NSD-1

Overview
NameNSD-1 (AFD29602.1)
Smed IDSMED30009651
Length (bp)2967
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of NSD-1 (SMED30009651) t-SNE clustered cells

Violin plots show distribution of expression levels for NSD-1 (SMED30009651) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of NSD-1 (SMED30009651) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for NSD-1 (SMED30009651) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30009651

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 31

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30009651SMESG000015015.1 Contig708uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30009651SMESG000015015.1 Contig708newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30009651SMESG000026036.1 Contig708uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30009651SMESG000026036.1 Contig708newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
X1 cellSMED30009651SMESG000015096.1 SMESG000015015.1 SmedASXL_016718SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30009651SMESG000015096.1 SMESG000015015.1 SmedASXL_016718SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
cephalic gangliaSMED30009651SMESG000015096.1 SMESG000015015.1 dd_Smed_v4_11074_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30009651SMESG000015096.1 SMESG000015015.1 dd_Smed_v4_11074_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30009651SMESG000015096.1 SMESG000015015.1 dd_Smed_v6_11074_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
parenchymaSMED30009651SMESG000015096.1 SMESG000015015.1 SMESG000008858.1 Contig47937uc_Smed_v2PMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymaSMED30009651SMESG000015096.1 SMESG000015015.1 SMESG000008858.1 Contig47937newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
zeta neoblastSMED30009651SMESG000015096.1 SMESG000015015.1 dd_Smed_v4_11074_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
neoblastSMED30009651SMESG000015096.1 SMESG000015015.1 JQ425134.1smed_ncbi_20200123PMID:27523733
Lei et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
neoblastSMED30009651SMESG000015015.1 SMED_23187_V2_2GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30009651SMESG000015015.1 SMED_23187_V2_2GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30009651SMESG000015015.1 SMED_20741_V2_1GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30009651SMESG000015015.1 SMED_20741_V2_1GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30009651SMESG000015015.1 SMED_23187_V2_1GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30009651SMESG000015015.1 SMED_23187_V2_1GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30009651SMESG000015015.1 SMED_20741_V2_2GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30009651SMESG000015015.1 SMED_20741_V2_2GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30009651SMESG000015015.1 SmWIOct06_025372GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30009651SMESG000015096.1 SMESG000015015.1 SMED_07236_V2_2GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30009651SMESG000015096.1 SMESG000015015.1 SMED_07236_V2_2GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30009651SMESG000015015.1 SmWIOct06_025395GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30009651SMESG000015015.1 SMED_07236_V2_1GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30009651SMESG000015015.1 SMED_07236_V2_1GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30009651SMESG000015096.1 SMESG000015015.1 SMED_07236_V2_1GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30009651SMESG000015096.1 SMESG000015015.1 SMED_07236_V2_1GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30009651SMESG000015096.1 SMESG000015015.1 SMED30009651smed_20140614PMID:22385657
Wagner et al., 2012
whole organism asexual adult fluorescence in situ hybridization evidence
neoblastSMED30009651SMESG000015096.1 SMESG000015015.1 SMED30009651smed_20140614PMID:22385657
Wagner et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of NSD-1 vs. Ensembl Human
Match: NSD2 (nuclear receptor binding SET domain protein 2 [Source:HGNC Symbol;Acc:HGNC:12766])

HSP 1 Score: 390.578 bits (1002), Expect = 1.548e-116
Identity = 237/705 (33.62%), Postives = 338/705 (47.94%), Query Frame = 3
Query:  693 CRYCLETKNIVQCNKCLFNNFHVKCLEFLQNSIETKINDLDRCLECSLGIIRCYACYKIVDISNEQGFMRCIIKTCTKWFHTNCLETGPMLEMTKFPKPGQLVCPCHICHKCELVNPS-PKYRCTKLIVCIMCPATFHTGDWCIPAGSVELNTGEIICPRHLVDLNFSMNIMVPPFVARVKSDLQERIYGNTLTKISEPMTITPSTVTKPTNVNWCFKCGEGGELLCCETCPAAYHFKCTDLKEIPQKFYCPDCASFCYRSYGEIVWIKCGTHPWWPGQILHLENVPKNIAAKKHANGQFVVQFFGSRDYMWRDHGNVFLYEKEDECNSKTSKYRYNNIFLEGIKEAAIGYV----------TREEKWQSGSCDHVMNSKIYNKIQVNKCPLELRRKVVPETPHCNCISFDPKSDCSIGSGCFNVASKCECDPQICNLGDKCKNQNFVKRIYPKQYTFWANDRGWGLKADEFIKTKQFVNEYIGEIITMEESEKRILWANENNITDFYFMELDNGRLIDARQFSNLSRFINNSCDPNLVAEKWIVNREHRIGLFALRDIQKGEELTFQYNLQNKSSNRIVCKCFSVNCSGFLGEAPKMAXXXXXXXXXXXXXXXXXXXXXXXCKSFLTDKNSNSQCFRCGEIIDMLSSIVCSVGPCMKTYHSVCLNLNMANYVQSSWICPHHYCDVCARPSHHFSSNTTESYCNK 2774
            C+ C +  +++ C       FH+ CL  L    E +      C EC+ GI  C+ C +     ++    RC++  C K++H  C++  P+   T F   G   CP H C  C   NPS P+    K++ C+ CP  +H+GD C+ AG   + +  IIC  H              F AR        +                       NV+WCF C +GG LLCCE+CPAA+H  C +++     ++C DC +     + +I+W+K G + WWP ++ H +NVP NI   KH  G+F V FFGS+DY W     VF Y + D  +          +F   ++EA   +           T+E + +     H+  +K Y K+Q+           + E P CNC   D ++ C   S C N     EC PQ+C  G+ C+NQ F KR YP+      + +GWGL A   I+  +FVNEY+GE+I  EE   RI  A+EN+IT FY + +D  R+IDA    N SRF+N+SC PN    KW VN + R+GLFA+ DI  G ELTF YNL    + + VC+C + NCSGFLG+ PK +     +    K  K                + S  +CFRCG   D    ++C    C K YH  CL L    +    W CP H+CDVC +PS  F      S+C +
Sbjct:  670 CQLCEKPGSLLLCEGPCCGAFHLACL-GLSRRPEGRFT----CSECASGIHSCFVCKE-----SKTDVKRCVVTQCGKFYHEACVKKYPL---TVFESRG-FRCPLHSCVSCHASNPSNPRPSKGKMMRCVRCPVAYHSGDACLAAGCSVIASNSIICTAH--------------FTARKGKRHHAHV-----------------------NVSWCFVCSKGGSLLCCESCPAAFHPDCLNIEMPDGSWFCNDCRAGKKLHFQDIIWVKLGNYRWWPAEVCHPKNVPPNIQKMKHEIGEFPVFFFGSKDYYWTHQARVFPYMEGDRGSRYQGVRGIGRVFKNALQEAEARFREIKLQREARETQESERKPPPYKHIKVNKPYGKVQIYTAD-------ISEIPKCNCKPTD-ENPCGFDSECLNRMLMFECHPQVCPAGEFCQNQCFTKRQYPETKIIKTDGKGWGLVAKRDIRKGEFVNEYVGELIDEEECMARIKHAHENDITHFYMLTIDKDRIIDAGPKGNYSRFMNHSCQPNCETLKWTVNGDTRVGLFAVCDIPAGTELTFNYNLDCLGNEKTVCRCGASNCSGFLGDRPKTSTTLSSEEKGKKTKKKTRRRR----AKGEGKRQSEDECFRCG---DGGQLVLCDRKFCTKAYHLSCLGLGKRPF--GKWECPWHHCDVCGKPSTSFCHLCPNSFCKE 1306          
BLAST of NSD-1 vs. Ensembl Human
Match: NSD2 (nuclear receptor binding SET domain protein 2 [Source:HGNC Symbol;Acc:HGNC:12766])

HSP 1 Score: 390.578 bits (1002), Expect = 1.548e-116
Identity = 237/705 (33.62%), Postives = 338/705 (47.94%), Query Frame = 3
Query:  693 CRYCLETKNIVQCNKCLFNNFHVKCLEFLQNSIETKINDLDRCLECSLGIIRCYACYKIVDISNEQGFMRCIIKTCTKWFHTNCLETGPMLEMTKFPKPGQLVCPCHICHKCELVNPS-PKYRCTKLIVCIMCPATFHTGDWCIPAGSVELNTGEIICPRHLVDLNFSMNIMVPPFVARVKSDLQERIYGNTLTKISEPMTITPSTVTKPTNVNWCFKCGEGGELLCCETCPAAYHFKCTDLKEIPQKFYCPDCASFCYRSYGEIVWIKCGTHPWWPGQILHLENVPKNIAAKKHANGQFVVQFFGSRDYMWRDHGNVFLYEKEDECNSKTSKYRYNNIFLEGIKEAAIGYV----------TREEKWQSGSCDHVMNSKIYNKIQVNKCPLELRRKVVPETPHCNCISFDPKSDCSIGSGCFNVASKCECDPQICNLGDKCKNQNFVKRIYPKQYTFWANDRGWGLKADEFIKTKQFVNEYIGEIITMEESEKRILWANENNITDFYFMELDNGRLIDARQFSNLSRFINNSCDPNLVAEKWIVNREHRIGLFALRDIQKGEELTFQYNLQNKSSNRIVCKCFSVNCSGFLGEAPKMAXXXXXXXXXXXXXXXXXXXXXXXCKSFLTDKNSNSQCFRCGEIIDMLSSIVCSVGPCMKTYHSVCLNLNMANYVQSSWICPHHYCDVCARPSHHFSSNTTESYCNK 2774
            C+ C +  +++ C       FH+ CL  L    E +      C EC+ GI  C+ C +     ++    RC++  C K++H  C++  P+   T F   G   CP H C  C   NPS P+    K++ C+ CP  +H+GD C+ AG   + +  IIC  H              F AR        +                       NV+WCF C +GG LLCCE+CPAA+H  C +++     ++C DC +     + +I+W+K G + WWP ++ H +NVP NI   KH  G+F V FFGS+DY W     VF Y + D  +          +F   ++EA   +           T+E + +     H+  +K Y K+Q+           + E P CNC   D ++ C   S C N     EC PQ+C  G+ C+NQ F KR YP+      + +GWGL A   I+  +FVNEY+GE+I  EE   RI  A+EN+IT FY + +D  R+IDA    N SRF+N+SC PN    KW VN + R+GLFA+ DI  G ELTF YNL    + + VC+C + NCSGFLG+ PK +     +    K  K                + S  +CFRCG   D    ++C    C K YH  CL L    +    W CP H+CDVC +PS  F      S+C +
Sbjct:  670 CQLCEKPGSLLLCEGPCCGAFHLACL-GLSRRPEGRFT----CSECASGIHSCFVCKE-----SKTDVKRCVVTQCGKFYHEACVKKYPL---TVFESRG-FRCPLHSCVSCHASNPSNPRPSKGKMMRCVRCPVAYHSGDACLAAGCSVIASNSIICTAH--------------FTARKGKRHHAHV-----------------------NVSWCFVCSKGGSLLCCESCPAAFHPDCLNIEMPDGSWFCNDCRAGKKLHFQDIIWVKLGNYRWWPAEVCHPKNVPPNIQKMKHEIGEFPVFFFGSKDYYWTHQARVFPYMEGDRGSRYQGVRGIGRVFKNALQEAEARFREIKLQREARETQESERKPPPYKHIKVNKPYGKVQIYTAD-------ISEIPKCNCKPTD-ENPCGFDSECLNRMLMFECHPQVCPAGEFCQNQCFTKRQYPETKIIKTDGKGWGLVAKRDIRKGEFVNEYVGELIDEEECMARIKHAHENDITHFYMLTIDKDRIIDAGPKGNYSRFMNHSCQPNCETLKWTVNGDTRVGLFAVCDIPAGTELTFNYNLDCLGNEKTVCRCGASNCSGFLGDRPKTSTTLSSEEKGKKTKKKTRRRR----AKGEGKRQSEDECFRCG---DGGQLVLCDRKFCTKAYHLSCLGLGKRPF--GKWECPWHHCDVCGKPSTSFCHLCPNSFCKE 1306          
BLAST of NSD-1 vs. Ensembl Human
Match: NSD2 (nuclear receptor binding SET domain protein 2 [Source:HGNC Symbol;Acc:HGNC:12766])

HSP 1 Score: 390.578 bits (1002), Expect = 1.548e-116
Identity = 237/705 (33.62%), Postives = 338/705 (47.94%), Query Frame = 3
Query:  693 CRYCLETKNIVQCNKCLFNNFHVKCLEFLQNSIETKINDLDRCLECSLGIIRCYACYKIVDISNEQGFMRCIIKTCTKWFHTNCLETGPMLEMTKFPKPGQLVCPCHICHKCELVNPS-PKYRCTKLIVCIMCPATFHTGDWCIPAGSVELNTGEIICPRHLVDLNFSMNIMVPPFVARVKSDLQERIYGNTLTKISEPMTITPSTVTKPTNVNWCFKCGEGGELLCCETCPAAYHFKCTDLKEIPQKFYCPDCASFCYRSYGEIVWIKCGTHPWWPGQILHLENVPKNIAAKKHANGQFVVQFFGSRDYMWRDHGNVFLYEKEDECNSKTSKYRYNNIFLEGIKEAAIGYV----------TREEKWQSGSCDHVMNSKIYNKIQVNKCPLELRRKVVPETPHCNCISFDPKSDCSIGSGCFNVASKCECDPQICNLGDKCKNQNFVKRIYPKQYTFWANDRGWGLKADEFIKTKQFVNEYIGEIITMEESEKRILWANENNITDFYFMELDNGRLIDARQFSNLSRFINNSCDPNLVAEKWIVNREHRIGLFALRDIQKGEELTFQYNLQNKSSNRIVCKCFSVNCSGFLGEAPKMAXXXXXXXXXXXXXXXXXXXXXXXCKSFLTDKNSNSQCFRCGEIIDMLSSIVCSVGPCMKTYHSVCLNLNMANYVQSSWICPHHYCDVCARPSHHFSSNTTESYCNK 2774
            C+ C +  +++ C       FH+ CL  L    E +      C EC+ GI  C+ C +     ++    RC++  C K++H  C++  P+   T F   G   CP H C  C   NPS P+    K++ C+ CP  +H+GD C+ AG   + +  IIC  H              F AR        +                       NV+WCF C +GG LLCCE+CPAA+H  C +++     ++C DC +     + +I+W+K G + WWP ++ H +NVP NI   KH  G+F V FFGS+DY W     VF Y + D  +          +F   ++EA   +           T+E + +     H+  +K Y K+Q+           + E P CNC   D ++ C   S C N     EC PQ+C  G+ C+NQ F KR YP+      + +GWGL A   I+  +FVNEY+GE+I  EE   RI  A+EN+IT FY + +D  R+IDA    N SRF+N+SC PN    KW VN + R+GLFA+ DI  G ELTF YNL    + + VC+C + NCSGFLG+ PK +     +    K  K                + S  +CFRCG   D    ++C    C K YH  CL L    +    W CP H+CDVC +PS  F      S+C +
Sbjct:  670 CQLCEKPGSLLLCEGPCCGAFHLACL-GLSRRPEGRFT----CSECASGIHSCFVCKE-----SKTDVKRCVVTQCGKFYHEACVKKYPL---TVFESRG-FRCPLHSCVSCHASNPSNPRPSKGKMMRCVRCPVAYHSGDACLAAGCSVIASNSIICTAH--------------FTARKGKRHHAHV-----------------------NVSWCFVCSKGGSLLCCESCPAAFHPDCLNIEMPDGSWFCNDCRAGKKLHFQDIIWVKLGNYRWWPAEVCHPKNVPPNIQKMKHEIGEFPVFFFGSKDYYWTHQARVFPYMEGDRGSRYQGVRGIGRVFKNALQEAEARFREIKLQREARETQESERKPPPYKHIKVNKPYGKVQIYTAD-------ISEIPKCNCKPTD-ENPCGFDSECLNRMLMFECHPQVCPAGEFCQNQCFTKRQYPETKIIKTDGKGWGLVAKRDIRKGEFVNEYVGELIDEEECMARIKHAHENDITHFYMLTIDKDRIIDAGPKGNYSRFMNHSCQPNCETLKWTVNGDTRVGLFAVCDIPAGTELTFNYNLDCLGNEKTVCRCGASNCSGFLGDRPKTSTTLSSEEKGKKTKKKTRRRR----AKGEGKRQSEDECFRCG---DGGQLVLCDRKFCTKAYHLSCLGLGKRPF--GKWECPWHHCDVCGKPSTSFCHLCPNSFCKE 1306          
BLAST of NSD-1 vs. Ensembl Human
Match: NSD2 (nuclear receptor binding SET domain protein 2 [Source:HGNC Symbol;Acc:HGNC:12766])

HSP 1 Score: 390.578 bits (1002), Expect = 1.548e-116
Identity = 237/705 (33.62%), Postives = 338/705 (47.94%), Query Frame = 3
Query:  693 CRYCLETKNIVQCNKCLFNNFHVKCLEFLQNSIETKINDLDRCLECSLGIIRCYACYKIVDISNEQGFMRCIIKTCTKWFHTNCLETGPMLEMTKFPKPGQLVCPCHICHKCELVNPS-PKYRCTKLIVCIMCPATFHTGDWCIPAGSVELNTGEIICPRHLVDLNFSMNIMVPPFVARVKSDLQERIYGNTLTKISEPMTITPSTVTKPTNVNWCFKCGEGGELLCCETCPAAYHFKCTDLKEIPQKFYCPDCASFCYRSYGEIVWIKCGTHPWWPGQILHLENVPKNIAAKKHANGQFVVQFFGSRDYMWRDHGNVFLYEKEDECNSKTSKYRYNNIFLEGIKEAAIGYV----------TREEKWQSGSCDHVMNSKIYNKIQVNKCPLELRRKVVPETPHCNCISFDPKSDCSIGSGCFNVASKCECDPQICNLGDKCKNQNFVKRIYPKQYTFWANDRGWGLKADEFIKTKQFVNEYIGEIITMEESEKRILWANENNITDFYFMELDNGRLIDARQFSNLSRFINNSCDPNLVAEKWIVNREHRIGLFALRDIQKGEELTFQYNLQNKSSNRIVCKCFSVNCSGFLGEAPKMAXXXXXXXXXXXXXXXXXXXXXXXCKSFLTDKNSNSQCFRCGEIIDMLSSIVCSVGPCMKTYHSVCLNLNMANYVQSSWICPHHYCDVCARPSHHFSSNTTESYCNK 2774
            C+ C +  +++ C       FH+ CL  L    E +      C EC+ GI  C+ C +     ++    RC++  C K++H  C++  P+   T F   G   CP H C  C   NPS P+    K++ C+ CP  +H+GD C+ AG   + +  IIC  H              F AR        +                       NV+WCF C +GG LLCCE+CPAA+H  C +++     ++C DC +     + +I+W+K G + WWP ++ H +NVP NI   KH  G+F V FFGS+DY W     VF Y + D  +          +F   ++EA   +           T+E + +     H+  +K Y K+Q+           + E P CNC   D ++ C   S C N     EC PQ+C  G+ C+NQ F KR YP+      + +GWGL A   I+  +FVNEY+GE+I  EE   RI  A+EN+IT FY + +D  R+IDA    N SRF+N+SC PN    KW VN + R+GLFA+ DI  G ELTF YNL    + + VC+C + NCSGFLG+ PK +     +    K  K                + S  +CFRCG   D    ++C    C K YH  CL L    +    W CP H+CDVC +PS  F      S+C +
Sbjct:  670 CQLCEKPGSLLLCEGPCCGAFHLACL-GLSRRPEGRFT----CSECASGIHSCFVCKE-----SKTDVKRCVVTQCGKFYHEACVKKYPL---TVFESRG-FRCPLHSCVSCHASNPSNPRPSKGKMMRCVRCPVAYHSGDACLAAGCSVIASNSIICTAH--------------FTARKGKRHHAHV-----------------------NVSWCFVCSKGGSLLCCESCPAAFHPDCLNIEMPDGSWFCNDCRAGKKLHFQDIIWVKLGNYRWWPAEVCHPKNVPPNIQKMKHEIGEFPVFFFGSKDYYWTHQARVFPYMEGDRGSRYQGVRGIGRVFKNALQEAEARFREIKLQREARETQESERKPPPYKHIKVNKPYGKVQIYTAD-------ISEIPKCNCKPTD-ENPCGFDSECLNRMLMFECHPQVCPAGEFCQNQCFTKRQYPETKIIKTDGKGWGLVAKRDIRKGEFVNEYVGELIDEEECMARIKHAHENDITHFYMLTIDKDRIIDAGPKGNYSRFMNHSCQPNCETLKWTVNGDTRVGLFAVCDIPAGTELTFNYNLDCLGNEKTVCRCGASNCSGFLGDRPKTSTTLSSEEKGKKTKKKTRRRR----AKGEGKRQSEDECFRCG---DGGQLVLCDRKFCTKAYHLSCLGLGKRPF--GKWECPWHHCDVCGKPSTSFCHLCPNSFCKE 1306          
BLAST of NSD-1 vs. Ensembl Human
Match: NSD2 (nuclear receptor binding SET domain protein 2 [Source:HGNC Symbol;Acc:HGNC:12766])

HSP 1 Score: 375.17 bits (962), Expect = 2.384e-116
Identity = 228/653 (34.92%), Postives = 322/653 (49.31%), Query Frame = 3
Query:  834 LGIIRCYACYKIVDISNEQGFMRCIIKTCTKWFHTNCLETGPMLEMTKFPKPGQLVCPCHICHKCELVNPS-PKYRCTKLIVCIMCPATFHTGDWCIPAGSVELNTGEIICPRHLVDLNFSMNIMVPPFVARVKSDLQERIYGNTLTKISEPMTITPSTVTKPTNVNWCFKCGEGGELLCCETCPAAYHFKCTDLKEIPQKFYCPDCASFCYRSYGEIVWIKCGTHPWWPGQILHLENVPKNIAAKKHANGQFVVQFFGSRDYMWRDHGNVFLYEKEDECNSKTSKYRYNNIFLEGIKEAAIGYVTREEKWQSGSCDHVMNSK---IYNKIQVNK--CPLELRRKVVPETPHCNCISFDPKSDCSIGSGCFNVASKCECDPQICNLGDKCKNQNFVKRIYPKQYTFWANDRGWGLKADEFIKTKQFVNEYIGEIITMEESEKRILWANENNITDFYFMELDNGRLIDARQFSNLSRFINNSCDPNLVAEKWIVNREHRIGLFALRDIQKGEELTFQYNLQNKSSNRIVCKCFSVNCSGFLGEAPKMAXXXXXXXXXXXXXXXXXXXXXXXCKSFLTDKNSNSQCFRCGEIIDMLSSIVCSVGPCMKTYHSVCLNLNMANYVQSSWICPHHYCDVCARPSHHFSSNTTESYCNK 2774
            LGI  C+ C +     ++    RC++  C K++H  C++  P+   T F   G   CP H C  C   NPS P+    K++ C+ CP  +H+GD C+ AG   + +  IIC  H              F AR        +                       NV+WCF C +GG LLCCE+CPAA+H  C +++     ++C DC +     + +I+W+K G + WWP ++ H +NVP NI   KH  G+F V FFGS+DY W     VF Y + D  +          +F   ++EA   +  RE K Q  + +   + +    Y  I+VNK    +++    + E P CNC   D ++ C   S C N     EC PQ+C  G+ C+NQ F KR YP+      + +GWGL A   I+  +FVNEY+GE+I  EE   RI  A+EN+IT FY + +D  R+IDA    N SRF+N+SC PN    KW VN + R+GLFA+ DI  G ELTF YNL    + + VC+C + NCSGFLG+ PK +     +    K  K                + S  +CFRCG   D    ++C    C K YH  CL L    +    W CP H+CDVC +PS  F      S+C +
Sbjct:   60 LGIHSCFVCKE-----SKTDVKRCVVTQCGKFYHEACVKKYPL---TVFESRG-FRCPLHSCVSCHASNPSNPRPSKGKMMRCVRCPVAYHSGDACLAAGCSVIASNSIICTAH--------------FTARKGKRHHAHV-----------------------NVSWCFVCSKGGSLLCCESCPAAFHPDCLNIEMPDGSWFCNDCRAGKKLHFQDIIWVKLGNYRWWPAEVCHPKNVPPNIQKMKHEIGEFPVFFFGSKDYYWTHQARVFPYMEGDRGSRYQGVRGIGRVFKNALQEAEARF--REIKLQREARETQESERKPPPYKHIKVNKPYGKVQIYTADISEIPKCNCKPTD-ENPCGFDSECLNRMLMFECHPQVCPAGEFCQNQCFTKRQYPETKIIKTDGKGWGLVAKRDIRKGEFVNEYVGELIDEEECMARIKHAHENDITHFYMLTIDKDRIIDAGPKGNYSRFMNHSCQPNCETLKWTVNGDTRVGLFAVCDIPAGTELTFNYNLDCLGNEKTVCRCGASNCSGFLGDRPKTSTTLSSEEKGKKTKKKTRRRR----AKGEGKRQSEDECFRCG---DGGQLVLCDRKFCTKAYHLSCLGLGKRPF--GKWECPWHHCDVCGKPSTSFCHLCPNSFCKE 654          
BLAST of NSD-1 vs. Ensembl Celegans
Match: met-1 (Histone-lysine N-methyltransferase [Source:UniProtKB/TrEMBL;Acc:A4LBC2])

HSP 1 Score: 112.079 bits (279), Expect = 1.167e-24
Identity = 73/183 (39.89%), Postives = 101/183 (55.19%), Query Frame = 3
Query: 1923 CFNVASKCECDPQICNLGDKCKNQNFVKRIYPKQYTF-WANDRGWGLKADEFIKTKQFVNEYIGEIITMEESEKR-ILWANENNITDFYFMELDNG-RLIDARQFSNLSRFINNSCDPNLVAEKWIVNRE----HRIGLFALRDIQKGEELTFQYNLQNKSSNRIVCKCFSVNCSGFLGEAPK 2450
            C N A   EC P  C +  KCKNQ F K+ Y     F     +G GL+A + IK  +F+ EYIGE++  ++ EKR   +A +      Y    D G   IDA  + N SRF+N+SCDPN + EKW V R     +R+G F+ R I+ GEE+TF Y   N   +   C C S +CSG++G+ P+
Sbjct:  641 CVNRAMLTEC-PSSCQV--KCKNQRFAKKKYAAVEAFHTGTAKGCGLRAVKDIKKGRFIIEYIGEVVERDDYEKRKTKYAADKKHKHHYL--CDTGVYTIDATVYGNPSRFVNHSCDPNAICEKWSVPRTPGDVNRVGFFSKRFIKAGEEITFDYQFVNYGRDAQQCFCGSASCSGWIGQKPE 818          
BLAST of NSD-1 vs. Ensembl Celegans
Match: met-1 (Histone-lysine N-methyltransferase [Source:UniProtKB/TrEMBL;Acc:A4LBC2])

