HEAT repeat-containing protein 5B

Overview
NameHEAT repeat-containing protein 5B
Smed IDSMED30009652
Length (bp)1176
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of HEAT repeat-containing protein 5B (SMED30009652) t-SNE clustered cells

Violin plots show distribution of expression levels for HEAT repeat-containing protein 5B (SMED30009652) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of HEAT repeat-containing protein 5B (SMED30009652) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for HEAT repeat-containing protein 5B (SMED30009652) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30009652

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
protonephridiaSMED30009652SMESG000028228.1 dd_Smed_v4_7872_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30009652SMESG000028228.1 dd_Smed_v4_7872_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30009652SMESG000028228.1 dd_Smed_v4_7872_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30009652SMESG000028228.1 dd_Smed_v4_7872_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30009652SMESG000028228.1 dd_Smed_v4_7872_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30009652SMESG000028228.1 dd_Smed_v4_7872_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of HEAT repeat-containing protein 5B vs. Ensembl Human
Match: HEATR5B (HEAT repeat containing 5B [Source:HGNC Symbol;Acc:HGNC:29273])

HSP 1 Score: 286.189 bits (731), Expect = 9.668e-86
Identity = 155/370 (41.89%), Postives = 229/370 (61.89%), Query Frame = 1
Query:    4 AESQTRCQTMLTLQHVVIGLGSAGIGCHKDILKVTRTCLLDRSMIVRSVACKCLFSLVDNSPTLYTLEIDNIMSMCFKALEDSNYDVRCEMAKVLGYLFSKSLAGTSVVQAST--KPLKQFTIDDVFSMLGQGFTRSNSSIFKTTANDSLKNGSSLNSEVRVGITHAIVEFGKCMGTAWLERNLSVFINKVLGLVANSKTTPTHVEAVYARKCVNFILRTVISFLLSDGGQMLAGRELCDIIRHTMSNMK--VNQKSNYNLDSFSEDGSKIYMNSSGDNSHHVLVCALQELSCLVQGLNTGAAILL-EAPSTIVDCIMPVLLHPSSSAQLSAAFCLRCLVEAIPSQVIPVLEKCFNKLDAYKSSPEALIG 1098
            AESQ R + +++LQ V+ GLG A    H+DI K  R+ L DRSM VR    KCL  L + +  ++T E++NI ++CFKALE+SNY VR  ++K+LG + + +L      QA+   + +K+ T D+V  ++  GF R  S   K+   + LK G S+N EVRVG+T A V F   +G  WLER+ + F++ VL LV++ + T THVEAVY+R+CV+FILR  +  LL +  Q+ A +E+C  I   M  ++  VN  S  N    ++  +          S HV+VCALQEL  LVQ LN  A+ L+ EA   +++ +  VLLHPS +A+L+AA+CLRC+  A+P Q+ P L++C  +L+  K+SPEA+ G
Sbjct:  148 AESQGRSEILMSLQKVLSGLGGAAASSHRDIYKNARSLLTDRSMAVRCAVAKCLLELQNEAVFMWTAELENIATLCFKALENSNYGVRVAVSKLLGTVMATALMPK---QATVMRQNVKRATFDEVLELMATGFLRGGSGFLKS-GGEMLKVGGSVNREVRVGVTQAYVVFVTTLGGQWLERSFATFLSHVLDLVSHPRATQTHVEAVYSRRCVSFILRATVGSLLGEKAQIAAAKEICQAIGKQMKAVEAVVNDTSGENKSGAADIAA----------SQHVMVCALQELGSLVQSLNATASPLIQEASIGLLEIVTSVLLHPSMAARLAAAWCLRCVAVALPFQLTPFLDRCAERLNNLKTSPEAVSG 503          
BLAST of HEAT repeat-containing protein 5B vs. Ensembl Human
Match: HEATR5A (HEAT repeat containing 5A [Source:HGNC Symbol;Acc:HGNC:20276])

HSP 1 Score: 282.337 bits (721), Expect = 1.973e-84
Identity = 153/374 (40.91%), Postives = 235/374 (62.83%), Query Frame = 1
Query:    4 AESQTRCQTMLTLQHVVIGLGSAGIGCHKDILKVTRTCLLDRSMIVRSVACKCLFSLVDNSPTLYTLEIDNIMSMCFKALEDSNYDVRCEMAKVLGYLFSKSL----AGTSVVQASTKPLKQFTIDDVFSMLGQGFTRSNSSIFKTTANDSLKNGSSLNSEVRVGITHAIVEFGKCMGTAWLERNLSVFINKVLGLVANS--KTTPTHVEAVYARKCVNFILRTVISFLLSDGGQMLAGRELCDIIRHTMSNMKVNQKSNYNLDSFSEDGSKIYMNSSGD--NSHHVLVCALQELSCLVQGLNTGAAILLEAPST-IVDCIMPVLLHPSSSAQLSAAFCLRCLVEAIPSQVIPVLEKCFNKLDAYKSSPEALIG 1098
            AESQ R + ML+LQ+++ GLG+A   CH+D+ K  R+CL DRSM VR  A KCL  L + +  +++ ++D++ ++CFK+ E SNYDVR  ++K+LG + +K++     GT+   AS + +++ ++++V  +LG GF R +S   + +  D LK  SS++ +VRVG+T A V F   +G AWLE+N + F + +L L + S  K T T ++AV  R+CV+FILRT I  LL +  Q+ A +++C  I           K    +D+   DG+      S D   S H+LVCALQEL  L+  L T AA LL+  ST ++D I+ V+LHPS S +L+AA+CL C+  A+PS + P+L++C  +L  +KSSPEA+ G
Sbjct:  148 AESQGRYEIMLSLQNILNGLGAAAAPCHRDVYKAARSCLTDRSMAVRCAAAKCLLELQNEAIFMWSTDLDSVATLCFKSFEGSNYDVRISVSKLLGIILAKAVISKHPGTA---ASRQSIRRVSLEEVLELLGTGFLRGSSGFLRAS-GDMLKGTSSVSRDVRVGVTQAYVVFVSTLGGAWLEKNFAAFFSHILSLASPSHPKATQTQIDAVCCRRCVSFILRTTIGGLLGEKAQLAAVKDICQAI----------WKLKKVMDAVMSDGNLETRLGSTDVAASQHMLVCALQELGNLIHNLGTTAAPLLQDSSTGLLDSILSVILHPSISVRLAAAWCLHCIAVALPSYLTPLLDRCLERLTGHKSSPEAVTG 507          
BLAST of HEAT repeat-containing protein 5B vs. Ensembl Human
Match: HEATR5A (HEAT repeat containing 5A [Source:HGNC Symbol;Acc:HGNC:20276])

HSP 1 Score: 120.168 bits (300), Expect = 7.436e-29
Identity = 69/173 (39.88%), Postives = 99/173 (57.23%), Query Frame = 1
Query:  583 ANSKTTPTHVEAVYARKCVNFILRTVISFLLSDGGQMLAGRELCDIIRHTMSNMKVNQKSNYNLDSFSEDGSKIYMNSSGDNSHHVLVCALQELSCLVQGLNTGAAILLEAPST-IVDCIMPVLLHPSSSAQLSAAFCLRCLVEAIPSQVIPVLEKCFNKLDAYKSSPEALIG 1098
            ++ K T T ++AV  R+CV+FILRT I  LL +  Q+ A +++C  I      M V                          S H+LVCALQEL  L+  L T AA LL+  ST ++D I+ V+LHPS S +L+AA+CL C+  A+PS + P+L++C  +L  +KSSPEA+ G
Sbjct:    2 SHPKATQTQIDAVCCRRCVSFILRTTIGGLLGEKAQLAAVKDICQAIWKLKKVMDVAA------------------------SQHMLVCALQELGNLIHNLGTTAAPLLQDSSTGLLDSILSVILHPSISVRLAAAWCLHCIAVALPSYLTPLLDRCLERLTGHKSSPEAVTG 150          
BLAST of HEAT repeat-containing protein 5B vs. Ensembl Human
Match: HEATR5A (HEAT repeat containing 5A [Source:HGNC Symbol;Acc:HGNC:20276])

HSP 1 Score: 96.2857 bits (238), Expect = 8.539e-21
Identity = 57/143 (39.86%), Postives = 84/143 (58.74%), Query Frame = 1
Query:  679 DGGQMLAGRELCDIIRHTMSNMKVNQKSNYNLDSFSEDGSKIYMNSSGD--NSHHVLVCALQELSCLVQGLNTGAAILLEAPST-IVDCIMPVLLHPSSSAQLSAAFCLRCLVEAIPSQVIPVLEKCFNKLDAYKSSPEALIG 1098
            +  Q+ A +++C  I           K    +D+   DG+      S D   S H+LVCALQEL  L+  L T AA LL+  ST ++D I+ V+LHPS S +L+AA+CL C+  A+PS + P+L++C  +L  +KSSPEA+ G
Sbjct:    3 EKAQLAAVKDICQAI----------WKLKKVMDAVMSDGNLETRLGSTDVAASQHMLVCALQELGNLIHNLGTTAAPLLQDSSTGLLDSILSVILHPSISVRLAAAWCLHCIAVALPSYLTPLLDRCLERLTGHKSSPEAVTG 135          
BLAST of HEAT repeat-containing protein 5B vs. Ensembl Celegans
Match: soap-1 (Sorting Of Apical Proteins [Source:UniProtKB/TrEMBL;Acc:O01485])

HSP 1 Score: 167.162 bits (422), Expect = 4.249e-45
Identity = 117/385 (30.39%), Postives = 197/385 (51.17%), Query Frame = 1
Query:    4 AESQTRCQTMLTLQHVVIGLGSAGIGCHKDILKVTRTCLLDRSMI----VRSVACKCLFSLVDNSPTLYTLEIDNIMSMCFKALEDSNYDVRCEMAKVLGYLFSKSLAGT--SVVQAS---TKPLKQFTIDDVFSMLGQGFTRSNSSIFKTTANDSLKNGSSL-----NSEVRVGITHAIVEFGKCMGTAWLERNL------SVFINKVLGLVANSKTTPTHVEAVYARKCVNFILRTVISFLLSDGGQMLAGRELCDIIRHTMSNMKVNQKSNYNLDSFSEDGSKIYMNSSGDNSHHVLVCALQELSCLVQGLNTGAAILLEAPSTIVDCIMPVLLHPSSSAQLSAAFCLRCLVEAIPSQVIPVLEKCFNKLDAYKSSPEALIG 1098
            A + ++   M TL  +V  LGS     HK I  + +  L DR++     V+  + +CL +LV     +YT E++   +MC K LE S Y++RC +AK    L + S+     +V++A    T P++  ++ D  ++L  GF R     F       LK  SS       S++R+G++   VE  + MG+AWLE++L       V +    G +A ++      EA+  R+C++FILR  I  LL +  Q LA + L  ++   +  + +   +  NLDS         ++SS   S + ++  LQE+S LV+ + T    L    + I++ I   L HP +SA+ +AA+CLRC+  A+P+ + P++++C  +LD   SS  A+ G
Sbjct:  149 AVAHSQAHIMNTLTSMVKALGSGDYVTHKKIHSIAKNSLQDRTLCKTPNVKIASLECLTALVQFHTPIYTTELEASCTMCIKILEGSTYELRCAVAKFTAQLLATSMKPPPGAVIKAKSNQTVPVRPASVTDTLNLLASGFLRGGIGGF-------LKGSSSTFSTMGRSDIRIGVSICYVEMVREMGSAWLEKHLIAVCCHMVDLASKCGHLAYTQNASHVSEALTIRRCISFILRQTIGSLLGENAQTLACKHLGVLLSQYVDLVSIG--TGDNLDS--------SVDSSDYGSGYAIIVILQEISVLVRQIGTSVMSLFTEATGIMEHIFKCLTHPLASARYAAAWCLRCIATAVPNLMTPLIDRCLPRLDQLSSSSRAISG 516          
BLAST of HEAT repeat-containing protein 5B vs. Ensembl Fly
Match: CG2747 (gene:FBgn0037541 transcript:FBtr0300916)

HSP 1 Score: 261.536 bits (667), Expect = 1.944e-77
Identity = 151/379 (39.84%), Postives = 225/379 (59.37%), Query Frame = 1
Query:    4 AESQTRCQTMLTLQHVVIGLGSAGIGCHKDILKVTRTCLLDRSMIVRSVACKCLFSLVDNSPTLYTLEIDNIMSMCFKALEDSNYDVRCEMAKVLGYLF-----------SKSLAGTSVVQASTKPLKQ--FTIDDVFSMLGQGFTRSNSSIFKTTANDSLKNGSSLNSEVRVGITHAIVEFGKCMGTAWLERNLSVFINKVLGLVANSKTTPTHVEAVYARKCVNFILRTVISFLLSDGGQMLAGRELCDIIRHTMSNMKVNQKSNYNLDSFSEDGSKIYMNSSGDNSHHVLVCALQELSCLVQGLNTGAAILLEAPS-TIVDCIMPVLLHPSSSAQLSAAFCLRCLVEAIPSQVIPVLEKCFNKLDAYKSSPEALIG 1098
            AESQ R + M TL+ V  G+G+A    HKDI K  + CLLDR M VR  A +C+  ++ ++P LY  E++++ ++CF+A + SNY+VRC +A++LG L            SK   G +V   + K   Q   ++D+   +L  GF R  +S  K T  + +K  S +N EVRVG+THA V F + MG+ WLER LS F+  VL LVAN K   +HV+AVY+RKC++FILR+ I  +L +  Q  A +EL  ++   M+++  N ++       ++D      N     S H+LVCALQELS L+ GL T A  LL   S   +D    VL+HP ++A+L+AA+CLRC   A+P Q+ P++++    ++  +SSPEA+ G
Sbjct:  196 AESQARIEIMHTLEKVSAGMGTAIANVHKDIYKAAKHCLLDRVMAVRVAAARCILKMIYSAPFLYQTELESLGTLCFRAFDGSNYEVRCAVAQLLGTLLAYTQQLAEAATSKKKQGQAVAIQAGKGATQRLVSLDEALGILMSGFLRGGASFLKGTG-EIIKGSSGVNREVRVGVTHAYVVFVQFMGSVWLERQLSTFLAHVLDLVANPKAACSHVDAVYSRKCISFILRSTIGKMLGEKAQSAACKELVHLVAKQMNSIDFNPEN-------AKDS-----NQETLFSQHLLVCALQELSSLLIGLGTTAQNLLGDQSLQAIDATCAVLVHPCAAARLAAAWCLRCACVAVPGQITPLIDRFVEAIEQMRSSPEAMAG 561          
BLAST of HEAT repeat-containing protein 5B vs. Ensembl Fly
Match: CG2747 (gene:FBgn0037541 transcript:FBtr0081818)

