIHCLSNTNDANKLMRHLAQNCKPHYSASKKSNVS
KNSIKEKRGYFLAQNIKYEEDNMRLTGCMRGFGIDLEKSEFIHLTGVGDF
SIKEVSWISPEESNHFTEKDKVQSLKNFVFKHEEINNEASDNDHESDEEM
ECSGSEDDAHDSSEDSEMEEVSDIGSIDSDNDPMDEKMSFATTAHSGFSV
AQIMKFKKSREESMFPDEVEVPYNEKAKEKFSKYRGMLGFKSTQWPIQAN
LPKCYEKISFFKNYKHERNRLCNMIDKTVREHNANFILPGSVFEMVLEKV
SPSDIEKLQNIIRMNPGRHLIGSGLFVKEEKLSVLHFNEKRIAAVDDSVI
NKLAKLSPSTDSAIALGEEATSHYDVIDENYQLKPAAEPIESKETMLFQL
GFRRFSSTPIYSELTAASDQPGDKGKSKFLNFMELNKHVVVSTYGPITFG
PVNVLQFRIRQQDESVDRAYVSELVASGSLLSIDPTKPIIKRIRLTGQIY
KVNKRSAMIRYMFFNTEDIEHFKDVRLHAPGNILGRILEPHGSHGYMKCH
FDKKVSQNVIPYMPLYKRVFPKFTVENMYDNFPNAEQAEMEDEAMSNVMD
TLF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000429neoblast
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR039761Bms1/Tsr1
IPR011528NERD
IPR012948AARP2CN
IPR007034BMS1_TSR1_C
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
Vocabulary: biological process
TermDefinition
GO:0042254ribosome biogenesis
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR007034Ribosome biogenesis protein BMS1/TSR1, C-terminalSMARTSM01362DUF663_2coord: 418..769
e-value: 8.6E-60
score: 214.6
IPR007034Ribosome biogenesis protein BMS1/TSR1, C-terminalPFAMPF04950RIBIOP_Ccoord: 587..771
e-value: 2.1E-55
score: 188.2
coord: 420..550
e-value: 1.6E-12
score: 47.5
IPR012948AARP2CNSMARTSM00785aarp2cn2coord: 225..311
e-value: 0.0021
score: 8.6
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..64
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 334..382
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 360..376
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 334..359
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 35..59
NoneNo IPR availablePANTHERPTHR12858:SF1PRE-RRNA-PROCESSING PROTEIN TSR1 HOMOLOGcoord: 336..779
coord: 3..320
IPR039761Ribosome biogenesis protein Bms1/Tsr1PANTHERPTHR12858RIBOSOME BIOGENESIS PROTEINcoord: 336..779
coord: 3..320