HSP 1 Score: 112.079 bits (279), Expect = 1.201e-24
Identity = 73/183 (39.89%), Postives = 101/183 (55.19%), Query Frame = 3
Query: 1923 CFNVASKCECDPQICNLGDKCKNQNFVKRIYPKQYTF-WANDRGWGLKADEFIKTKQFVNEYIGEIITMEESEKR-ILWANENNITDFYFMELDNG-RLIDARQFSNLSRFINNSCDPNLVAEKWIVNRE----HRIGLFALRDIQKGEELTFQYNLQNKSSNRIVCKCFSVNCSGFLGEAPK 2450
            C N A   EC P  C +  KCKNQ F K+ Y     F     +G GL+A + IK  +F+ EYIGE++  ++ EKR   +A +      Y    D G   IDA  + N SRF+N+SCDPN + EKW V R     +R+G F+ R I+ GEE+TF Y   N   +   C C S +CSG++G+ P+
Sbjct:  655 CVNRAMLTEC-PSSCQV--KCKNQRFAKKKYAAVEAFHTGTAKGCGLRAVKDIKKGRFIIEYIGEVVERDDYEKRKTKYAADKKHKHHYL--CDTGVYTIDATVYGNPSRFVNHSCDPNAICEKWSVPRTPGDVNRVGFFSKRFIKAGEEITFDYQFVNYGRDAQQCFCGSASCSGWIGQKPE 832          
BLAST of NSD-1 vs. Ensembl Celegans
Match: mes-4 (Histone-lysine N-methyltransferase mes-4 [Source:UniProtKB/Swiss-Prot;Acc:Q9NH52])

HSP 1 Score: 102.064 bits (253), Expect = 8.868e-22
Identity = 131/535 (24.49%), Postives = 221/535 (41.31%), Query Frame = 3
Query:  990 GQLVCPCHICHKCELVNPSPKYRCTKLIVCIMCPATFHTGDWCIPAGSVELNTG-----------EIICPRHLVDLNFSMNIMVPPFVARVKSDLQERIYGNTLTKISEPMTITP-STVTKPTNVNWCFKCG----EGGELLCCETCPAAYHFKCTDL-----KEIPQKFYCPDCASFCYRSYGEIVWIKCGTHPWWPGQILHLENVPK----NIAAKKHANGQFVVQFFGSRDYMWRDHGNVFLYEKEDECN--------SKTSKYRYNNIFLEGIKEAAIGYVTREEKWQSGSCDHVMNSKIYNKIQVN---KCPLELRRKVVPETPHCNCISFDPKSDCSIGSGCFNVASKCECDPQICNLGDKCKNQNFVKRIYPKQYTFWAND-RGWGLKADEFIKTKQFVNEYIGEIITMEESEKRI--LWANENNITDFYFMELDNGRLIDARQFSNLSRFINNSCDPNLVA--EKWIVNREHRIGLF-------ALRDIQKGEELTFQYNLQNKSSNRIVCKCFSVNCSGFLGEAPK 2450
             +L+CP H C+ C L +         +  C +C   FH    C P+G  +LN              IICP H +                  +D+Q   + N   K    +T+ P + VT  +++  C   G       + + C+TC  ++H  C ++     K IP    C  C          ++  K   + +W    L     P     NI  ++   G  VVQ+   ++        + +    D           +K S  R  N++ E  +E A   + R        C +V  + ++ +++ +   KC  +L      E   CNC   D  +  S    C  +A   EC P  C+    C N+     I  ++    A   +G+G+ A   I+  +++ EY+GEII   E ++R+  +  + +   + Y MEL  G  +DA ++ N+SR+IN+SCDPN  +   K  V +     L+       A+R I  G+E+TF YN+ N+  N   C+C + NC G +G+A +
Sbjct:  199 ARLLCPLHCCNSCNLDHHKQSAYVGDIAECALCLRAFHLTS-CYPSGGRDLNVSITIGGKVEKFEMIICPAHYLP----------------GADVQ---FYNKHKKRKNAVTVVPKADVTMKSHIKACCVIGCEKSSNSKTIMCKTCCRSFHSGCREVETLNGKPIPDD-QCESCVCGDPIPQNTLILAKWTDNSFWLALTLDWYKYPTGNRGNINFERL--GYTVVQWLIPQENDKEKQPLMSIVPVSDIARLTKNYFSLAKNSTLR--NLWEEKYEEQADTALKR--------CPYVCKT-VFGRLRTSVYYKCEPKLEEYHNNEV--CNCEGADRCTKLS----CQYLADDYECPPS-CSKKGVCHNRQVSMGIVSEKIKLAATLCKGYGVFAKGQIEKDEYICEYVGEIIDKAEKKRRLDSVSISRDFQANHYMMELHKGLTVDAARYGNISRYINHSCDPNAASFVTKVFVKKTKEGSLYDTRSYIRAIRTIDDGDEITFSYNMNNE-ENLPDCECGAENCMGTMGKAKR 691          
BLAST of NSD-1 vs. Ensembl Celegans
Match: set-12 (Histone-lysine N-methyltransferase [Source:UniProtKB/TrEMBL;Acc:Q21404])

HSP 1 Score: 96.6709 bits (239), Expect = 6.439e-21
Identity = 66/184 (35.87%), Postives = 99/184 (53.80%), Query Frame = 3
Query: 1899 SDCSIGSGCFNVASKCECDPQICNLGDKCKNQNFVKRIYPKQYTFWA-NDRGWGLKADEFIKTKQFVNEYIGEIITMEESEKRILWANENNITDFYFMELDNGRLIDARQFSNLSRFINNSCDPNLVAEKWIV-NREHR-IGLFALRDIQKGEELTFQYNLQNKSSNRIVCKCFSVNCSGFLGE 2441
            +DC+    C N A+  EC P+ C+    C+NQ F KR +    TF   N  G GL+A E I T + + EY GE IT  E  KR+    ++ I   Y  E+     +D  +  N +RFIN+SC+PN + + W V +R  + +G+FA + I+ GEE+TF Y    +  N   C+C    C G++G+
Sbjct:   61 TDCTTEE-CSNFANHREC-PRGCS---NCENQRFRKRQFCGVETFLTDNGIGHGLRATEEIATGKLILEYRGEAITKAEHNKRVKRYKKDGIKHSYSFEVGRNYYVDPTRKGNSARFINHSCNPNALVKVWTVPDRPMKSLGIFASKVIKPGEEITFDYGTSFR--NDQPCQCGEAACRGWIGK 237          
BLAST of NSD-1 vs. Ensembl Celegans
Match: set-2 (Histone-lysine N-methyltransferase set-2 [Source:UniProtKB/Swiss-Prot;Acc:Q18221])

HSP 1 Score: 83.1889 bits (204), Expect = 4.795e-16
Identity = 55/163 (33.74%), Postives = 84/163 (51.53%), Query Frame = 3
Query: 1962 ICNLGDKCKNQNFVK---RIYPKQYTFWANDR--GWGLKADEFIKTKQFVNEYIGEIITMEESEKRILWANENNITDFYFMELDNGRLIDARQFSNLSRFINNSCDPNLVAEKWIVNREHRIGLFALRDIQKGEELTFQYNLQNKSSNRIVCKCFSVNCSGFL 2435
            + +LGD   N +F K     + K+   +A  R  GWGL A E I   + + EYIG+ I    +E+R        I   Y   +D   +IDA +  N +RFIN+SC PN  A+   +  E RI +++   I+KGEE+T+ Y    +  ++I C C +  C G+L
Sbjct:  579 LTSLGDA--NNDFFKINQLKFRKKMIKFARSRIHGWGLYAMESIAPDEMIVEYIGQTIRSLVAEEREKAYERRGIGSSYLFRIDLHHVIDATKRGNFARFINHSCQPNCYAKVLTIEGEKRIVIYSRTIIKKGEEITYDYKFPIE-DDKIDCLCGAKTCRGYL 738          
BLAST of NSD-1 vs. Ensembl Fly
Match: NSD (gene:FBgn0039559 transcript:FBtr0085267)

HSP 1 Score: 296.975 bits (759), Expect = 1.121e-83
Identity = 181/530 (34.15%), Postives = 262/530 (49.43%), Query Frame = 3
Query:  885 EQGFMRCIIKTCTKWFHTNCLETGPMLEMTKFPKPGQLVCPCHICHKCELVNPSPKYR---CTKLIVCIMCPATFHTGDWCIPAGSVELNTGEIICPRHLVDLNFSMNIMVPPFVARVKSDLQERIYGNTLTKISEPMTITPSTVTKPTNVNWCFKCGEGGELLCCETCPAAYHFKCTDLK-EIPQKFYCPDCASFCYRSYGEIVWIKCGTHPWWPGQILHLENVPKNIAAKKHANGQFVVQFFGSRDYMWRDHGNVFLYEKEDECNSKTSKYRYNNIFLEGIKEAA----IGYVTREEKWQSGSCDHVMNSKIYNKIQVNKCPLELR-RKVVPETPHCNCISFDPKSDCSIGSGCFNVASKCECDPQICNLGDKCKNQNFVKRIYPKQYTFWANDRGWGLKADEFIKTKQFVNEYIGEIITMEESEKRILWANENNITDFYFMELDNGRLIDARQFSNLSRFINNSCDPNLVAEKWIVNREHRIGLFALRDIQKGEELTFQY---NLQNKSSNRIVCKCFSVNCSGFLG 2438
            E   + C    C K FHT+C +  P    +K        CP H+CH C   +PS K++    +KL  C+ CPAT+H    CIPAG+  LNT  IICPRH +                 K+D                            NV WC+ C +GGEL+CCETCP A H  C ++  +  + + C +C S     YGEIVW K     WWP  IL    VP NI  K H    FVV+FFG+ D+ W     V+LY + D  +   +K +    +  G++EA+    I    R+E+       + ++   Y KI+ NK    LR  + + +   CNC+  D +  C   +GC N     EC+P+ C  G  C+N+ F +R  P+    + N+RG+GL   E I    FV EY+GE+I   E ++R+     +   ++YF+ ++   +IDA    NL+RF+N+SC+PN   +KW VN  HR+G+FA++DI    ELTF Y   +L N S  +  C C +  CSG +G
Sbjct:  894 EDKLLTCSQPMCGKRFHTSCCKYWPQASSSKH----SARCPRHVCHTCVSDDPSGKFQQLGSSKLAKCVRCPATYHQLSKCIPAGTQMLNTTNIICPRHNI----------------AKADAH-------------------------VNVLWCYICVKGGELVCCETCPIAVHAHCRNIPIKTNESYICEECESGRLPLYGEIVWAKFNNFRWWPAIILPPTEVPSNILKKAHGENDFVVRFFGTHDHGWISRRRVYLYIEGDTGDGHKTKSQLFRNYTTGVEEASRFLPIIKARRQEQDMERQSGNKLHPPPYVKIKTNKAVPPLRFSQNLEDLSTCNCLPVD-EHPCGPEAGCLNRMLFNECNPEYCKAGSLCENRMFEQRKSPRLEVVYMNERGFGLVNREPIAVGDFVIEYVGEVINHAEFQRRMEQKQRDRDENYYFLGVEKDFIIDAGPKGNLARFMNHSCEPNCETQKWTVNCIHRVGIFAIKDIPVNSELTFNYLWDDLMNNS--KKACFCGAKRCSGEIG 1375          
BLAST of NSD-1 vs. Ensembl Fly
Match: NSD (gene:FBgn0039559 transcript:FBtr0335014)

HSP 1 Score: 296.975 bits (759), Expect = 1.167e-83
Identity = 181/530 (34.15%), Postives = 262/530 (49.43%), Query Frame = 3
Query:  885 EQGFMRCIIKTCTKWFHTNCLETGPMLEMTKFPKPGQLVCPCHICHKCELVNPSPKYR---CTKLIVCIMCPATFHTGDWCIPAGSVELNTGEIICPRHLVDLNFSMNIMVPPFVARVKSDLQERIYGNTLTKISEPMTITPSTVTKPTNVNWCFKCGEGGELLCCETCPAAYHFKCTDLK-EIPQKFYCPDCASFCYRSYGEIVWIKCGTHPWWPGQILHLENVPKNIAAKKHANGQFVVQFFGSRDYMWRDHGNVFLYEKEDECNSKTSKYRYNNIFLEGIKEAA----IGYVTREEKWQSGSCDHVMNSKIYNKIQVNKCPLELR-RKVVPETPHCNCISFDPKSDCSIGSGCFNVASKCECDPQICNLGDKCKNQNFVKRIYPKQYTFWANDRGWGLKADEFIKTKQFVNEYIGEIITMEESEKRILWANENNITDFYFMELDNGRLIDARQFSNLSRFINNSCDPNLVAEKWIVNREHRIGLFALRDIQKGEELTFQY---NLQNKSSNRIVCKCFSVNCSGFLG 2438
            E   + C    C K FHT+C +  P    +K        CP H+CH C   +PS K++    +KL  C+ CPAT+H    CIPAG+  LNT  IICPRH +                 K+D                            NV WC+ C +GGEL+CCETCP A H  C ++  +  + + C +C S     YGEIVW K     WWP  IL    VP NI  K H    FVV+FFG+ D+ W     V+LY + D  +   +K +    +  G++EA+    I    R+E+       + ++   Y KI+ NK    LR  + + +   CNC+  D +  C   +GC N     EC+P+ C  G  C+N+ F +R  P+    + N+RG+GL   E I    FV EY+GE+I   E ++R+     +   ++YF+ ++   +IDA    NL+RF+N+SC+PN   +KW VN  HR+G+FA++DI    ELTF Y   +L N S  +  C C +  CSG +G
Sbjct:  890 EDKLLTCSQPMCGKRFHTSCCKYWPQASSSKH----SARCPRHVCHTCVSDDPSGKFQQLGSSKLAKCVRCPATYHQLSKCIPAGTQMLNTTNIICPRHNI----------------AKADAH-------------------------VNVLWCYICVKGGELVCCETCPIAVHAHCRNIPIKTNESYICEECESGRLPLYGEIVWAKFNNFRWWPAIILPPTEVPSNILKKAHGENDFVVRFFGTHDHGWISRRRVYLYIEGDTGDGHKTKSQLFRNYTTGVEEASRFLPIIKARRQEQDMERQSGNKLHPPPYVKIKTNKAVPPLRFSQNLEDLSTCNCLPVD-EHPCGPEAGCLNRMLFNECNPEYCKAGSLCENRMFEQRKSPRLEVVYMNERGFGLVNREPIAVGDFVIEYVGEVINHAEFQRRMEQKQRDRDENYYFLGVEKDFIIDAGPKGNLARFMNHSCEPNCETQKWTVNCIHRVGIFAIKDIPVNSELTFNYLWDDLMNNS--KKACFCGAKRCSGEIG 1371          
BLAST of NSD-1 vs. Ensembl Fly
Match: Set2 (gene:FBgn0030486 transcript:FBtr0301559)

HSP 1 Score: 139.428 bits (350), Expect = 6.365e-33
Identity = 74/206 (35.92%), Postives = 108/206 (52.43%), Query Frame = 3
Query: 1845 RKVVPETPHCNCISF-----DPKSDCSIGSGCFNVASKCECDPQICNLGDKCKNQNFVKRIYPKQYTFWANDRGWGLKADEFIKTKQFVNEYIGEIITMEESEKRILWANENNITDFYFMELDNGRLIDARQFSNLSRFINNSCDPNLVAEKWIVNREHRIGLFALRDIQKGEELTFQYNLQNKSSNRIVCKCFSVNCSGFLGEAP 2447
            R+V  E     C  F     + +   S G+GC N     EC P +C+ G +C N+ F +        F    +G G+ A+  I   +F+ EY+GE+I  EE E+R    +++    +YFM L    +IDA    N+SR+IN+SCDPN   +KW VN E RIG F+++ IQ GEE+TF Y       +   C C + NC G++G  P
Sbjct: 1301 RQVSQENAEMQCDCFLTGDEEAQGHLSCGAGCINRMLMIECGP-LCSNGARCTNKRFQQHQCWPCRVFRTEKKGCGITAELLIPPGEFIMEYVGEVIDSEEFERRQHLYSKDRNRHYYFMALRGEAVIDATSKGNISRYINHSCDPNAETQKWTVNGELRIGFFSVKPIQPGEEITFDYQYLRYGRDAQRCYCEAANCRGWIGGEP 1505          
BLAST of NSD-1 vs. Ensembl Fly
Match: Set2 (gene:FBgn0030486 transcript:FBtr0073779)

HSP 1 Score: 139.428 bits (350), Expect = 6.577e-33
Identity = 74/206 (35.92%), Postives = 108/206 (52.43%), Query Frame = 3
Query: 1845 RKVVPETPHCNCISF-----DPKSDCSIGSGCFNVASKCECDPQICNLGDKCKNQNFVKRIYPKQYTFWANDRGWGLKADEFIKTKQFVNEYIGEIITMEESEKRILWANENNITDFYFMELDNGRLIDARQFSNLSRFINNSCDPNLVAEKWIVNREHRIGLFALRDIQKGEELTFQYNLQNKSSNRIVCKCFSVNCSGFLGEAP 2447
            R+V  E     C  F     + +   S G+GC N     EC P +C+ G +C N+ F +        F    +G G+ A+  I   +F+ EY+GE+I  EE E+R    +++    +YFM L    +IDA    N+SR+IN+SCDPN   +KW VN E RIG F+++ IQ GEE+TF Y       +   C C + NC G++G  P
Sbjct: 1350 RQVSQENAEMQCDCFLTGDEEAQGHLSCGAGCINRMLMIECGP-LCSNGARCTNKRFQQHQCWPCRVFRTEKKGCGITAELLIPPGEFIMEYVGEVIDSEEFERRQHLYSKDRNRHYYFMALRGEAVIDATSKGNISRYINHSCDPNAETQKWTVNGELRIGFFSVKPIQPGEEITFDYQYLRYGRDAQRCYCEAANCRGWIGGEP 1554          
BLAST of NSD-1 vs. Ensembl Fly
Match: ash1 (gene:FBgn0005386 transcript:FBtr0306009)

HSP 1 Score: 128.642 bits (322), Expect = 1.392e-29
Identity = 79/223 (35.43%), Postives = 120/223 (53.81%), Query Frame = 3
Query: 1782 HVMNSKIYNKIQVNKCPLELRRKVVP-ETPHCNCISFDPKSDCSIGSGCFNVASKCECDPQICNLGDKCKNQNFVKR-IYPKQYTFWANDRGWGLKADEFIKTKQFVNEYIGEIITMEESEKRILWANENNITDFYFMELDNGRLIDARQFSNLSRFINNSCDPNLVAEKWIVNREHRIGLFALRDIQKGEELTFQYN--LQNKSSNRIVCKCFSVNCSGFLG 2438
            +V+ S  Y KI+ N     +R  +   + P CNC +   KS C     C N     EC P  C  G+KC+NQ   +  + P    F   D+GWG++    I    ++ EY+GE++T +E ++R+     N+ T  Y + LD G +ID ++  +  RF+N+SC+PN   +KW VN   R+ LFA R I++GEELT+ YN  L N S  +  C+C +  C G +G
Sbjct: 1313 NVVPSWNYRKIRTNVYAESVRPNLAGFDHPTCNCKNQGEKS-CL--DNCLNRMVYTECSPSNCPAGEKCRNQKIQRHAVAPGVERFMTADKGWGVRTKLPIAKGTYILEYVGEVVTEKEFKQRMASIYLND-THHYCLHLDGGLVIDGQRMGSDCRFVNHSCEPNCEMQKWSVNGLSRMVLFAKRAIEEGEELTYDYNFSLFNPSEGQ-PCRCNTPQCRGVIG 1530          
BLAST of NSD-1 vs. Ensembl Zebrafish
Match: nsd1b (nuclear receptor binding SET domain protein 1b [Source:ZFIN;Acc:ZDB-GENE-080519-2])

HSP 1 Score: 387.497 bits (994), Expect = 6.227e-115
Identity = 238/700 (34.00%), Postives = 346/700 (49.43%), Query Frame = 3
Query:  693 CRYCLETKNIVQCNKCLFNNFHVKCLEFLQNSIETKINDLDRCLECSLGIIRCYACYKIVDISNEQGFMRCIIKTCTKWFHTNCLET-GPMLEMTKFPKPGQLVCPCHICHKCELVNPS-PKYRCTKLIVCIMCPATFHTGDWCIPAGSVELNTGEIICPRHLVDLNFSMNIMVPPFVARVKSDLQERIYGNTLTKISEPMTITPSTVTKPTNVNWCFKCGEGGELLCCETCPAAYHFKCTDLKEIPQKFYCPDCASFCYRSYGEIVWIKCGTHPWWPGQILHLENVPKNIAAKKHANGQFVVQFFGSRDYMWRDHGNVFLYEKEDECNSKTSKYRYNNIFLEGIKEAAIGY--VTREEKWQSGSCDHVMNSKI--YNKIQVNK--CPLELRRKVVPETPHCNCISFDPKSDCSIGSGCFNVASKCECDPQICNLGDKCKNQNFVKRIYPKQYTFWANDRGWGLKADEFIKTKQFVNEYIGEIITMEESEKRILWANENNITDFYFMELDNGRLIDARQFSNLSRFINNSCDPNLVAEKWIVNREHRIGLFALRDIQKGEELTFQYNLQNKSSNRIVCKCFSVNCSGFLGEAPKMAXXXXXXXXXXXXXXXXXXXXXXXCKSFLTDKNSNSQCFRCGEIIDMLSSIVCSVGPCMKTYHSVCLNLNMANYVQSSWICPHHYCDVCARPSHHFSSNTTESYC 2768
            C  C +  +++ C       FH +C    +      +     C EC+ G+  C+AC ++      +   RC++  C K++H  C  +  P + + +        CP H C  C ++NP+ P     +L  CI CP  +H+ D+CIPAGSV L    I+CP H              F  R      E +                       NV+WCF C EGG LLCCE+CPAA+H +C ++      +YC DC +     Y E+VW+K G + WWP ++ + +++P+NI   KH  G+F V FFGS DY+W     VF Y + D  + +      ++ + + + EAA+ +  +  E++ +    D   + K   Y +I+VNK    + +    + E P CNC + D ++ C + S C N     EC PQ+C  G++C+NQ F+KR Y +  TF    RGWGL+    IK   F++EY+GE+I  EE   RI  A ENNI +FY + LD  R+IDA    N +RF+N+ C PN   +KW VN + R+GLF+L DI  G ELTF YNL+   + + VCKC + NCSGFLG  PK    S  K    KK +    E           K    +CF CG+   ++S   C    C K YH+ CLNL         W CP H CD+C + +  F      SYC
Sbjct:  724 CPMCEKQGDLLLCEGQCCGAFHPQCTGLNEPPTGKFL-----CQECTSGVHSCFACKRL-----GEDVRRCMVPGCGKFYHGECAASHAPTVPLNR-----AFRCPLHACLSCFILNPANPSVAKGQLTRCIRCPVAYHSSDFCIPAGSVTLTDSNIVCPNH--------------FTPRKGCRNHEHV-----------------------NVSWCFVCSEGGSLLCCESCPAAFHRECLNIDMPEGSWYCNDCRAGKKPHYKEVVWVKVGRYRWWPAEVSNPKDIPENILRMKHDVGEFPVLFFGSNDYLWTYQARVFPYMEGDANSKEKMGKGVDSTYKKALDEAALRFKELQAEKELRQLQEDRRNDKKPPPYKQIKVNKPFGKVLIISADLSEIPRCNCKATD-ENPCGMDSECINRMLLYECHPQVCPAGERCQNQCFIKRQYCQVETFRTLSRGWGLRCVHDIKKGGFISEYVGEVIDEEECRARIKHAQENNIGNFYMLTLDKDRIIDAGPKGNEARFMNHCCQPNCETQKWTVNGDTRVGLFSLTDIPAGTELTFNYNLECLGNGKTVCKCGASNCSGFLGVRPKNNPPSDDKGRKLKKKRKSQQEVI---------KEREDECFSCGDGGQIVS---CKRPGCPKVYHADCLNL--TKRPAGRWECPWHQCDLCGQEAASFCEMCPSSYC 1356          
BLAST of NSD-1 vs. Ensembl Zebrafish
Match: nsd1a (nuclear receptor binding SET domain protein 1a [Source:ZFIN;Acc:ZDB-GENE-080519-3])

HSP 1 Score: 389.037 bits (998), Expect = 4.521e-114
Identity = 244/715 (34.13%), Postives = 358/715 (50.07%), Query Frame = 3
Query:  693 CRYCLETKNIVQCNKCLFNNFHVKCLEFLQNSIETKINDLDRCLECSLGIIRCYACYKIVDISNEQGFMRCIIKTCTKWFHTNC-LETGPMLEMTKFPKPGQLVCPCHICHKCELVNPS-PKYRCTKLIVCIMCPATFHTGDWCIPAGSVELNTGEIICPRHLVDLNFSMNIMVPPFVARVKSDLQERIYGNTLTKISEPMTITPSTVTKPTNVNWCFKCGEGGELLCCETCPAAYHFKCTDLKEIPQ-KFYCPDCASFCYRSYGEIVWIKCGTHPWWPGQILHLENVPKNIAAKKHANGQFVVQFFGSRDYMWRDHGNVFLYEKEDECNSKTSKYRYNNIFLEGIKEAAIGY--VTREEKWQSGSCDHVMNSKI--YNKIQVNK--CPLELRRKVVPETPHCNCISFDPKSDCSIGSGCFNVASKCECDPQICNLGDKCKNQNFVKRIYPKQYTFWANDRGWGLKADEFIKTKQFVNEYIGEIITMEESEKRILWANENNITDFYFMELDNGRLIDARQFSNLSRFINNSCDPNLVAEKWIVNREHRIGLFALRDIQKGEELTFQYNLQNKSSNRIVCKCFSVNCSGFLGEAPKMAXXXXXXXXXXXXXXXXXXXXXXXCKSFLTDKNSNSQCFRCGEIIDMLSSIVCSVGPCMKTYHSVCLNLNMANYVQSSWICPHHYCDVCARPSHHFSSNTTESYCNKD-----FIKKFN 2795
            C+ C +T  ++ C       FH++C+   +      I     C EC +G+  C+ C K      ++   RC+I  C K++H +C L+  P +   +        C  H+C  C + NP+ P     +L  C+ CP  +H  D+C+ AGSV L     +CP H              F  R      E I                       NV+WCF C EGG LLCCE+CPAA+H +C ++ E+PQ  ++C DC +     Y +I+W+K G + WWP ++   ++VP+NI+  KH  G+F V FFGS+DY+W      F Y + D  N +      + ++ + + EAA  +  + +E++ +    D   + K   Y  I+VNK    + +    + E P CNC + D ++ C I S C N     EC  Q+C  G++C+NQ+F KR Y +   F    RGWGL++   IK   FVNEY+GE+I  EE   RI  A +N+I +FY + LD  R+IDA    N SRF+N+SC PN   +KW VN + R+GLFAL DI KG ELTF YNL+   + + VCKC + NCSGFLG  PK    ++  SD   +        +   +S +T K    +CF CG+   ++S   C    C K YH+ CLNL  +      W CP H C+ C R +  +      SYC +      FI K +
Sbjct: 1245 CQVCEKTGELLLCEGQCCGAFHLQCIGLTETPKGRFI-----CQECKMGVHTCFVCKKP-----DKEVRRCMIPVCGKFYHMDCILKYSPTVAQNRG-----FRCSIHVCLSCYITNPNNPGISKGRLTRCVRCPVAYHANDYCMAAGSVPLANNSFLCPNH--------------FTPRKGCKNHEHI-----------------------NVSWCFVCSEGGSLLCCESCPAAFHRECLNI-EMPQGSWFCNDCRAGKKPHYKDILWVKVGRYRWWPAEVTQPKSVPENISRMKHEVGEFPVHFFGSKDYVWTYQARCFPYMEGDANNKEKMGKGADAVYKKALNEAADRFRELLKEKEMRQLQEDRKNDKKPPPYKHIKVNKQIGKVLIITADLSEIPRCNCKATD-ENPCGIDSECINRMLLYECHSQVCPAGERCQNQSFTKRQYTEVEIFRTLSRGWGLRSISDIKKGAFVNEYVGEVIDEEECRSRIKNAQDNDICNFYMLTLDKDRIIDAGPKGNESRFMNHSCQPNCETQKWTVNGDTRVGLFALEDIPKGVELTFNYNLECLGNGKTVCKCGAPNCSGFLGVRPK----NQPPSDDKTRKLRRKVSGKRKSQSEVT-KEREDECFYCGDGGQIVS---CKKPGCPKVYHADCLNL--SKRPAGRWECPWHQCNECGREAASYCEMCPNSYCEQHREGMLFISKLD 1895          
BLAST of NSD-1 vs. Ensembl Zebrafish
Match: nsd1a (nuclear receptor binding SET domain protein 1a [Source:ZFIN;Acc:ZDB-GENE-080519-3])