HSP 1 Score: 261.151 bits (666), Expect = 2.101e-77
Identity = 151/379 (39.84%), Postives = 225/379 (59.37%), Query Frame = 1
Query:    4 AESQTRCQTMLTLQHVVIGLGSAGIGCHKDILKVTRTCLLDRSMIVRSVACKCLFSLVDNSPTLYTLEIDNIMSMCFKALEDSNYDVRCEMAKVLGYLF-----------SKSLAGTSVVQASTKPLKQ--FTIDDVFSMLGQGFTRSNSSIFKTTANDSLKNGSSLNSEVRVGITHAIVEFGKCMGTAWLERNLSVFINKVLGLVANSKTTPTHVEAVYARKCVNFILRTVISFLLSDGGQMLAGRELCDIIRHTMSNMKVNQKSNYNLDSFSEDGSKIYMNSSGDNSHHVLVCALQELSCLVQGLNTGAAILLEAPS-TIVDCIMPVLLHPSSSAQLSAAFCLRCLVEAIPSQVIPVLEKCFNKLDAYKSSPEALIG 1098
            AESQ R + M TL+ V  G+G+A    HKDI K  + CLLDR M VR  A +C+  ++ ++P LY  E++++ ++CF+A + SNY+VRC +A++LG L            SK   G +V   + K   Q   ++D+   +L  GF R  +S  K T  + +K  S +N EVRVG+THA V F + MG+ WLER LS F+  VL LVAN K   +HV+AVY+RKC++FILR+ I  +L +  Q  A +EL  ++   M+++  N ++       ++D      N     S H+LVCALQELS L+ GL T A  LL   S   +D    VL+HP ++A+L+AA+CLRC   A+P Q+ P++++    ++  +SSPEA+ G
Sbjct:  196 AESQARIEIMHTLEKVSAGMGTAIANVHKDIYKAAKHCLLDRVMAVRVAAARCILKMIYSAPFLYQTELESLGTLCFRAFDGSNYEVRCAVAQLLGTLLAYTQQLAEAATSKKKQGQAVAIQAGKGATQRLVSLDEALGILMSGFLRGGASFLKGTG-EIIKGSSGVNREVRVGVTHAYVVFVQFMGSVWLERQLSTFLAHVLDLVANPKAACSHVDAVYSRKCISFILRSTIGKMLGEKAQSAACKELVHLVAKQMNSIDFNPEN-------AKDS-----NQETLFSQHLLVCALQELSSLLIGLGTTAQNLLGDQSLQAIDATCAVLVHPCAAARLAAAWCLRCACVAVPGQITPLIDRFVEAIEQMRSSPEAMAG 561          
BLAST of HEAT repeat-containing protein 5B vs. Ensembl Fly
Match: CG2747 (gene:FBgn0037541 transcript:FBtr0335230)

HSP 1 Score: 261.151 bits (666), Expect = 2.314e-77
Identity = 151/379 (39.84%), Postives = 225/379 (59.37%), Query Frame = 1
Query:    4 AESQTRCQTMLTLQHVVIGLGSAGIGCHKDILKVTRTCLLDRSMIVRSVACKCLFSLVDNSPTLYTLEIDNIMSMCFKALEDSNYDVRCEMAKVLGYLF-----------SKSLAGTSVVQASTKPLKQ--FTIDDVFSMLGQGFTRSNSSIFKTTANDSLKNGSSLNSEVRVGITHAIVEFGKCMGTAWLERNLSVFINKVLGLVANSKTTPTHVEAVYARKCVNFILRTVISFLLSDGGQMLAGRELCDIIRHTMSNMKVNQKSNYNLDSFSEDGSKIYMNSSGDNSHHVLVCALQELSCLVQGLNTGAAILLEAPS-TIVDCIMPVLLHPSSSAQLSAAFCLRCLVEAIPSQVIPVLEKCFNKLDAYKSSPEALIG 1098
            AESQ R + M TL+ V  G+G+A    HKDI K  + CLLDR M VR  A +C+  ++ ++P LY  E++++ ++CF+A + SNY+VRC +A++LG L            SK   G +V   + K   Q   ++D+   +L  GF R  +S  K T  + +K  S +N EVRVG+THA V F + MG+ WLER LS F+  VL LVAN K   +HV+AVY+RKC++FILR+ I  +L +  Q  A +EL  ++   M+++  N ++       ++D      N     S H+LVCALQELS L+ GL T A  LL   S   +D    VL+HP ++A+L+AA+CLRC   A+P Q+ P++++    ++  +SSPEA+ G
Sbjct:  196 AESQARIEIMHTLEKVSAGMGTAIANVHKDIYKAAKHCLLDRVMAVRVAAARCILKMIYSAPFLYQTELESLGTLCFRAFDGSNYEVRCAVAQLLGTLLAYTQQLAEAATSKKKQGQAVAIQAGKGATQRLVSLDEALGILMSGFLRGGASFLKGTG-EIIKGSSGVNREVRVGVTHAYVVFVQFMGSVWLERQLSTFLAHVLDLVANPKAACSHVDAVYSRKCISFILRSTIGKMLGEKAQSAACKELVHLVAKQMNSIDFNPEN-------AKDS-----NQETLFSQHLLVCALQELSSLLIGLGTTAQNLLGDQSLQAIDATCAVLVHPCAAARLAAAWCLRCACVAVPGQITPLIDRFVEAIEQMRSSPEAMAG 561          
BLAST of HEAT repeat-containing protein 5B vs. Ensembl Fly
Match: CG2747 (gene:FBgn0037541 transcript:FBtr0335229)

HSP 1 Score: 261.151 bits (666), Expect = 2.569e-77
Identity = 151/379 (39.84%), Postives = 225/379 (59.37%), Query Frame = 1
Query:    4 AESQTRCQTMLTLQHVVIGLGSAGIGCHKDILKVTRTCLLDRSMIVRSVACKCLFSLVDNSPTLYTLEIDNIMSMCFKALEDSNYDVRCEMAKVLGYLF-----------SKSLAGTSVVQASTKPLKQ--FTIDDVFSMLGQGFTRSNSSIFKTTANDSLKNGSSLNSEVRVGITHAIVEFGKCMGTAWLERNLSVFINKVLGLVANSKTTPTHVEAVYARKCVNFILRTVISFLLSDGGQMLAGRELCDIIRHTMSNMKVNQKSNYNLDSFSEDGSKIYMNSSGDNSHHVLVCALQELSCLVQGLNTGAAILLEAPS-TIVDCIMPVLLHPSSSAQLSAAFCLRCLVEAIPSQVIPVLEKCFNKLDAYKSSPEALIG 1098
            AESQ R + M TL+ V  G+G+A    HKDI K  + CLLDR M VR  A +C+  ++ ++P LY  E++++ ++CF+A + SNY+VRC +A++LG L            SK   G +V   + K   Q   ++D+   +L  GF R  +S  K T  + +K  S +N EVRVG+THA V F + MG+ WLER LS F+  VL LVAN K   +HV+AVY+RKC++FILR+ I  +L +  Q  A +EL  ++   M+++  N ++       ++D      N     S H+LVCALQELS L+ GL T A  LL   S   +D    VL+HP ++A+L+AA+CLRC   A+P Q+ P++++    ++  +SSPEA+ G
Sbjct:  196 AESQARIEIMHTLEKVSAGMGTAIANVHKDIYKAAKHCLLDRVMAVRVAAARCILKMIYSAPFLYQTELESLGTLCFRAFDGSNYEVRCAVAQLLGTLLAYTQQLAEAATSKKKQGQAVAIQAGKGATQRLVSLDEALGILMSGFLRGGASFLKGTG-EIIKGSSGVNREVRVGVTHAYVVFVQFMGSVWLERQLSTFLAHVLDLVANPKAACSHVDAVYSRKCISFILRSTIGKMLGEKAQSAACKELVHLVAKQMNSIDFNPEN-------AKDS-----NQETLFSQHLLVCALQELSSLLIGLGTTAQNLLGDQSLQAIDATCAVLVHPCAAARLAAAWCLRCACVAVPGQITPLIDRFVEAIEQMRSSPEAMAG 561          
BLAST of HEAT repeat-containing protein 5B vs. Ensembl Fly
Match: CG2747 (gene:FBgn0037541 transcript:FBtr0081817)

HSP 1 Score: 261.151 bits (666), Expect = 2.661e-77
Identity = 151/379 (39.84%), Postives = 225/379 (59.37%), Query Frame = 1
Query:    4 AESQTRCQTMLTLQHVVIGLGSAGIGCHKDILKVTRTCLLDRSMIVRSVACKCLFSLVDNSPTLYTLEIDNIMSMCFKALEDSNYDVRCEMAKVLGYLF-----------SKSLAGTSVVQASTKPLKQ--FTIDDVFSMLGQGFTRSNSSIFKTTANDSLKNGSSLNSEVRVGITHAIVEFGKCMGTAWLERNLSVFINKVLGLVANSKTTPTHVEAVYARKCVNFILRTVISFLLSDGGQMLAGRELCDIIRHTMSNMKVNQKSNYNLDSFSEDGSKIYMNSSGDNSHHVLVCALQELSCLVQGLNTGAAILLEAPS-TIVDCIMPVLLHPSSSAQLSAAFCLRCLVEAIPSQVIPVLEKCFNKLDAYKSSPEALIG 1098
            AESQ R + M TL+ V  G+G+A    HKDI K  + CLLDR M VR  A +C+  ++ ++P LY  E++++ ++CF+A + SNY+VRC +A++LG L            SK   G +V   + K   Q   ++D+   +L  GF R  +S  K T  + +K  S +N EVRVG+THA V F + MG+ WLER LS F+  VL LVAN K   +HV+AVY+RKC++FILR+ I  +L +  Q  A +EL  ++   M+++  N ++       ++D      N     S H+LVCALQELS L+ GL T A  LL   S   +D    VL+HP ++A+L+AA+CLRC   A+P Q+ P++++    ++  +SSPEA+ G
Sbjct:  148 AESQARIEIMHTLEKVSAGMGTAIANVHKDIYKAAKHCLLDRVMAVRVAAARCILKMIYSAPFLYQTELESLGTLCFRAFDGSNYEVRCAVAQLLGTLLAYTQQLAEAATSKKKQGQAVAIQAGKGATQRLVSLDEALGILMSGFLRGGASFLKGTG-EIIKGSSGVNREVRVGVTHAYVVFVQFMGSVWLERQLSTFLAHVLDLVANPKAACSHVDAVYSRKCISFILRSTIGKMLGEKAQSAACKELVHLVAKQMNSIDFNPEN-------AKDS-----NQETLFSQHLLVCALQELSSLLIGLGTTAQNLLGDQSLQAIDATCAVLVHPCAAARLAAAWCLRCACVAVPGQITPLIDRFVEAIEQMRSSPEAMAG 513          
BLAST of HEAT repeat-containing protein 5B vs. Ensembl Zebrafish
Match: heatr5b (HEAT repeat containing 5B [Source:ZFIN;Acc:ZDB-GENE-130530-676])

HSP 1 Score: 280.411 bits (716), Expect = 7.205e-84
Identity = 149/370 (40.27%), Postives = 235/370 (63.51%), Query Frame = 1
Query:    4 AESQTRCQTMLTLQHVVIGLGSAGIGCHKDILKVTRTCLLDRSMIVRSVACKCLFSLVDNSPTLYTLEIDNIMSMCFKALEDSNYDVRCEMAKVLGYLFSKSLAGTSVVQAST--KPLKQFTIDDVFSMLGQGFTRSNSSIFKTTANDSLKNGSSLNSEVRVGITHAIVEFGKCMGTAWLERNLSVFINKVLGLVANSKTTPTHVEAVYARKCVNFILRTVISFLLSDGGQMLAGRELCDIIRHTMSNMK--VNQKSNYNLDSFSEDGSKIYMNSSGDNSHHVLVCALQELSCLVQGLNTGAAILLEAPST-IVDCIMPVLLHPSSSAQLSAAFCLRCLVEAIPSQVIPVLEKCFNKLDAYKSSPEALIG 1098
            AE+Q R + +L+LQ V+ GLG A   CH+DI K TR+ L DRSM VR    +CL  L + +  ++T E++N+ ++CFKALE S YDVR  ++ +LG + + +L      QA+   + +K+ T+++V  ++  GF R  S   K+     +  G+S++ EVRVG+T A V F   +G  WLERN +VF++ +L LVA+ + T THVEAVY+R+CV+F LR  +  LL +  Q+ A +E+C  I   M  ++  VN++S+ N    ++  +          S HV+VCAL+EL  LVQ L+  A+ L++ PS  +++ ++ VLLHPS +A+L+AA+CLRC+  A+P Q+ P+LE+C + ++  K+SPEA+ G
Sbjct:  148 AEAQGRGEILLSLQKVLSGLGGAAASCHRDIYKNTRSMLSDRSMAVRCAVARCLLELQNEAVFIWTTELENVATLCFKALEGSTYDVRVAVSTLLGTVMATALMPK---QATVMRQNVKRATLEEVLELMATGFLRGGSGFLKS--GGEMLKGASVSREVRVGVTQAYVVFVTVLGGQWLERNFAVFLSHLLELVAHPRATQTHVEAVYSRRCVSFALRATLGGLLGEKAQIAAAKEICLAISKQMRAVEAVVNEQSSENRTGAADVSA----------SQHVMVCALKELGRLVQSLSATASPLIQEPSIGLLETVLSVLLHPSMAARLAAAWCLRCVCVALPHQLTPLLERCADCINTLKNSPEAVSG 502          
BLAST of HEAT repeat-containing protein 5B vs. Ensembl Zebrafish
Match: heatr5b (HEAT repeat containing 5B [Source:ZFIN;Acc:ZDB-GENE-130530-676])

HSP 1 Score: 279.641 bits (714), Expect = 7.875e-84
Identity = 149/370 (40.27%), Postives = 235/370 (63.51%), Query Frame = 1
Query:    4 AESQTRCQTMLTLQHVVIGLGSAGIGCHKDILKVTRTCLLDRSMIVRSVACKCLFSLVDNSPTLYTLEIDNIMSMCFKALEDSNYDVRCEMAKVLGYLFSKSLAGTSVVQAST--KPLKQFTIDDVFSMLGQGFTRSNSSIFKTTANDSLKNGSSLNSEVRVGITHAIVEFGKCMGTAWLERNLSVFINKVLGLVANSKTTPTHVEAVYARKCVNFILRTVISFLLSDGGQMLAGRELCDIIRHTMSNMK--VNQKSNYNLDSFSEDGSKIYMNSSGDNSHHVLVCALQELSCLVQGLNTGAAILLEAPST-IVDCIMPVLLHPSSSAQLSAAFCLRCLVEAIPSQVIPVLEKCFNKLDAYKSSPEALIG 1098
            AE+Q R + +L+LQ V+ GLG A   CH+DI K TR+ L DRSM VR    +CL  L + +  ++T E++N+ ++CFKALE S YDVR  ++ +LG + + +L      QA+   + +K+ T+++V  ++  GF R  S   K+     +  G+S++ EVRVG+T A V F   +G  WLERN +VF++ +L LVA+ + T THVEAVY+R+CV+F LR  +  LL +  Q+ A +E+C  I   M  ++  VN++S+ N    ++  +          S HV+VCAL+EL  LVQ L+  A+ L++ PS  +++ ++ VLLHPS +A+L+AA+CLRC+  A+P Q+ P+LE+C + ++  K+SPEA+ G
Sbjct:  148 AEAQGRGEILLSLQKVLSGLGGAAASCHRDIYKNTRSMLSDRSMAVRCAVARCLLELQNEAVFIWTTELENVATLCFKALEGSTYDVRVAVSTLLGTVMATALMPK---QATVMRQNVKRATLEEVLELMATGFLRGGSGFLKS--GGEMLKGASVSREVRVGVTQAYVVFVTVLGGQWLERNFAVFLSHLLELVAHPRATQTHVEAVYSRRCVSFALRATLGGLLGEKAQIAAAKEICLAISKQMRAVEAVVNEQSSENRTGAADVSA----------SQHVMVCALKELGRLVQSLSATASPLIQEPSIGLLETVLSVLLHPSMAARLAAAWCLRCVCVALPHQLTPLLERCADCINTLKNSPEAVSG 502          
BLAST of HEAT repeat-containing protein 5B vs. Ensembl Zebrafish
Match: heatr5a (HEAT repeat containing 5a [Source:NCBI gene;Acc:368728])

HSP 1 Score: 259.61 bits (662), Expect = 1.005e-76
Identity = 142/368 (38.59%), Postives = 220/368 (59.78%), Query Frame = 1
Query:    4 AESQTRCQTMLTLQHVVIGLGSAGIGCHKDILKVTRTCLLDRSMIVRSVACKCLFSLVDNSPTLYTLEIDNIMSMCFKALEDSNYDVRCEMAKVLGYLFSKSLAGTSVVQASTKPLKQFTIDDVFSMLGQGFTRSNSSIFKTTANDSLKNGSSLNSEVRVGITHAIVEFGKCMGTAWLERNLSVFINKVLGLVANSKTTPTHVEAVYARKCVNFILRTVISFLLSDGGQMLAGRELCDIIRHTMSNMKVNQKSNYNLDSFSEDGSKIYMNSSGD--NSHHVLVCALQELSCLVQGLNTGAAILLEAPST-IVDCIMPVLLHPSSSAQLSAAFCLRCLVEAIPSQVIPVLEKCFNKLDAYKSSPEALIG 1098
            AESQ RC+ ML ++ ++ GLG + + CH+DI K  RT L DRSM VR  A KCL  L   +  L++ E++N+ ++CF+ALE SNYDVR  ++K+LG L + +L     + A     K+ ++++V  +L  GF R  +   + +  D LK  SS++ +VRVGIT   V F   +G  WLE + S  ++ ++   ++++ T    +AV  R CV+FILR  +  LL +  Q+ A +E+C +I           K    +D+   +G+     S  D   S HVLVCAL EL  LVQ L++ AA LL+     ++D ++ VLLHPS+SA+L++A+CLRC+   +P+QV  +L++C  +L+A KS PEA+ G
Sbjct:  148 AESQGRCEIMLCVERILRGLGVSAVSCHRDIYKAARTGLTDRSMAVRCAAAKCLLELQREAVFLWSTELENVATLCFRALEGSNYDVRVSISKLLGTLLASALEPRQAI-APRPGSKRSSLEEVMELLSSGFLRGGAGFLRAS-GDMLKGTSSVSRDVRVGITQTCVVFVSILGGVWLETHFSRLLSLLMEWASHTRATQYPADAVSCRCCVSFILRATLGTLLGEKAQIAAAKEICQVI----------SKQKRVVDASLHEGNMETRVSPADVAASQHVLVCALLELGSLVQDLSSTAAPLLQDTGIGMLDTVISVLLHPSASARLASAWCLRCIAVGMPAQVAVLLDRCVERLNALKSCPEAVAG 503          
BLAST of HEAT repeat-containing protein 5B vs. Ensembl Zebrafish
Match: BX465838.3 (HEAT repeat containing 5a [Source:NCBI gene;Acc:368728])

HSP 1 Score: 259.61 bits (662), Expect = 1.048e-76
Identity = 142/368 (38.59%), Postives = 220/368 (59.78%), Query Frame = 1
Query:    4 AESQTRCQTMLTLQHVVIGLGSAGIGCHKDILKVTRTCLLDRSMIVRSVACKCLFSLVDNSPTLYTLEIDNIMSMCFKALEDSNYDVRCEMAKVLGYLFSKSLAGTSVVQASTKPLKQFTIDDVFSMLGQGFTRSNSSIFKTTANDSLKNGSSLNSEVRVGITHAIVEFGKCMGTAWLERNLSVFINKVLGLVANSKTTPTHVEAVYARKCVNFILRTVISFLLSDGGQMLAGRELCDIIRHTMSNMKVNQKSNYNLDSFSEDGSKIYMNSSGD--NSHHVLVCALQELSCLVQGLNTGAAILLEAPST-IVDCIMPVLLHPSSSAQLSAAFCLRCLVEAIPSQVIPVLEKCFNKLDAYKSSPEALIG 1098
            AESQ RC+ ML ++ ++ GLG + + CH+DI K  RT L DRSM VR  A KCL  L   +  L++ E++N+ ++CF+ALE SNYDVR  ++K+LG L + +L     + A     K+ ++++V  +L  GF R  +   + +  D LK  SS++ +VRVGIT   V F   +G  WLE + S  ++ ++   ++++ T    +AV  R CV+FILR  +  LL +  Q+ A +E+C +I           K    +D+   +G+     S  D   S HVLVCAL EL  LVQ L++ AA LL+     ++D ++ VLLHPS+SA+L++A+CLRC+   +P+QV  +L++C  +L+A KS PEA+ G
Sbjct:  148 AESQGRCEIMLCVERILRGLGVSAVSCHRDIYKAARTGLTDRSMAVRCAAAKCLLELQREAVFLWSTELENVATLCFRALEGSNYDVRVSISKLLGTLLASALEPRQAI-APRPGSKRSSLEEVMELLSSGFLRGGAGFLRAS-GDMLKGTSSVSRDVRVGITQTCVVFVSILGGVWLETHFSRLLSLLMEWASHTRATQYPADAVSCRCCVSFILRATLGTLLGEKAQIAAAKEICQVI----------SKQKRVVDASLHEGNMETRVSPADVAASQHVLVCALLELGSLVQDLSSTAAPLLQDTGIGMLDTVISVLLHPSASARLASAWCLRCIAVGMPAQVAVLLDRCVERLNALKSCPEAVAG 503          
BLAST of HEAT repeat-containing protein 5B vs. Ensembl Zebrafish
Match: heatr5a (HEAT repeat containing 5a [Source:NCBI gene;Acc:368728])

HSP 1 Score: 259.225 bits (661), Expect = 1.439e-76
Identity = 142/368 (38.59%), Postives = 220/368 (59.78%), Query Frame = 1
Query:    4 AESQTRCQTMLTLQHVVIGLGSAGIGCHKDILKVTRTCLLDRSMIVRSVACKCLFSLVDNSPTLYTLEIDNIMSMCFKALEDSNYDVRCEMAKVLGYLFSKSLAGTSVVQASTKPLKQFTIDDVFSMLGQGFTRSNSSIFKTTANDSLKNGSSLNSEVRVGITHAIVEFGKCMGTAWLERNLSVFINKVLGLVANSKTTPTHVEAVYARKCVNFILRTVISFLLSDGGQMLAGRELCDIIRHTMSNMKVNQKSNYNLDSFSEDGSKIYMNSSGD--NSHHVLVCALQELSCLVQGLNTGAAILLEAPST-IVDCIMPVLLHPSSSAQLSAAFCLRCLVEAIPSQVIPVLEKCFNKLDAYKSSPEALIG 1098
            AESQ RC+ ML ++ ++ GLG + + CH+DI K  RT L DRSM VR  A KCL  L   +  L++ E++N+ ++CF+ALE SNYDVR  ++K+LG L + +L     + A     K+ ++++V  +L  GF R  +   + +  D LK  SS++ +VRVGIT   V F   +G  WLE + S  ++ ++   ++++ T    +AV  R CV+FILR  +  LL +  Q+ A +E+C +I           K    +D+   +G+     S  D   S HVLVCAL EL  LVQ L++ AA LL+     ++D ++ VLLHPS+SA+L++A+CLRC+   +P+QV  +L++C  +L+A KS PEA+ G
Sbjct:  148 AESQGRCEIMLCVERILRGLGVSAVSCHRDIYKAARTGLTDRSMAVRCAAAKCLLELQREAVFLWSTELENVATLCFRALEGSNYDVRVSISKLLGTLLASALEPRQAI-APRPGSKRSSLEEVMELLSSGFLRGGAGFLRAS-GDMLKGTSSVSRDVRVGITQTCVVFVSILGGVWLETHFSRLLSLLMEWASHTRATQYPADAVSCRCCVSFILRATLGTLLGEKAQIAAAKEICQVI----------SKQKRVVDASLHEGNMETRVSPADVAASQHVLVCALLELGSLVQDLSSTAAPLLQDTGIGMLDTVISVLLHPSASARLASAWCLRCIAVGMPAQVAVLLDRCVERLNALKSCPEAVAG 503          
BLAST of HEAT repeat-containing protein 5B vs. Ensembl Xenopus
Match: heatr5b (HEAT repeat containing 5B [Source:NCBI gene;Acc:100036680])

HSP 1 Score: 290.041 bits (741), Expect = 3.904e-87
Identity = 156/368 (42.39%), Postives = 231/368 (62.77%), Query Frame = 1
Query:    4 AESQTRCQTMLTLQHVVIGLGSAGIGCHKDILKVTRTCLLDRSMIVRSVACKCLFSLVDNSPTLYTLEIDNIMSMCFKALEDSNYDVRCEMAKVLGYLFSKSLAGTSVVQASTKPLKQFTIDDVFSMLGQGFTRSNSSIFKTTANDSLKNGSSLNSEVRVGITHAIVEFGKCMGTAWLERNLSVFINKVLGLVANSKTTPTHVEAVYARKCVNFILRTVISFLLSDGGQMLAGRELCDIIRHTMSNMK--VNQKSNYNLDSFSEDGSKIYMNSSGDNSHHVLVCALQELSCLVQGLNTGAAILLEAPST-IVDCIMPVLLHPSSSAQLSAAFCLRCLVEAIPSQVIPVLEKCFNKLDAYKSSPEALIG 1098
            AESQ R + +++LQ V+ GLG A    H+DI K  R+ L DRSM VR    KCL  L   +  ++T E++N+ ++CFKALE SNY VR  ++K+LG + + +L    + + +T  L + T+++V  ++  GF R  S   K+   + LK G S++ EVRVG+T A V F   +G  WLERN + F++ VL LV++ + T THVEAVY+R+CV+FILR  +  LL +  Q  A +E+C  I   M +++  VN  +N N  S + D S          S HV+VCALQEL  LVQ LN+ A+ L+  PS  ++D +  VLLHPS +A+L+AA+CLRC+  A+P Q+ P+L++C  +L+  K+SPEA+ G
Sbjct:  148 AESQGRSEILMSLQKVLSGLGGAASSSHRDIYKNARSVLTDRSMAVRCATAKCLLELQSEAVFMWTAELENVATLCFKALEGSNYGVRVAVSKLLGTVMATAL----MPKQATGRLTKATLEEVLELMATGFLRGGSGFLKS-GGEMLKGGGSISREVRVGVTQAYVVFVTALGGKWLERNFATFLSHVLDLVSHPRATQTHVEAVYSRRCVSFILRATVGSLLGEKAQNAAAKEICQAISKQMKSVEAVVNDANNDN-KSGTADVSA---------SQHVMVCALQELGSLVQSLNSTASPLILEPSIGLLDTVTNVLLHPSMAARLAAAWCLRCVAVALPFQLTPLLDRCAERLNNLKNSPEAVSG 500          
BLAST of HEAT repeat-containing protein 5B vs. Ensembl Xenopus
Match: heatr5b (HEAT repeat containing 5B [Source:NCBI gene;Acc:100036680])

HSP 1 Score: 289.271 bits (739), Expect = 6.667e-87
Identity = 156/366 (42.62%), Postives = 230/366 (62.84%), Query Frame = 1
Query:    4 AESQTRCQTMLTLQHVVIGLGSAGIGCHKDILKVTRTCLLDRSMIVRSVACKCLFSLVDNSPTLYTLEIDNIMSMCFKALEDSNYDVRCEMAKVLGYLFSKSLAGTSVVQASTKPLKQFTIDDVFSMLGQGFTRSNSSIFKTTANDSLKNGSSLNSEVRVGITHAIVEFGKCMGTAWLERNLSVFINKVLGLVANSKTTPTHVEAVYARKCVNFILRTVISFLLSDGGQMLAGRELCDIIRHTMSNMKVNQKSNYNLDSFSEDGSKIYMNSSGDNSHHVLVCALQELSCLVQGLNTGAAILLEAPST-IVDCIMPVLLHPSSSAQLSAAFCLRCLVEAIPSQVIPVLEKCFNKLDAYKSSPEALIG 1098
            AESQ R + +++LQ V+ GLG A    H+DI K  R+ L DRSM VR    KCL  L   +  ++T E++N+ ++CFKALE SNY VR  ++K+LG + + +L    + + +T  L + T+++V  ++  GF R  S   K+   + LK G S++ EVRVG+T A V F   +G  WLERN + F++ VL LV++ + T THVEAVY+R+CV+FILR  +  LL +  Q  A +E+C  I   M ++ VN  +N N  S + D S          S HV+VCALQEL  LVQ LN+ A+ L+  PS  ++D +  VLLHPS +A+L+AA+CLRC+  A+P Q+ P+L++C  +L+  K+SPEA+ G
Sbjct:  159 AESQGRSEILMSLQKVLSGLGGAASSSHRDIYKNARSVLTDRSMAVRCATAKCLLELQSEAVFMWTAELENVATLCFKALEGSNYGVRVAVSKLLGTVMATAL----MPKQATGRLTKATLEEVLELMATGFLRGGSGFLKS-GGEMLKGGGSISREVRVGVTQAYVVFVTALGGKWLERNFATFLSHVLDLVSHPRATQTHVEAVYSRRCVSFILRATVGSLLGEKAQNAAAKEICQAISKQMKSV-VNDANNDN-KSGTADVSA---------SQHVMVCALQELGSLVQSLNSTASPLILEPSIGLLDTVTNVLLHPSMAARLAAAWCLRCVAVALPFQLTPLLDRCAERLNNLKNSPEAVSG 508          
BLAST of HEAT repeat-containing protein 5B vs. Ensembl Xenopus
Match: heatr5b (HEAT repeat containing 5B [Source:NCBI gene;Acc:100036680])