HSP 1 Score: 388.652 bits (997), Expect = 5.643e-114
Identity = 244/715 (34.13%), Postives = 358/715 (50.07%), Query Frame = 3
Query:  693 CRYCLETKNIVQCNKCLFNNFHVKCLEFLQNSIETKINDLDRCLECSLGIIRCYACYKIVDISNEQGFMRCIIKTCTKWFHTNC-LETGPMLEMTKFPKPGQLVCPCHICHKCELVNPS-PKYRCTKLIVCIMCPATFHTGDWCIPAGSVELNTGEIICPRHLVDLNFSMNIMVPPFVARVKSDLQERIYGNTLTKISEPMTITPSTVTKPTNVNWCFKCGEGGELLCCETCPAAYHFKCTDLKEIPQ-KFYCPDCASFCYRSYGEIVWIKCGTHPWWPGQILHLENVPKNIAAKKHANGQFVVQFFGSRDYMWRDHGNVFLYEKEDECNSKTSKYRYNNIFLEGIKEAAIGY--VTREEKWQSGSCDHVMNSKI--YNKIQVNK--CPLELRRKVVPETPHCNCISFDPKSDCSIGSGCFNVASKCECDPQICNLGDKCKNQNFVKRIYPKQYTFWANDRGWGLKADEFIKTKQFVNEYIGEIITMEESEKRILWANENNITDFYFMELDNGRLIDARQFSNLSRFINNSCDPNLVAEKWIVNREHRIGLFALRDIQKGEELTFQYNLQNKSSNRIVCKCFSVNCSGFLGEAPKMAXXXXXXXXXXXXXXXXXXXXXXXCKSFLTDKNSNSQCFRCGEIIDMLSSIVCSVGPCMKTYHSVCLNLNMANYVQSSWICPHHYCDVCARPSHHFSSNTTESYCNKD-----FIKKFN 2795
            C+ C +T  ++ C       FH++C+   +      I     C EC +G+  C+ C K      ++   RC+I  C K++H +C L+  P +   +        C  H+C  C + NP+ P     +L  C+ CP  +H  D+C+ AGSV L     +CP H              F  R      E I                       NV+WCF C EGG LLCCE+CPAA+H +C ++ E+PQ  ++C DC +     Y +I+W+K G + WWP ++   ++VP+NI+  KH  G+F V FFGS+DY+W      F Y + D  N +      + ++ + + EAA  +  + +E++ +    D   + K   Y  I+VNK    + +    + E P CNC + D ++ C I S C N     EC  Q+C  G++C+NQ+F KR Y +   F    RGWGL++   IK   FVNEY+GE+I  EE   RI  A +N+I +FY + LD  R+IDA    N SRF+N+SC PN   +KW VN + R+GLFAL DI KG ELTF YNL+   + + VCKC + NCSGFLG  PK    ++  SD   +        +   +S +T K    +CF CG+   ++S   C    C K YH+ CLNL  +      W CP H C+ C R +  +      SYC +      FI K +
Sbjct: 1229 CQVCEKTGELLLCEGQCCGAFHLQCIGLTETPKGRFI-----CQECKMGVHTCFVCKKP-----DKEVRRCMIPVCGKFYHMDCILKYSPTVAQNRG-----FRCSIHVCLSCYITNPNNPGISKGRLTRCVRCPVAYHANDYCMAAGSVPLANNSFLCPNH--------------FTPRKGCKNHEHI-----------------------NVSWCFVCSEGGSLLCCESCPAAFHRECLNI-EMPQGSWFCNDCRAGKKPHYKDILWVKVGRYRWWPAEVTQPKSVPENISRMKHEVGEFPVHFFGSKDYVWTYQARCFPYMEGDANNKEKMGKGADAVYKKALNEAADRFRELLKEKEMRQLQEDRKNDKKPPPYKHIKVNKQIGKVLIITADLSEIPRCNCKATD-ENPCGIDSECINRMLLYECHSQVCPAGERCQNQSFTKRQYTEVEIFRTLSRGWGLRSISDIKKGAFVNEYVGEVIDEEECRSRIKNAQDNDICNFYMLTLDKDRIIDAGPKGNESRFMNHSCQPNCETQKWTVNGDTRVGLFALEDIPKGVELTFNYNLECLGNGKTVCKCGAPNCSGFLGVRPK----NQPPSDDKTRKLRRKVSGKRKSQSEVT-KEREDECFYCGDGGQIVS---CKKPGCPKVYHADCLNL--SKRPAGRWECPWHQCNECGREAASYCEMCPNSYCEQHREGMLFISKLD 1879          
BLAST of NSD-1 vs. Ensembl Zebrafish
Match: nsd1b (nuclear receptor binding SET domain protein 1b [Source:ZFIN;Acc:ZDB-GENE-080519-2])

HSP 1 Score: 387.497 bits (994), Expect = 7.773e-114
Identity = 238/700 (34.00%), Postives = 346/700 (49.43%), Query Frame = 3
Query:  693 CRYCLETKNIVQCNKCLFNNFHVKCLEFLQNSIETKINDLDRCLECSLGIIRCYACYKIVDISNEQGFMRCIIKTCTKWFHTNCLET-GPMLEMTKFPKPGQLVCPCHICHKCELVNPS-PKYRCTKLIVCIMCPATFHTGDWCIPAGSVELNTGEIICPRHLVDLNFSMNIMVPPFVARVKSDLQERIYGNTLTKISEPMTITPSTVTKPTNVNWCFKCGEGGELLCCETCPAAYHFKCTDLKEIPQKFYCPDCASFCYRSYGEIVWIKCGTHPWWPGQILHLENVPKNIAAKKHANGQFVVQFFGSRDYMWRDHGNVFLYEKEDECNSKTSKYRYNNIFLEGIKEAAIGY--VTREEKWQSGSCDHVMNSKI--YNKIQVNK--CPLELRRKVVPETPHCNCISFDPKSDCSIGSGCFNVASKCECDPQICNLGDKCKNQNFVKRIYPKQYTFWANDRGWGLKADEFIKTKQFVNEYIGEIITMEESEKRILWANENNITDFYFMELDNGRLIDARQFSNLSRFINNSCDPNLVAEKWIVNREHRIGLFALRDIQKGEELTFQYNLQNKSSNRIVCKCFSVNCSGFLGEAPKMAXXXXXXXXXXXXXXXXXXXXXXXCKSFLTDKNSNSQCFRCGEIIDMLSSIVCSVGPCMKTYHSVCLNLNMANYVQSSWICPHHYCDVCARPSHHFSSNTTESYC 2768
            C  C +  +++ C       FH +C    +      +     C EC+ G+  C+AC ++      +   RC++  C K++H  C  +  P + + +        CP H C  C ++NP+ P     +L  CI CP  +H+ D+CIPAGSV L    I+CP H              F  R      E +                       NV+WCF C EGG LLCCE+CPAA+H +C ++      +YC DC +     Y E+VW+K G + WWP ++ + +++P+NI   KH  G+F V FFGS DY+W     VF Y + D  + +      ++ + + + EAA+ +  +  E++ +    D   + K   Y +I+VNK    + +    + E P CNC + D ++ C + S C N     EC PQ+C  G++C+NQ F+KR Y +  TF    RGWGL+    IK   F++EY+GE+I  EE   RI  A ENNI +FY + LD  R+IDA    N +RF+N+ C PN   +KW VN + R+GLF+L DI  G ELTF YNL+   + + VCKC + NCSGFLG  PK    S  K    KK +    E           K    +CF CG+   ++S   C    C K YH+ CLNL         W CP H CD+C + +  F      SYC
Sbjct: 1099 CPMCEKQGDLLLCEGQCCGAFHPQCTGLNEPPTGKFL-----CQECTSGVHSCFACKRL-----GEDVRRCMVPGCGKFYHGECAASHAPTVPLNR-----AFRCPLHACLSCFILNPANPSVAKGQLTRCIRCPVAYHSSDFCIPAGSVTLTDSNIVCPNH--------------FTPRKGCRNHEHV-----------------------NVSWCFVCSEGGSLLCCESCPAAFHRECLNIDMPEGSWYCNDCRAGKKPHYKEVVWVKVGRYRWWPAEVSNPKDIPENILRMKHDVGEFPVLFFGSNDYLWTYQARVFPYMEGDANSKEKMGKGVDSTYKKALDEAALRFKELQAEKELRQLQEDRRNDKKPPPYKQIKVNKPFGKVLIISADLSEIPRCNCKATD-ENPCGMDSECINRMLLYECHPQVCPAGERCQNQCFIKRQYCQVETFRTLSRGWGLRCVHDIKKGGFISEYVGEVIDEEECRARIKHAQENNIGNFYMLTLDKDRIIDAGPKGNEARFMNHCCQPNCETQKWTVNGDTRVGLFSLTDIPAGTELTFNYNLECLGNGKTVCKCGASNCSGFLGVRPKNNPPSDDKGRKLKKKRKSQQEVI---------KEREDECFSCGDGGQIVS---CKRPGCPKVYHADCLNL--TKRPAGRWECPWHQCDLCGQEAASFCEMCPSSYC 1731          
BLAST of NSD-1 vs. Ensembl Zebrafish
Match: nsd2 (nuclear receptor binding SET domain protein 2 [Source:ZFIN;Acc:ZDB-GENE-030131-2581])

HSP 1 Score: 376.326 bits (965), Expect = 3.898e-111
Identity = 237/698 (33.95%), Postives = 339/698 (48.57%), Query Frame = 3
Query:  693 CRYCLET-KNIVQCNKCLFNNFHVKCLEFLQNSIETKINDLDRCLECSLGIIRCYACYKIVDISNEQGFMRCIIKTCTKWFHTNCLETGPMLEMTKFPKPGQLVCPCHICHKCELVNPSP-KYRCTKLIVCIMCPATFHTGDWCIPAGSVELNTGEIICPRHLVDLNFSMNIMVPPFVARVKSDLQERIYGNTLTKISEPMTITPSTVTKPTNVNWCFKCGEGGELLCCETCPAAYHFKCTDLKEIPQKFYCPDCASFCYRSYGEIVWIKCGTHPWWPGQILHLENVPKNIAAKKHANGQFVVQFFGSRDYMWRDHGNVFLYEKEDECNSKTSKYRYNNIFLEGIKEAAIGYVTREEKWQSGSCDHVMNSKI--YNKIQVNK--CPLELRRKVVPETPHCNCISFDPKSDCSIGSGCFNVASKCECDPQICNLGDKCKNQNFVKRIYPKQYTFWANDRGWGLKADEFIKTKQFVNEYIGEIITMEESEKRILWANENNITDFYFMELDNGRLIDARQFSNLSRFINNSCDPNLVAEKWIVNREHRIGLFALRDIQKGEELTFQYNLQNKSSNRIVCKCFSVNCSGFLGEAPKMAXXXXXXXXXXXXXXXXXXXXXXXCKSFLTDKNSNSQCFRCGEIIDMLSSIVCSVGPCMKTYHSVCLNLNMANYVQSSWICPHHYCDVCARPSHHFSSNTTESYC 2768
            C  C +T ++IV C    +  +H+ C+  ++ S E  +     C  CS G+  C+ C K     +E    RC    C +++H  C+    +  +T F   G   CP H C  C     +  K    K++ C+ CP  +H GD C+ AGS  +++  I+C  H                 R K       +                      NV+WCF C +GG LLCCE+CPAA+H  C ++      ++C DC S     Y +++W+K G + WWP +I H +N+P NI   +H  G+F V FFGS+DY W   G VF Y + D   SK  +     +F   + +A   +   E + ++    H  N K   +  I+VNK    +++    + E P CNC     +  CS  S C N     EC PQ+C  G++C+NQ+F KR+YP+        +GWGL +   IK  +FVNEY+GE+I  EE   RI  A EN+IT FY + +D  R+IDA    N SRF+N+SC PN   +KW VN + R+GLFA+ DI  G ELTF YNL    + + VC+C + NCSGFLG+ PK    S+ K+   KK                  K S  +CFRCG   D    ++C    C K YH  CL+     +    W CP H+CDVC + S  F      S+C
Sbjct:  762 CLVCEQTGEDIVTCAGQCYGTYHLHCI-GVERSAEKIL-----CTACSTGVHVCFTCKK-----SEGEVRRCCALHCGRFYHEACVR---LSALTVFENRG-FRCPLHTCLSCHYSGRAACKATKGKMMRCLRCPVAYHVGDLCVAAGSEMISSSAIVCTNHF----------------RAKKGYSHHSH---------------------VNVSWCFICSKGGRLLCCESCPAAFHPDCLNIAMPDGSWFCNDCRSGKKPKYRDVIWVKLGNYRWWPAEIRHPKNIPTNIQHLRHEIGEFPVFFFGSKDYFWTHQGRVFPYMEGDR-GSKYQQTGIGKVFKNALLDAETRFKEIEMEREAKEA-HENNKKPPPFKYIKVNKPCGRVQVYTADISEIPKCNCKPSTERP-CSFESECLNRMLLYECHPQVCPAGERCQNQDFTKRLYPETKIIRTAGKGWGLISLRDIKKGEFVNEYVGELIDEEECRSRIRHAQENDITHFYMLTIDKDRIIDAGPKGNYSRFMNHSCQPNCETQKWTVNGDTRVGLFAVCDIPAGTELTFNYNLDCLGNEKTVCRCGAPNCSGFLGDRPKNGHTSEPKAKLQKKKPKRKRARNE-------GKKSEDECFRCG---DGGQLVLCDKKGCTKAYHLSCLDRTKRPF--GRWDCPWHHCDVCGKNSAAFCQLCPNSFC 1392          
BLAST of NSD-1 vs. Ensembl Xenopus
Match: NSD2 (nuclear receptor binding SET domain protein 2 [Source:NCBI gene;Acc:100125213])

HSP 1 Score: 391.734 bits (1005), Expect = 2.386e-117
Identity = 241/707 (34.09%), Postives = 337/707 (47.67%), Query Frame = 3
Query:  693 CRYCLETKNIVQCNKCLFNNFHVKCLEFLQNSIETKINDLDRCLECSLGIIRCYACYKIVDISNEQGFMRCIIKTCTKWFHTNCLETGPMLEMTKFPKPGQLVCPCHICHKCELVNPS-PKYRCTKLIVCIMCPATFHTGDWCIPAGSVELNTGEIICPRHLVDLNFSMNIMVPPFVARVKSDLQERIYGNTLTKISEPMTITPSTVTKPTNVNWCFKCGEGGELLCCETCPAAYHFKCTDLKEIPQKFYCPDCASFCYRSYGEIVWIKCGTHPWWPGQILHLENVPKNIAAKKHANGQFVVQFFGSRDYMWRDHGNVFLYEKEDECNSKTSKYRYNNIFLEGIKEAAIGY----------VTREEKWQSGSCDHVMNSKIYNKIQVNKCPLELRRKVVPETPHCNCISFDPKSDCSIGSGCFNVASKCECDPQICNLGDKCKNQNFVKRIYPKQYTFWANDRGWGLKADEFIKTKQFVNEYIGEIITMEESEKRILWANENNITDFYFMELDNGRLIDARQFSNLSRFINNSCDPNLVAEKWIVNREHRIGLFALRDIQKGEELTFQYNLQNKSSNRIVCKCFSVNCSGFLGEAPKMAXXXXXXXXXXXXXXXXXXXXXXXCKSFLTDKNSNSQCFRCGEIIDMLSSIVCSVGPCMKTYHSVCLNLNMANYVQSSWICPHHYCDVCARPSHHFSSNTTESYCNKDF 2780
            C+ C +  +++ C     + FH+ C+      + T+      C EC+ G   C+ C +     + +   RCI+  C K++H +CL   P+     F   G   CP H C  C   NPS P+    K++ C+ CP  +H  + CI AG   L +  IIC  H              F A         I                       NV+WCF C  GG LLCCE+CPAA+H  C +++     ++C DC       + +I+W+K G + WWP ++ H +NVP NI   KHA G+F V FFGS+DY W     VF Y + D  +          +F   ++EA   +          VT+E + +     H+  +K Y K+QV    +        E P CNC     K  C   S C N     EC PQ+C  GD+C+NQ F KR YP+        +GWGL A   IK  +FVNEYIGE+I  EE   RI  A EN+IT FY + +D  R+IDA    N SRF+N+SC PN   +KW VN + R+GLFA+RDI  GEELTF YNL    + + +C+C + NCSGFLG+ PK++   + K    KK +                K S   CFRC +  ++   ++C    C K YH  CL+L    +    W CP H+CDVC + S    S    S+C   +
Sbjct:  620 CQVCEKVGDLMLCEGVCCSAFHLSCI-----GLSTRPAGKYLCKECTSGARSCFLCKE-----SNRDVKRCIVPHCGKFYHESCLRKYPL---AVFESRG-FRCPLHRCATCYFSNPSNPRASKGKMVRCVRCPLAYHGAESCIVAGCTALTSTSIICSSH--------------FAANKAKSHHAHI-----------------------NVSWCFVCSNGGSLLCCESCPAAFHPDCLNIEMPDGSWFCNDCRLGKKPRFNDIIWVKLGNYRWWPAEVCHPKNVPPNIQKMKHAIGEFPVFFFGSKDYYWTHQARVFPYMEGDRGSKHHGGKSIGKVFKNALQEAETRFCEIMRQREAKVTQENEKKPPPYKHIKVNKPYGKVQVYTADIS-------EIPKCNCKPSSEKP-CGFDSECLNRMLMYECHPQVCPAGDRCQNQCFNKRQYPETKIIKTEGKGWGLIATRDIKKGEFVNEYIGELIDEEECMYRIRHAQENDITHFYMLTIDKDRIIDAGPKGNFSRFMNHSCQPNCETQKWSVNGDTRVGLFAVRDIPAGEELTFNYNLDCLGNEKTICRCGAPNCSGFLGDRPKVSSSHEEKVKKPKKKQKKRRTKTD------GKKQSEDYCFRCNDGGEL---VLCDRKFCTKAYHLSCLSLTKRPF--GKWECPWHHCDVCGKASVSCCSLCPNSFCKGHY 1256          
BLAST of NSD-1 vs. Ensembl Xenopus
Match: NSD1 (nuclear receptor binding SET domain protein 1 [Source:NCBI gene;Acc:100145675])

HSP 1 Score: 392.889 bits (1008), Expect = 2.725e-117
Identity = 240/714 (33.61%), Postives = 342/714 (47.90%), Query Frame = 3
Query:  696 RYCLETKNIVQCNKCLFNNFHVKCLEFLQNSIETKINDLDRCLECSLGIIRCYACYKIVDISNEQGFMRCIIKTCTKWFHTNC-LETGPMLEMTKFPKPGQLVCPCHICHKCELVNPS-PKYRCTKLIVCIMCPATFHTGDWCIPAGSVELNTGEIICPRHLVDLNFSMNIMVPPFVARVKSDLQERIYGNTLTKISEPMTITPSTVTKPTNVNWCFKCGEGGELLCCETCPAAYHFKCTDLKEIPQKFYCPDCASFCYRSYGEIVWIKCGTHPWWPGQILHLENVPKNIAAKKHANGQFVVQFFGSRDYMWRDHGNVFLYEKEDECNSKTSKYRYNNIFLEGIKEAAIGY----VTREEKWQSGSCDHVMNSKIYNKIQVNK--CPLELRRKVVPETPHCNCISFDPKSDCSIGSGCFNVASKCECDPQICNLGDKCKNQNFVKRIYPKQYTFWANDRGWGLKADEFIKTKQFVNEYIGEIITMEESEKRILWANENNITDFYFMELDNGRLIDARQFSNLSRFINNSCDPNLVAEKWIVNREHRIGLFALRDIQKGEELTFQYNLQNKSSNRIVCKCFSVNCSGFLGEAPKMAXXXXXXXXXXXXXXXXXXXXXXXCKSFLTDKNSNSQCFRCGEIIDMLSSIVCSVGPCMKTYHSVCLNLNMANYVQSSWICPHHYCDVCARPSHHFSSNTTESYCNKD-----FIKKFNS 2798
            + C +   ++ C       FH++CL      +E        C ECS G   C+ C +     ++QG  RC++  C K++H  C L+  P  +  +        C  HIC  C   NPS P     +L+ C+ CP  +H  D+C+PAG+V L +  IICP H              F  R      E +                       NV+WCF C EGG LLCCE+CPAA+H +C ++      ++C DC +     Y E+VW+K G + WWP ++ H + +P NI   KH  G+F V FFGS+DY+W     VF Y + D  N        + ++ +G+ EAA  +      +E +       +      Y  I+VN+    +++    + E P CNC + D ++ C   S C N     EC P +C  G++C+NQ F KR YP+   F    RGWGL+    IK  +FVNEY+GE+I  EE   RI +A E +IT+FY + LD  R+IDA    N +RF+N+ C PN   +KW VN + R+GLFAL DI+ G ELTF YNL+   + + VCKC + NCSGFLG  PK   VS       +K            K     K    +CF CG+   ++S   C    C K YH+ CL L         W CP H CD+C + +         S+C +      FI K + 
Sbjct:  665 QVCEKPGELLLCEAQCCGAFHLQCL-----GMEAMPQGKFVCTECSSGYHTCFVCKE-----SDQGVKRCMLPLCGKYYHEECALKYPPATQQNR-----GFRCSLHICSTCYATNPSNPSASKGRLMRCVRCPIAYHANDFCLPAGAVTLASNSIICPNH--------------FTPRRGCKNHEHV-----------------------NVSWCFVCSEGGSLLCCESCPAAFHRECLNIDMPEGSWFCNDCKAGKKPHYKEVVWVKVGRYRWWPAEVCHPKTIPPNIQKMKHDIGEFPVVFFGSKDYLWTHQARVFPYMEGDALNKDKMSKGMDAVYKKGLMEAAERFEELKAQKEMRQLQEDKKNDKKPPPYKHIKVNRPVGKVQILTADLSEIPRCNCKATD-ENPCGQDSECINRMLLYECHPSVCPAGERCQNQAFSKRQYPEVEIFRTLSRGWGLRCRTDIKKGEFVNEYVGEMIDEEECRARIRYAQEQDITNFYMLTLDKDRVIDAGPKGNFARFMNHCCQPNCETQKWTVNGDTRVGLFALCDIKAGVELTFNYNLECLGNGKTVCKCGAPNCSGFLGVRPKNQPVSSEDKGKKRKQYVKR-------KKSEVVKEHEDECFSCGDGGQLVS---CKKPGCPKVYHAECLKL--TRRPAGKWECPWHQCDICHKEAASLCEMCPSSFCKQHREGMLFISKLDG 1313          
BLAST of NSD-1 vs. Ensembl Xenopus
Match: NSD1 (nuclear receptor binding SET domain protein 1 [Source:NCBI gene;Acc:100145675])

HSP 1 Score: 395.971 bits (1016), Expect = 2.808e-117
Identity = 241/714 (33.75%), Postives = 343/714 (48.04%), Query Frame = 3
Query:  693 CRYCLETKNIVQCNKCLFNNFHVKCLEFLQNSIETKINDLDRCLECSLGIIRCYACYKIVDISNEQGFMRCIIKTCTKWFHTNC-LETGPMLEMTKFPKPGQLVCPCHICHKCELVNPS-PKYRCTKLIVCIMCPATFHTGDWCIPAGSVELNTGEIICPRHLVDLNFSMNIMVPPFVARVKSDLQERIYGNTLTKISEPMTITPSTVTKPTNVNWCFKCGEGGELLCCETCPAAYHFKCTDLKEIPQKFYCPDCASFCYRSYGEIVWIKCGTHPWWPGQILHLENVPKNIAAKKHANGQFVVQFFGSRDYMWRDHGNVFLYEKEDECNSKTSKYRYNNIFLEGIKEAAIGY----VTREEKWQSGSCDHVMNSKIYNKIQVNK--CPLELRRKVVPETPHCNCISFDPKSDCSIGSGCFNVASKCECDPQICNLGDKCKNQNFVKRIYPKQYTFWANDRGWGLKADEFIKTKQFVNEYIGEIITMEESEKRILWANENNITDFYFMELDNGRLIDARQFSNLSRFINNSCDPNLVAEKWIVNREHRIGLFALRDIQKGEELTFQYNLQNKSSNRIVCKCFSVNCSGFLGEAPKMAXXXXXXXXXXXXXXXXXXXXXXXCKSFLTDKNSNSQCFRCGEIIDMLSSIVCSVGPCMKTYHSVCLNLNMANYVQSSWICPHHYCDVCARPSHHFSSNTTESYCNKD-----FIKKFN 2795
            C+ C +   ++ C       FH++CL      +E        C ECS G   C+ C +     ++QG  RC++  C K++H  C L+  P  +  +        C  HIC  C   NPS P     +L+ C+ CP  +H  D+C+PAG+V L +  IICP H              F  R      E +                       NV+WCF C EGG LLCCE+CPAA+H +C ++      ++C DC +     Y E+VW+K G + WWP ++ H + +P NI   KH  G+F V FFGS+DY+W     VF Y + D  N        + ++ +G+ EAA  +      +E +       +      Y  I+VN+    +++    + E P CNC + D ++ C   S C N     EC P +C  G++C+NQ F KR YP+   F    RGWGL+    IK  +FVNEY+GE+I  EE   RI +A E +IT+FY + LD  R+IDA    N +RF+N+ C PN   +KW VN + R+GLFAL DI+ G ELTF YNL+   + + VCKC + NCSGFLG  PK   VS       +K            K     K    +CF CG+   ++S   C    C K YH+ CL L         W CP H CD+C + +         S+C +      FI K +
Sbjct:  549 CQVCEKPGELLLCEAQCCGAFHLQCL-----GMEAMPQGKFVCTECSSGYHTCFVCKE-----SDQGVKRCMLPLCGKYYHEECALKYPPATQQNRG-----FRCSLHICSTCYATNPSNPSASKGRLMRCVRCPIAYHANDFCLPAGAVTLASNSIICPNH--------------FTPRRGCKNHEHV-----------------------NVSWCFVCSEGGSLLCCESCPAAFHRECLNIDMPEGSWFCNDCKAGKKPHYKEVVWVKVGRYRWWPAEVCHPKTIPPNIQKMKHDIGEFPVVFFGSKDYLWTHQARVFPYMEGDALNKDKMSKGMDAVYKKGLMEAAERFEELKAQKEMRQLQEDKKNDKKPPPYKHIKVNRPVGKVQILTADLSEIPRCNCKATD-ENPCGQDSECINRMLLYECHPSVCPAGERCQNQAFSKRQYPEVEIFRTLSRGWGLRCRTDIKKGEFVNEYVGEMIDEEECRARIRYAQEQDITNFYMLTLDKDRVIDAGPKGNFARFMNHCCQPNCETQKWTVNGDTRVGLFALCDIKAGVELTFNYNLECLGNGKTVCKCGAPNCSGFLGVRPKNQPVSSEDKGKKRKQYVKR-------KKSEVVKEHEDECFSCGDGGQLVS---CKKPGCPKVYHAECLKL--TRRPAGKWECPWHQCDICHKEAASLCEMCPSSFCKQHREGMLFISKLD 1197          
BLAST of NSD-1 vs. Ensembl Xenopus
Match: NSD2 (nuclear receptor binding SET domain protein 2 [Source:NCBI gene;Acc:100125213])