HSP 1 Score: 288.115 bits (736), Expect = 1.674e-86
Identity = 157/370 (42.43%), Postives = 232/370 (62.70%), Query Frame = 1
Query:    4 AESQTRCQTMLTLQHVVIGLGSAGIGCHKDILKVTRTCLLDRSMIVRSVACKCLFSLVDNSPTLYTLEIDNIMSMCFKALEDSNYDVRCEMAKVLGYLFSKSLAGTSVVQAST--KPLKQFTIDDVFSMLGQGFTRSNSSIFKTTANDSLKNGSSLNSEVRVGITHAIVEFGKCMGTAWLERNLSVFINKVLGLVANSKTTPTHVEAVYARKCVNFILRTVISFLLSDGGQMLAGRELCDIIRHTMSNMK--VNQKSNYNLDSFSEDGSKIYMNSSGDNSHHVLVCALQELSCLVQGLNTGAAILLEAPST-IVDCIMPVLLHPSSSAQLSAAFCLRCLVEAIPSQVIPVLEKCFNKLDAYKSSPEALIG 1098
            AESQ R + +++LQ V+ GLG A    H+DI K  R+ L DRSM VR    KCL  L   +  ++T E++N+ ++CFKALE SNY VR  ++K+LG + + +L      QA+   + +K+ T+++V  ++  GF R  S   K+   + LK G S++ EVRVG+T A V F   +G  WLERN + F++ VL LV++ + T THVEAVY+R+CV+FILR  +  LL +  Q  A +E+C  I   M +++  VN  +N N  S + D S          S HV+VCALQEL  LVQ LN+ A+ L+  PS  ++D +  VLLHPS +A+L+AA+CLRC+  A+P Q+ P+L++C  +L+  K+SPEA+ G
Sbjct:  148 AESQGRSEILMSLQKVLSGLGGAASSSHRDIYKNARSVLTDRSMAVRCATAKCLLELQSEAVFMWTAELENVATLCFKALEGSNYGVRVAVSKLLGTVMATALMPK---QATVMRQNVKKATLEEVLELMATGFLRGGSGFLKS-GGEMLKGGGSISREVRVGVTQAYVVFVTALGGKWLERNFATFLSHVLDLVSHPRATQTHVEAVYSRRCVSFILRATVGSLLGEKAQNAAAKEICQAISKQMKSVEAVVNDANNDN-KSGTADVSA---------SQHVMVCALQELGSLVQSLNSTASPLILEPSIGLLDTVTNVLLHPSMAARLAAAWCLRCVAVALPFQLTPLLDRCAERLNNLKNSPEAVSG 503          
BLAST of HEAT repeat-containing protein 5B vs. Ensembl Xenopus
Match: heatr5b (HEAT repeat containing 5B [Source:NCBI gene;Acc:100036680])

HSP 1 Score: 288.115 bits (736), Expect = 1.887e-86
Identity = 155/368 (42.12%), Postives = 229/368 (62.23%), Query Frame = 1
Query:    4 AESQTRCQTMLTLQHVVIGLGSAGIGCHKDILKVTRTCLLDRSMIVRSVACKCLFSLVDNSPTLYTLEIDNIMSMCFKALEDSNYDVRCEMAKVLGYLFSKSLAGTSVVQASTKPLKQFTIDDVFSMLGQGFTRSNSSIFKTTANDSLKNGSSLNSEVRVGITHAIVEFGKCMGTAWLERNLSVFINKVLGLVANSKTTPTHVEAVYARKCVNFILRTVISFLLSDGGQMLAGRELCDIIRHTMSNMK--VNQKSNYNLDSFSEDGSKIYMNSSGDNSHHVLVCALQELSCLVQGLNTGAAILLEAPST-IVDCIMPVLLHPSSSAQLSAAFCLRCLVEAIPSQVIPVLEKCFNKLDAYKSSPEALIG 1098
            AESQ R + +++LQ V+ GLG A    H+DI K  R+ L DRSM VR    KCL  L   +  ++T E++N+ ++CFKALE SNY VR  ++K+LG + + +L          + +K+ T+++V  ++  GF R  S   K+   + LK G S++ EVRVG+T A V F   +G  WLERN + F++ VL LV++ + T THVEAVY+R+CV+FILR  +  LL +  Q  A +E+C  I   M +++  VN  +N N  S + D S          S HV+VCALQEL  LVQ LN+ A+ L+  PS  ++D +  VLLHPS +A+L+AA+CLRC+  A+P Q+ P+L++C  +L+  K+SPEA+ G
Sbjct:  148 AESQGRSEILMSLQKVLSGLGGAASSSHRDIYKNARSVLTDRSMAVRCATAKCLLELQSEAVFMWTAELENVATLCFKALEGSNYGVRVAVSKLLGTVMATALMPKQAT-VMRQNVKKATLEEVLELMATGFLRGGSGFLKS-GGEMLKGGGSISREVRVGVTQAYVVFVTALGGKWLERNFATFLSHVLDLVSHPRATQTHVEAVYSRRCVSFILRATVGSLLGEKAQNAAAKEICQAISKQMKSVEAVVNDANNDN-KSGTADVSA---------SQHVMVCALQELGSLVQSLNSTASPLILEPSIGLLDTVTNVLLHPSMAARLAAAWCLRCVAVALPFQLTPLLDRCAERLNNLKNSPEAVSG 503          
BLAST of HEAT repeat-containing protein 5B vs. Ensembl Xenopus
Match: heatr5b (HEAT repeat containing 5B [Source:NCBI gene;Acc:100036680])

HSP 1 Score: 288.115 bits (736), Expect = 2.052e-86
Identity = 157/370 (42.43%), Postives = 232/370 (62.70%), Query Frame = 1
Query:    4 AESQTRCQTMLTLQHVVIGLGSAGIGCHKDILKVTRTCLLDRSMIVRSVACKCLFSLVDNSPTLYTLEIDNIMSMCFKALEDSNYDVRCEMAKVLGYLFSKSLAGTSVVQAST--KPLKQFTIDDVFSMLGQGFTRSNSSIFKTTANDSLKNGSSLNSEVRVGITHAIVEFGKCMGTAWLERNLSVFINKVLGLVANSKTTPTHVEAVYARKCVNFILRTVISFLLSDGGQMLAGRELCDIIRHTMSNMK--VNQKSNYNLDSFSEDGSKIYMNSSGDNSHHVLVCALQELSCLVQGLNTGAAILLEAPST-IVDCIMPVLLHPSSSAQLSAAFCLRCLVEAIPSQVIPVLEKCFNKLDAYKSSPEALIG 1098
            AESQ R + +++LQ V+ GLG A    H+DI K  R+ L DRSM VR    KCL  L   +  ++T E++N+ ++CFKALE SNY VR  ++K+LG + + +L      QA+   + +K+ T+++V  ++  GF R  S   K+   + LK G S++ EVRVG+T A V F   +G  WLERN + F++ VL LV++ + T THVEAVY+R+CV+FILR  +  LL +  Q  A +E+C  I   M +++  VN  +N N  S + D S          S HV+VCALQEL  LVQ LN+ A+ L+  PS  ++D +  VLLHPS +A+L+AA+CLRC+  A+P Q+ P+L++C  +L+  K+SPEA+ G
Sbjct:  145 AESQGRSEILMSLQKVLSGLGGAASSSHRDIYKNARSVLTDRSMAVRCATAKCLLELQSEAVFMWTAELENVATLCFKALEGSNYGVRVAVSKLLGTVMATALMPK---QATVMRQNVKKATLEEVLELMATGFLRGGSGFLKS-GGEMLKGGGSISREVRVGVTQAYVVFVTALGGKWLERNFATFLSHVLDLVSHPRATQTHVEAVYSRRCVSFILRATVGSLLGEKAQNAAAKEICQAISKQMKSVEAVVNDANNDN-KSGTADVSA---------SQHVMVCALQELGSLVQSLNSTASPLILEPSIGLLDTVTNVLLHPSMAARLAAAWCLRCVAVALPFQLTPLLDRCAERLNNLKNSPEAVSG 500          
BLAST of HEAT repeat-containing protein 5B vs. Ensembl Mouse
Match: Heatr5a (HEAT repeat containing 5A [Source:MGI Symbol;Acc:MGI:2444133])

HSP 1 Score: 287.345 bits (734), Expect = 2.813e-86
Identity = 151/370 (40.81%), Postives = 230/370 (62.16%), Query Frame = 1
Query:    4 AESQTRCQTMLTLQHVVIGLGSAGIGCHKDILKVTRTCLLDRSMIVRSVACKCLFSLVDNSPTLYTLEIDNIMSMCFKALEDSNYDVRCEMAKVLGYLFSKSLAGTSVVQASTKPLKQFTIDDVFSMLGQGFTRSNSSIFKTTANDSLKNGSSLNSEVRVGITHAIVEFGKCMGTAWLERNLSVFINKVLGLV--ANSKTTPTHVEAVYARKCVNFILRTVISFLLSDGGQMLAGRELCDIIRHTMSNMKVNQKSNYNLDSFSEDGSKIYMNSSGD--NSHHVLVCALQELSCLVQGLNTGAAILLEAPST-IVDCIMPVLLHPSSSAQLSAAFCLRCLVEAIPSQVIPVLEKCFNKLDAYKSSPEALIG 1098
            AESQ R + ML+LQ ++ GLG+A   CH+D+ K  R+CL DRSM VR  A KCL  L + +  +++ ++D++ ++CFK+ E SNYDVR  ++K+LG + +K++        S +  ++ ++++V  +LG GF R +S   + +  D LK  SS++ +VRVG+T A V F   +G AWLE+NL+ F++ +L LV  +N K T T ++AV  R+CV+FILR  +  LL +  Q+ A +E+C  +      M          D+   DG+     SS D   S HVLVCALQEL  L+  L T AA LL+  ST ++D ++ V+LHPS S +L+AA+CL C+  A+PS + P+L++C  +L   KSSPEA+ G
Sbjct:  148 AESQGRYEIMLSLQSILTGLGAAAAPCHRDVYKAARSCLTDRSMAVRCAAAKCLLELQNEAIFMWSTDVDSVATLCFKSFEGSNYDVRISVSKLLGTVLAKAVTAKHPGAGSKQSARRVSLEEVLELLGAGFLRGSSGFLRAS-GDMLKGNSSVSRDVRVGVTQAYVVFVSTLGGAWLEKNLAAFLSHILSLVSQSNPKATQTQIDAVCCRRCVSFILRATLGGLLGEKAQIAAAKEICQAVWRLKKVM----------DAALSDGNVETRLSSTDVAASQHVLVCALQELGNLIHNLGTTAAPLLQDSSTGLLDSVISVVLHPSISVRLAAAWCLHCIAVALPSYLTPLLDRCLERLAILKSSPEAVTG 506          
BLAST of HEAT repeat-containing protein 5B vs. Ensembl Mouse
Match: Heatr5b (HEAT repeat containing 5B [Source:MGI Symbol;Acc:MGI:2444098])

HSP 1 Score: 283.493 bits (724), Expect = 5.448e-85
Identity = 152/370 (41.08%), Postives = 230/370 (62.16%), Query Frame = 1
Query:    4 AESQTRCQTMLTLQHVVIGLGSAGIGCHKDILKVTRTCLLDRSMIVRSVACKCLFSLVDNSPTLYTLEIDNIMSMCFKALEDSNYDVRCEMAKVLGYLFSKSLAGTSVVQAST--KPLKQFTIDDVFSMLGQGFTRSNSSIFKTTANDSLKNGSSLNSEVRVGITHAIVEFGKCMGTAWLERNLSVFINKVLGLVANSKTTPTHVEAVYARKCVNFILRTVISFLLSDGGQMLAGRELCDIIRHTMSNMK--VNQKSNYNLDSFSEDGSKIYMNSSGDNSHHVLVCALQELSCLVQGLNTGAAILL-EAPSTIVDCIMPVLLHPSSSAQLSAAFCLRCLVEAIPSQVIPVLEKCFNKLDAYKSSPEALIG 1098
            AESQ R + +++LQ V+ GLG A    H+DI K  R+ L DRSM VR    KCL  L + +  ++T E++N+ ++CFKALE+SNY VR  ++K+LG + + +L      QA+   + +K+ T D+V  ++  GF R  S   K+   + LK G S+N EVRVG+T A V F   +G  WLER+ + F++ VL LV++ + T THV+AVY+R+CV+F+LR  +  LL +  Q+ A +E+C  I   M  ++  VN  S+ N    ++  +          S HV+VCALQEL  LVQ LN  A+ L+ EA   +++ +  VLLHPS +A+L+AA+CLRC+  A+P Q+ P L++C  +L+  K+SPEA+ G
Sbjct:  148 AESQGRSEILMSLQKVLTGLGGAAASSHRDIYKNARSLLTDRSMAVRCAVAKCLLELQNEAVFMWTAELENVATLCFKALENSNYGVRVAVSKLLGTVMATALMPK---QATVMRQNVKRATFDEVLELMATGFLRGGSGFLKS-GGEMLKVGGSVNREVRVGVTQAYVVFVTTLGGQWLERSFATFLSHVLDLVSHPRATQTHVDAVYSRRCVSFMLRATVGSLLGEKAQIAAAKEICQAIGKQMKAVEAVVNDTSSENKSGTADIAA----------SQHVMVCALQELGSLVQSLNATASPLIQEASIGLLEIVTSVLLHPSMAARLAAAWCLRCVAVALPFQLTPFLDRCAERLNNLKTSPEAVSG 503          
BLAST of HEAT repeat-containing protein 5B vs. UniProt/SwissProt
Match: sp|A1A5F2|HTR5B_XENTR (HEAT repeat-containing protein 5B OS=Xenopus tropicalis OX=8364 GN=heatr5b PE=2 SV=1)

HSP 1 Score: 288.115 bits (736), Expect = 8.870e-86
Identity = 157/370 (42.43%), Postives = 232/370 (62.70%), Query Frame = 1
Query:    4 AESQTRCQTMLTLQHVVIGLGSAGIGCHKDILKVTRTCLLDRSMIVRSVACKCLFSLVDNSPTLYTLEIDNIMSMCFKALEDSNYDVRCEMAKVLGYLFSKSLAGTSVVQAST--KPLKQFTIDDVFSMLGQGFTRSNSSIFKTTANDSLKNGSSLNSEVRVGITHAIVEFGKCMGTAWLERNLSVFINKVLGLVANSKTTPTHVEAVYARKCVNFILRTVISFLLSDGGQMLAGRELCDIIRHTMSNMK--VNQKSNYNLDSFSEDGSKIYMNSSGDNSHHVLVCALQELSCLVQGLNTGAAILLEAPST-IVDCIMPVLLHPSSSAQLSAAFCLRCLVEAIPSQVIPVLEKCFNKLDAYKSSPEALIG 1098
            AESQ R + +++LQ V+ GLG A    H+DI K  R+ L DRSM VR    KCL  L   +  ++T E++N+ ++CFKALE SNY VR  ++K+LG + + +L      QA+   + +K+ T+++V  ++  GF R  S   K+   + LK G S++ EVRVG+T A V F   +G  WLERN + F++ VL LV++ + T THVEAVY+R+CV+FILR  +  LL +  Q  A +E+C  I   M +++  VN  +N N  S + D S          S HV+VCALQEL  LVQ LN+ A+ L+  PS  ++D +  VLLHPS +A+L+AA+CLRC+  A+P Q+ P+L++C  +L+  K+SPEA+ G
Sbjct:  148 AESQGRSEILMSLQKVLSGLGGAASSSHRDIYKNARSVLTDRSMAVRCATAKCLLELQSEAVFMWTAELENVATLCFKALEGSNYGVRVAVSKLLGTVMATALMPK---QATVMRQNVKKATLEEVLELMATGFLRGGSGFLKS-GGEMLKGGGSISREVRVGVTQAYVVFVTALGGKWLERNFATFLSHVLDLVSHPRATQTHVEAVYSRRCVSFILRATVGSLLGEKAQNAAAKEICQAISKQMKSVEAVVNDANNDN-KSGTADVSA---------SQHVMVCALQELGSLVQSLNSTASPLILEPSIGLLDTVTNVLLHPSMAARLAAAWCLRCVAVALPFQLTPLLDRCAERLNNLKNSPEAVSG 503          
BLAST of HEAT repeat-containing protein 5B vs. UniProt/SwissProt
Match: sp|Q5PRF0|HTR5A_MOUSE (HEAT repeat-containing protein 5A OS=Mus musculus OX=10090 GN=Heatr5a PE=1 SV=2)

HSP 1 Score: 287.345 bits (734), Expect = 1.968e-85
Identity = 151/370 (40.81%), Postives = 230/370 (62.16%), Query Frame = 1
Query:    4 AESQTRCQTMLTLQHVVIGLGSAGIGCHKDILKVTRTCLLDRSMIVRSVACKCLFSLVDNSPTLYTLEIDNIMSMCFKALEDSNYDVRCEMAKVLGYLFSKSLAGTSVVQASTKPLKQFTIDDVFSMLGQGFTRSNSSIFKTTANDSLKNGSSLNSEVRVGITHAIVEFGKCMGTAWLERNLSVFINKVLGLV--ANSKTTPTHVEAVYARKCVNFILRTVISFLLSDGGQMLAGRELCDIIRHTMSNMKVNQKSNYNLDSFSEDGSKIYMNSSGD--NSHHVLVCALQELSCLVQGLNTGAAILLEAPST-IVDCIMPVLLHPSSSAQLSAAFCLRCLVEAIPSQVIPVLEKCFNKLDAYKSSPEALIG 1098
            AESQ R + ML+LQ ++ GLG+A   CH+D+ K  R+CL DRSM VR  A KCL  L + +  +++ ++D++ ++CFK+ E SNYDVR  ++K+LG + +K++        S +  ++ ++++V  +LG GF R +S   + +  D LK  SS++ +VRVG+T A V F   +G AWLE+NL+ F++ +L LV  +N K T T ++AV  R+CV+FILR  +  LL +  Q+ A +E+C  +      M          D+   DG+     SS D   S HVLVCALQEL  L+  L T AA LL+  ST ++D ++ V+LHPS S +L+AA+CL C+  A+PS + P+L++C  +L   KSSPEA+ G
Sbjct:  148 AESQGRYEIMLSLQSILTGLGAAAAPCHRDVYKAARSCLTDRSMAVRCAAAKCLLELQNEAIFMWSTDVDSVATLCFKSFEGSNYDVRISVSKLLGTVLAKAVTAKHPGAGSKQSARRVSLEEVLELLGAGFLRGSSGFLRAS-GDMLKGNSSVSRDVRVGVTQAYVVFVSTLGGAWLEKNLAAFLSHILSLVSQSNPKATQTQIDAVCCRRCVSFILRATLGGLLGEKAQIAAAKEICQAVWRLKKVM----------DAALSDGNVETRLSSTDVAASQHVLVCALQELGNLIHNLGTTAAPLLQDSSTGLLDSVISVVLHPSISVRLAAAWCLHCIAVALPSYLTPLLDRCLERLAILKSSPEAVTG 506          
BLAST of HEAT repeat-containing protein 5B vs. UniProt/SwissProt
Match: sp|Q9P2D3|HTR5B_HUMAN (HEAT repeat-containing protein 5B OS=Homo sapiens OX=9606 GN=HEATR5B PE=1 SV=2)

HSP 1 Score: 286.189 bits (731), Expect = 4.643e-85
Identity = 155/370 (41.89%), Postives = 229/370 (61.89%), Query Frame = 1
Query:    4 AESQTRCQTMLTLQHVVIGLGSAGIGCHKDILKVTRTCLLDRSMIVRSVACKCLFSLVDNSPTLYTLEIDNIMSMCFKALEDSNYDVRCEMAKVLGYLFSKSLAGTSVVQAST--KPLKQFTIDDVFSMLGQGFTRSNSSIFKTTANDSLKNGSSLNSEVRVGITHAIVEFGKCMGTAWLERNLSVFINKVLGLVANSKTTPTHVEAVYARKCVNFILRTVISFLLSDGGQMLAGRELCDIIRHTMSNMK--VNQKSNYNLDSFSEDGSKIYMNSSGDNSHHVLVCALQELSCLVQGLNTGAAILL-EAPSTIVDCIMPVLLHPSSSAQLSAAFCLRCLVEAIPSQVIPVLEKCFNKLDAYKSSPEALIG 1098
            AESQ R + +++LQ V+ GLG A    H+DI K  R+ L DRSM VR    KCL  L + +  ++T E++NI ++CFKALE+SNY VR  ++K+LG + + +L      QA+   + +K+ T D+V  ++  GF R  S   K+   + LK G S+N EVRVG+T A V F   +G  WLER+ + F++ VL LV++ + T THVEAVY+R+CV+FILR  +  LL +  Q+ A +E+C  I   M  ++  VN  S  N    ++  +          S HV+VCALQEL  LVQ LN  A+ L+ EA   +++ +  VLLHPS +A+L+AA+CLRC+  A+P Q+ P L++C  +L+  K+SPEA+ G
Sbjct:  148 AESQGRSEILMSLQKVLSGLGGAAASSHRDIYKNARSLLTDRSMAVRCAVAKCLLELQNEAVFMWTAELENIATLCFKALENSNYGVRVAVSKLLGTVMATALMPK---QATVMRQNVKRATFDEVLELMATGFLRGGSGFLKS-GGEMLKVGGSVNREVRVGVTQAYVVFVTTLGGQWLERSFATFLSHVLDLVSHPRATQTHVEAVYSRRCVSFILRATVGSLLGEKAQIAAAKEICQAIGKQMKAVEAVVNDTSGENKSGAADIAA----------SQHVMVCALQELGSLVQSLNATASPLIQEASIGLLEIVTSVLLHPSMAARLAAAWCLRCVAVALPFQLTPFLDRCAERLNNLKTSPEAVSG 503          
BLAST of HEAT repeat-containing protein 5B vs. UniProt/SwissProt
Match: sp|Q8C547|HTR5B_MOUSE (HEAT repeat-containing protein 5B OS=Mus musculus OX=10090 GN=Heatr5b PE=1 SV=3)

HSP 1 Score: 283.493 bits (724), Expect = 3.811e-84
Identity = 152/370 (41.08%), Postives = 230/370 (62.16%), Query Frame = 1
Query:    4 AESQTRCQTMLTLQHVVIGLGSAGIGCHKDILKVTRTCLLDRSMIVRSVACKCLFSLVDNSPTLYTLEIDNIMSMCFKALEDSNYDVRCEMAKVLGYLFSKSLAGTSVVQAST--KPLKQFTIDDVFSMLGQGFTRSNSSIFKTTANDSLKNGSSLNSEVRVGITHAIVEFGKCMGTAWLERNLSVFINKVLGLVANSKTTPTHVEAVYARKCVNFILRTVISFLLSDGGQMLAGRELCDIIRHTMSNMK--VNQKSNYNLDSFSEDGSKIYMNSSGDNSHHVLVCALQELSCLVQGLNTGAAILL-EAPSTIVDCIMPVLLHPSSSAQLSAAFCLRCLVEAIPSQVIPVLEKCFNKLDAYKSSPEALIG 1098
            AESQ R + +++LQ V+ GLG A    H+DI K  R+ L DRSM VR    KCL  L + +  ++T E++N+ ++CFKALE+SNY VR  ++K+LG + + +L      QA+   + +K+ T D+V  ++  GF R  S   K+   + LK G S+N EVRVG+T A V F   +G  WLER+ + F++ VL LV++ + T THV+AVY+R+CV+F+LR  +  LL +  Q+ A +E+C  I   M  ++  VN  S+ N    ++  +          S HV+VCALQEL  LVQ LN  A+ L+ EA   +++ +  VLLHPS +A+L+AA+CLRC+  A+P Q+ P L++C  +L+  K+SPEA+ G
Sbjct:  148 AESQGRSEILMSLQKVLTGLGGAAASSHRDIYKNARSLLTDRSMAVRCAVAKCLLELQNEAVFMWTAELENVATLCFKALENSNYGVRVAVSKLLGTVMATALMPK---QATVMRQNVKRATFDEVLELMATGFLRGGSGFLKS-GGEMLKVGGSVNREVRVGVTQAYVVFVTTLGGQWLERSFATFLSHVLDLVSHPRATQTHVDAVYSRRCVSFMLRATVGSLLGEKAQIAAAKEICQAIGKQMKAVEAVVNDTSSENKSGTADIAA----------SQHVMVCALQELGSLVQSLNATASPLIQEASIGLLEIVTSVLLHPSMAARLAAAWCLRCVAVALPFQLTPFLDRCAERLNNLKTSPEAVSG 503          
BLAST of HEAT repeat-containing protein 5B vs. UniProt/SwissProt
Match: sp|Q86XA9|HTR5A_HUMAN (HEAT repeat-containing protein 5A OS=Homo sapiens OX=9606 GN=HEATR5A PE=1 SV=2)

HSP 1 Score: 270.781 bits (691), Expect = 1.027e-79
Identity = 150/374 (40.11%), Postives = 232/374 (62.03%), Query Frame = 1
Query:    4 AESQTRCQTMLTLQHVVIGLGSAGIGCHKDILKVTRTCLLDRSMIVRSVACKCLFSLVDNSPTLYTLEIDNIMSMCFKALEDSNYDVRCEMAKVLGYLFSKSL----AGTSVVQASTKPLKQFTIDDVFSMLGQGFTRSNSSIFKTTANDSLKNGSSLNSEVRVGITHAIVEFGKCMGTAWLERNLSVFINKVLGLVANS--KTTPTHVEAVYARKCVNFILRTVISFLLSDGGQMLAGRELCDIIRHTMSNMKVNQKSNYNLDSFSEDGSKIYMNSSGD--NSHHVLVCALQELSCLVQGLNTGAAILLEAPST-IVDCIMPVLLHPSSSAQLSAAFCLRCLVEAIPSQVIPVLEKCFNKLDAYKSSPEALIG 1098
            AESQ R + ML+LQ+++ GLG+A   CH+D+ K  R+CL DRSM VR  A K      + +  +++ ++D++ ++CFK+ E SNYDVR  ++K+LG + +K++     GT+   AS + +++ ++++V  +LG GF R +S   + +  D LK  SS++ +VRVG+T A V F   +G AWLE+N + F + +L L + S  K T T ++AV  R+CV+FILRT I  LL +  Q+ A +++C  I           K    +D+   DG+      S D   S H+LVCALQEL  L+  L T AA LL+  ST ++D I+ V+LHPS S +L+AA+CL C+  A+PS + P+L++C  +L  +KSSPEA+ G
Sbjct:  148 AESQGRYEIMLSLQNILNGLGAAAAPCHRDVYKAARSCLTDRSMAVRCAAAK------NEAIFMWSTDLDSVATLCFKSFEGSNYDVRISVSKLLGIILAKAVISKHPGTA---ASRQSIRRVSLEEVLELLGTGFLRGSSGFLRAS-GDMLKGTSSVSRDVRVGVTQAYVVFVSTLGGAWLEKNFAAFFSHILSLASPSHPKATQTQIDAVCCRRCVSFILRTTIGGLLGEKAQLAAVKDICQAI----------WKLKKVMDAVMSDGNLETRLGSTDVAASQHMLVCALQELGNLIHNLGTTAAPLLQDSSTGLLDSILSVILHPSISVRLAAAWCLHCIAVALPSYLTPLLDRCLERLTGHKSSPEAVTG 501          
BLAST of HEAT repeat-containing protein 5B vs. TrEMBL
Match: T1ELN1 (Uncharacterized protein OS=Helobdella robusta OX=6412 GN=20197481 PE=4 SV=1)