HSP 1 Score: 388.652 bits (997), Expect = 1.175e-116
Identity = 241/707 (34.09%), Postives = 337/707 (47.67%), Query Frame = 3
Query:  693 CRYCLETKNIVQCNKCLFNNFHVKCLEFLQNSIETKINDLDRCLECSLGIIRCYACYKIVDISNEQGFMRCIIKTCTKWFHTNCLETGPMLEMTKFPKPGQLVCPCHICHKCELVNPS-PKYRCTKLIVCIMCPATFHTGDWCIPAGSVELNTGEIICPRHLVDLNFSMNIMVPPFVARVKSDLQERIYGNTLTKISEPMTITPSTVTKPTNVNWCFKCGEGGELLCCETCPAAYHFKCTDLKEIPQKFYCPDCASFCYRSYGEIVWIKCGTHPWWPGQILHLENVPKNIAAKKHANGQFVVQFFGSRDYMWRDHGNVFLYEKEDECNSKTSKYRYNNIFLEGIKEAAIGY----------VTREEKWQSGSCDHVMNSKIYNKIQVNKCPLELRRKVVPETPHCNCISFDPKSDCSIGSGCFNVASKCECDPQICNLGDKCKNQNFVKRIYPKQYTFWANDRGWGLKADEFIKTKQFVNEYIGEIITMEESEKRILWANENNITDFYFMELDNGRLIDARQFSNLSRFINNSCDPNLVAEKWIVNREHRIGLFALRDIQKGEELTFQYNLQNKSSNRIVCKCFSVNCSGFLGEAPKMAXXXXXXXXXXXXXXXXXXXXXXXCKSFLTDKNSNSQCFRCGEIIDMLSSIVCSVGPCMKTYHSVCLNLNMANYVQSSWICPHHYCDVCARPSHHFSSNTTESYCNKDF 2780
            C+ C +  +++ C     + FH+ C+      + T+      C EC+ G   C+ C +     + +   RCI+  C K++H +CL   P+     F   G   CP H C  C   NPS P+    K++ C+ CP  +H  + CI AG   L +  IIC  H              F A         I                       NV+WCF C  GG LLCCE+CPAA+H  C +++     ++C DC       + +I+W+K G + WWP ++ H +NVP NI   KHA G+F V FFGS+DY W     VF Y + D  +          +F   ++EA   +          VT+E + +     H+  +K Y K+QV    +        E P CNC     K  C   S C N     EC PQ+C  GD+C+NQ F KR YP+        +GWGL A   IK  +FVNEYIGE+I  EE   RI  A EN+IT FY + +D  R+IDA    N SRF+N+SC PN   +KW VN + R+GLFA+RDI  GEELTF YNL    + + +C+C + NCSGFLG+ PK    +   S   +K K    + +         K S   CFRC +  ++   ++C    C K YH  CL+L    +    W CP H+CDVC + S    S    S+C   +
Sbjct:  557 CQVCEKVGDLMLCEGVCCSAFHLSCI-----GLSTRPAGKYLCKECTSGARSCFLCKE-----SNRDVKRCIVPHCGKFYHESCLRKYPL---AVFESRG-FRCPLHRCATCYFSNPSNPRASKGKMVRCVRCPLAYHGAESCIVAGCTALTSTSIICSSH--------------FAANKAKSHHAHI-----------------------NVSWCFVCSNGGSLLCCESCPAAFHPDCLNIEMPDGSWFCNDCRLGKKPRFNDIIWVKLGNYRWWPAEVCHPKNVPPNIQKMKHAIGEFPVFFFGSKDYYWTHQARVFPYMEGDRGSKHHGGKSIGKVFKNALQEAETRFCEIMRQREAKVTQENEKKPPPYKHIKVNKPYGKVQVYTADIS-------EIPKCNCKPSSEKP-CGFDSECLNRMLMYECHPQVCPAGDRCQNQCFNKRQYPETKIIKTEGKGWGLIATRDIKKGEFVNEYIGELIDEEECMYRIRHAQENDITHFYMLTIDKDRIIDAGPKGNFSRFMNHSCQPNCETQKWSVNGDTRVGLFAVRDIPAGEELTFNYNLDCLGNEKTICRCGAPNCSGFLGDRPK----NNTASSHEEKVKKPKKKQKKRRTKTDGKKQSEDYCFRCNDGGEL---VLCDRKFCTKAYHLSCLSLTKRPF--GKWECPWHHCDVCGKASVSCCSLCPNSFCKGHY 1195          
BLAST of NSD-1 vs. Ensembl Xenopus
Match: NSD1 (nuclear receptor binding SET domain protein 1 [Source:NCBI gene;Acc:100145675])

HSP 1 Score: 395.586 bits (1015), Expect = 1.325e-116
Identity = 241/714 (33.75%), Postives = 343/714 (48.04%), Query Frame = 3
Query:  693 CRYCLETKNIVQCNKCLFNNFHVKCLEFLQNSIETKINDLDRCLECSLGIIRCYACYKIVDISNEQGFMRCIIKTCTKWFHTNC-LETGPMLEMTKFPKPGQLVCPCHICHKCELVNPS-PKYRCTKLIVCIMCPATFHTGDWCIPAGSVELNTGEIICPRHLVDLNFSMNIMVPPFVARVKSDLQERIYGNTLTKISEPMTITPSTVTKPTNVNWCFKCGEGGELLCCETCPAAYHFKCTDLKEIPQKFYCPDCASFCYRSYGEIVWIKCGTHPWWPGQILHLENVPKNIAAKKHANGQFVVQFFGSRDYMWRDHGNVFLYEKEDECNSKTSKYRYNNIFLEGIKEAAIGY----VTREEKWQSGSCDHVMNSKIYNKIQVNK--CPLELRRKVVPETPHCNCISFDPKSDCSIGSGCFNVASKCECDPQICNLGDKCKNQNFVKRIYPKQYTFWANDRGWGLKADEFIKTKQFVNEYIGEIITMEESEKRILWANENNITDFYFMELDNGRLIDARQFSNLSRFINNSCDPNLVAEKWIVNREHRIGLFALRDIQKGEELTFQYNLQNKSSNRIVCKCFSVNCSGFLGEAPKMAXXXXXXXXXXXXXXXXXXXXXXXCKSFLTDKNSNSQCFRCGEIIDMLSSIVCSVGPCMKTYHSVCLNLNMANYVQSSWICPHHYCDVCARPSHHFSSNTTESYCNKD-----FIKKFN 2795
            C+ C +   ++ C       FH++CL      +E        C ECS G   C+ C +     ++QG  RC++  C K++H  C L+  P  +  +        C  HIC  C   NPS P     +L+ C+ CP  +H  D+C+PAG+V L +  IICP H              F  R      E +                       NV+WCF C EGG LLCCE+CPAA+H +C ++      ++C DC +     Y E+VW+K G + WWP ++ H + +P NI   KH  G+F V FFGS+DY+W     VF Y + D  N        + ++ +G+ EAA  +      +E +       +      Y  I+VN+    +++    + E P CNC + D ++ C   S C N     EC P +C  G++C+NQ F KR YP+   F    RGWGL+    IK  +FVNEY+GE+I  EE   RI +A E +IT+FY + LD  R+IDA    N +RF+N+ C PN   +KW VN + R+GLFAL DI+ G ELTF YNL+   + + VCKC + NCSGFLG  PK   VS       +K            K     K    +CF CG+   ++S   C    C K YH+ CL L         W CP H CD+C + +         S+C +      FI K +
Sbjct:  711 CQVCEKPGELLLCEAQCCGAFHLQCL-----GMEAMPQGKFVCTECSSGYHTCFVCKE-----SDQGVKRCMLPLCGKYYHEECALKYPPATQQNRG-----FRCSLHICSTCYATNPSNPSASKGRLMRCVRCPIAYHANDFCLPAGAVTLASNSIICPNH--------------FTPRRGCKNHEHV-----------------------NVSWCFVCSEGGSLLCCESCPAAFHRECLNIDMPEGSWFCNDCKAGKKPHYKEVVWVKVGRYRWWPAEVCHPKTIPPNIQKMKHDIGEFPVVFFGSKDYLWTHQARVFPYMEGDALNKDKMSKGMDAVYKKGLMEAAERFEELKAQKEMRQLQEDKKNDKKPPPYKHIKVNRPVGKVQILTADLSEIPRCNCKATD-ENPCGQDSECINRMLLYECHPSVCPAGERCQNQAFSKRQYPEVEIFRTLSRGWGLRCRTDIKKGEFVNEYVGEMIDEEECRARIRYAQEQDITNFYMLTLDKDRVIDAGPKGNFARFMNHCCQPNCETQKWTVNGDTRVGLFALCDIKAGVELTFNYNLECLGNGKTVCKCGAPNCSGFLGVRPKNQPVSSEDKGKKRKQYVKR-------KKSEVVKEHEDECFSCGDGGQLVS---CKKPGCPKVYHAECLKL--TRRPAGKWECPWHQCDICHKEAASLCEMCPSSFCKQHREGMLFISKLD 1359          
BLAST of NSD-1 vs. Ensembl Mouse
Match: Nsd2 (nuclear receptor binding SET domain protein 2 [Source:MGI Symbol;Acc:MGI:1276574])

HSP 1 Score: 393.66 bits (1010), Expect = 1.027e-117
Identity = 244/735 (33.20%), Postives = 348/735 (47.35%), Query Frame = 3
Query:  627 PIKYAFDELTLPFVSVKLTNKN--------CRYCLETKNIVQCNKCLFNNFHVKCLEFLQNSIETKINDLDRCLECSLGIIRCYACYKIVDISNEQGFMRCIIKTCTKWFHTNCLETGPMLEMTKFPKPGQLVCPCHICHKCELVNPS-PKYRCTKLIVCIMCPATFHTGDWCIPAGSVELNTGEIICPRHLVDLNFSMNIMVPPFVARVKSDLQERIYGNTLTKISEPMTITPSTVTKPTNVNWCFKCGEGGELLCCETCPAAYHFKCTDLKEIPQKFYCPDCASFCYRSYGEIVWIKCGTHPWWPGQILHLENVPKNIAAKKHANGQFVVQFFGSRDYMWRDHGNVFLYEKEDECNSKTSKYRYNNIFLEGIKEAAIGY----------VTREEKWQSGSCDHVMNSKIYNKIQVNKCPLELRRKVVPETPHCNCISFDPKSDCSIGSGCFNVASKCECDPQICNLGDKCKNQNFVKRIYPKQYTFWANDRGWGLKADEFIKTKQFVNEYIGEIITMEESEKRILWANENNITDFYFMELDNGRLIDARQFSNLSRFINNSCDPNLVAEKWIVNREHRIGLFALRDIQKGEELTFQYNLQNKSSNRIVCKCFSVNCSGFLGEAPKMAXXXXXXXXXXXXXXXXXXXXXXXCKSFLTDKNSNSQCFRCGEIIDMLSSIVCSVGPCMKTYHSVCLNLNMANYVQSSWICPHHYCDVCARPSHHFSSNTTESYCNK 2774
            P + A +  T   VS K + +         C+ C +T +++ C       FH+ CL  L    E +      C EC+ GI  C+ C +     ++    RC++  C K++H  C++  P+   T F   G   CP H C  C   NPS P+    K++ C+ CP  +H GD C+ AG   + +  IIC  H              F AR        +                       NV+WCF C +GG LLCCE CPAA+H  C +++     ++C DC +     + +I+W+K G + WWP ++ H +NVP NI   KH  G+F V FFGS+DY W     VF Y + D  +          +F   ++EA   +           T+E + +     H+  +K Y K+Q+           + E P CNC   D ++ C   S C N     EC PQ+C  G+ C+NQ F KR YP+      + +GWGL A   I+  +FVNEY+GE+I  EE   RI +A+EN+IT FY + +D  R+IDA    N SRF+N+SC PN    KW VN + R+GLFA+ DI  G ELTF YNL    + + VC+C + NCSGFLG+ PK +     +    K  K                + S  +CFRCG   D    ++C    C K YH  CL L    +    W CP H+CDVC +PS  F      S+C +
Sbjct:  641 PYESADETQTEASVSSKKSERGMAAKKEYVCQLCEKTGSLLLCEGPCCGAFHLACL-GLSRRPEGRFT----CTECASGIHSCFVCKE-----SKMEVKRCVVNQCGKFYHEACVKKYPL---TVFESRG-FRCPLHSCMSCHASNPSNPRPSKGKMMRCVRCPVAYHGGDACLAAGCSVIASNSIICTGH--------------FTARKGKRHHTHV-----------------------NVSWCFVCSKGGSLLCCEACPAAFHPDCLNIEMPDGSWFCNDCRAGKKLHFQDIIWVKLGNYRWWPAEVCHPKNVPPNIQKMKHEIGEFPVFFFGSKDYYWTHQARVFPYMEGDRGSRYQGVRGIGRVFKNALQEAEARFNEVKLQREARETQESERKPPPYKHIKVNKPYGKVQIYTAD-------ISEIPKCNCKPTD-ENPCGSDSECLNRMLMFECHPQVCPAGEYCQNQCFTKRQYPETKIIKTDGKGWGLVAKRDIRKGEFVNEYVGELIDEEECMARIKYAHENDITHFYMLTIDKDRIIDAGPKGNYSRFMNHSCQPNCETLKWTVNGDTRVGLFAVCDIPAGTELTFNYNLDCLGNEKTVCRCGASNCSGFLGDRPKTSASLSSEEKGKKAKKKTRRRR----AKGEGKRQSEDECFRCG---DGGQLVLCDRKFCTKAYHLSCLGLGKRPF--GKWECPWHHCDVCGKPSTSFCHLCPNSFCKE 1307          
BLAST of NSD-1 vs. Ensembl Mouse
Match: Nsd2 (nuclear receptor binding SET domain protein 2 [Source:MGI Symbol;Acc:MGI:1276574])

HSP 1 Score: 393.66 bits (1010), Expect = 1.027e-117
Identity = 244/735 (33.20%), Postives = 348/735 (47.35%), Query Frame = 3
Query:  627 PIKYAFDELTLPFVSVKLTNKN--------CRYCLETKNIVQCNKCLFNNFHVKCLEFLQNSIETKINDLDRCLECSLGIIRCYACYKIVDISNEQGFMRCIIKTCTKWFHTNCLETGPMLEMTKFPKPGQLVCPCHICHKCELVNPS-PKYRCTKLIVCIMCPATFHTGDWCIPAGSVELNTGEIICPRHLVDLNFSMNIMVPPFVARVKSDLQERIYGNTLTKISEPMTITPSTVTKPTNVNWCFKCGEGGELLCCETCPAAYHFKCTDLKEIPQKFYCPDCASFCYRSYGEIVWIKCGTHPWWPGQILHLENVPKNIAAKKHANGQFVVQFFGSRDYMWRDHGNVFLYEKEDECNSKTSKYRYNNIFLEGIKEAAIGY----------VTREEKWQSGSCDHVMNSKIYNKIQVNKCPLELRRKVVPETPHCNCISFDPKSDCSIGSGCFNVASKCECDPQICNLGDKCKNQNFVKRIYPKQYTFWANDRGWGLKADEFIKTKQFVNEYIGEIITMEESEKRILWANENNITDFYFMELDNGRLIDARQFSNLSRFINNSCDPNLVAEKWIVNREHRIGLFALRDIQKGEELTFQYNLQNKSSNRIVCKCFSVNCSGFLGEAPKMAXXXXXXXXXXXXXXXXXXXXXXXCKSFLTDKNSNSQCFRCGEIIDMLSSIVCSVGPCMKTYHSVCLNLNMANYVQSSWICPHHYCDVCARPSHHFSSNTTESYCNK 2774
            P + A +  T   VS K + +         C+ C +T +++ C       FH+ CL  L    E +      C EC+ GI  C+ C +     ++    RC++  C K++H  C++  P+   T F   G   CP H C  C   NPS P+    K++ C+ CP  +H GD C+ AG   + +  IIC  H              F AR        +                       NV+WCF C +GG LLCCE CPAA+H  C +++     ++C DC +     + +I+W+K G + WWP ++ H +NVP NI   KH  G+F V FFGS+DY W     VF Y + D  +          +F   ++EA   +           T+E + +     H+  +K Y K+Q+           + E P CNC   D ++ C   S C N     EC PQ+C  G+ C+NQ F KR YP+      + +GWGL A   I+  +FVNEY+GE+I  EE   RI +A+EN+IT FY + +D  R+IDA    N SRF+N+SC PN    KW VN + R+GLFA+ DI  G ELTF YNL    + + VC+C + NCSGFLG+ PK +     +    K  K                + S  +CFRCG   D    ++C    C K YH  CL L    +    W CP H+CDVC +PS  F      S+C +
Sbjct:  641 PYESADETQTEASVSSKKSERGMAAKKEYVCQLCEKTGSLLLCEGPCCGAFHLACL-GLSRRPEGRFT----CTECASGIHSCFVCKE-----SKMEVKRCVVNQCGKFYHEACVKKYPL---TVFESRG-FRCPLHSCMSCHASNPSNPRPSKGKMMRCVRCPVAYHGGDACLAAGCSVIASNSIICTGH--------------FTARKGKRHHTHV-----------------------NVSWCFVCSKGGSLLCCEACPAAFHPDCLNIEMPDGSWFCNDCRAGKKLHFQDIIWVKLGNYRWWPAEVCHPKNVPPNIQKMKHEIGEFPVFFFGSKDYYWTHQARVFPYMEGDRGSRYQGVRGIGRVFKNALQEAEARFNEVKLQREARETQESERKPPPYKHIKVNKPYGKVQIYTAD-------ISEIPKCNCKPTD-ENPCGSDSECLNRMLMFECHPQVCPAGEYCQNQCFTKRQYPETKIIKTDGKGWGLVAKRDIRKGEFVNEYVGELIDEEECMARIKYAHENDITHFYMLTIDKDRIIDAGPKGNYSRFMNHSCQPNCETLKWTVNGDTRVGLFAVCDIPAGTELTFNYNLDCLGNEKTVCRCGASNCSGFLGDRPKTSASLSSEEKGKKAKKKTRRRR----AKGEGKRQSEDECFRCG---DGGQLVLCDRKFCTKAYHLSCLGLGKRPF--GKWECPWHHCDVCGKPSTSFCHLCPNSFCKE 1307          
BLAST of NSD-1 vs. Ensembl Mouse
Match: Nsd2 (nuclear receptor binding SET domain protein 2 [Source:MGI Symbol;Acc:MGI:1276574])

HSP 1 Score: 393.66 bits (1010), Expect = 1.066e-117
Identity = 243/735 (33.06%), Postives = 349/735 (47.48%), Query Frame = 3
Query:  627 PIKYAFDELTLPFVSVKLTNKN--------CRYCLETKNIVQCNKCLFNNFHVKCLEFLQNSIETKINDLDRCLECSLGIIRCYACYKIVDISNEQGFMRCIIKTCTKWFHTNCLETGPMLEMTKFPKPGQLVCPCHICHKCELVNPS-PKYRCTKLIVCIMCPATFHTGDWCIPAGSVELNTGEIICPRHLVDLNFSMNIMVPPFVARVKSDLQERIYGNTLTKISEPMTITPSTVTKPTNVNWCFKCGEGGELLCCETCPAAYHFKCTDLKEIPQKFYCPDCASFCYRSYGEIVWIKCGTHPWWPGQILHLENVPKNIAAKKHANGQFVVQFFGSRDYMWRDHGNVFLYEKEDECNSKTSKYRYNNIFLEGIKEAAIGY----------VTREEKWQSGSCDHVMNSKIYNKIQVNKCPLELRRKVVPETPHCNCISFDPKSDCSIGSGCFNVASKCECDPQICNLGDKCKNQNFVKRIYPKQYTFWANDRGWGLKADEFIKTKQFVNEYIGEIITMEESEKRILWANENNITDFYFMELDNGRLIDARQFSNLSRFINNSCDPNLVAEKWIVNREHRIGLFALRDIQKGEELTFQYNLQNKSSNRIVCKCFSVNCSGFLGEAPKMAXXXXXXXXXXXXXXXXXXXXXXXCKSFLTDKNSNSQCFRCGEIIDMLSSIVCSVGPCMKTYHSVCLNLNMANYVQSSWICPHHYCDVCARPSHHFSSNTTESYCNK 2774
            P + A +  T   VS K + +         C+ C +T +++ C       FH+ CL  L    E +      C EC+ GI  C+ C +     ++    RC++  C K++H  C++  P+   T F   G   CP H C  C   NPS P+    K++ C+ CP  +H GD C+ AG   + +  IIC  H              F AR        +                       NV+WCF C +GG LLCCE CPAA+H  C +++     ++C DC +     + +I+W+K G + WWP ++ H +NVP NI   KH  G+F V FFGS+DY W     VF Y + D  +          +F   ++EA   +           T+E + +     H+  +K Y K+Q+           + E P CNC   D ++ C   S C N     EC PQ+C  G+ C+NQ F KR YP+      + +GWGL A   I+  +FVNEY+GE+I  EE   RI +A+EN+IT FY + +D  R+IDA    N SRF+N+SC PN    KW VN + R+GLFA+ DI  G ELTF YNL    + + VC+C + NCSGFLG+ PK +     +    K  K                + S  +CFRCG+   +   ++C    C K YH  CL L    +    W CP H+CDVC +PS  F      S+C +
Sbjct:  640 PYESADETQTEASVSSKKSERGMAAKKEYVCQLCEKTGSLLLCEGPCCGAFHLACL-GLSRRPEGRFT----CTECASGIHSCFVCKE-----SKMEVKRCVVNQCGKFYHEACVKKYPL---TVFESRG-FRCPLHSCMSCHASNPSNPRPSKGKMMRCVRCPVAYHGGDACLAAGCSVIASNSIICTGH--------------FTARKGKRHHTHV-----------------------NVSWCFVCSKGGSLLCCEACPAAFHPDCLNIEMPDGSWFCNDCRAGKKLHFQDIIWVKLGNYRWWPAEVCHPKNVPPNIQKMKHEIGEFPVFFFGSKDYYWTHQARVFPYMEGDRGSRYQGVRGIGRVFKNALQEAEARFNEVKLQREARETQESERKPPPYKHIKVNKPYGKVQIYTAD-------ISEIPKCNCKPTD-ENPCGSDSECLNRMLMFECHPQVCPAGEYCQNQCFTKRQYPETKIIKTDGKGWGLVAKRDIRKGEFVNEYVGELIDEEECMARIKYAHENDITHFYMLTIDKDRIIDAGPKGNYSRFMNHSCQPNCETLKWTVNGDTRVGLFAVCDIPAGTELTFNYNLDCLGNEKTVCRCGASNCSGFLGDRPKTSASLSSEEKGKKAKKKTRRRR----AKGEGKRQSEDECFRCGDGGQL---VLCDRKFCTKAYHLSCLGLGKRPF--GKWECPWHHCDVCGKPSTSFCHLCPNSFCKE 1306          
BLAST of NSD-1 vs. Ensembl Mouse
Match: Nsd1 (nuclear receptor-binding SET-domain protein 1 [Source:MGI Symbol;Acc:MGI:1276545])

HSP 1 Score: 382.104 bits (980), Expect = 1.293e-111
Identity = 246/745 (33.02%), Postives = 361/745 (48.46%), Query Frame = 3
Query:  606 QEIIKREPIKYAFDELTLPFVSVKLTNKN-CRYCLETKNIVQCNKCLFNNFHVKCLEFLQNSIETKINDLDRCLECSLGIIRCYACYKIVDISNEQGFMRCIIKTCTKWFHTNCLET-GPMLEMTKFPKPGQLVCPCHICHKCELVNPSP-KYRCTKLIVCIMCPATFHTGDWCIPAGSVELNTGEIICPRHLVDLNFSMNIMVPPFVARVKSDLQERIYGNTLTKISEPMTITPSTVTKPTNVNWCFKCGEGGELLCCETCPAAYHFKCTDLKEIPQ-KFYCPDCASFCYRSYGEIVWIKCGTHPWWPGQILHLENVPKNIAAKKHANGQFVVQFFGSRDYMWRDHGNVFLYEKEDECNSKTSKYRYNNIFLEGIKEAAIGY--VTREEKWQSGSCDHVMNSKI--YNKIQVNK--CPLELRRKVVPETPHCNCISFDPKSDCSIGSGCFNVASKCECDPQICNLGDKCKNQNFVKRIYPKQYTFWANDRGWGLKADEFIKTKQFVNEYIGEIITMEESEKRILWANENNITDFYFMELDNGRLIDARQFSNLSRFINNSCDPNLVAEKWIVNREHRIGLFALRDIQKGEELTFQYNLQNKSSNRIVCKCFSVNCSGFLGEAPKMAXXXXXXXXXXXXXXXXXXXXXXXCKSFLTDKNSNSQCFRCGEIIDMLSSIVCSVGPCMKTYHSVCLNLNMANYVQSSWICPHHYCDVCARPSHHFSSNTTESYCNKD-----FIKKFN 2795
            +E ++ +P   A  +L +         +N C+ C +   ++ C       FH++CL   +      I     C EC  GI  C+ C +     + +   RC++  C K++H  C++   P +   K        CP HIC  C   NP+       +L+ C+ CP  +H  D+C+ AGS  L +  IICP H              F  R      E +                       NV+WCF C EGG LLCC++CPAA+H +C ++ +IP+  +YC DC +     Y EIVW+K G + WWP +I H   VP NI   +H  G+F V FFGS DY+W     VF Y + D  +        +  + + ++EAA  +  +  +++ +    D   + K   Y  I+VN+    +++    + E P CNC + D ++ C I S C N     EC P +C  G +C+NQ F KR YP    F    RGWGL+    IK  +FVNEY+GE+I  EE   RI +A E++IT+FY + LD  R+IDA    N +RF+N+ C PN   +KW VN + R+GLFAL DI+ G ELTF YNL+   + + VCKC + NCSGFLG  PK      + ++   +        +   +  +T K    +CF CG+   ++S   C    C K YH+ CLNL         W CP H CDVC + +  F      S+C +      FI K +
Sbjct: 1517 EEGVEHDPGMSASKKLQVERGGGAALKENVCQNCEKLGELLLCEAQCCGAFHLECLGLPEMPRGKFI-----CNECHTGIHTCFVCKQ-----SGEDVKRCLLPLCGKFYHEECVQKYPPTVTQNKG-----FRCPLHICITCHAANPANVSASKGRLMRCVRCPVAYHANDFCLAAGSKILASNSIICPNH--------------FTPRRGCRNHEHV-----------------------NVSWCFVCSEGGSLLCCDSCPAAFHRECLNI-DIPEGNWYCNDCKAGKKPHYREIVWVKVGRYRWWPAEICHPRAVPSNIDKMRHDVGEFPVLFFGSNDYLWTHQARVFPYMEGDVSSKDKMGKGVDGTYKKALQEAAARFEELKAQKELRQLQEDRKNDKKPPPYKHIKVNRPIGRVQIFTADLSEIPRCNCKATD-ENPCGIDSECINRMLLYECHPTVCPAGVRCQNQCFSKRQYPDVEIFRTLQRGWGLRTKTDIKKGEFVNEYVGELIDEEECRARIRYAQEHDITNFYMLTLDKDRIIDAGPKGNYARFMNHCCQPNCETQKWSVNGDTRVGLFALSDIKAGTELTFNYNLECLGNGKTVCKCGAPNCSGFLGVRPK---NQPIVTEEKSRKFKRKPHGKRRSQGEVT-KEREDECFSCGDAGQLVS---CKKPGCPKVYHADCLNLT--KRPAGKWECPWHQCDVCGKEAASFCEMCPSSFCKQHREGMLFISKLD 2198          
BLAST of NSD-1 vs. Ensembl Mouse
Match: Nsd1 (nuclear receptor-binding SET-domain protein 1 [Source:MGI Symbol;Acc:MGI:1276545])