HSP 1 Score: 330.487 bits (846), Expect = 6.421e-98
Identity = 165/370 (44.59%), Postives = 245/370 (66.22%), Query Frame = 1
Query:    4 AESQTRCQTMLTLQHVVIGLGSAGIGCHKDILKVTRTCLLDRSMIVRSVACKCLFSLVDNSPTLYTLEIDNIMSMCFKALEDSNYDVRCEMAKVLGYLFSKS-LAGTSVVQASTKPLKQFTIDDVFSMLGQGFTRSNSSIFKTTANDSLKNGSSLNSEVRVGITHAIVEFGKCMGTAWLERNLSVFINKVLGLVANSKTTPTHVEAVYARKCVNFILRTVISFLLSDGGQMLAGRELCDIIRHTMSNMKVNQKSNYNLDSFSEDGSKIYMNSS---GDNSHHVLVCALQELSCLVQGLNTGAAILLEAPST-IVDCIMPVLLHPSSSAQLSAAFCLRCLVEAIPSQVIPVLEKCFNKLDAYKSSPEALIG 1098
            AES  RC+ M+TL+ VVIGLGSAG  C+KDI K  + CL +RS+ VRS A  CL  +++  P +YT E+DNI S+CF+A++ +NY+VRC++A++LG + + S L+  S +  +    KQ  +DD+ +M+G GF R  SS  K       K GS++N ++RVG+THA VEF + MG  WLERNLS F+N +  LV+N + T  H++AVYARKC+NFILR+V+  LL++  Q+ A RELC ++   + N+  +   +       +   +   +SS     N+HH+L+CALQEL  LVQGL T AA L+  PS  I++ ++ VL+HPS  A+L+AA+CLR +  A+PSQ+  ++++C N++   KSS EA+ G
Sbjct:  148 AESHGRCEIMITLRKVVIGLGSAGSNCYKDIYKAAKNCLTERSLPVRSAAAACLIQMIEECPFIYTSEMDNITSLCFRAMDSANYEVRCDVAQLLGSIMAASLLSQNSKIAGTNSKGKQVKLDDILAMMGSGFMRGGSSFLKGGEQ---KGGSNINRDIRVGVTHAYVEFCRRMGPQWLERNLSTFLNHLFSLVSNPRNTSYHIDAVYARKCINFILRSVLGSLLAEKAQVGAARELCLVVVKQI-NLTADMGDDPQQQQQQQQPQQQQTSSSSTDAPNAHHILICALQELGSLVQGLGTSAATLVVEPSNGIIEPVVSVLVHPSPPARLAAAWCLRSIAIALPSQMTILIDRCMNRMQHLKSSMEAISG 513          
BLAST of HEAT repeat-containing protein 5B vs. TrEMBL
Match: V4A0F3 (Uncharacterized protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_164458 PE=4 SV=1)

HSP 1 Score: 328.176 bits (840), Expect = 3.196e-97
Identity = 170/370 (45.95%), Postives = 240/370 (64.86%), Query Frame = 1
Query:    4 AESQTRCQTMLTLQHVVIGLGSAGIGCHKDILKVTRTCLLDRSMIVRSVACKCLFSLVDNSPTLYTLEIDNIMSMCFKALEDSNYDVRCEMAKVLGYLFSKSLAGTSVVQASTKPLKQFTIDDVFSMLGQGFTRSNSSIFKTTANDSL-KNGSSLNSEVRVGITHAIVEFGKCMGTAWLERNLSVFINKVLGLVANSKTTPTHVEAVYARKCVNFILRTVISFLLSDGGQMLAGRELCDIIRHTMSNMKVNQKSNYNLDSFSEDGSKIYMNSSGDN---SHHVLVCALQELSCLVQGLNTGAAILLEAPST-IVDCIMPVLLHPSSSAQLSAAFCLRCLVEAIPSQVIPVLEKCFNKLDAYKSSPEALIG 1098
            +ESQ R + MLTL+ VV GLGSAG  CHKDI K  R  + DR+M VR  A KC++ LV+ +P + T E+DN+ S+CF+AL+ SNYDVRC +AK+LG L + +     +    TKP+K   IDDV ++L  GF +      K++A   L K  SS+N E+RVG+THA VEF KCMG  WLERN++VF+N +  LVAN + TPTHV+AVYARKCV FILR++I  +L +  Q+ A +E+C  I   M             ++  E    +    SG +   S HVLVCAL EL CLV  L + A+ L+  P+T I++ ++ VL+HPS +A+L+A++CL  +  A+PSQ+ P+L++C  +++  KSSPEA+ G
Sbjct:  148 SESQGRTEVMLTLEKVVGGLGSAGNSCHKDIYKAARQAMTDRAMAVRFAAAKCMYQLVNEAPFMSTSELDNVSSLCFRALDGSNYDVRCAVAKLLGNLMAVAQTAKPISN-KTKPVK---IDDVLNILASGFLKGGIGFMKSSAAGELIKGSSSINREIRVGVTHAYVEFIKCMGGLWLERNMTVFLNHIFDLVANPRATPTHVDAVYARKCVLFILRSIIGGMLGEKAQIAAAKEICQTIVKQM-------------NTVGEATVDVAEGKSGGDLTASQHVLVCALHELGCLVLRLCSSASPLVAEPATGIIEPVVSVLIHPSHAARLAASWCLGSIAVALPSQLSPLLDRCMERMEKLKSSPEAVSG 500          
BLAST of HEAT repeat-containing protein 5B vs. TrEMBL
Match: A0A1S3H215 (HEAT repeat-containing protein 5B-like isoform X2 OS=Lingula unguis OX=7574 GN=LOC106151010 PE=4 SV=1)

HSP 1 Score: 323.939 bits (829), Expect = 1.192e-95
Identity = 168/367 (45.78%), Postives = 235/367 (64.03%), Query Frame = 1
Query:    4 AESQTRCQTMLTLQHVVIGLGSAGIGCHKDILKVTRTCLLDRSMIVRSVACKCLFSLVDNSPTLYTLEIDNIMSMCFKALEDSNYDVRCEMAKVLGYLFSKSLAGTSVVQASTKPLKQFTIDDVFSMLGQGFTRSNSSIFKTT-ANDSLKNGSSLNSEVRVGITHAIVEFGKCMGTAWLERNLSVFINKVLGLVANSKTTPTHVEAVYARKCVNFILRTVISFLLSDGGQMLAGRELCDIIRHTMSNMKVNQKSNYNLDSFSEDGSKIYMNSSGDNSHHVLVCALQELSCLVQGLNTGAAILLEAP-STIVDCIMPVLLHPSSSAQLSAAFCLRCLVEAIPSQVIPVLEKCFNKLDAYKSSPEALIG 1098
            AES  RC+ M+TLQ VV GLGSA  G HKDI K T++C+ DRSM VR  A KCL  LV  +P +YT E + ++S+CF+AL+ SNYDVRC +A++LG L   +L  T+  Q +    KQ  ++DV ++L  GF +  S   K++ A + +K G ++N E+RVG+THA V+F +CMG  WLE+N+ VF++ +  LVAN K T THV+AVYARKCV FILRTVI  LL +  Q+ A +E+  +I   M+ +  +  +         DG+          S H+LVCAL EL  LVQ L T A+ L+  P S I+  ++ VLLH S +A+L+AA+CLRC+  A+PS + P+L++C   L   K+SPEA  G
Sbjct:  148 AESTGRCEIMVTLQKVVQGLGSAACGVHKDIYKATKSCMTDRSMTVRCAAAKCLEELVHEAPFMYTTETEAVVSLCFRALDGSNYDVRCSVAELLGRLLEAAL--TAKPQGTKG--KQMKLEDVLNLLSAGFLKGGSGFLKSSAAGEMIKGGGTVNREIRVGVTHAYVQFVRCMGGTWLEKNIVVFLDHIFNLVANPKATVTHVDAVYARKCVQFILRTVIGSLLGEKAQIAAAKEIAQVITKQMNLLSPDAMT---------DGTGGNQTIDFTGSQHILVCALHELGSLVQTLGTSASPLVSEPNSGIIPPVISVLLHISPAARLAAAWCLRCIAVALPSYLTPLLDQCMGNLSKMKASPEATSG 501          
BLAST of HEAT repeat-containing protein 5B vs. TrEMBL
Match: A0A1S3H069 (HEAT repeat-containing protein 5B-like isoform X1 OS=Lingula unguis OX=7574 GN=LOC106151010 PE=4 SV=1)

HSP 1 Score: 323.553 bits (828), Expect = 1.325e-95
Identity = 168/367 (45.78%), Postives = 235/367 (64.03%), Query Frame = 1
Query:    4 AESQTRCQTMLTLQHVVIGLGSAGIGCHKDILKVTRTCLLDRSMIVRSVACKCLFSLVDNSPTLYTLEIDNIMSMCFKALEDSNYDVRCEMAKVLGYLFSKSLAGTSVVQASTKPLKQFTIDDVFSMLGQGFTRSNSSIFKTT-ANDSLKNGSSLNSEVRVGITHAIVEFGKCMGTAWLERNLSVFINKVLGLVANSKTTPTHVEAVYARKCVNFILRTVISFLLSDGGQMLAGRELCDIIRHTMSNMKVNQKSNYNLDSFSEDGSKIYMNSSGDNSHHVLVCALQELSCLVQGLNTGAAILLEAP-STIVDCIMPVLLHPSSSAQLSAAFCLRCLVEAIPSQVIPVLEKCFNKLDAYKSSPEALIG 1098
            AES  RC+ M+TLQ VV GLGSA  G HKDI K T++C+ DRSM VR  A KCL  LV  +P +YT E + ++S+CF+AL+ SNYDVRC +A++LG L   +L  T+  Q +    KQ  ++DV ++L  GF +  S   K++ A + +K G ++N E+RVG+THA V+F +CMG  WLE+N+ VF++ +  LVAN K T THV+AVYARKCV FILRTVI  LL +  Q+ A +E+  +I   M+ +  +  +         DG+          S H+LVCAL EL  LVQ L T A+ L+  P S I+  ++ VLLH S +A+L+AA+CLRC+  A+PS + P+L++C   L   K+SPEA  G
Sbjct:  149 AESTGRCEIMVTLQKVVQGLGSAACGVHKDIYKATKSCMTDRSMTVRCAAAKCLEELVHEAPFMYTTETEAVVSLCFRALDGSNYDVRCSVAELLGRLLEAAL--TAKPQGTKG--KQMKLEDVLNLLSAGFLKGGSGFLKSSAAGEMIKGGGTVNREIRVGVTHAYVQFVRCMGGTWLEKNIVVFLDHIFNLVANPKATVTHVDAVYARKCVQFILRTVIGSLLGEKAQIAAAKEIAQVITKQMNLLSPDAMT---------DGTGGNQTIDFTGSQHILVCALHELGSLVQTLGTSASPLVSEPNSGIIPPVISVLLHISPAARLAAAWCLRCIAVALPSYLTPLLDQCMGNLSKMKASPEATSG 502          
BLAST of HEAT repeat-containing protein 5B vs. TrEMBL
Match: A0A1S3H0J5 (HEAT repeat-containing protein 5B-like isoform X4 OS=Lingula unguis OX=7574 GN=LOC106151010 PE=4 SV=1)

HSP 1 Score: 323.553 bits (828), Expect = 1.362e-95
Identity = 168/367 (45.78%), Postives = 235/367 (64.03%), Query Frame = 1
Query:    4 AESQTRCQTMLTLQHVVIGLGSAGIGCHKDILKVTRTCLLDRSMIVRSVACKCLFSLVDNSPTLYTLEIDNIMSMCFKALEDSNYDVRCEMAKVLGYLFSKSLAGTSVVQASTKPLKQFTIDDVFSMLGQGFTRSNSSIFKTT-ANDSLKNGSSLNSEVRVGITHAIVEFGKCMGTAWLERNLSVFINKVLGLVANSKTTPTHVEAVYARKCVNFILRTVISFLLSDGGQMLAGRELCDIIRHTMSNMKVNQKSNYNLDSFSEDGSKIYMNSSGDNSHHVLVCALQELSCLVQGLNTGAAILLEAP-STIVDCIMPVLLHPSSSAQLSAAFCLRCLVEAIPSQVIPVLEKCFNKLDAYKSSPEALIG 1098
            AES  RC+ M+TLQ VV GLGSA  G HKDI K T++C+ DRSM VR  A KCL  LV  +P +YT E + ++S+CF+AL+ SNYDVRC +A++LG L   +L  T+  Q +    KQ  ++DV ++L  GF +  S   K++ A + +K G ++N E+RVG+THA V+F +CMG  WLE+N+ VF++ +  LVAN K T THV+AVYARKCV FILRTVI  LL +  Q+ A +E+  +I   M+ +  +  +         DG+          S H+LVCAL EL  LVQ L T A+ L+  P S I+  ++ VLLH S +A+L+AA+CLRC+  A+PS + P+L++C   L   K+SPEA  G
Sbjct:  148 AESTGRCEIMVTLQKVVQGLGSAACGVHKDIYKATKSCMTDRSMTVRCAAAKCLEELVHEAPFMYTTETEAVVSLCFRALDGSNYDVRCSVAELLGRLLEAAL--TAKPQGTKG--KQMKLEDVLNLLSAGFLKGGSGFLKSSAAGEMIKGGGTVNREIRVGVTHAYVQFVRCMGGTWLEKNIVVFLDHIFNLVANPKATVTHVDAVYARKCVQFILRTVIGSLLGEKAQIAAAKEIAQVITKQMNLLSPDAMT---------DGTGGNQTIDFTGSQHILVCALHELGSLVQTLGTSASPLVSEPNSGIIPPVISVLLHISPAARLAAAWCLRCIAVALPSYLTPLLDQCMGNLSKMKASPEATSG 501          
BLAST of HEAT repeat-containing protein 5B vs. Ensembl Cavefish
Match: heatr5b (HEAT repeat containing 5B [Source:ZFIN;Acc:ZDB-GENE-130530-676])