HSP 1 Score: 382.104 bits (980), Expect = 1.366e-111
Identity = 246/745 (33.02%), Postives = 361/745 (48.46%), Query Frame = 3
Query:  606 QEIIKREPIKYAFDELTLPFVSVKLTNKN-CRYCLETKNIVQCNKCLFNNFHVKCLEFLQNSIETKINDLDRCLECSLGIIRCYACYKIVDISNEQGFMRCIIKTCTKWFHTNCLET-GPMLEMTKFPKPGQLVCPCHICHKCELVNPSP-KYRCTKLIVCIMCPATFHTGDWCIPAGSVELNTGEIICPRHLVDLNFSMNIMVPPFVARVKSDLQERIYGNTLTKISEPMTITPSTVTKPTNVNWCFKCGEGGELLCCETCPAAYHFKCTDLKEIPQ-KFYCPDCASFCYRSYGEIVWIKCGTHPWWPGQILHLENVPKNIAAKKHANGQFVVQFFGSRDYMWRDHGNVFLYEKEDECNSKTSKYRYNNIFLEGIKEAAIGY--VTREEKWQSGSCDHVMNSKI--YNKIQVNK--CPLELRRKVVPETPHCNCISFDPKSDCSIGSGCFNVASKCECDPQICNLGDKCKNQNFVKRIYPKQYTFWANDRGWGLKADEFIKTKQFVNEYIGEIITMEESEKRILWANENNITDFYFMELDNGRLIDARQFSNLSRFINNSCDPNLVAEKWIVNREHRIGLFALRDIQKGEELTFQYNLQNKSSNRIVCKCFSVNCSGFLGEAPKMAXXXXXXXXXXXXXXXXXXXXXXXCKSFLTDKNSNSQCFRCGEIIDMLSSIVCSVGPCMKTYHSVCLNLNMANYVQSSWICPHHYCDVCARPSHHFSSNTTESYCNKD-----FIKKFN 2795
            +E ++ +P   A  +L +         +N C+ C +   ++ C       FH++CL   +      I     C EC  GI  C+ C +     + +   RC++  C K++H  C++   P +   K        CP HIC  C   NP+       +L+ C+ CP  +H  D+C+ AGS  L +  IICP H              F  R      E +                       NV+WCF C EGG LLCC++CPAA+H +C ++ +IP+  +YC DC +     Y EIVW+K G + WWP +I H   VP NI   +H  G+F V FFGS DY+W     VF Y + D  +        +  + + ++EAA  +  +  +++ +    D   + K   Y  I+VN+    +++    + E P CNC + D ++ C I S C N     EC P +C  G +C+NQ F KR YP    F    RGWGL+    IK  +FVNEY+GE+I  EE   RI +A E++IT+FY + LD  R+IDA    N +RF+N+ C PN   +KW VN + R+GLFAL DI+ G ELTF YNL+   + + VCKC + NCSGFLG  PK      + ++   +        +   +  +T K    +CF CG+   ++S   C    C K YH+ CLNL         W CP H CDVC + +  F      S+C +      FI K +
Sbjct: 1414 EEGVEHDPGMSASKKLQVERGGGAALKENVCQNCEKLGELLLCEAQCCGAFHLECLGLPEMPRGKFI-----CNECHTGIHTCFVCKQ-----SGEDVKRCLLPLCGKFYHEECVQKYPPTVTQNKG-----FRCPLHICITCHAANPANVSASKGRLMRCVRCPVAYHANDFCLAAGSKILASNSIICPNH--------------FTPRRGCRNHEHV-----------------------NVSWCFVCSEGGSLLCCDSCPAAFHRECLNI-DIPEGNWYCNDCKAGKKPHYREIVWVKVGRYRWWPAEICHPRAVPSNIDKMRHDVGEFPVLFFGSNDYLWTHQARVFPYMEGDVSSKDKMGKGVDGTYKKALQEAAARFEELKAQKELRQLQEDRKNDKKPPPYKHIKVNRPIGRVQIFTADLSEIPRCNCKATD-ENPCGIDSECINRMLLYECHPTVCPAGVRCQNQCFSKRQYPDVEIFRTLQRGWGLRTKTDIKKGEFVNEYVGELIDEEECRARIRYAQEHDITNFYMLTLDKDRIIDAGPKGNYARFMNHCCQPNCETQKWSVNGDTRVGLFALSDIKAGTELTFNYNLECLGNGKTVCKCGAPNCSGFLGVRPK---NQPIVTEEKSRKFKRKPHGKRRSQGEVT-KEREDECFSCGDAGQLVS---CKKPGCPKVYHADCLNL--TKRPAGKWECPWHQCDVCGKEAASFCEMCPSSFCKQHREGMLFISKLD 2095          
BLAST of NSD-1 vs. UniProt/SwissProt
Match: sp|Q8BVE8|NSD2_MOUSE (Histone-lysine N-methyltransferase NSD2 OS=Mus musculus OX=10090 GN=Nsd2 PE=1 SV=2)

HSP 1 Score: 393.66 bits (1010), Expect = 7.455e-117
Identity = 243/735 (33.06%), Postives = 349/735 (47.48%), Query Frame = 3
Query:  627 PIKYAFDELTLPFVSVKLTNKN--------CRYCLETKNIVQCNKCLFNNFHVKCLEFLQNSIETKINDLDRCLECSLGIIRCYACYKIVDISNEQGFMRCIIKTCTKWFHTNCLETGPMLEMTKFPKPGQLVCPCHICHKCELVNPS-PKYRCTKLIVCIMCPATFHTGDWCIPAGSVELNTGEIICPRHLVDLNFSMNIMVPPFVARVKSDLQERIYGNTLTKISEPMTITPSTVTKPTNVNWCFKCGEGGELLCCETCPAAYHFKCTDLKEIPQKFYCPDCASFCYRSYGEIVWIKCGTHPWWPGQILHLENVPKNIAAKKHANGQFVVQFFGSRDYMWRDHGNVFLYEKEDECNSKTSKYRYNNIFLEGIKEAAIGY----------VTREEKWQSGSCDHVMNSKIYNKIQVNKCPLELRRKVVPETPHCNCISFDPKSDCSIGSGCFNVASKCECDPQICNLGDKCKNQNFVKRIYPKQYTFWANDRGWGLKADEFIKTKQFVNEYIGEIITMEESEKRILWANENNITDFYFMELDNGRLIDARQFSNLSRFINNSCDPNLVAEKWIVNREHRIGLFALRDIQKGEELTFQYNLQNKSSNRIVCKCFSVNCSGFLGEAPKMAXXXXXXXXXXXXXXXXXXXXXXXCKSFLTDKNSNSQCFRCGEIIDMLSSIVCSVGPCMKTYHSVCLNLNMANYVQSSWICPHHYCDVCARPSHHFSSNTTESYCNK 2774
            P + A +  T   VS K + +         C+ C +T +++ C       FH+ CL  L    E +      C EC+ GI  C+ C +     ++    RC++  C K++H  C++  P+   T F   G   CP H C  C   NPS P+    K++ C+ CP  +H GD C+ AG   + +  IIC  H              F AR        +                       NV+WCF C +GG LLCCE CPAA+H  C +++     ++C DC +     + +I+W+K G + WWP ++ H +NVP NI   KH  G+F V FFGS+DY W     VF Y + D  +          +F   ++EA   +           T+E + +     H+  +K Y K+Q+           + E P CNC   D ++ C   S C N     EC PQ+C  G+ C+NQ F KR YP+      + +GWGL A   I+  +FVNEY+GE+I  EE   RI +A+EN+IT FY + +D  R+IDA    N SRF+N+SC PN    KW VN + R+GLFA+ DI  G ELTF YNL    + + VC+C + NCSGFLG+ PK +     +    K  K                + S  +CFRCG+   +   ++C    C K YH  CL L    +    W CP H+CDVC +PS  F      S+C +
Sbjct:  640 PYESADETQTEASVSSKKSERGMAAKKEYVCQLCEKTGSLLLCEGPCCGAFHLACL-GLSRRPEGRFT----CTECASGIHSCFVCKE-----SKMEVKRCVVNQCGKFYHEACVKKYPL---TVFESRG-FRCPLHSCMSCHASNPSNPRPSKGKMMRCVRCPVAYHGGDACLAAGCSVIASNSIICTGH--------------FTARKGKRHHTHV-----------------------NVSWCFVCSKGGSLLCCEACPAAFHPDCLNIEMPDGSWFCNDCRAGKKLHFQDIIWVKLGNYRWWPAEVCHPKNVPPNIQKMKHEIGEFPVFFFGSKDYYWTHQARVFPYMEGDRGSRYQGVRGIGRVFKNALQEAEARFNEVKLQREARETQESERKPPPYKHIKVNKPYGKVQIYTAD-------ISEIPKCNCKPTD-ENPCGSDSECLNRMLMFECHPQVCPAGEYCQNQCFTKRQYPETKIIKTDGKGWGLVAKRDIRKGEFVNEYVGELIDEEECMARIKYAHENDITHFYMLTIDKDRIIDAGPKGNYSRFMNHSCQPNCETLKWTVNGDTRVGLFAVCDIPAGTELTFNYNLDCLGNEKTVCRCGASNCSGFLGDRPKTSASLSSEEKGKKAKKKTRRRR----AKGEGKRQSEDECFRCGDGGQL---VLCDRKFCTKAYHLSCLGLGKRPF--GKWECPWHHCDVCGKPSTSFCHLCPNSFCKE 1306          
BLAST of NSD-1 vs. UniProt/SwissProt
Match: sp|O96028|NSD2_HUMAN (Histone-lysine N-methyltransferase NSD2 OS=Homo sapiens OX=9606 GN=NSD2 PE=1 SV=1)

HSP 1 Score: 390.578 bits (1002), Expect = 7.434e-116
Identity = 237/705 (33.62%), Postives = 338/705 (47.94%), Query Frame = 3
Query:  693 CRYCLETKNIVQCNKCLFNNFHVKCLEFLQNSIETKINDLDRCLECSLGIIRCYACYKIVDISNEQGFMRCIIKTCTKWFHTNCLETGPMLEMTKFPKPGQLVCPCHICHKCELVNPS-PKYRCTKLIVCIMCPATFHTGDWCIPAGSVELNTGEIICPRHLVDLNFSMNIMVPPFVARVKSDLQERIYGNTLTKISEPMTITPSTVTKPTNVNWCFKCGEGGELLCCETCPAAYHFKCTDLKEIPQKFYCPDCASFCYRSYGEIVWIKCGTHPWWPGQILHLENVPKNIAAKKHANGQFVVQFFGSRDYMWRDHGNVFLYEKEDECNSKTSKYRYNNIFLEGIKEAAIGYV----------TREEKWQSGSCDHVMNSKIYNKIQVNKCPLELRRKVVPETPHCNCISFDPKSDCSIGSGCFNVASKCECDPQICNLGDKCKNQNFVKRIYPKQYTFWANDRGWGLKADEFIKTKQFVNEYIGEIITMEESEKRILWANENNITDFYFMELDNGRLIDARQFSNLSRFINNSCDPNLVAEKWIVNREHRIGLFALRDIQKGEELTFQYNLQNKSSNRIVCKCFSVNCSGFLGEAPKMAXXXXXXXXXXXXXXXXXXXXXXXCKSFLTDKNSNSQCFRCGEIIDMLSSIVCSVGPCMKTYHSVCLNLNMANYVQSSWICPHHYCDVCARPSHHFSSNTTESYCNK 2774
            C+ C +  +++ C       FH+ CL  L    E +      C EC+ GI  C+ C +     ++    RC++  C K++H  C++  P+   T F   G   CP H C  C   NPS P+    K++ C+ CP  +H+GD C+ AG   + +  IIC  H              F AR        +                       NV+WCF C +GG LLCCE+CPAA+H  C +++     ++C DC +     + +I+W+K G + WWP ++ H +NVP NI   KH  G+F V FFGS+DY W     VF Y + D  +          +F   ++EA   +           T+E + +     H+  +K Y K+Q+           + E P CNC   D ++ C   S C N     EC PQ+C  G+ C+NQ F KR YP+      + +GWGL A   I+  +FVNEY+GE+I  EE   RI  A+EN+IT FY + +D  R+IDA    N SRF+N+SC PN    KW VN + R+GLFA+ DI  G ELTF YNL    + + VC+C + NCSGFLG+ PK +     +    K  K                + S  +CFRCG   D    ++C    C K YH  CL L    +    W CP H+CDVC +PS  F      S+C +
Sbjct:  670 CQLCEKPGSLLLCEGPCCGAFHLACL-GLSRRPEGRFT----CSECASGIHSCFVCKE-----SKTDVKRCVVTQCGKFYHEACVKKYPL---TVFESRG-FRCPLHSCVSCHASNPSNPRPSKGKMMRCVRCPVAYHSGDACLAAGCSVIASNSIICTAH--------------FTARKGKRHHAHV-----------------------NVSWCFVCSKGGSLLCCESCPAAFHPDCLNIEMPDGSWFCNDCRAGKKLHFQDIIWVKLGNYRWWPAEVCHPKNVPPNIQKMKHEIGEFPVFFFGSKDYYWTHQARVFPYMEGDRGSRYQGVRGIGRVFKNALQEAEARFREIKLQREARETQESERKPPPYKHIKVNKPYGKVQIYTAD-------ISEIPKCNCKPTD-ENPCGFDSECLNRMLMFECHPQVCPAGEFCQNQCFTKRQYPETKIIKTDGKGWGLVAKRDIRKGEFVNEYVGELIDEEECMARIKHAHENDITHFYMLTIDKDRIIDAGPKGNYSRFMNHSCQPNCETLKWTVNGDTRVGLFAVCDIPAGTELTFNYNLDCLGNEKTVCRCGASNCSGFLGDRPKTSTTLSSEEKGKKTKKKTRRRR----AKGEGKRQSEDECFRCG---DGGQLVLCDRKFCTKAYHLSCLGLGKRPF--GKWECPWHHCDVCGKPSTSFCHLCPNSFCKE 1306          
BLAST of NSD-1 vs. UniProt/SwissProt
Match: sp|Q96L73|NSD1_HUMAN (Histone-lysine N-methyltransferase, H3 lysine-36 specific OS=Homo sapiens OX=9606 GN=NSD1 PE=1 SV=1)

HSP 1 Score: 382.489 bits (981), Expect = 5.937e-111
Identity = 240/714 (33.61%), Postives = 349/714 (48.88%), Query Frame = 3
Query:  693 CRYCLETKNIVQCNKCLFNNFHVKCLEFLQNSIETKINDLDRCLECSLGIIRCYACYKIVDISNEQGFMRCIIKTCTKWFHTNCLETGPMLEMTKFPKPGQLVCPCHICHKCELVNPSP-KYRCTKLIVCIMCPATFHTGDWCIPAGSVELNTGEIICPRHLVDLNFSMNIMVPPFVARVKSDLQERIYGNTLTKISEPMTITPSTVTKPTNVNWCFKCGEGGELLCCETCPAAYHFKCTDLKEIPQ-KFYCPDCASFCYRSYGEIVWIKCGTHPWWPGQILHLENVPKNIAAKKHANGQFVVQFFGSRDYMWRDHGNVFLYEKEDECNSKTSKYRYNNIFLEGIKEAAIGY--VTREEKWQSGSCDHVMNSKI--YNKIQVNK--CPLELRRKVVPETPHCNCISFDPKSDCSIGSGCFNVASKCECDPQICNLGDKCKNQNFVKRIYPKQYTFWANDRGWGLKADEFIKTKQFVNEYIGEIITMEESEKRILWANENNITDFYFMELDNGRLIDARQFSNLSRFINNSCDPNLVAEKWIVNREHRIGLFALRDIQKGEELTFQYNLQNKSSNRIVCKCFSVNCSGFLGEAPKMAXXXXXXXXXXXXXXXXXXXXXXXCKSFLTDKNSNSQCFRCGEIIDMLSSIVCSVGPCMKTYHSVCLNLNMANYVQSSWICPHHYCDVCARPSHHFSSNTTESYCNKD-----FIKKFN 2795
            C+ C +   ++ C       FH++CL   +      I     C EC  GI  C+ C +     + +   RC++  C K++H  C++  P   M          C  HIC  C   NP+       +L+ C+ CP  +H  D+C+ AGS  L +  IICP H              F  R      E +                       NV+WCF C EGG LLCC++CPAA+H +C ++ +IP+  +YC DC +     Y EIVW+K G + WWP +I H   VP NI   +H  G+F V FFGS DY+W     VF Y + D  +        +  + + ++EAA  +  +  +++ +    D   + K   Y  I+VN+    +++    + E P CNC + D ++ C I S C N     EC P +C  G +C+NQ F KR YP+   F    RGWGL+    IK  +FVNEY+GE+I  EE   RI +A E++IT+FY + LD  R+IDA    N +RF+N+ C PN   +KW VN + R+GLFAL DI+ G ELTF YNL+   + + VCKC + NCSGFLG  PK      + ++   K      + +   +  +T K    +CF CG+   ++S   C    C K YH+ CLNL         W CP H CD+C + +  F      S+C +      FI K +
Sbjct: 1546 CQNCEKLGELLLCEAQCCGAFHLECLGLTEMPRGKFI-----CNECRTGIHTCFVCKQ-----SGEDVKRCLLPLCGKFYHEECVQKYPPTVMQN----KGFRCSLHICITCHAANPANVSASKGRLMRCVRCPVAYHANDFCLAAGSKILASNSIICPNH--------------FTPRRGCRNHEHV-----------------------NVSWCFVCSEGGSLLCCDSCPAAFHRECLNI-DIPEGNWYCNDCKAGKKPHYREIVWVKVGRYRWWPAEICHPRAVPSNIDKMRHDVGEFPVLFFGSNDYLWTHQARVFPYMEGDVSSKDKMGKGVDGTYKKALQEAAARFEELKAQKELRQLQEDRKNDKKPPPYKHIKVNRPIGRVQIFTADLSEIPRCNCKATD-ENPCGIDSECINRMLLYECHPTVCPAGGRCQNQCFSKRQYPEVEIFRTLQRGWGLRTKTDIKKGEFVNEYVGELIDEEECRARIRYAQEHDITNFYMLTLDKDRIIDAGPKGNYARFMNHCCQPNCETQKWSVNGDTRVGLFALSDIKAGTELTFNYNLECLGNGKTVCKCGAPNCSGFLGVRPK---NQPIATEEKSKKFKKKQQGKRRTQGEIT-KEREDECFSCGDAGQLVS---CKKPGCPKVYHADCLNL--TKRPAGKWECPWHQCDICGKEAASFCEMCPSSFCKQHREGMLFISKLD 2197          
BLAST of NSD-1 vs. UniProt/SwissProt
Match: sp|O88491|NSD1_MOUSE (Histone-lysine N-methyltransferase, H3 lysine-36 specific OS=Mus musculus OX=10090 GN=Nsd1 PE=1 SV=1)

HSP 1 Score: 381.333 bits (978), Expect = 1.585e-110
Identity = 245/745 (32.89%), Postives = 357/745 (47.92%), Query Frame = 3
Query:  606 QEIIKREPIKYAFDELTLPFVSVKLTNKN-CRYCLETKNIVQCNKCLFNNFHVKCLEFLQNSIETKINDLDRCLECSLGIIRCYACYKIVDISNEQGFMRCIIKTCTKWFHTNCLET-GPMLEMTKFPKPGQLVCPCHICHKCELVNPSP-KYRCTKLIVCIMCPATFHTGDWCIPAGSVELNTGEIICPRHLVDLNFSMNIMVPPFVARVKSDLQERIYGNTLTKISEPMTITPSTVTKPTNVNWCFKCGEGGELLCCETCPAAYHFKCTDLKEIPQ-KFYCPDCASFCYRSYGEIVWIKCGTHPWWPGQILHLENVPKNIAAKKHANGQFVVQFFGSRDYMWRDHGNVFLYEKEDECNSKTSKYRYNNIFLEGIKEAAIGY----VTREEKWQSGSCDHVMNSKIYNKIQVNK--CPLELRRKVVPETPHCNCISFDPKSDCSIGSGCFNVASKCECDPQICNLGDKCKNQNFVKRIYPKQYTFWANDRGWGLKADEFIKTKQFVNEYIGEIITMEESEKRILWANENNITDFYFMELDNGRLIDARQFSNLSRFINNSCDPNLVAEKWIVNREHRIGLFALRDIQKGEELTFQYNLQNKSSNRIVCKCFSVNCSGFLGEAPKMAXXXXXXXXXXXXXXXXXXXXXXXCKSFLTDKNSNSQCFRCGEIIDMLSSIVCSVGPCMKTYHSVCLNLNMANYVQSSWICPHHYCDVCARPSHHFSSNTTESYCNKD-----FIKKFN 2795
            +E ++ +P   A  +L +         +N C+ C +   ++ C       FH++CL   +      I     C EC  GI  C+ C +     + +   RC++  C K++H  C++   P +   K        CP HIC  C   NP+       +L+ C+ CP  +H  D+C+ AGS  L +  IICP H              F  R      E +                       NV+WCF C EGG LLCC++CPAA+H +C ++ +IP+  +YC DC +     Y EIVW+K G + WWP +I H   VP NI   +H  G+F V FFGS DY+W     VF Y + D  +        +  + + ++EAA  +      +E +       +      Y  I+VN+    +++    + E P CNC + D ++ C I S C N     EC P +C  G +C+NQ F KR YP    F    RGWGL+    IK  +FVNEY+GE+I  EE   RI +A E++IT+FY + LD  R+IDA    N +RF+N+ C PN   +KW VN + R+GLFAL DI+ G ELTF YNL+   + + VCKC + NCSGFLG  PK      + ++   +        +   +  +T K    +CF CG+   ++S   C    C K YH+ CLNL         W CP H CDVC + +  F      S+C +      FI K +
Sbjct: 1414 EEGVEHDPGMSASKKLQVERGGGAALKENVCQNCEKLGELLLCEAQCCGAFHLECLGLPEMPRGKFI-----CNECHTGIHTCFVCKQ-----SGEDVKRCLLPLCGKFYHEECVQKYPPTVTQNKG-----FRCPLHICITCHAANPANVSASKGRLMRCVRCPVAYHANDFCLAAGSKILASNSIICPNH--------------FTPRRGCRNHEHV-----------------------NVSWCFVCSEGGSLLCCDSCPAAFHRECLNI-DIPEGNWYCNDCKAGKKPHYREIVWVKVGRYRWWPAEICHPRAVPSNIDKMRHDVGEFPVLFFGSNDYLWTHQARVFPYMEGDVSSKDKMGKGVDGTYKKALQEAAARFEELKARKELRQLQEDRKNDKKPPPYKHIKVNRPIGRVQIFTADLSEIPRCNCKATD-ENPCGIDSECINRMLLYECHPTVCPAGVRCQNQCFSKRQYPDVEIFRTLQRGWGLRTKTDIKKGEFVNEYVGELIDEEECRARIRYAQEHDITNFYMLTLDKDRIIDAGPKGNYARFMNHCCQPNCETQKWSVNGDTRVGLFALSDIKAGTELTFNYNLECLGNGKTVCKCGAPNCSGFLGVRPK---NQPIVTEEKSRKFKRKPHGKRRSQGEVT-KEREDECFSCGDAGQLVS---CKKPGCPKVYHADCLNL--TKRPAGKWECPWHQCDVCGKEAASFCEMCPSSFCKQHREGMLFISKLD 2095          
BLAST of NSD-1 vs. UniProt/SwissProt
Match: sp|Q6P2L6|NSD3_MOUSE (Histone-lysine N-methyltransferase NSD3 OS=Mus musculus OX=10090 GN=Nsd3 PE=1 SV=2)