HSP 1 Score: 291.197 bits (744), Expect = 9.731e-88
Identity = 151/375 (40.27%), Postives = 231/375 (61.60%), Query Frame = 1
Query:    4 AESQTRCQTMLTLQHVVIGLGSAGIGCHKDILKVTRTCLLDRSMIVRSVACKCLFSLVDNSPTLYTLEIDNIMSMCFKALEDSNYDVRCEMAKVLGYLFSKSLAGTSVVQASTKPLKQFTIDDVFSMLGQGFTRSNSSIFKTTANDSLKNGSSLNSEVRVGITHAIVEFGKCMGTAWLERNLSVFINKVLGLVANSKTTPTHVEAVYARKCVNFILRTVISFLLSDGGQMLAGRELCDIIRHTMSNMKVNQKSNYNLDSFSEDGSKIYMNSSGDN---------SHHVLVCALQELSCLVQGLNTGAAILLEAPST-IVDCIMPVLLHPSSSAQLSAAFCLRCLVEAIPSQVIPVLEKCFNKLDAYKSSPEALIG 1098
            AESQ R + +L+LQ V+ GLG A   CH+DI K  R+ L DRSM VR    KCL  L + +  ++T E++N+ ++CFKALE S Y VR  ++K+LG + + +L          + +K+ T+++V  ++  GF R  S   K+   + LK G S++ EVRVG+T A V F   +G  WLERN + F++ VL LVA+ + T THVEAVY+R+CV+F LR  +  LL +  Q+ A +E+C  I   M  +   +++   +  F      +  +SSG+N         S HV+VCAL+EL  LVQ L+  A+ L++ PS  +++ +  VLLHPS +A+L+AA+CLRC+  A+P Q+ P+L++C  +++  KSSPEA+ G
Sbjct:  148 AESQGRSEILLSLQKVLSGLGGAAASCHRDIYKNARSLLTDRSMAVRCAVAKCLLELQNEAVFMWTTELENVATLCFKALEGSTYGVRVAVSKLLGTVMATALLPKQAA-VMRQNVKRATLEEVLELMATGFLRGGSGFLKS-GGEMLKGGGSVSREVRVGVTQAYVVFVTTLGGQWLERNFATFLSHVLELVAHPRATQTHVEAVYSRRCVSFALRATLGGLLGEKAQIAAAKEICQAINKQMRAVG-KEENRGEISGFRALQKAVVSDSSGENKGGAADVSASQHVMVCALKELGSLVQSLSATASPLIQEPSIGLLETVTSVLLHPSMAARLAAAWCLRCVAVALPYQLTPLLDRCAERINTLKSSPEAVSG 519          
BLAST of HEAT repeat-containing protein 5B vs. Ensembl Cavefish
Match: heatr5a (HEAT repeat containing 5a [Source:NCBI gene;Acc:368728])

HSP 1 Score: 248.054 bits (632), Expect = 7.752e-73
Identity = 146/368 (39.67%), Postives = 222/368 (60.33%), Query Frame = 1
Query:    4 AESQTRCQTMLTLQHVVIGLGSAGIGCHKDILKVTRTCLLDRSMIVRSVACKCLFSLVDNSPTLYTLEIDNIMSMCFKALEDSNYDVRCEMAKVLGYLFSKSLAGTSVVQASTKPLKQFTIDDVFSMLGQGFTRSNSSIFKTTANDSLKNGSSLNSEVRVGITHAIVEFGKCMGTAWLERNLSVFINKVLGLVANSKTTPTHVEAVYARKCVNFILRTVISFLLSDGGQMLAGRELCDIIRHTMSNMKVNQKSNYNLDSFSEDGSKIYMNSSGD--NSHHVLVCALQELSCLVQGLNTGAAILLEAPST-IVDCIMPVLLHPSSSAQLSAAFCLRCLVEAIPSQVIPVLEKCFNKLDAYKSSPEALIG 1098
            AESQ R + ML ++ ++ GLG + + CH+DI K TR CL DRSM VR  A KCL  L   +  +++ E++N+ ++CF+A E SNYDVR  ++K+LG L + +L     + A     K+  +++V  ++  GF R      + +  D LK  SS++ +VRVGIT A V F   +G AWLE N S  ++ ++ LV++++ T +  +A+  R+CV+FILR  +  LL +  Q+ A +E+C  I           K    +D    +G++    SS D   S HVLVCAL EL  ++Q L + AA LL   S  ++D ++ VLLHPS SA+L+AA+CLRC+  AIP+QV  +L++C  +L+A KS PEA+ G
Sbjct:  148 AESQGRHEIMLCIEKILKGLGVSAVPCHRDIYKATRACLTDRSMAVRCAAAKCLLELQREAVFMWSTELENVAALCFRAFEGSNYDVRVCVSKLLGALLASALEPKQAI-APRPGSKRSCLEEVMELVSGGFLRGCPGFLRAS-GDILKGTSSVSRDVRVGITQACVVFISTLGRAWLEANFSPLLSLLMELVSHTRATQSPADAICCRRCVSFILRASVGSLLGEKAQIAAAKEICLAI----------SKQKKAVDMALYEGNQETRVSSTDVGTSQHVLVCALLELGSVLQDLRSSAAPLLHDSSIGMLDTVLSVLLHPSVSARLAAAWCLRCVAVAIPAQVAVLLDRCSERLNALKSCPEAVAG 503          
BLAST of HEAT repeat-containing protein 5B vs. Ensembl Sea Lamprey
Match: heatr5b (HEAT repeat containing 5B [Source:ZFIN;Acc:ZDB-GENE-130530-676])

HSP 1 Score: 290.041 bits (741), Expect = 5.259e-88
Identity = 157/372 (42.20%), Postives = 228/372 (61.29%), Query Frame = 1
Query:    4 AESQTRCQTMLTLQHVVIGLGSAGIGCHKDILKVTRTCLLDRSMIVRSVACKCLFSLVDNSPTLYTLEIDNIMSMCFKALEDSNYDVRCEMAKVLGYLFSKSLAGTSVVQASTKPLKQ----FTIDDVFSMLGQGFTRSNSSIFKTTANDSLKNGSSLNSEVRVGITHAIVEFGKCMGTAWLERNLSVFINKVLGLVANSKTTPTHVEAVYARKCVNFILRTVISFLLSDGGQMLAGRELCDIIRHTMSNMKVNQKSNYNLDSFSEDGSKIYMNSSGD--NSHHVLVCALQELSCLVQGLNTGAAILLEAPST-IVDCIMPVLLHPSSSAQLSAAFCLRCLVEAIPSQVIPVLEKCFNKLDAYKSSPEALIG 1098
            AESQ R + M++LQ ++ GLG A   CH+DI K  R CL DRSM VR  A KCL  L + +  L++ E++N+ ++CFKALE SNYDVR  ++ +LG + +     T+V+      ++Q     T+++VF +L  GF R  S   + +  + LK G S+  EVRVG+T A V F   MG  WLER+   F+  +LGLVAN + T  HVEAVY+R+CV+FILR+ +  LL +  Q+ A +++C  I   M            LD+ + D +      S D   S H+LVCALQEL  L+ GL+  A  L++   T +VD ++ VLLHPS SA+LSAA+CLR +  A+PSQ+ P+LE+C   +++ K+SP+A+ G
Sbjct:  148 AESQGRSEIMISLQKILSGLGGAAASCHRDIYKSARVCLTDRSMAVRCAAAKCLLELQNEAVFLWSSELENMATICFKALEGSNYDVRVAVSTLLGTVLA-----TAVLPKHAAVMRQNVRKATLEEVFELLATGFLRGGSGFLR-SGGEMLKGGGSIPREVRVGVTQAYVVFVSTMGGPWLERSFPTFLMHILGLVANPRATQNHVEAVYSRRCVSFILRSTVGSLLGEKAQVAAAKDICQAITKQMK----------ALDAAASDSNTDNKAGSVDMCASQHMLVCALQELGSLILGLSATATPLVQETHTGVVDTVISVLLHPSISARLSAAWCLRSVSIALPSQLTPLLERCTEFMNSLKNSPDAVTG 503          
BLAST of HEAT repeat-containing protein 5B vs. Ensembl Medaka
Match: heatr5b (HEAT repeat containing 5B [Source:NCBI gene;Acc:101168395])

HSP 1 Score: 264.233 bits (674), Expect = 2.522e-78
Identity = 151/368 (41.03%), Postives = 230/368 (62.50%), Query Frame = 1
Query:    4 AESQTRCQTMLTLQHVVIGLGSAGIGCHKDILKVTRTCLLDRSMIVRSVACKCLFSLVDNSPTLYTLEIDNIMSMCFKALEDSNYDVRCEMAKVLGYLFSKSLAGTSVVQASTKPLKQFTIDDVFSMLGQGFTRSNSSIFKTTANDSLKNGSSLNSEVRVGITHAIVEFGKCMGTAWLERNLSVFINKVLGLVANSKTTPTHVEAVYARKCVNFILRTVISFLLSDGGQMLAGRELCDIIRHTMSNMK--VNQKSNYNLDSFSEDGSKIYMNSSGDNSHHVLVCALQELSCLVQGLNTGAAILLEAPST-IVDCIMPVLLHPSSSAQLSAAFCLRCLVEAIPSQVIPVLEKCFNKLDAYKSSPEALIG 1098
            AESQ R + +L+LQ V+ GLG A   CH+DI K  R+ L DRSM VR    KCL  L + +  ++T E++N+ ++CFKALE SNY VR  +AK+LG + + +L          + +K+ T+++V  ++  GF R  S   K+   + LK G S++ EVRVG+T A V F   +G  WLERN + F++ VL LV++ + T THVEAVY+R+CV+F+LR  +  LL +  Q+ AG+E+C  I   M  ++  VN  +  N    ++  +          S HV+VCAL+EL  LVQ L+  A+ L++ PS  +++ +  VLLHPS +A+L+AA CLRC+  A+P Q+ P+L++C  ++++ KSSPEA+ G
Sbjct:  211 AESQGRGEILLSLQKVLSGLGGAAASCHRDIYKNARSLLTDRSMAVRCAVAKCLLELQNEAVFMWTTELENMATLCFKALEGSNYGVRVAVAKLLGTVMATALLPKQAA-VMRQNVKRATLEEVLELMATGFLRGGSGFLKS-GGEMLKGGGSVSREVRVGVTQAYVVFVTTLGGQWLERNFATFLSHVLDLVSHPRATQTHVEAVYSRRCVSFMLRATLGGLLGEKAQIAAGKEICQAIGKQMRAVEAVVNDINGENKTGAADVSA----------SQHVMVCALKELGSLVQSLSATASPLIQEPSVGLLETVTSVLLHPSMAARLAAARCLRCVAVALPYQLSPLLDRCAERINSLKSSPEAVSG 566          
BLAST of HEAT repeat-containing protein 5B vs. Ensembl Medaka
Match: heatr5b (HEAT repeat containing 5B [Source:NCBI gene;Acc:101168395])

HSP 1 Score: 247.669 bits (631), Expect = 1.161e-72
Identity = 151/400 (37.75%), Postives = 230/400 (57.50%), Query Frame = 1
Query:    4 AESQTRCQTMLTLQHVVIGLGSAGIGCHKDILKVTRTCLLDRSMIVRSVACKCLFSLVDNSPTLYTLEIDNIMSMCFKALEDSNYDVRCEMAKVLGYLFSKSLAGTSVVQASTKPLKQFTIDDVFSMLGQGFTRSNSSIFKTTANDSLKNGSSLNSEVRVGITH--------------------------------AIVEFGKCMGTAWLERNLSVFINKVLGLVANSKTTPTHVEAVYARKCVNFILRTVISFLLSDGGQMLAGRELCDIIRHTMSNMK--VNQKSNYNLDSFSEDGSKIYMNSSGDNSHHVLVCALQELSCLVQGLNTGAAILLEAPST-IVDCIMPVLLHPSSSAQLSAAFCLRCLVEAIPSQVIPVLEKCFNKLDAYKSSPEALIG 1098
            AESQ R + +L+LQ V+ GLG A   CH+DI K  R+ L DRSM VR    KCL  L + +  ++T E++N+ ++CFKALE SNY VR  +AK+LG + + +L          + +K+ T+++V  ++  GF R  S   K+   + LK G S++ EVRVG+T                                 A V F   +G  WLERN + F++ VL LV++ + T THVEAVY+R+CV+F+LR  +  LL +  Q+ AG+E+C  I   M  ++  VN  +  N    ++  +          S HV+VCAL+EL  LVQ L+  A+ L++ PS  +++ +  VLLHPS +A+L+AA CLRC+  A+P Q+ P+L++C  ++++ KSSPEA+ G
Sbjct:  148 AESQGRGEILLSLQKVLSGLGGAAASCHRDIYKNARSLLTDRSMAVRCAVAKCLLELQNEAVFMWTTELENMATLCFKALEGSNYGVRVAVAKLLGTVMATALLPKQAA-VMRQNVKRATLEEVLELMATGFLRGGSGFLKS-GGEMLKGGGSVSREVRVGVTQVRLSDSYPPPPRRWLIQMRSVPPLPPPLPPPQAYVVFVTTLGGQWLERNFATFLSHVLDLVSHPRATQTHVEAVYSRRCVSFMLRATLGGLLGEKAQIAAGKEICQAIGKQMRAVEAVVNDINGENKTGAADVSA----------SQHVMVCALKELGSLVQSLSATASPLIQEPSVGLLETVTSVLLHPSMAARLAAARCLRCVAVALPYQLSPLLDRCAERINSLKSSPEAVSG 535          
BLAST of HEAT repeat-containing protein 5B vs. Planmine SMEST
Match: SMESG000028228.1 (SMESG000028228.1)

HSP 1 Score: 781.171 bits (2016), Expect = 0.000e+0
Identity = 391/392 (99.74%), Postives = 392/392 (100.00%), Query Frame = 1
Query:    1 QAESQTRCQTMLTLQHVVIGLGSAGIGCHKDILKVTRTCLLDRSMIVRSVACKCLFSLVDNSPTLYTLEIDNIMSMCFKALEDSNYDVRCEMAKVLGYLFSKSLAGTSVVQASTKPLKQFTIDDVFSMLGQGFTRSNSSIFKTTANDSLKNGSSLNSEVRVGITHAIVEFGKCMGTAWLERNLSVFINKVLGLVANSKTTPTHVEAVYARKCVNFILRTVISFLLSDGGQMLAGRELCDIIRHTMSNMKVNQKSNYNLDSFSEDGSKIYMNSSGDNSHHVLVCALQELSCLVQGLNTGAAILLEAPSTIVDCIMPVLLHPSSSAQLSAAFCLRCLVEAIPSQVIPVLEKCFNKLDAYKSSPEALIGXXXXXXXXXXXXXRINQPIYDKGQQV 1176
            QAESQTRCQTMLTLQHVVIGLGSAGIGCHKDILKVTRTCLLDRSMIVRSVACKCLFSLVDNSPTLYTLEIDNIMSMCFKALEDSNYDVRCEMAKVLGYLFSKSLAGTSVVQASTKPLKQFTIDDVFSMLGQGFTRSNSSIFKTTANDSLKNGSSLNSEVRVGITHAIVEFGKCMGTAWLERNLSVFINKVLGLVANSKTTPTHVEAVYARKCVNFILRTVISFLLSDGGQMLAGRELCDIIRHTMSNMKVNQKSNYNLDSFSEDGSKIYMNSSGDNSHHVLVCALQELSCLVQGLNTGAAILLEAPSTIVDCIMPVLLHPSSSAQLSAAFCLRCLVEAIPSQVIPVLEKCFNKLDAYKSSPEALIGYSYAIAAVIASVSRINQPIYDKGQQ+
Sbjct:  147 QAESQTRCQTMLTLQHVVIGLGSAGIGCHKDILKVTRTCLLDRSMIVRSVACKCLFSLVDNSPTLYTLEIDNIMSMCFKALEDSNYDVRCEMAKVLGYLFSKSLAGTSVVQASTKPLKQFTIDDVFSMLGQGFTRSNSSIFKTTANDSLKNGSSLNSEVRVGITHAIVEFGKCMGTAWLERNLSVFINKVLGLVANSKTTPTHVEAVYARKCVNFILRTVISFLLSDGGQMLAGRELCDIIRHTMSNMKVNQKSNYNLDSFSEDGSKIYMNSSGDNSHHVLVCALQELSCLVQGLNTGAAILLEAPSTIVDCIMPVLLHPSSSAQLSAAFCLRCLVEAIPSQVIPVLEKCFNKLDAYKSSPEALIGYSYAIAAVIASVSRINQPIYDKGQQI 538          
BLAST of HEAT repeat-containing protein 5B vs. Planmine SMEST
Match: SMESG000028228.1 (SMESG000028228.1)