HSP 1 Score: 358.221 bits (918), Expect = 7.865e-104
Identity = 242/730 (33.15%), Postives = 348/730 (47.67%), Query Frame = 3
Query:  693 CRYCLETKN-IVQCNKCLFNNFHVKCLEFLQNSIETKINDLD-RCLECSLGIIRCYACYKIVDISNEQGFMRCIIKTCTKWFHTNCLETGP--MLEMTKFPKPGQLVCPCHICHKCELVNPSPKYRCTKLIVCIMCPATFHTGDWCIPAGSVELNTGEIICPRHLVDLNFSMNIMVP-------PFVARVKSDLQERIYG----------NTLTKISEPMTITPSTVTKPTNVNWCFKCGEGGELLCCETCPAAYHFKCTDLKEIPQK-FYCPDCASFCYRSYGEIVWIKCGTHP---WWPGQILHLENVPKNIAAKKHANGQFVVQFFGSRDYMWRDHGNVFLYEKEDECNSKTSKYRYNNIFLEGIKEAAIGYVTREEKWQSGSC-------------DHVMNSKIYNKIQVNKCPLELRRKVVPETPHCNCISFDPKSDCSIGSGCFNVASKCECDPQICNLGDKCKNQNFVKRIYPKQYTFWANDRGWGLKADEFIKTKQFVNEYIGEIITMEESEKRILWANENNITDFYFMELDNGRLIDARQFSNLSRFINNSCDPNLVAEKWIVNREHRIGLFALRDIQKGEELTFQYNLQNKSSNRIVCKCFSVNCSGFLGEAPKMAXXXXXXXXXXXXXXXXXXXXXXXCKSFLTDKNSNSQCFRCGEIIDMLSSIVCSVGPCMKTYHSVCLNLNMANYVQSSWICPHHYCDVCARPSHHFSSNTTESYC 2768
            C+ C +  + +V C      +FHV+CL        T + +    C EC  G   C++C     +S +    RC +  C K++H  C+   P  + E   F       CP H C  C +     K    +++ C+ CP  +H GD C+ AGSV +++  +IC  H    + S  I V          + +  SD     Y           N    +  PM  + S   K        +C +GG LLCCE+CPA++H +C  + ++P+  + C DC +     Y +IVW+K G +    WWP +I    +VP NI   KH  G F V FFGS DY W   G VF Y + D+ +    +   N  F + ++EAA  +   + + +S                 H+  +K+  K+QV    L        E P CNC   D ++ C + S C N  S+ EC PQ+C  GD+C+NQ F KR+YP         RGWGL+    IK  +FVNEY+GE+I  EE   RI  A+EN++T+FY + +   R+IDA    N SRF+N+SC+PN   +KW VN + R+GLFAL DI  G ELTF YNL    + R VC C + NCSGFLG  PK A  S +   T         + ++  K    D      CF+CG+  ++   ++C    C K YH +CLNL    +    W CP H CD C   +  F      S+C
Sbjct:  704 CQVCEKAGDCLVACEGECCRHFHVECLGL------TAVPEGHFTCEECETGQHPCFSC----KVSGKD-VKRCSVSVCGKFYHEACVRKFPTAIFESKGF------RCPQHCCSSCSMEKDIHKASKGRMMRCLRCPVAYHVGDACVAAGSVSVSSHILICSNHSKRSSQSAAINVGFCFVCARGLIVQDHSDPMFSSYAYKSHYLLSESNRAELMKLPMIPSSSASKK--------RCEKGGRLLCCESCPASFHPECLSI-DMPEGCWNCNDCKAGKKLHYKQIVWVKLGNYRQVLWWPAEICSPRSVPLNIQGLKHDLGDFPVFFFGSHDYYWVHQGRVFPYVEGDK-HFAEGQTSINKTFKKALEEAAKRFQELKAQRESKEALEMERTSRKPPPYKHIKANKVIGKVQVQVADLS-------EIPRCNCKPGD-ENPCGLESQCLNRMSQYECHPQVCPAGDRCQNQCFTKRLYPDAEVIKTERRGWGLRTKRSIKKGEFVNEYVGELIDEEECRLRIKRAHENSVTNFYMLTVTKDRIIDAGPKGNYSRFMNHSCNPNCETQKWTVNGDVRVGLFALCDIPAGMELTFNYNLDCLGNGRTVCHCGADNCSGFLGVRPKSACTSAVDEKTKNAKLKKRRKVKAEAKPIHED-----YCFQCGDGGEL---VMCDKKDCPKAYHLLCLNLTQPPH--GKWECPWHRCDECGSVAVSFCEFCPHSFC 1388          
BLAST of NSD-1 vs. TrEMBL
Match: H9CXT1 (NSD-1 OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 1726.07 bits (4469), Expect = 0.000e+0
Identity = 914/914 (100.00%), Postives = 914/914 (100.00%), Query Frame = 3
Query:   57 MLFXXXXXXXXXXXMFKEXXXXXXXXXXXXXXXXXXXRTEDSRSKSYKVGQIICGKVGKYPWWPCMVNTIPTSNEPRVLVSYFGKKNDYSYLFDDCTMYAQTKSDFENIFKLHNHDKKTLARLAHYKKQLDLAWKEVEIASLLDENSRFELYKIKCEIKESINXXXXXXXXXXXXXXXXXXXXQEIIKREPIKYAFDELTLPFVSVKLTNKNCRYCLETKNIVQCNKCLFNNFHVKCLEFLQNSIETKINDLDRCLECSLGIIRCYACYKIVDISNEQGFMRCIIKTCTKWFHTNCLETGPMLEMTKFPKPGQLVCPCHICHKCELVNPSPKYRCTKLIVCIMCPATFHTGDWCIPAGSVELNTGEIICPRHLVDLNFSMNIMVPPFVARVKSDLQERIYGNTLTKISEPMTITPSTVTKPTNVNWCFKCGEGGELLCCETCPAAYHFKCTDLKEIPQKFYCPDCASFCYRSYGEIVWIKCGTHPWWPGQILHLENVPKNIAAKKHANGQFVVQFFGSRDYMWRDHGNVFLYEKEDECNSKTSKYRYNNIFLEGIKEAAIGYVTREEKWQSGSCDHVMNSKIYNKIQVNKCPLELRRKVVPETPHCNCISFDPKSDCSIGSGCFNVASKCECDPQICNLGDKCKNQNFVKRIYPKQYTFWANDRGWGLKADEFIKTKQFVNEYIGEIITMEESEKRILWANENNITDFYFMELDNGRLIDARQFSNLSRFINNSCDPNLVAEKWIVNREHRIGLFALRDIQKGEELTFQYNLQNKSSNRIVCKCFSVNCSGFLGEAPKMAXXXXXXXXXXXXXXXXXXXXXXXCKSFLTDKNSNSQCFRCGEIIDMLSSIVCSVGPCMKTYHSVCLNLNMANYVQSSWICPHHYCDVCARPSHHFSSNTTESYCNKDFIKKFNS 2798
            MLFNSIIINSISYNMFKELTNLNNNSSNVSLLSTSSNRTEDSRSKSYKVGQIICGKVGKYPWWPCMVNTIPTSNEPRVLVSYFGKKNDYSYLFDDCTMYAQTKSDFENIFKLHNHDKKTLARLAHYKKQLDLAWKEVEIASLLDENSRFELYKIKCEIKESINPPKKRIRPPKPKKEKAASKPQEIIKREPIKYAFDELTLPFVSVKLTNKNCRYCLETKNIVQCNKCLFNNFHVKCLEFLQNSIETKINDLDRCLECSLGIIRCYACYKIVDISNEQGFMRCIIKTCTKWFHTNCLETGPMLEMTKFPKPGQLVCPCHICHKCELVNPSPKYRCTKLIVCIMCPATFHTGDWCIPAGSVELNTGEIICPRHLVDLNFSMNIMVPPFVARVKSDLQERIYGNTLTKISEPMTITPSTVTKPTNVNWCFKCGEGGELLCCETCPAAYHFKCTDLKEIPQKFYCPDCASFCYRSYGEIVWIKCGTHPWWPGQILHLENVPKNIAAKKHANGQFVVQFFGSRDYMWRDHGNVFLYEKEDECNSKTSKYRYNNIFLEGIKEAAIGYVTREEKWQSGSCDHVMNSKIYNKIQVNKCPLELRRKVVPETPHCNCISFDPKSDCSIGSGCFNVASKCECDPQICNLGDKCKNQNFVKRIYPKQYTFWANDRGWGLKADEFIKTKQFVNEYIGEIITMEESEKRILWANENNITDFYFMELDNGRLIDARQFSNLSRFINNSCDPNLVAEKWIVNREHRIGLFALRDIQKGEELTFQYNLQNKSSNRIVCKCFSVNCSGFLGEAPKMAKVSKLKSDTSKKSKGDTTESESSCKSFLTDKNSNSQCFRCGEIIDMLSSIVCSVGPCMKTYHSVCLNLNMANYVQSSWICPHHYCDVCARPSHHFSSNTTESYCNKDFIKKFNS
Sbjct:    1 MLFNSIIINSISYNMFKELTNLNNNSSNVSLLSTSSNRTEDSRSKSYKVGQIICGKVGKYPWWPCMVNTIPTSNEPRVLVSYFGKKNDYSYLFDDCTMYAQTKSDFENIFKLHNHDKKTLARLAHYKKQLDLAWKEVEIASLLDENSRFELYKIKCEIKESINPPKKRIRPPKPKKEKAASKPQEIIKREPIKYAFDELTLPFVSVKLTNKNCRYCLETKNIVQCNKCLFNNFHVKCLEFLQNSIETKINDLDRCLECSLGIIRCYACYKIVDISNEQGFMRCIIKTCTKWFHTNCLETGPMLEMTKFPKPGQLVCPCHICHKCELVNPSPKYRCTKLIVCIMCPATFHTGDWCIPAGSVELNTGEIICPRHLVDLNFSMNIMVPPFVARVKSDLQERIYGNTLTKISEPMTITPSTVTKPTNVNWCFKCGEGGELLCCETCPAAYHFKCTDLKEIPQKFYCPDCASFCYRSYGEIVWIKCGTHPWWPGQILHLENVPKNIAAKKHANGQFVVQFFGSRDYMWRDHGNVFLYEKEDECNSKTSKYRYNNIFLEGIKEAAIGYVTREEKWQSGSCDHVMNSKIYNKIQVNKCPLELRRKVVPETPHCNCISFDPKSDCSIGSGCFNVASKCECDPQICNLGDKCKNQNFVKRIYPKQYTFWANDRGWGLKADEFIKTKQFVNEYIGEIITMEESEKRILWANENNITDFYFMELDNGRLIDARQFSNLSRFINNSCDPNLVAEKWIVNREHRIGLFALRDIQKGEELTFQYNLQNKSSNRIVCKCFSVNCSGFLGEAPKMAKVSKLKSDTSKKSKGDTTESESSCKSFLTDKNSNSQCFRCGEIIDMLSSIVCSVGPCMKTYHSVCLNLNMANYVQSSWICPHHYCDVCARPSHHFSSNTTESYCNKDFIKKFNS 914          
BLAST of NSD-1 vs. TrEMBL
Match: A0A2T7PCE1 (Uncharacterized protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_10357 PE=4 SV=1)

HSP 1 Score: 411.379 bits (1056), Expect = 1.659e-120
Identity = 246/703 (34.99%), Postives = 351/703 (49.93%), Query Frame = 3
Query:  693 CRYCLETKNIVQCNKCLFNNFHVKCLEFLQNSIETKINDLDRCLECSLGIIRCYACYKIVDISNEQGFMRCIIKTCTKWFHTNCLETGPMLEMTKFPKPGQLVCPCHICHKCELVN-PSPKYRCTKLIVCIMCPATFHTGDWCIPAGSVELNTGEIICPRHLVDLNFSMNIMVPPFVARVKSDLQERIYGNTLTKISEPMTITPSTVTKPTNVNWCFKCGEGGELLCCETCPAAYHFKCTDLKEIPQK-FYCPDCASFCYRSYGEIVWIKCGTHPWWPGQILHLENVPKNIAAKKHANGQFVVQFFGSRDYMWRDHGNVFLYEKEDECNSKTSKYR-YNNIFLEGIKEAAIGYV------TREEKWQSGSCDHVMNSKIYNKIQVNKCPLELRRKVVPETPHCNCISFDPKSDCSIGSGCFNVASKCECDPQICNLGDKCKNQNFVKRIYPKQYTFWANDRGWGLKADEFIKTKQFVNEYIGEIITMEESEKRILWANENNITDFYFMELDNGRLIDARQFSNLSRFINNSCDPNLVAEKWIVNREHRIGLFALRDIQKGEELTFQYNLQNKSSNRIVCKCFSVNCSGFLGEAPKMAXXXXXXXXXXXXXXXXXXXXXXXCKSFLTDKNSNSQCFRCGEIIDMLSSIVCSVGPCMKTYHSVCLNLNMANYVQSSWICPHHYCDVCARPSHHFSSNTTESYCNK 2774
            C  C +   +++C+    + FH  CL+ L+   E       RC EC  GI  C+AC K      ++   RC +  C K++H  C++  P   M    +    +CP H+C  C   N  +PK    +L+ C+ CP  +H GD+CI AGS  L    I+C  H   L    + +              RI                       NV+WCF C +GG L+CCETCPAA+H +C  L  +P+  +YC DCA      YG+I+WIK G + WWPG+I H  NVP NI  K H  G+F V+FFGS D+ W   G VFL+++ D  +   S  R    ++ +G+KEA   +         +E+ +    D       + K  V    +++ +  + E P C C   D ++ C   + C N     EC PQ+C   + C NQ F KR YP    +    RGWGLK    IK  QFV EY+G+++  +E ++RI  A+E NIT+FY + LD  R+IDA    N SRF+N+SC+PNL  +KW VN + R+GLF L+DI  G ELTF YNL+   + +  C C S  CSGFLG  PK A  + ++    +K      +     K     K    +CFRCGE  ++   ++C    C K YH  CLNL  A      W+CP H+CDVC + ++   S    S+C +
Sbjct:  592 CTVCEQAGELIECHGPCQSYFHTSCLK-LEKEPEADF----RCSECCAGIHSCFACKK-----QDKEVRRCSVSQCGKFYHEECVKKLPQARM----EGKGFICPLHVCATCAADNIRNPKAVKGRLLRCVRCPTAYHVGDFCIAAGSKHLAGYHIVCSGHFKPLKSQAHHV--------------RI-----------------------NVSWCFSCSKGGSLVCCETCPAAFHIECAHLDSMPEDAWYCSDCAHGKRPLYGDIIWIKIGNYRWWPGEICHPRNVPVNIQEKAHQVGEFPVRFFGSHDFYWTHQGRVFLFQEGDRGSKDISACRGLFKMYCKGVKEATEAFKLWKAAKMNKEQLEQERNDRKPAPYKFVKANVPVGNVQIHKADLSEIPRCECRP-DQENPCGSDTECLNRMLMYECHPQVCPAKESCHNQRFQKRQYPDLLPYRTESRGWGLKTLMDIKKGQFVIEYVGDLVDEDECKRRIAQAHEENITNFYMLTLDKNRIIDAGPKGNYSRFMNHSCEPNLETQKWTVNGDIRVGLFTLKDIPAGSELTFNYNLECLGNEKTKCSCGSDICSGFLGVRPKTAAAAHMEKRKREKDARKKKKK----KKLDVKKEHEDECFRCGEGGEL---VMCDKPNCPKVYHLQCLNL--AKPPHGKWLCPWHHCDVCGKLANKLCSECPNSFCQQ 1233          
BLAST of NSD-1 vs. TrEMBL
Match: A0A267ERM7 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig026212g1 PE=4 SV=1)

HSP 1 Score: 403.675 bits (1036), Expect = 2.243e-120
Identity = 256/749 (34.18%), Postives = 356/749 (47.53%), Query Frame = 3
Query:  633 KYAFDELTLPFVSVKLTNKNCRYCLETKNIVQCNKCLFNNFHVKCLEFLQNSIETKINDL--DRCLECSLGIIRCYACYKIVDISNEQGFMRCIIKTCTKWFHTNCLETGPMLEMTKFPKPGQLVCPCHICHKCELVNPSP----KYRCT---KLIVCIMCPATFHTGDWCIPAGSVELNTGEIICPRHLVDLNFSMNIMVPPFVARVKSDLQERIYGNTLTKISEPMTITPSTVTKPTNVNWCFKCGEGGELLCCETCPAAYHFKCTDLKEIPQKFYCPDCASFCYRSYGEIVWIKCGTHPWWPGQILHLENVPKNIAAKKHANGQFVVQFFGSRDYMWRDHGNVFLYEKED--ECNSKTSKYRYNNIFLEGIKEAAIG-YVTREEKWQSGSCDHVMNSKIYNKIQVNKCPLELRR----KVVPETPHCNCISFDPKSDCSIGSGCFNVASKCECDPQICNLGDKCKNQNFVKRIYPKQYTFWAND--RGWGLKADEFIKTKQFVNEYIGEIITMEESEKRILWANENNITDFYFMELDNGRLIDARQFSNLSRFINNSCDPNLVAEKWIVNREHRIGLFALRDIQKGEELTFQYNLQNKSSNRIVCKCFSVNCSGFLGEAPKMAX-------------------XXXXXXXXXXXXXXXXXXXXXXCKSFLTDKNSNSQCFRCGEIIDMLSSIVCSVGPCMKTYHSVCLNLNMANYVQSSWICPHHYCDVCARPSHHFSSNTTESYC 2768
            ++ F  L     SVK     C  C     ++ C+ C    FH  CL     + +    +    +C +C+ G   C+ C +    + ++  +RC I  C K +H  C  + P  ++        LVCP H C  C +  PS       R T   KL+ C+ CPA +H GD+C+PAGS EL+   I+CP HL D                                            K  NV WCF C +GG L+CCE CPA++H +C  L E+P++F C DC       YG+IVW+K G   WWP +IL+ ++ P NI    H  G F V FFG+ +Y W   G VF +E  D  +        R   +F EG++ A     + RE +      +       Y  I+ N  P    R      + E   C+C S D +  C   S C N     EC P +C   D+C NQ FVKR YP Q  F  N   RGWGLKA + I   +FVNEY+G++I  EE++KR+ WA+++ +T+FY + LD GR+IDA    NLSRF+N+SC PNLV +KW VN + RIGLFALRDI+ GEELTF YN +   + ++ C+C + NCSGFLG  P+ +                     ++      +     +  + + CK    D      C+RC +  +M   I+C    C K YH  CL L+ A      W CP H+CD C RP+    S    SYC
Sbjct:  334 RFEFQRLLHAPSSVKRA-PVCSKCELGGEVIPCDSCCLQ-FHAVCLADGAAAADAADGEAGAKKCADCAAGRQLCFLCKQD---AGDKRMLRCHINGCGKQYHDACAGSMPFAKVESR----GLVCPQHACLACCVDAPSSAPGSSGRATGAAKLVRCVRCPAAYHGGDFCVPAGSEELSETCIVCPEHLRD-----------------------------------------KAAKTINVAWCFICSQGGSLVCCERCPASFHPECLKLSELPEQFTCDDCRMGRQPRYGDIVWVKVGHFRWWPCEILYPDHAPLNIQRMAHQKGTFPVHFFGTDEYYWVHKGRVFEFEDGDLGDLRKTQGSSRLVQLFKEGVRLAQEACRLFREMRENRDKMEQSKKPPPYKFIRTNY-PFGNARVYKAADLSELHRCDC-SADSQEPCGSDSDCMNRVLYYECHPGLCAAKDRCLNQRFVKREYPTQAVFKTNQGGRGWGLKAMQDIAKGEFVNEYVGDLIDEEEAKKRLSWAHDHGVTNFYMLTLDKGRIIDAGPKGNLSRFMNHSCSPNLVTQKWSVNGDLRIGLFALRDIKAGEELTFNYNFECLGAEKLACQCGAENCSGFLGVRPRSSANLLRDAAASSGGGGGGGGDGAESGKKRRRTKGVASGTTGAVCKVVYED-----TCYRCCDGGEM---IMCDKEACPKVYHLGCLGLSKAP--SGKWYCPWHHCDECGRPATVLCSECPGSYC 1020          
BLAST of NSD-1 vs. TrEMBL
Match: A0A267FZR2 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig014479g2 PE=4 SV=1)

HSP 1 Score: 403.675 bits (1036), Expect = 2.618e-120
Identity = 256/749 (34.18%), Postives = 356/749 (47.53%), Query Frame = 3
Query:  633 KYAFDELTLPFVSVKLTNKNCRYCLETKNIVQCNKCLFNNFHVKCLEFLQNSIETKINDL--DRCLECSLGIIRCYACYKIVDISNEQGFMRCIIKTCTKWFHTNCLETGPMLEMTKFPKPGQLVCPCHICHKCELVNPSP----KYRCT---KLIVCIMCPATFHTGDWCIPAGSVELNTGEIICPRHLVDLNFSMNIMVPPFVARVKSDLQERIYGNTLTKISEPMTITPSTVTKPTNVNWCFKCGEGGELLCCETCPAAYHFKCTDLKEIPQKFYCPDCASFCYRSYGEIVWIKCGTHPWWPGQILHLENVPKNIAAKKHANGQFVVQFFGSRDYMWRDHGNVFLYEKED--ECNSKTSKYRYNNIFLEGIKEAAIG-YVTREEKWQSGSCDHVMNSKIYNKIQVNKCPLELRR----KVVPETPHCNCISFDPKSDCSIGSGCFNVASKCECDPQICNLGDKCKNQNFVKRIYPKQYTFWAND--RGWGLKADEFIKTKQFVNEYIGEIITMEESEKRILWANENNITDFYFMELDNGRLIDARQFSNLSRFINNSCDPNLVAEKWIVNREHRIGLFALRDIQKGEELTFQYNLQNKSSNRIVCKCFSVNCSGFLGEAPKMAX-------------------XXXXXXXXXXXXXXXXXXXXXXCKSFLTDKNSNSQCFRCGEIIDMLSSIVCSVGPCMKTYHSVCLNLNMANYVQSSWICPHHYCDVCARPSHHFSSNTTESYC 2768
            ++ F  L     SVK     C  C     ++ C+ C    FH  CL     + +    +    +C +C+ G   C+ C +    + ++  +RC I  C K +H  C  + P  ++        LVCP H C  C +  PS       R T   KL+ C+ CPA +H GD+C+PAGS EL+   I+CP HL D                                            K  NV WCF C +GG L+CCE CPA++H +C  L E+P++F C DC       YG+IVW+K G   WWP +IL+ ++ P NI    H  G F V FFG+ +Y W   G VF +E  D  +        R   +F EG++ A     + RE +      +       Y  I+ N  P    R      + E   C+C S D +  C   S C N     EC P +C   D+C NQ FVKR YP Q  F  N   RGWGLKA + I   +FVNEY+G++I  EE++KR+ WA+++ +T+FY + LD GR+IDA    NLSRF+N+SC PNLV +KW VN + RIGLFALRDI+ GEELTF YN +   + ++ C+C + NCSGFLG  P+ +                     ++      +     +  + + CK    D      C+RC +  +M   I+C    C K YH  CL L+ A      W CP H+CD C RP+    S    SYC
Sbjct:  334 RFEFQRLLHAPSSVKRA-PVCSKCELGGEVIPCDSCCLQ-FHAVCLADGAAAADAADGEAGAKKCADCAAGRQLCFLCKQD---AGDKRMLRCHINGCGKQYHDACAGSMPFAKVESR----GLVCPQHACLACCVDAPSSAPGSSGRATGAAKLVRCVRCPAAYHGGDFCVPAGSEELSETCIVCPEHLRD-----------------------------------------KAAKTINVAWCFICSQGGSLVCCERCPASFHPECLKLSELPEQFTCDDCRMGRQPRYGDIVWVKVGHFRWWPCEILYPDHAPLNIQRMAHQKGTFPVHFFGTDEYYWVHKGRVFEFEDGDLGDLRKTQGSSRLVQLFKEGVRLAQEACRLFREMRENRDKMEQSKKPPPYKFIRTNY-PFGNARVYKAADLSELHRCDC-SADSQEPCGSDSDCMNRVLYYECHPGLCAAKDRCLNQRFVKREYPTQAVFKTNQGGRGWGLKAMQDIAKGEFVNEYVGDLIDEEEAKKRLSWAHDHGVTNFYMLTLDKGRIIDAGPKGNLSRFMNHSCSPNLVTQKWSVNGDLRIGLFALRDIKAGEELTFNYNFECLGAEKLACQCGAENCSGFLGVRPRSSANLLRDAAASSGGGGGGGGDGAESGKKRRRTKGVASGTTGAVCKVVYED-----TCYRCCDGGEM---IMCDKEACPKVYHLGCLGLSKAP--SGKWYCPWHHCDECGRPATVLCSECPGSYC 1020          
BLAST of NSD-1 vs. TrEMBL
Match: A0A1I8IAL6 (Histone-lysine N-methyltransferase OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 403.675 bits (1036), Expect = 2.722e-120
Identity = 256/749 (34.18%), Postives = 356/749 (47.53%), Query Frame = 3
Query:  633 KYAFDELTLPFVSVKLTNKNCRYCLETKNIVQCNKCLFNNFHVKCLEFLQNSIETKINDL--DRCLECSLGIIRCYACYKIVDISNEQGFMRCIIKTCTKWFHTNCLETGPMLEMTKFPKPGQLVCPCHICHKCELVNPSP----KYRCT---KLIVCIMCPATFHTGDWCIPAGSVELNTGEIICPRHLVDLNFSMNIMVPPFVARVKSDLQERIYGNTLTKISEPMTITPSTVTKPTNVNWCFKCGEGGELLCCETCPAAYHFKCTDLKEIPQKFYCPDCASFCYRSYGEIVWIKCGTHPWWPGQILHLENVPKNIAAKKHANGQFVVQFFGSRDYMWRDHGNVFLYEKED--ECNSKTSKYRYNNIFLEGIKEAAIG-YVTREEKWQSGSCDHVMNSKIYNKIQVNKCPLELRR----KVVPETPHCNCISFDPKSDCSIGSGCFNVASKCECDPQICNLGDKCKNQNFVKRIYPKQYTFWAND--RGWGLKADEFIKTKQFVNEYIGEIITMEESEKRILWANENNITDFYFMELDNGRLIDARQFSNLSRFINNSCDPNLVAEKWIVNREHRIGLFALRDIQKGEELTFQYNLQNKSSNRIVCKCFSVNCSGFLGEAPKMAX-------------------XXXXXXXXXXXXXXXXXXXXXXCKSFLTDKNSNSQCFRCGEIIDMLSSIVCSVGPCMKTYHSVCLNLNMANYVQSSWICPHHYCDVCARPSHHFSSNTTESYC 2768
            ++ F  L     SVK     C  C     ++ C+ C    FH  CL     + +    +    +C +C+ G   C+ C +    + ++  +RC I  C K +H  C  + P  ++        LVCP H C  C +  PS       R T   KL+ C+ CPA +H GD+C+PAGS EL+   I+CP HL D                                            K  NV WCF C +GG L+CCE CPA++H +C  L E+P++F C DC       YG+IVW+K G   WWP +IL+ ++ P NI    H  G F V FFG+ +Y W   G VF +E  D  +        R   +F EG++ A     + RE +      +       Y  I+ N  P    R      + E   C+C S D +  C   S C N     EC P +C   D+C NQ FVKR YP Q  F  N   RGWGLKA + I   +FVNEY+G++I  EE++KR+ WA+++ +T+FY + LD GR+IDA    NLSRF+N+SC PNLV +KW VN + RIGLFALRDI+ GEELTF YN +   + ++ C+C + NCSGFLG  P+ +                     ++      +     +  + + CK    D      C+RC +  +M   I+C    C K YH  CL L+ A      W CP H+CD C RP+    S    SYC
Sbjct:  342 RFEFQRLLHAPSSVKRA-PVCSKCELGGEVIPCDSCCLQ-FHAVCLADGAAAADAADGEAGAKKCADCAAGRQLCFLCKQD---AGDKRMLRCHINGCGKQYHDACAGSMPFAKVESR----GLVCPQHACLACCVDAPSSAPGSSGRATGAAKLVRCVRCPAAYHGGDFCVPAGSEELSETCIVCPEHLRD-----------------------------------------KAAKTINVAWCFICSQGGSLVCCERCPASFHPECLKLSELPEQFTCDDCRMGRQPRYGDIVWVKVGHFRWWPCEILYPDHAPLNIQRMAHQKGTFPVHFFGTDEYYWVHKGRVFEFEDGDLGDLRKTQGSSRLVQLFKEGVRLAQEACRLFREMRENRDKMEQSKKPPPYKFIRTNY-PFGNARVYKAADLSELHRCDC-SADSQEPCGSDSDCMNRVLYYECHPGLCAAKDRCLNQRFVKREYPTQAVFKTNQGGRGWGLKAMQDIAKGEFVNEYVGDLIDEEEAKKRLSWAHDHGVTNFYMLTLDKGRIIDAGPKGNLSRFMNHSCSPNLVTQKWSVNGDLRIGLFALRDIKAGEELTFNYNFECLGAEKLACQCGAENCSGFLGVRPRSSANLLRDAAASSGGGGGGGGDGAESGKKRRRTKGVASGTTGAVCKVVYED-----TCYRCCDGGEM---IMCDKEACPKVYHLGCLGLSKAP--SGKWYCPWHHCDECGRPATVLCSECPGSYC 1028          
BLAST of NSD-1 vs. Ensembl Cavefish
Match: nsd2 (nuclear receptor binding SET domain protein 2 [Source:ZFIN;Acc:ZDB-GENE-030131-2581])

HSP 1 Score: 393.66 bits (1010), Expect = 1.083e-117
Identity = 241/698 (34.53%), Postives = 342/698 (49.00%), Query Frame = 3
Query:  693 CRYCLET-KNIVQCNKCLFNNFHVKCLEFLQNSIETKINDLDRCLECSLGIIRCYACYKIVDISNEQGFMRCIIKTCTKWFHTNCLETGPMLEMTKFPKPGQLVCPCHICHKCELVN-PSPKYRCTKLIVCIMCPATFHTGDWCIPAGSVELNTGEIICPRHL-VDLNFSMNIMVPPFVARVKSDLQERIYGNTLTKISEPMTITPSTVTKPTNVNWCFKCGEGGELLCCETCPAAYHFKCTDLKEIPQKFYCPDCASFCYRSYGEIVWIKCGTHPWWPGQILHLENVPKNIAAKKHANGQFVVQFFGSRDYMWRDHGNVFLYEKEDECNSKTSKYRYNNIFLEGIKEAAIGYVT-REEKWQSGSCDHVMNSKIYNKIQVNK--CPLELRRKVVPETPHCNCISFDPKSDCSIGSGCFNVASKCECDPQICNLGDKCKNQNFVKRIYPKQYTFWANDRGWGLKADEFIKTKQFVNEYIGEIITMEESEKRILWANENNITDFYFMELDNGRLIDARQFSNLSRFINNSCDPNLVAEKWIVNREHRIGLFALRDIQKGEELTFQYNLQNKSSNRIVCKCFSVNCSGFLGEAPKMAXXXXXXXXXXXXXXXXXXXXXXXCKSFLTDKNSNSQCFRCGEIIDMLSSIVCSVGPCMKTYHSVCLNLNMANYVQSSWICPHHYCDVCARPSHHFSSNTTESYC 2768
            C+ C +T +++V C    F  +H++CL     +      D   C  C  G+  C+ C +     +E    RC +  C K++H  CL    +  +T F   G   CP H C  C   N  + K    K+I C+ CP  +H GD C+ AGS  L +  I+C  H      +S +  V                                      NV+WCF C +GG LLCCE+CPAA+H  C ++      ++C DC S     Y +I+W+K G + WWP +I H  N+P NI   +H  G+F V FFGS+DY W   G VF Y + D   S+  +     +F   + EA   +   + E+    + ++      Y  I+ NK    +++    + E P CNC   D +  CS  S C N     EC PQ+C  G++C NQ+F KR+YP+  T     +GWGL     IK  +FVNEY+GE+I  EE   RI +A EN+IT FY + ++  R+IDA    N SRF+N+SC PN   +KW VN + R+GLFA+ DI  G ELTF YNL    + + VC+C + NCSGFLG+ PK+A  S+ KS   KK                  K S  +CFRCG+   +   ++C    C K YH  CL+     +    W CP H+CDVC +PS  F  +   S+C
Sbjct:  686 CQVCEKTSEDLVTCEGHCFATYHLQCLGLDHPT------DKVLCTACRTGVHACFTCKQ-----SEGEVKRCSVLHCGKYYHEACLR---LSALTVFDNRG-FRCPLHTCLSCHYSNRGTAKATKGKMIRCLRCPVAYHAGDLCVAAGSEMLTSTAIVCTNHFNPKKGYSHHSHV--------------------------------------NVSWCFICSKGGRLLCCESCPAAFHPDCLNIAMPDGSWFCNDCRSGKKPKYRDIIWVKLGNYRWWPAEIRHPRNIPTNIQHLRHEIGEFPVYFFGSKDYFWTHQGRVFPYIEGDR-GSRHQRNGIGKVFKTALLEAETRFKQIKMEREAKEAHENNKKPPPYKYIKTNKPCGRVQIYTADISEIPKCNCKPTDERP-CSFESECLNRMLLYECHPQVCPAGERCMNQDFTKRLYPETKTIRTAGKGWGLLTLRDIKKGEFVNEYVGELIDEEECRARIRYAQENDITHFYMLTINKDRIIDAGPKGNYSRFMNHSCQPNCETQKWTVNGDTRVGLFAVCDIPTGTELTFNYNLDCLGNEKTVCRCGAPNCSGFLGDRPKIAPTSESKSKPQKKKPRKRRARSEG------KKQSEDECFRCGDGGQL---VLCDKKGCTKAYHLSCLDRTKRPF--GRWDCPWHHCDVCGKPSDAFCQHCPNSFC 1317          
BLAST of NSD-1 vs. Ensembl Cavefish
Match: nsd2 (nuclear receptor binding SET domain protein 2 [Source:ZFIN;Acc:ZDB-GENE-030131-2581])

HSP 1 Score: 393.66 bits (1010), Expect = 2.209e-117
Identity = 241/698 (34.53%), Postives = 342/698 (49.00%), Query Frame = 3
Query:  693 CRYCLET-KNIVQCNKCLFNNFHVKCLEFLQNSIETKINDLDRCLECSLGIIRCYACYKIVDISNEQGFMRCIIKTCTKWFHTNCLETGPMLEMTKFPKPGQLVCPCHICHKCELVN-PSPKYRCTKLIVCIMCPATFHTGDWCIPAGSVELNTGEIICPRHL-VDLNFSMNIMVPPFVARVKSDLQERIYGNTLTKISEPMTITPSTVTKPTNVNWCFKCGEGGELLCCETCPAAYHFKCTDLKEIPQKFYCPDCASFCYRSYGEIVWIKCGTHPWWPGQILHLENVPKNIAAKKHANGQFVVQFFGSRDYMWRDHGNVFLYEKEDECNSKTSKYRYNNIFLEGIKEAAIGYVT-REEKWQSGSCDHVMNSKIYNKIQVNK--CPLELRRKVVPETPHCNCISFDPKSDCSIGSGCFNVASKCECDPQICNLGDKCKNQNFVKRIYPKQYTFWANDRGWGLKADEFIKTKQFVNEYIGEIITMEESEKRILWANENNITDFYFMELDNGRLIDARQFSNLSRFINNSCDPNLVAEKWIVNREHRIGLFALRDIQKGEELTFQYNLQNKSSNRIVCKCFSVNCSGFLGEAPKMAXXXXXXXXXXXXXXXXXXXXXXXCKSFLTDKNSNSQCFRCGEIIDMLSSIVCSVGPCMKTYHSVCLNLNMANYVQSSWICPHHYCDVCARPSHHFSSNTTESYC 2768
            C+ C +T +++V C    F  +H++CL     +      D   C  C  G+  C+ C +     +E    RC +  C K++H  CL    +  +T F   G   CP H C  C   N  + K    K+I C+ CP  +H GD C+ AGS  L +  I+C  H      +S +  V                                      NV+WCF C +GG LLCCE+CPAA+H  C ++      ++C DC S     Y +I+W+K G + WWP +I H  N+P NI   +H  G+F V FFGS+DY W   G VF Y + D   S+  +     +F   + EA   +   + E+    + ++      Y  I+ NK    +++    + E P CNC   D +  CS  S C N     EC PQ+C  G++C NQ+F KR+YP+  T     +GWGL     IK  +FVNEY+GE+I  EE   RI +A EN+IT FY + ++  R+IDA    N SRF+N+SC PN   +KW VN + R+GLFA+ DI  G ELTF YNL    + + VC+C + NCSGFLG+ PK+A  S+ KS   KK                  K S  +CFRCG+   +   ++C    C K YH  CL+     +    W CP H+CDVC +PS  F  +   S+C
Sbjct:  733 CQVCEKTSEDLVTCEGHCFATYHLQCLGLDHPT------DKVLCTACRTGVHACFTCKQ-----SEGEVKRCSVLHCGKYYHEACLR---LSALTVFDNRG-FRCPLHTCLSCHYSNRGTAKATKGKMIRCLRCPVAYHAGDLCVAAGSEMLTSTAIVCTNHFNPKKGYSHHSHV--------------------------------------NVSWCFICSKGGRLLCCESCPAAFHPDCLNIAMPDGSWFCNDCRSGKKPKYRDIIWVKLGNYRWWPAEIRHPRNIPTNIQHLRHEIGEFPVYFFGSKDYFWTHQGRVFPYIEGDR-GSRHQRNGIGKVFKTALLEAETRFKQIKMEREAKEAHENNKKPPPYKYIKTNKPCGRVQIYTADISEIPKCNCKPTDERP-CSFESECLNRMLLYECHPQVCPAGERCMNQDFTKRLYPETKTIRTAGKGWGLLTLRDIKKGEFVNEYVGELIDEEECRARIRYAQENDITHFYMLTINKDRIIDAGPKGNYSRFMNHSCQPNCETQKWTVNGDTRVGLFAVCDIPTGTELTFNYNLDCLGNEKTVCRCGAPNCSGFLGDRPKIAPTSESKSKPQKKKPRKRRARSEG------KKQSEDECFRCGDGGQL---VLCDKKGCTKAYHLSCLDRTKRPF--GRWDCPWHHCDVCGKPSDAFCQHCPNSFC 1364          
BLAST of NSD-1 vs. Ensembl Cavefish
Match: nsd1a (nuclear receptor binding SET domain protein 1a [Source:ZFIN;Acc:ZDB-GENE-080519-3])

HSP 1 Score: 382.489 bits (981), Expect = 5.021e-112
Identity = 245/726 (33.75%), Postives = 357/726 (49.17%), Query Frame = 3
Query:  669 SVKLTNKNCRYCLETKNIVQCNKCLFNNFHVKCLEFLQNSIETKINDLDR----CLECSLGIIRCYACYKIVDISNEQGFMRCIIKTCTKWFHTNCLETGPMLEMTKFPKPGQLVCPCHICHKCELVNPS-PKYRCTKLIVCIMCPATFHTGDWCIPAGSVELNTGEIICPRHLVDLNFSMNIMVPPFVARVKSDLQERIYGNTLTKISEPMTITPSTVTKPTNVNWCFKCGEGGELLCCETCPAAYHFKCTDLKEIPQ-KFYCPDCASFCYRSYGEIVWIKCGTHPWWPGQILHLENVPKNIAAKKHANGQFVVQFFGSRDYMWRDHGNVFLYEKEDECNSKTSKYRYNNIFLEGIKEAAIGY--VTREEKWQSGSCDHVMNSKI--YNKIQVNK--CPLELRRKVVPETPHCNCISFDPKSDCSIGSGCFNVASKCECDPQICNLGDKCKNQNFVKRIYPKQYTFWANDRGWGLKADEFIKTKQFVNEYIGEIITMEESEKRILWANENNITDFYFMELDNGRLIDARQFSNLSRFINNSCDPNLVAEKWIVNREHRIGLFALRDIQKGEELTFQYNLQNKSSNRIVCKCFSVNCSGFLGEAPKMAXXXXXXXXXXXXXXXXXXXXXXXCKSFLTDKNSNSQCFRCGEIIDMLSSIVCSVGPCMKTYHSVCLNLNMANYVQSSWICPHHYCDVCARPSHHFSSNTTESYCNKD-----FIKKFN 2795
            +  L    C+ C +   ++ C       FH++C+          ++++ R    C EC  G+  C+ C     +S E    RC++  C K++H  C+    +      P+     C  H+C  C + NP+ P     +L  C+ CP  +H  D+C+ AGSV L    I+CP H              F  R      E I                       NV+WCF C EGG LLCCE+CPAA+H +C ++ E+PQ  +YC DC +     Y +I+W+K G + WWP ++   +NVP+NI   KH  G+F V FFGS+DY+W      F Y + D  N +      + ++ + + EAA  +  +  E++ +    D   + K   Y  I+VN+    +++    + E P CNC + D ++ C + S C N     EC+PQ+C  G++C+NQ F KR Y     F    RGWGL++   IK   FV+EY+GE+I  EE   RI  A +N+I++FY + LD  R+IDA    N +RF+N+ C PN   +KW VN + R+GLFAL DI  G ELTF YNL+   + + VCKC + NCSGFLG  PK    S+ K    KK      +S+S        K    +CF CG+   ++S   C    C K YH+ CLNLN        W CP H C+ C R +  F      SYC +      FI K +
Sbjct: 1201 AASLKENVCQVCEQPGELLLCEGHCCGAFHLQCI---------GLSEMPRGRFVCKECKSGLHTCFVC----KLSGED-VRRCMVPVCGKFYHAECI----LKYAPTAPQNRGFRCSLHVCLACYITNPNNPSISKGRLTRCVRCPVAYHANDYCMAAGSVPLANNSILCPNH--------------FTPRKGCKNHEHI-----------------------NVSWCFVCSEGGSLLCCESCPAAFHRECLNI-EMPQDSWYCNDCRAGKKPQYKDILWVKVGRYRWWPAEVTLPKNVPENILRMKHEVGEFPVHFFGSKDYVWTYQARCFPYMEGDASNIEKMGKGTDAVYKKALNEAAERFRELQAEKEMRQLQEDRKNDKKPPPYKHIKVNRPIGKVQILTADLSEIPRCNCKATD-ETPCGMDSECINRMLMYECNPQVCAAGERCQNQCFTKREYSPVEIFRTLSRGWGLRSVSEIKKGAFVSEYVGEMIDEEECRARIKHAQDNDISNFYMLTLDKDRIIDAGPKGNEARFMNHCCQPNCETQKWTVNGDTRVGLFALEDIGAGVELTFNYNLECLGNGKTVCKCGAPNCSGFLGVRPKNQPPSEDKGRKLKKRVSGKRKSQSE-----VIKEREDECFYCGDSGQIIS---CKKPGCPKVYHADCLNLN--KRPAGRWECPWHQCNECGREAASFCEMCPNSYCKQHRDGMLFISKLD 1859          
BLAST of NSD-1 vs. Ensembl Cavefish
Match: nsd1b (nuclear receptor binding SET domain protein 1b [Source:ZFIN;Acc:ZDB-GENE-080519-2])

HSP 1 Score: 353.599 bits (906), Expect = 8.850e-110
Identity = 210/574 (36.59%), Postives = 295/574 (51.39%), Query Frame = 3
Query: 1065 KLIVCIMCPATFHTGDWCIPAGSVELNTGEIICPRHLVDLNFSMNIMVPPFVARVKSDLQERIYGNTLTKISEPMTITPSTVTKPTNVNWCFKCGEGGELLCCETCPAAYHFKCTDLKEIPQKFYCPDCASFCYRSYGEIVWIKCGTHPWWPGQILHLENVPKNIAAKKHANGQFVVQFFGSRDYMWRDHGNVFLYEKEDECNSKTSKYRYNNIFLEGIKEAAIGY--VTREEKWQSGSCDHVMNSKI--YNKIQVNK--CPLELRRKVVPETPHCNCISFDPKSDCSIGSGCFNVASKCECDPQICNLGDKCKNQNFVKRIYPKQYTFWANDRGWGLKADEFIKTKQFVNEYIGEIITMEESEKRILWANENNITDFYFMELDNGRLIDARQFSNLSRFINNSCDPNLVAEKWIVNREHRIGLFALRDIQKGEELTFQYNLQNKSSNRIVCKCFSVNCSGFLGEAPKMAXXXXXXXXXXXXXXXXXXXXXXXCKSFLTDKNSNSQCFRCGEIIDMLSSIVCSVGPCMKTYHSVCLNLNMANYVQSSWICPHHYCDVCARPSHHFSSNTTESYC 2768
            +L  C+ CP  +H  D+CIPAGSV L    I+CP H              F+ R      E +                       NV+WCF C EGG LLCCE+CPAA+H +C ++      ++C DC +     Y E+VW+K G + WWP ++ + +N+P+NI   +H  G+F V FFGS DY+W     VF Y + D  + +      ++++ + ++EAA  +  +  E++ +    D   + K   Y  I+ N+    +++    + E P CNC + D +S C + S C N     EC+PQ+C  G+KC+NQ F+KR Y +   F    RGWGL+    IK   FVNEY+GE+I  EE   RI  A EN+I +FY + LD  R+IDA    N +RF+N+SC PN   +KW VN + R+GLFAL DI  G ELTF YNL+   + + VCKC + NCSGFLG  PK    S  K    +K      + +         K    +CF CG+   M+S   C    C K YH+ CLNL         W CP H CD+C + S  F      SYC
Sbjct:   14 RLTRCVRCPIAYHATDYCIPAGSVILANNLILCPNH--------------FIPRKGCRNHEHV-----------------------NVSWCFVCSEGGSLLCCESCPAAFHRECLNIDMPEGSWFCNDCRAGKKPHYKEVVWVKVGRYRWWPAEVSNPKNIPENILRMRHDVGEFPVLFFGSNDYLWTYQARVFPYMEGDANSKEKMGKGVDSVYKKALEEAAKRFQELQAEKELRQLQEDRRNDKKPPPYKHIKANRPIGKVQIITADLSEIPRCNCRATD-ESPCGMDSECINRMLLYECNPQVCPAGEKCQNQRFLKREYSEVEIFRTLSRGWGLRGCHDIKKGDFVNEYVGEVIDEEECRARIRQAQENDIGNFYMLTLDKDRIIDAGPKGNEARFMNHSCQPNCETQKWTVNGDTRVGLFALVDISTGTELTFNYNLECLGNGKTVCKCGAPNCSGFLGVRPKNNPPSDDKGRKKRKGYMKRKQQQE------VTKEREDECFSCGDGGQMVS---CKRPGCPKVYHADCLNL--TKRPAGRWECPWHQCDLCGQESASFCEMCPSSYC 538          
BLAST of NSD-1 vs. Ensembl Cavefish
Match: nsd3 (nuclear receptor binding SET domain protein 3 [Source:ZFIN;Acc:ZDB-GENE-050324-2])

HSP 1 Score: 305.834 bits (782), Expect = 4.105e-87
Identity = 191/504 (37.90%), Postives = 260/504 (51.59%), Query Frame = 3
Query: 1284 PMTITPSTVTKPTNVNWCFKCGEGGELLCCETCPAAYHFKCTDLKEIPQKFY-CPDCASFCYRSYGEIVWIKCGTHPWWPGQILHLENVPKNIAAKKHANGQFVVQFFGSRDYMWRDHGNVFLYEKEDECNSKTSKYRYNNIFLEGIKEAAIGY----VTREEKWQSGSCDHVMNSKIYNKIQVNKCPLELRRKV--VPETPHCNCISFDPKSDCSIGSGCFNVASKCECDPQICNLGDKCKNQNFVKRIYPKQYTFWANDRGWGLKADEFIKTKQFVNEYIGEIITMEESEKRILWANENNITDFYFMELDNGRLIDARQFSNLSRFINNSCDPNLVAEKWIVNREHRIGLFALRDIQKGEELTFQYNLQNKSSNRIVCKCFSVNCSGFLGEAPKMAXXXXXXXXXXXXXXXXXXXXXXXCKSFLTDKNSNSQCFRCGEIIDMLSSIVCSVGPCMKTYHSVCLNLNMANYVQSSWICPHHYCDVCARPSHHFSSNTTESYCNK 2774
            PM  + S+ TK  NV      G+GG LLCCE CPA++H  C ++ E+P+  + C +C +     Y +IVW+K G + WWP +I +   VP NI + KH  G F V FFGS DY W   G VF Y + D+ N    +   N  F + ++EAA  +      RE K       +      Y  I+ NK   +++  V  + E P CNC   D +  C   S C N   + EC PQ+C   ++C NQ+F KR+YP       + RGWGLK  + +K   F+ EY+GE+I +EE  +RI  AN+N+IT+FY + L   R+IDA    NLSRF+N+SC PN   +KW VN + RIGLF L DI    ELTF YNL    + R  C C + NCSGFLG  PK A V + +                      + +     CF CGE  ++   ++C    C K YH +CLNL    Y    W CP H C VC RP+        ES+C +
Sbjct:  743 PMIPSSSSATK-KNV------GKGGRLLCCEACPASFHPSCLNI-EMPEGVWLCSECRAGKKPHYKQIVWVKLGNYRWWPAEICNPRLVPSNIQSLKHDVGDFPVFFFGSHDYYWIHQGRVFPYVESDK-NFAEGQVGINKTFKKALEEAAKRFQELKAQRETKEALEQERNSRRPPPYKLIKANKPVGKVQVHVADLSEVPRCNCRPTDERP-CGQDSQCLNRMLQYECHPQVCPAAERCLNQSFSKRVYPDTEVIKTSGRGWGLKTKQDLKKGDFIMEYVGELIDLEECRQRISHANKNHITNFYMLTLTKDRVIDAGPKGNLSRFMNHSCSPNCETQKWTVNGDIRIGLFTLCDIAADTELTFNYNLDCLGNGRTSCHCGAENCSGFLGVRPKSAVVMEREEKVKNSKLKAKKRK----LKLESRQTHEYYCFCCGEGGEL---VMCDRKDCPKAYHLLCLNLTKPPY--GRWECPWHQCSVCQRPASASCQFCPESFCRE 1227          
BLAST of NSD-1 vs. Ensembl Sea Lamprey
Match: nsd2 (nuclear receptor binding SET domain protein 2 [Source:ZFIN;Acc:ZDB-GENE-030131-2581])

HSP 1 Score: 375.555 bits (963), Expect = 1.614e-112
Identity = 240/696 (34.48%), Postives = 344/696 (49.43%), Query Frame = 3
Query:  717 NIVQCNKCLFNNFHVKCLEFLQNSIETKINDLDRCLECSLGIIRCYACYKIVDISNEQGFMRCIIKTCTKWFHTNCLE--TGPMLEMTKFPKPGQLVCPCHICHKCELVNP-SPKYRCTKLIVCIMCPATFHTGDWCIPAGSVELNTGEIICPRHL----------VDLNF----SMNIMVPPFV-ARVKSDLQERIYGNTLTKISEPMTITPSTVTKPTNVNWCFKCGEGGELLCCETCPAAYHFKCTDLKEIPQKFYCPDCASFCYRSYGEIVWIKCGTHPWWPGQILHLENVPKNIAAKKHANGQFVVQFFGSRDYMWRDHGNVFLYEKEDECNSKTSKYRYNNIFLEGIKEAAIGYVTREEKWQSGSCDHVMNSK----IYNKIQVNK--CPLELRRKVVPETPHCNCISFDPKSDCSIGSGCFNVASKCECDPQICNLGDKCKNQNFVKRIYPKQYTFWANDRGWGLKADEFIKTKQFVNEYIGEIITMEESEKRILWANENNITDFYFMELDNGRLIDARQFSNLSRFINNSCDPNLVAEKWIVNREHRIGLFALRDIQKGEELTFQYNLQNKSSNRIVCKCFSVNCSGFLGEAPKMAXXXXXXXXXXXXXXXXXXXXXXXCKSFLTDKNSNSQCFRCGEIIDMLSSIVCSVGPCMKTYHSVCLNLNMANYVQSSWICPHHYCDVCARPS 2732
            ++V C       FHV+CL      ++T   D   C ECS G+  C+AC K           RC + +C +++H  C++  +  + E  +F       CP H+C  C L  P S +    ++  C+ CP  +HT D C+ AGS  L+   I+C  H           V++N+    S  ++  P   A +    Q   Y  +  K S  +   P     P        CG+GG LLCCE+CPAA+H +C  ++     + C +C +     Y +IVW+K G + WWP +I    N+P+NI   KH  GQF VQFFGS DY W   G VF Y + D+ ++       N  F   + EAA  Y   + + ++        S+     Y  I+ NK    +++    V E P CNC   D +S C + S C N   + EC P IC  GD+C+NQ F KR YP         RGWGL     I+  +FVNEY+GE+I  EE  KRI +A+E N+++FY + ++  R+IDA    N SRF+N+SC PN   +KW VN + R+GLFA  DI  G ELTF YNL    + + +CKC + NCSGFLG  PK A  +  +    K  +          ++         +C+RCG+  ++   ++C    C K YH  CLNL    +    W CP H+CDVC RPS
Sbjct:  579 SLVSCEGQCCGTFHVECL-----GVQTAPGDKVMCNECSTGLHVCFAC-KCAGAE----VRRCAVSSCGRFYHEECVQRSSAAVFEGRRF------RCPLHVCLSCHLAYPASSRASRGRMQRCVRCPVAYHTSDSCLAAGSKVLSPYSIVCSGHFTPNKRDSTWHVNVNWCFLCSRGVIGAPLPDAGLALFEQSSHYLLSEYKRSSELGKLPMIPVVPAAAA--KACGKGGCLLCCESCPAAFHPECLGMEPPEGTWCCAECRAGKKPQYHDIVWVKLGNYRWWPAEICQPRNIPQNIQNLKHTVGQFPVQFFGSHDYYWTTQGRVFPYMEGDKGSTDYKTNCLNKTFKRALLEAAARYQALKAQRETREAQETERSERKPPTYKHIKSNKPVGRVQVYTADVSEIPRCNCKPTD-ESPCGLDSECLNRMLQYECHPSICPAGDRCQNQAFTKRAYPPSQIVKTAGRGWGLLTLVSIRKGEFVNEYVGELIDEEECRKRIKYAHEKNLSNFYMLTIEKDRIIDAGPKGNFSRFMNHSCQPNCETQKWTVNGDTRVGLFATSDIATGTELTFNYNLDCLGNEKTICKCGAPNCSGFLGVRPKTAAAAATEEKAKKAKRKARGRRP---RTETARAEHEDECYRCGDGGEL---VMCDKKACPKAYHLSCLNLTKPPF--GKWECPWHHCDVCGRPS 1247          
BLAST of NSD-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003690.1 (pep scaffold:Pmarinus_7.0:GL484755:705:3732:1 gene:ENSPMAG00000003373.1 transcript:ENSPMAT00000003690.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 104.76 bits (260), Expect = 3.491e-25
Identity = 62/154 (40.26%), Postives = 83/154 (53.90%), Query Frame = 3
Query: 2205 RLIDARQFSNLSRFINNSCDPNLVAEKWIVNREHRIGLFALRDIQKGEELTFQYNLQNKSSNRIVCKCFSVNCSGFLGEAPKMAXXXXXXXXXXXXXXXXXXXXXXXCKSFLTDKNSNSQCFRCGEIIDMLSSIVCSVGPCMKTYHSVCLNLNM 2666
            R+IDA    N SRF+N+SC PN   +KW VN + R+GLFA+ DI  G ELTF YNL    + + VC C + NCSGFLG  PK  +      D   K K          +    DK  +S+C+RC +  ++   ++C    C KT+H  CLNL  
Sbjct:    3 RIIDAGPKGNFSRFMNHSCQPNCETQKWTVNGDTRVGLFAVSDIPCGTELTFNYNLDCLGNEKTVCMCGAPNCSGFLGVRPKRVRAQSAVVDKKPKRKYRK-------RKVRADKVHDSECYRCKDGGEL---VMCDHRNCTKTFHLACLNLGT 146          
BLAST of NSD-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005461.1 (pep scaffold:Pmarinus_7.0:GL477205:1717:42601:-1 gene:ENSPMAG00000004962.1 transcript:ENSPMAT00000005461.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 110.923 bits (276), Expect = 5.936e-25
Identity = 67/221 (30.32%), Postives = 107/221 (48.42%), Query Frame = 3
Query: 1800 IYNKIQVNKCPLELRRKVVPETPHCNCISFDPKSDCSIGSGCFNVASKCECDPQICNLGDKCKNQNFVKRIYPKQY-TFWANDRGWGLKADEFIKTKQFVNEYIGEIITMEE----SEKRILWANENNITDFYFMELDNGRLIDARQFSNLSRFINNSCDPNLVAEKW--IVNREHRIGLFALRDIQKGEELTFQYNLQN-KSSNRIVCKCFSVNCSGFLG 2438
            +Y KI+     ++++     E   C+C   +   D +   GC N     EC    C  G+ C N+ F ++        F   DRGWG++     +    + EY+GE+++       + +  + A        Y ++LD+G +ID+ +  N +RFIN+SC PN   +KW   VN  +RIGLFAL+DI    ELT+ YN     + ++  C C S NC   +G
Sbjct: 1093 LYKKIRSTDVFVDMKPLSGCEPVSCSCKRPEETEDSACTEGCLNRLVYAECVQSSCPCGELCTNRRFQRQERSAGLERFRTTDRGWGVRTTHHFQANDLIIEYLGEVLSEANFRAFAPRSRMLAQRGEQAGMYCVQLDSGVVIDSYRMGNEARFINHSCQPNCEMQKWCVSVNGIYRIGLFALKDIPISTELTYDYNFHTFTAESQRPCLCGSPNCRNVIG 1313          
BLAST of NSD-1 vs. Ensembl Sea Lamprey
Match: SUV39H2 (suppressor of variegation 3-9 homolog 2 [Source:HGNC Symbol;Acc:HGNC:17287])