HSP 1 Score: 780.4 bits (2014), Expect = 0.000e+0
Identity = 391/392 (99.74%), Postives = 392/392 (100.00%), Query Frame = 1
Query:    1 QAESQTRCQTMLTLQHVVIGLGSAGIGCHKDILKVTRTCLLDRSMIVRSVACKCLFSLVDNSPTLYTLEIDNIMSMCFKALEDSNYDVRCEMAKVLGYLFSKSLAGTSVVQASTKPLKQFTIDDVFSMLGQGFTRSNSSIFKTTANDSLKNGSSLNSEVRVGITHAIVEFGKCMGTAWLERNLSVFINKVLGLVANSKTTPTHVEAVYARKCVNFILRTVISFLLSDGGQMLAGRELCDIIRHTMSNMKVNQKSNYNLDSFSEDGSKIYMNSSGDNSHHVLVCALQELSCLVQGLNTGAAILLEAPSTIVDCIMPVLLHPSSSAQLSAAFCLRCLVEAIPSQVIPVLEKCFNKLDAYKSSPEALIGXXXXXXXXXXXXXRINQPIYDKGQQV 1176
            QAESQTRCQTMLTLQHVVIGLGSAGIGCHKDILKVTRTCLLDRSMIVRSVACKCLFSLVDNSPTLYTLEIDNIMSMCFKALEDSNYDVRCEMAKVLGYLFSKSLAGTSVVQASTKPLKQFTIDDVFSMLGQGFTRSNSSIFKTTANDSLKNGSSLNSEVRVGITHAIVEFGKCMGTAWLERNLSVFINKVLGLVANSKTTPTHVEAVYARKCVNFILRTVISFLLSDGGQMLAGRELCDIIRHTMSNMKVNQKSNYNLDSFSEDGSKIYMNSSGDNSHHVLVCALQELSCLVQGLNTGAAILLEAPSTIVDCIMPVLLHPSSSAQLSAAFCLRCLVEAIPSQVIPVLEKCFNKLDAYKSSPEALIGYSYAIAAVIASVSRINQPIYDKGQQ+
Sbjct:  147 QAESQTRCQTMLTLQHVVIGLGSAGIGCHKDILKVTRTCLLDRSMIVRSVACKCLFSLVDNSPTLYTLEIDNIMSMCFKALEDSNYDVRCEMAKVLGYLFSKSLAGTSVVQASTKPLKQFTIDDVFSMLGQGFTRSNSSIFKTTANDSLKNGSSLNSEVRVGITHAIVEFGKCMGTAWLERNLSVFINKVLGLVANSKTTPTHVEAVYARKCVNFILRTVISFLLSDGGQMLAGRELCDIIRHTMSNMKVNQKSNYNLDSFSEDGSKIYMNSSGDNSHHVLVCALQELSCLVQGLNTGAAILLEAPSTIVDCIMPVLLHPSSSAQLSAAFCLRCLVEAIPSQVIPVLEKCFNKLDAYKSSPEALIGYSYAIAAVIASVSRINQPIYDKGQQI 538          
The following BLAST results are available for this feature:
BLAST of HEAT repeat-containing protein 5B vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 4
Match NameE-valueIdentityDescription
HEATR5B9.668e-8641.89HEAT repeat containing 5B [Source:HGNC Symbol;Acc:... [more]
HEATR5A1.973e-8440.91HEAT repeat containing 5A [Source:HGNC Symbol;Acc:... [more]
HEATR5A7.436e-2939.88HEAT repeat containing 5A [Source:HGNC Symbol;Acc:... [more]
HEATR5A8.539e-2139.86HEAT repeat containing 5A [Source:HGNC Symbol;Acc:... [more]
back to top
BLAST of HEAT repeat-containing protein 5B vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
soap-14.249e-4530.39Sorting Of Apical Proteins [Source:UniProtKB/TrEM... [more]
back to top
BLAST of HEAT repeat-containing protein 5B vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG27471.944e-7739.84gene:FBgn0037541 transcript:FBtr0300916[more]
CG27472.101e-7739.84gene:FBgn0037541 transcript:FBtr0081818[more]
CG27472.314e-7739.84gene:FBgn0037541 transcript:FBtr0335230[more]
CG27472.569e-7739.84gene:FBgn0037541 transcript:FBtr0335229[more]
CG27472.661e-7739.84gene:FBgn0037541 transcript:FBtr0081817[more]
back to top
BLAST of HEAT repeat-containing protein 5B vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
heatr5b7.205e-8440.27HEAT repeat containing 5B [Source:ZFIN;Acc:ZDB-GEN... [more]
heatr5b7.875e-8440.27HEAT repeat containing 5B [Source:ZFIN;Acc:ZDB-GEN... [more]
heatr5a1.005e-7638.59HEAT repeat containing 5a [Source:NCBI gene;Acc:36... [more]
BX465838.31.048e-7638.59HEAT repeat containing 5a [Source:NCBI gene;Acc:36... [more]
heatr5a1.439e-7638.59HEAT repeat containing 5a [Source:NCBI gene;Acc:36... [more]
back to top
BLAST of HEAT repeat-containing protein 5B vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
heatr5b3.904e-8742.39HEAT repeat containing 5B [Source:NCBI gene;Acc:10... [more]
heatr5b6.667e-8742.62HEAT repeat containing 5B [Source:NCBI gene;Acc:10... [more]
heatr5b1.674e-8642.43HEAT repeat containing 5B [Source:NCBI gene;Acc:10... [more]
heatr5b1.887e-8642.12HEAT repeat containing 5B [Source:NCBI gene;Acc:10... [more]
heatr5b2.052e-8642.43HEAT repeat containing 5B [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of HEAT repeat-containing protein 5B vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Heatr5a2.813e-8640.81HEAT repeat containing 5A [Source:MGI Symbol;Acc:M... [more]
Heatr5b5.448e-8541.08HEAT repeat containing 5B [Source:MGI Symbol;Acc:M... [more]
back to top
BLAST of HEAT repeat-containing protein 5B vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|A1A5F2|HTR5B_XENTR8.870e-8642.43HEAT repeat-containing protein 5B OS=Xenopus tropi... [more]
sp|Q5PRF0|HTR5A_MOUSE1.968e-8540.81HEAT repeat-containing protein 5A OS=Mus musculus ... [more]
sp|Q9P2D3|HTR5B_HUMAN4.643e-8541.89HEAT repeat-containing protein 5B OS=Homo sapiens ... [more]
sp|Q8C547|HTR5B_MOUSE3.811e-8441.08HEAT repeat-containing protein 5B OS=Mus musculus ... [more]
sp|Q86XA9|HTR5A_HUMAN1.027e-7940.11HEAT repeat-containing protein 5A OS=Homo sapiens ... [more]
back to top
BLAST of HEAT repeat-containing protein 5B vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
T1ELN16.421e-9844.59Uncharacterized protein OS=Helobdella robusta OX=6... [more]
V4A0F33.196e-9745.95Uncharacterized protein OS=Lottia gigantea OX=2251... [more]
A0A1S3H2151.192e-9545.78HEAT repeat-containing protein 5B-like isoform X2 ... [more]
A0A1S3H0691.325e-9545.78HEAT repeat-containing protein 5B-like isoform X1 ... [more]
A0A1S3H0J51.362e-9545.78HEAT repeat-containing protein 5B-like isoform X4 ... [more]
back to top
BLAST of HEAT repeat-containing protein 5B vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
heatr5b9.731e-8840.27HEAT repeat containing 5B [Source:ZFIN;Acc:ZDB-GEN... [more]
heatr5a7.752e-7339.67HEAT repeat containing 5a [Source:NCBI gene;Acc:36... [more]
back to top
BLAST of HEAT repeat-containing protein 5B vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
heatr5b5.259e-8842.20HEAT repeat containing 5B [Source:ZFIN;Acc:ZDB-GEN... [more]
back to top
BLAST of HEAT repeat-containing protein 5B vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of HEAT repeat-containing protein 5B vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of HEAT repeat-containing protein 5B vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
heatr5b2.522e-7841.03HEAT repeat containing 5B [Source:NCBI gene;Acc:10... [more]
heatr5b1.161e-7237.75HEAT repeat containing 5B [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of HEAT repeat-containing protein 5B vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000028228.10.000e+099.74SMESG000028228.1[more]
SMESG000028228.10.000e+099.74SMESG000028228.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30009652 ID=SMED30009652|Name=HEAT repeat-containing protein 5B|organism=Schmidtea mediterranea sexual|type=transcript|length=1176bp
CAGGCCGAATCACAAACCAGATGTCAAACAATGTTGACCCTACAGCATGT
TGTCATTGGACTGGGTTCAGCTGGTATTGGTTGTCATAAAGATATCTTGA
AAGTTACCAGAACATGTCTTCTTGATCGATCAATGATTGTTAGAAGTGTA
GCCTGTAAATGTTTATTTTCATTGGTTGACAATTCACCAACTCTTTACAC
GCTGGAGATCGACAACATCATGTCGATGTGTTTCAAAGCTCTCGAAGATT
CGAATTATGATGTGCGCTGTGAAATGGCAAAAGTGCTAGGTTATCTCTTT
TCCAAATCGTTAGCTGGAACATCAGTCGTTCAAGCTTCAACTAAACCCCT
GAAACAATTCACTATCGATGATGTTTTCAGTATGTTGGGCCAAGGTTTTA
CGAGAAGTAATAGTAGTATATTTAAAACAACAGCCAATGATTCCTTGAAG
AATGGAAGTTCTCTCAATAGTGAAGTTAGAGTCGGAATCACACATGCTAT
AGTAGAATTTGGAAAATGTATGGGTACAGCTTGGTTGGAAAGAAACTTAT
CTGTATTTATCAATAAAGTCCTGGGCTTAGTTGCCAACAGTAAAACTACT
CCAACTCATGTTGAAGCTGTTTATGCAAGGAAGTGTGTAAATTTTATATT
GAGAACTGTTATCAGTTTTCTTTTGTCGGATGGGGGTCAAATGTTGGCTG
GGAGAGAGTTGTGTGATATTATCAGGCATACAATGTCCAATATGAAGGTT
AACCAAAAATCAAATTATAACTTGGATTCATTCAGTGAAGACGGAAGCAA
AATTTATATGAATTCTTCTGGAGACAATAGCCACCATGTTCTTGTATGTG
CTCTACAAGAACTGAGTTGTCTTGTTCAAGGACTCAATACCGGAGCAGCA
ATCTTACTTGAGGCACCATCTACTATTGTCGATTGTATAATGCCGGTGCT
TCTTCATCCAAGCAGCAGTGCACAATTGTCAGCTGCATTTTGTCTTCGAT
GTTTAGTGGAAGCAATACCTTCTCAAGTTATTCCAGTTCTAGAAAAATGT
TTCAATAAATTAGACGCTTACAAATCGAGTCCAGAAGCCCTGATAGGTTA
CAGCTATGCTATAGCAGCTGTGATTGCTAGTGTTAGTCGTATCAATCAAC
CGATTTACGATAAAGGCCAACAAGTG
back to top

protein sequence of SMED30009652-orf-1

>SMED30009652-orf-1 ID=SMED30009652-orf-1|Name=SMED30009652-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=392bp
QAESQTRCQTMLTLQHVVIGLGSAGIGCHKDILKVTRTCLLDRSMIVRSV
ACKCLFSLVDNSPTLYTLEIDNIMSMCFKALEDSNYDVRCEMAKVLGYLF
SKSLAGTSVVQASTKPLKQFTIDDVFSMLGQGFTRSNSSIFKTTANDSLK
NGSSLNSEVRVGITHAIVEFGKCMGTAWLERNLSVFINKVLGLVANSKTT
PTHVEAVYARKCVNFILRTVISFLLSDGGQMLAGRELCDIIRHTMSNMKV
NQKSNYNLDSFSEDGSKIYMNSSGDNSHHVLVCALQELSCLVQGLNTGAA
ILLEAPSTIVDCIMPVLLHPSSSAQLSAAFCLRCLVEAIPSQVIPVLEKC
FNKLDAYKSSPEALIGYSYAIAAVIASVSRINQPIYDKGQQV
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000101muscle cell
Vocabulary: INTERPRO
TermDefinition
IPR040108Laa1/Sip1/HEATR5
IPR032878Vac14_Fab1-bd
IPR011989ARM-like
IPR016024ARM-type_fold
Vocabulary: molecular function
TermDefinition
GO:0005488binding
GO:0003674molecular_function
Vocabulary: cellular component
TermDefinition
GO:0005575cellular_component
Vocabulary: biological process
TermDefinition
GO:0008150biological_process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR011989Armadillo-like helicalGENE3DG3DSA:1.25.10.10coord: 1..140
e-value: 3.3E-6
score: 28.8
IPR032878Vacuole morphology and inheritance protein 14, Fab1-binding regionPFAMPF12755Vac14_Fab1_bdcoord: 6..90
e-value: 1.4E-5
score: 25.6
IPR040108Laa1/Sip1/HEATR5PANTHERPTHR21663HYPOTHETICAL HEAT DOMAIN-CONTAININGcoord: 1..380
IPR016024Armadillo-type foldSUPERFAMILYSSF48371ARM repeatcoord: 6..364