HSP 1 Score: 102.449 bits (254), Expect = 3.324e-23
Identity = 68/193 (35.23%), Postives = 97/193 (50.26%), Query Frame = 3
Query: 1947 ECDPQICNLGDKCKNQNFVKRI-YPKQYTFWANDRGWGLKADEFIKTKQFVNEYIGEIITMEESEKRILWANENNITDFYFMELD---NGRLIDARQFSNLSRFINNSCDPNLVAEKWIVN----REHRIGLFALRDIQKGEELTFQYNLQNKSSN----------------------RIVCKCFSVNCSGFL 2435
            EC+  +C  G +CKN+   K I +P       N RGWG+K  + IK   FV EY+GE+I  EE+E+R +  +    T  Y  +LD   +   +DA  + N+S F+N+SC+PNL      +N     + RI  FA+ D+  GEELTF YN+++ SS                       RI CKC +  C  FL
Sbjct:  231 ECN-SLCQCGPECKNRVVQKGIPFPLCIFRTDNGRGWGVKTMQKIKKNSFVMEYVGELIPSEEAERRGVIYDRAGTT--YLFDLDFCKDDYTVDATFYGNISHFVNHSCEPNLQVYSTFINNHDFSQPRIAFFAMDDLAAGEELTFDYNIKDSSSQNESCNKDTVLHTTVTTSPKQRARITCKCGASTCRKFL 420          
BLAST of NSD-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004922.1 (pep scaffold:Pmarinus_7.0:GL479351:23010:32607:-1 gene:ENSPMAG00000004401.1 transcript:ENSPMAT00000004922.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 87.0409 bits (214), Expect = 1.087e-17
Identity = 56/165 (33.94%), Postives = 83/165 (50.30%), Query Frame = 3
Query: 1947 ECDP---QICNLGDKCKNQNF------VKRIYPKQYTFWAND-RGWGLKADEFIKTKQFVNEYIGEIITMEESEKRILWANENNITDFY----FMELDNGRLIDARQFSNLSRFINNSCDPNLVAEKWIVNREHRIGLFALRDIQKGEELTFQYNLQNKSSNRIV 2399
            ECDP   Q C   D   N+N       ++R   K      +D  GWG+     ++  +F++EY GEII+ +E+++R        + D Y       L+N  ++DA +  N  RF N+S  PN  A+  +VN +HRIG+FA R IQ GEEL F Y      + + V
Sbjct:  616 ECDPDLCQTCGAADHWDNRNVSCKNCCIQRGLKKHLLLAPSDVAGWGIFIKVPVQKNEFISEYCGEIISQDEADRR------GKVYDKYMCSFLFNLNNDFVVDATRKGNKIRFANHSVSPNCYAKVMMVNGDHRIGIFAKRAIQTGEELFFDYRYSQADALKYV 774          
BLAST of NSD-1 vs. Ensembl Yeast
Match: SET2 (Histone methyltransferase with a role in transcriptional elongation; methylates H3 lysine 36 (H3K36), which suppresses incorporation of acetylated histones and signals for the deacetylation of these histones within transcribed genes; associates with the C-terminal domain(CTD) of Rpo21p; H3K36me3 (trimethylation) requires Spt6p, proline 38 on H3, CTD of Rpo21p, Ctk1p, and C-terminal SRI domain of Ste2p; relocalizes to the cytosol in response to hypoxia [Source:SGD;Acc:S000003704])

HSP 1 Score: 134.035 bits (336), Expect = 1.369e-32
Identity = 71/179 (39.66%), Postives = 101/179 (56.42%), Query Frame = 3
Query: 1905 CSIGSGCFNVASKCECDPQICNL-GDKCKNQNFVKRIYPKQYTFWANDRGWGLKADEFIKTKQFVNEYIGEIITMEESEKRILWANENNITDFYFMELDNGRLIDARQFSNLSRFINNSCDPNLVAEKWIVNREHRIGLFALRDIQKGEELTFQYNLQNKSSNRIVCKCFSVNCSGFLG 2438
            C   S C N  +  EC   +C+  G+ C+NQ F K+ Y     F    +G+G++A++ I+  QF+ EY GE+I   E   R++  ++ +   FYFM L NG  IDA    +L+RF N+SC PN    KW+V  + R+G+FA R I KGEE+TF YN+    +    C C   NC GFLG
Sbjct:   82 CDEDSDCINRLTLIECVNDLCSSCGNDCQNQRFQKKQYAPIAIFKTKHKGYGVRAEQDIEANQFIYEYKGEVIEEMEFRDRLIDYDQRHFKHFYFMMLQNGEFIDATIKGSLARFCNHSCSPNAYVNKWVVKDKLRMGIFAQRKILKGEEITFDYNVDRYGAQAQKCYCEEPNCIGFLG 260          
BLAST of NSD-1 vs. Ensembl Yeast
Match: SET1 (Histone methyltransferase, subunit of the COMPASS (Set1C) complex; COMPASS methylates histone H3K4; Set1p-dependent H3K4 trimethylation recruits Nrd1p, allowing efficient termination of snoRNAs and cryptic unstable transcripts (CUTs) by Nrd1p-Nab3p-Sen1p pathway; modulates histone acetylation levels in promoter proximal regions to ensure efficient Nrd1p-dependent termination; required in transcriptional silencing near telomeres and at silent mating type loci; has a SET domain [Source:SGD;Acc:S000001161])

HSP 1 Score: 90.5077 bits (223), Expect = 7.519e-19
Identity = 50/130 (38.46%), Postives = 71/130 (54.62%), Query Frame = 3
Query: 2052 WGLKADEFIKTKQFVNEYIGEIITMEESEKRILWANENNITDFYFMELDNGRLIDARQFSNLSRFINNSCDPNLVAEKWIVNREHRIGLFALRDIQKGEELTFQYNLQNKSSN--RIVCKCFSVNCSGFL 2435
            WGL A + I  K+ + EY+GE I    +E R     +N I   Y   +D   +IDA +   ++RFIN+ CDPN  A+   V    RI ++ALRDI   EELT+ Y  + +  +  R+ C C + NC GFL
Sbjct:  950 WGLYALDSIAAKEMIIEYVGERIRQPVAEMREKRYLKNGIGSSYLFRVDENTVIDATKKGGIARFINHCCDPNCTAKIIKVGGRRRIVIYALRDIAASEELTYDYKFEREKDDEERLPCLCGAPNCKGFL 1079          
BLAST of NSD-1 vs. Ensembl Nematostella
Match: EDO43156 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZJ4])

HSP 1 Score: 336.65 bits (862), Expect = 6.299e-103
Identity = 216/667 (32.38%), Postives = 310/667 (46.48%), Query Frame = 3
Query:  816 RCLECSLGIIRCYACYKIVDISNEQGFMRCIIKTCTKWFHTNCLETGPMLEMTKFPKPGQLVCPCHICHKCELVNPSPKYRCTKLIVCIMCPATFHTGDWCIPAGSVELNTGEIICPRHLVDLNFSMNIMVPPFVARVKSDLQERIYGNTLTKISEPMTITPSTVTKPTNVNWCFKCGEGGELLCCETCPAAYHFKCTDLKEIPQ-KFYCPDCASFCYRSYGEIVWIKCGTHPWWPGQILHLENVPKNIAAKKHANGQFVVQFFGSRDYMWRDHGNVFLYEKEDECNSKTSKYRYNNIFLEGIKEAAIGY----VTREEKWQSGSCDHVMNSKIYNKIQVNKCPLELRRKVVP-ETPHCNCISFDPKSDCSIGSGCFNVASKCECDPQICNLGDKCKNQNFVKRIYPKQYTFWANDRGWGLKADEFIKTKQFVNEYIGEIITMEESEKRILWANENNITDFYFMELDNGRLIDARQFSNLSRFINNSCDPNLVAEKWIVNREHRIGLFALRDIQKGEELTFQYNLQNKSSNRIVCKCFSVNCSGFLGEAPKMAXXXXXXXXXXXXXXXXXXXXXXXCKSFLTDKNSNSQCFRCGEIIDMLSSIVCSVGPCMKTYHSVCLNLNMANYVQSSWICPHHYCDVCARPSHHFSSNTTESYCNKDFIKKFNS 2798
            +C EC+ G+  C+ C +  D+        C    C+K++H  CL++    ++       ++ CP H C  C + N +P  R  +L  CI CP  +H G  C+ AG + + +  ++C +H +           P  ++                                NVNWCF C  GG L+CCE+CPAA+H +C   + IP+ +FYC DC       YG+IVW+K G + WWP  I +  +VP NI + +H  G+F V F GS D+ W   G VF Y+  D+     +      +F + + EA   Y      RE+K +            Y  I+ NKC    R  + P E P C C    P   C   + C N+  + EC    C  GDKC+NQ F KR Y     F A+ RGWGL++ + IK   FV EY+GE+I      +R+   +++  T++Y + +D   +IDA    NLSRF+N+SC PN   +KW VN E R+GLF  RD++  EELTF Y L    + +  C C S NCSGFLG  PK       +      +           K     +     CF CG   D    I+C    C+K YH  CLNL+     Q  W CP H+CD C + +    S    S+C      + NS
Sbjct:   26 KCDECTSGVHSCFVCRQTGDVK------ACSQPLCSKFYHKECLQSYKCSKIDG----DRIYCPLHFCSTC-ISNKTPVNR-GRLTKCIRCPTAYHAG--CLVAGCMPITSHLMVCAKHFL-----------PNKSKAHH--------------------------THVNVNWCFVCSIGGTLICCESCPAAFHPECISYEGIPEGRFYCKDCVEGKSLLYGDIVWVKLGMYRWWPAMICNPRDVPTNIQSMRHQPGEFPVMFLGSHDFYWIHKGRVFSYQDGDKGTESGNNKYLAKVFKKALVEAKEKYDEWKKAREDKAEQDLQRFCKKPPQYKHIKTNKCTTAQRIILDPSEMPVCECT---PDQACGQDANCLNLMLQFECVASRCPAGDKCQNQRFQKRQYVDCEPFRAHSRGWGLRSKQAIKKGTFVIEYVGELIDDATCRERVKKGDDD--TNYYMLTIDKDCIIDAGPMGNLSRFMNHSCYPNCETQKWTVNGEVRVGLFTSRDVESQEELTFDYCLDCHGNEKKKCHCGSQNCSGFLGVRPKTQNAQMNEDKAKNAALKRRKRKP---KKPAVKQVHEDDCFICG---DGGQLIMCDRSGCLKCYHVDCLNLDKK--PQGRWQCPWHFCDNCGKRATVLCSECPNSFCRSHAQGQINS 628          
BLAST of NSD-1 vs. Ensembl Nematostella
Match: EDO43763 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RXE9])

HSP 1 Score: 124.02 bits (310), Expect = 1.088e-30
Identity = 69/175 (39.43%), Postives = 92/175 (52.57%), Query Frame = 3
Query: 1914 GSGCFNVASKCECDPQICNLGDKCKNQNFVKRIYPKQYTFWANDRGWGLKADEFIKTKQFVNEYIGEIITMEESEKRILWANENNITDFYFMELDNGRLIDARQFSNLSRFINNSCDPNLVAEKWIVNREHRIGLFALRDIQKGEELTFQYNLQNKSSNRIVCKCFSVNCSGFLG 2438
            G  C N     EC+ + C  GD C N+ F +    K   F    +GWG+K  E ++  QFV EY GE++   + + R    +      +YFM L    +IDA    ++SRFIN+SC+PN V +KW VN   RIG F LR I+ GEELTF Y LQ        C C S +C G +G
Sbjct:   44 GEDCLNRLLMIECNHR-CPCGDLCTNRRFQEGCKIKVEVFKTEKKGWGVKTLEDLEQNQFVIEYCGEVMNYRDFQSRAQRYDRQKRRHYYFMTLRADEIIDATLKGSISRFINHSCEPNCVTQKWTVNGLLRIGFFTLRTIKAGEELTFDYQLQRYGKIAQTCYCESPSCRGIIG 217          
BLAST of NSD-1 vs. Ensembl Nematostella
Match: EDO36231 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJ88])

HSP 1 Score: 90.8929 bits (224), Expect = 2.699e-20
Identity = 67/186 (36.02%), Postives = 97/186 (52.15%), Query Frame = 3
Query: 1872 CNCISFDPKS-DCSIGSG---CFNVASKCECDP--------QICNLGDKCKNQNFVKRIYPKQYTFWA--NDRGWGLKADEFIKTKQFVNEYIGEIITMEESEKR---ILWANENNITDFYFMELDNGRLIDARQFSNLSRFINNSCDPNL-VAEKWIVNRE---HRIGLFALRDIQKGEELTFQY 2366
            CNC    PKS +C   SG    ++   + + +P          C+  + C+N+  V+R    + T +   N  GWG+K  + I   QFV EY+GE+IT EE+E R      A +  + D  + + D    IDA+++ N+S FIN+SCDPNL V   W+   +    RI  FA RDI  GEE+TF Y
Sbjct:   58 CNCQRCTPKSCECPKNSGGVFAYDRFGRVQFEPGKPIYECNSKCSCSESCRNR-VVQRGRTVRVTIFRTYNGCGWGVKTMDPIMKNQFVTEYVGEVITNEEAEHRGRHYDAAGQTYLFDLDYNDGDCAYTIDAKKYGNISHFINHSCDPNLSVFGVWVDTLDPQMPRIAFFARRDIPAGEEITFDY 242          
BLAST of NSD-1 vs. Ensembl Nematostella
Match: EDO49808 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RFZ3])

HSP 1 Score: 84.3445 bits (207), Expect = 4.792e-18
Identity = 60/179 (33.52%), Postives = 89/179 (49.72%), Query Frame = 3
Query: 1947 ECDPQICNLGDKCKNQNFVKRIYPKQYTFWANDRGWGLKADEFIKTKQFVNEYIGEIITMEESEKRILWA-NENNITDFYFMELDNGRL----IDARQFSNLSRFINNSCDPNLVAEKWIVNRE-HRIGLFALRDIQKGEELTFQYN-----LQNKSSNR-----IVCKCFSVNCSGFL 2435
            EC+ Q CN    C  +   K I  +   F +  + WGL+  E I   QF+ EY GE+++ +E++KR +      N        +  G++    +D R + N  RFIN+SCDPNLV     V+    ++ LFA +DI   EEL+F Y+     L + S        + C C S NC+GFL
Sbjct:   66 ECNSQ-CNCDLSCYTKLVQKLIQTRLEVFKSKHKLWGLRTLEHISQGQFICEYAGEVLSYKEAKKRTIEGKGRPNYIITVKEHISGGKILRTHVDPRIYGNAGRFINHSCDPNLVMVPVRVDSLIPKLALFASKDIFPNEELSFDYSGGRCGLPSSSCADDPALCLPCYCNSSNCTGFL 243          
BLAST of NSD-1 vs. Ensembl Nematostella
Match: EDO30322 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T142])

HSP 1 Score: 88.1965 bits (217), Expect = 6.720e-18
Identity = 55/165 (33.33%), Postives = 85/165 (51.52%), Query Frame = 3
Query: 1947 ECDPQICNL---------GDKCKNQNFVKRIYPKQYTFWAND-RGWGLKADEFIKTKQFVNEYIGEIITMEESEKRILWANENNITDFY----FMELDNGRLIDARQFSNLSRFINNSCDPNLVAEKWIVNREHRIGLFALRDIQKGEELTFQYNLQNKSSNRIV 2399
            ECDP +C              CKN + ++R   K      +D  GWG+   + +K  +F++EY GE+I+ +E+++R        + D Y       L+N  ++DA +  N  RF N+S  PN  A+  +VN +HRIG+FA RDI+ GEEL F Y      + + V
Sbjct:  520 ECDPDLCGTCGADNFDQDSKTCKNVS-LQRGQRKHMLLAPSDVAGWGIYIKQSVKKNEFISEYCGEVISQDEADRR------GKVYDKYMCSFLFNLNNDFVVDATRKGNKIRFANHSISPNCYAKVMMVNGDHRIGIFAKRDIEAGEELFFDYRYSATDALKFV 677          
BLAST of NSD-1 vs. Ensembl Medaka
Match: nsd2 (nuclear receptor binding SET domain protein 2 [Source:NCBI gene;Acc:101172132])

HSP 1 Score: 391.734 bits (1005), Expect = 1.202e-117
Identity = 243/699 (34.76%), Postives = 341/699 (48.78%), Query Frame = 3
Query:  693 CRYCLET-KNIVQCNKCLFNNFHVKCLEFLQNSIETKINDLDRCLECSLGIIRCYACYKIVDISNEQGFMRCIIKTCTKWFHTNCLETGPMLEMTKFPKPGQLVCPCHICHKCELVNPSPKYRCTK--LIVCIMCPATFHTGDWCIPAGSVELNTGEIICPRHL-VDLNFSMNIMVPPFVARVKSDLQERIYGNTLTKISEPMTITPSTVTKPTNVNWCFKCGEGGELLCCETCPAAYHFKCTDLKEIPQKFYCPDCASFCYRSYGEIVWIKCGTHPWWPGQILHLENVPKNIAAKKHANGQFVVQFFGSRDYMWRDHGNVFLYEKEDECNSKTSKYRYNNIFLEGIKEAAIGYVTREEKWQSGSC-DHVMNSKIYNKIQVNK--CPLELRRKVVPETPHCNCISFDPKSDCSIGSGCFNVASKCECDPQICNLGDKCKNQNFVKRIYPKQYTFWANDRGWGLKADEFIKTKQFVNEYIGEIITMEESEKRILWANENNITDFYFMELDNGRLIDARQFSNLSRFINNSCDPNLVAEKWIVNREHRIGLFALRDIQKGEELTFQYNLQNKSSNRIVCKCFSVNCSGFLGEAPKMAXXXXXXXXXXXXXXXXXXXXXXXCKSFLTDKNSNSQCFRCGEIIDMLSSIVCSVGPCMKTYHSVCLNLNMANYVQSSWICPHHYCDVCARPSHHFSSNTTESYC 2768
            C+ C +  +++V C       FH+ CL         K  D   C +C  GI  C+AC +     +E    RC +  C K++H  C+   P+   T F   G L CP H C  C   + + K++ TK  L+ C+ CP  +H GD C+ AGS  +    I+C  H      +S +  V                                      NV+WCF C +GG+LLCCE+CPAA+H  C ++      +YC DC +     Y +I+W+K GT+ WWP +I H  N+P NI   +H  G+F V FFGSRDY W   G VF Y + D   SK  +     +F   + EA   +   + K ++    +       Y  I+VN+    +++    V E P CNC   D +  C   S C N   + EC PQ+C  G++C NQ+F KR+YP+        +GWGL A   IK  +FVNEYIGE+I  EE   RI +A+ENNIT+FY + +D  R+IDA    N SRF+N+SC PN   +KW VN + R+GLFA+  I  G ELTF YNL    + + +C+C + NCSGFLG+ PK +     +    +  +                K S  +CFRCG   D    ++C    C K YH  CLNL    +    W CP H+CDVC + S  F      S+C
Sbjct:  578 CQVCEQAGEDLVPCEGQCCGMFHLHCL-----GPSFKPEDKLLCQQCRAGIHSCFACKQ-----SEGEVRRCHVVHCGKFYHEACIRLNPL---TVFDNKG-LRCPLHACLSCHYGSRT-KHKSTKGRLMRCLRCPVAYHVGDLCVAAGSEMITNTAIVCTNHFNAKKGYSHHSHV--------------------------------------NVSWCFVCSKGGQLLCCESCPAAFHPDCLNIAMPDGSWYCNDCRAGKKPRYRDIIWVKLGTYRWWPAEIQHPRNIPTNIQHLRHEIGEFPVFFFGSRDYFWTHQGRVFPYMEGDR-GSKHQRTGIGRVFKNALLEAEARFKEMKMKREAKEAQESSRKPPPYKFIKVNRPYGRVQVYTADVSEIPKCNCKPTDERP-CGFESECLNRMLQYECHPQVCPSGERCCNQDFTKRLYPETKIIKTPGKGWGLVALRDIKKGKFVNEYIGELIDEEECRARIKYAHENNITNFYMLTIDKDRIIDAGPKGNYSRFMNHSCQPNCETQKWTVNGDTRVGLFAVCHIPAGTELTFNYNLDCLGNEKTICRCGAPNCSGFLGDRPKNSNGHAAEPKGKRPKRKYKKRRSE------GKKKSEDECFRCG---DGGQLVLCDKKTCTKAYHLSCLNLTKRPF--GRWDCPWHHCDVCGKNSEAFCQLCPNSFC 1210          
BLAST of NSD-1 vs. Ensembl Medaka
Match: nsd1b (histone-lysine N-methyltransferase, H3 lysine-36 and H4 lysine-20 specific [Source:NCBI gene;Acc:101161079])

HSP 1 Score: 390.193 bits (1001), Expect = 1.230e-114
Identity = 239/700 (34.14%), Postives = 344/700 (49.14%), Query Frame = 3
Query:  693 CRYCLETKNIVQCNKCLFNNFHVKCLEFLQNSIETKINDLDRCLECSLGIIRCYACYKIVDISNEQGFMRCIIKTCTKWFHTNCLET-GPMLEMTKFPKPGQLVCPCHICHKCELVNP-SPKYRCTKLIVCIMCPATFHTGDWCIPAGSVELNTGEIICPRHLVDLNFSMNIMVPPFVARVKSDLQERIYGNTLTKISEPMTITPSTVTKPTNVNWCFKCGEGGELLCCETCPAAYHFKCTDLKEIPQKFYCPDCASFCYRSYGEIVWIKCGTHPWWPGQILHLENVPKNIAAKKHANGQFVVQFFGSRDYMWRDHGNVFLYEKEDECNSKTSKYRYNNIFLEGIKEAAIGY--VTREEKWQSGSCDHVMNSKI--YNKIQVNK--CPLELRRKVVPETPHCNCISFDPKSDCSIGSGCFNVASKCECDPQICNLGDKCKNQNFVKRIYPKQYTFWANDRGWGLKADEFIKTKQFVNEYIGEIITMEESEKRILWANENNITDFYFMELDNGRLIDARQFSNLSRFINNSCDPNLVAEKWIVNREHRIGLFALRDIQKGEELTFQYNLQNKSSNRIVCKCFSVNCSGFLGEAPKMAXXXXXXXXXXXXXXXXXXXXXXXCKSFLTDKNSNSQCFRCGEIIDMLSSIVCSVGPCMKTYHSVCLNLNMANYVQSSWICPHHYCDVCARPSHHFSSNTTESYC 2768
            C+ C +T  ++ C       FH+ C+  L ++ + K      C EC  G+  C+ C K       +   RC+I  C K++H  C+    P   + +        C  H+C  C + NP S      +L+ C+ CP  +H  D C+ AGSV L++  I+CP H              F  R      E +                       NV+WCF C EGG LLCCE+CPAA+H +C +++     +YC DC +     Y +I+W+K G + WWP ++ H + +P+NI   +H  G+F V FFGS DY+W     VF Y   D  + +      +  + + ++EAA+ +  +  E++ +    D   + K   Y  I+VN+    +++    + E P CNC + D +S C   S C N     EC+PQ+C  G+KC NQ F KR Y +   F    RGWGL+    IK  QFV+EY+GE+I  EE   RI  A EN+I +FY + LD  R+IDA    N +RF+N+ C PN   +KW VN + R+GLFAL D++ G ELTF YNL+   + + VCKC + NCSGFLG  PK    S  K    K+      +     K  +  K    +CF CG+   M+S   C    C K YH+ CLNL         W CP H CDVC + +  F      SYC
Sbjct: 1285 CQVCEKTGELLLCEGQCCGAFHLACIS-LADAPKGKF----VCPECKSGVHTCFVCKK-----RGEDVRRCMIPVCGKFYHGECITNHAPTAPVNR-----GFRCSIHVCLTCFIANPNSSSISKGRLVRCVRCPVAYHATDLCMAAGSVVLSSNSIVCPNH--------------FTPRRGVKNHEHV-----------------------NVSWCFVCTEGGSLLCCESCPAAFHRECLNIEMPKGSWYCNDCKAGKKPHYKDILWVKVGRYRWWPAEVSHPKTIPENIQRMRHDVGEFPVHFFGSNDYLWTYQARVFPYMDVDANSKEKMGKGVDTTYKKALEEAAVRFRELQAEKELRQLQEDRKNDRKPPPYKHIKVNRPIGKVQIFTADLSEVPRCNCKATD-ESPCGSDSECINRMLLYECNPQVCPAGEKCLNQAFTKRQYSQVEIFRTLSRGWGLRCVHDIKKGQFVSEYVGEVIDEEECRSRIRHAQENDICNFYMLTLDKDRIIDAGPKGNEARFMNHCCQPNCETQKWTVNGDTRVGLFALVDVKAGTELTFNYNLECLGNGKTVCKCGAPNCSGFLGVRPKNNPPSDDKGRKMKRRGHGRRK-----KKVVLAKEREDECFSCGDGGQMVS---CKKPGCPKVYHADCLNL--TKRPAGRWECPWHQCDVCGKEAASFCEMCPSSYC 1921          
BLAST of NSD-1 vs. Ensembl Medaka
Match: nsd1b (histone-lysine N-methyltransferase, H3 lysine-36 and H4 lysine-20 specific [Source:NCBI gene;Acc:101161079])

HSP 1 Score: 389.808 bits (1000), Expect = 2.482e-114
Identity = 239/700 (34.14%), Postives = 344/700 (49.14%), Query Frame = 3
Query:  693 CRYCLETKNIVQCNKCLFNNFHVKCLEFLQNSIETKINDLDRCLECSLGIIRCYACYKIVDISNEQGFMRCIIKTCTKWFHTNCLET-GPMLEMTKFPKPGQLVCPCHICHKCELVNP-SPKYRCTKLIVCIMCPATFHTGDWCIPAGSVELNTGEIICPRHLVDLNFSMNIMVPPFVARVKSDLQERIYGNTLTKISEPMTITPSTVTKPTNVNWCFKCGEGGELLCCETCPAAYHFKCTDLKEIPQKFYCPDCASFCYRSYGEIVWIKCGTHPWWPGQILHLENVPKNIAAKKHANGQFVVQFFGSRDYMWRDHGNVFLYEKEDECNSKTSKYRYNNIFLEGIKEAAIGY--VTREEKWQSGSCDHVMNSKI--YNKIQVNK--CPLELRRKVVPETPHCNCISFDPKSDCSIGSGCFNVASKCECDPQICNLGDKCKNQNFVKRIYPKQYTFWANDRGWGLKADEFIKTKQFVNEYIGEIITMEESEKRILWANENNITDFYFMELDNGRLIDARQFSNLSRFINNSCDPNLVAEKWIVNREHRIGLFALRDIQKGEELTFQYNLQNKSSNRIVCKCFSVNCSGFLGEAPKMAXXXXXXXXXXXXXXXXXXXXXXXCKSFLTDKNSNSQCFRCGEIIDMLSSIVCSVGPCMKTYHSVCLNLNMANYVQSSWICPHHYCDVCARPSHHFSSNTTESYC 2768
            C+ C +T  ++ C       FH+ C+  L ++ + K      C EC  G+  C+ C K       +   RC+I  C K++H  C+    P   + +        C  H+C  C + NP S      +L+ C+ CP  +H  D C+ AGSV L++  I+CP H              F  R      E +                       NV+WCF C EGG LLCCE+CPAA+H +C +++     +YC DC +     Y +I+W+K G + WWP ++ H + +P+NI   +H  G+F V FFGS DY+W     VF Y   D  + +      +  + + ++EAA+ +  +  E++ +    D   + K   Y  I+VN+    +++    + E P CNC + D +S C   S C N     EC+PQ+C  G+KC NQ F KR Y +   F    RGWGL+    IK  QFV+EY+GE+I  EE   RI  A EN+I +FY + LD  R+IDA    N +RF+N+ C PN   +KW VN + R+GLFAL D++ G ELTF YNL+   + + VCKC + NCSGFLG  PK    S  K    K+      +     K  +  K    +CF CG+   M+S   C    C K YH+ CLNL         W CP H CDVC + +  F      SYC
Sbjct: 1691 CQVCEKTGELLLCEGQCCGAFHLACIS-LADAPKGKF----VCPECKSGVHTCFVCKK-----RGEDVRRCMIPVCGKFYHGECITNHAPTAPVNRG-----FRCSIHVCLTCFIANPNSSSISKGRLVRCVRCPVAYHATDLCMAAGSVVLSSNSIVCPNH--------------FTPRRGVKNHEHV-----------------------NVSWCFVCTEGGSLLCCESCPAAFHRECLNIEMPKGSWYCNDCKAGKKPHYKDILWVKVGRYRWWPAEVSHPKTIPENIQRMRHDVGEFPVHFFGSNDYLWTYQARVFPYMDVDANSKEKMGKGVDTTYKKALEEAAVRFRELQAEKELRQLQEDRKNDRKPPPYKHIKVNRPIGKVQIFTADLSEVPRCNCKATD-ESPCGSDSECINRMLLYECNPQVCPAGEKCLNQAFTKRQYSQVEIFRTLSRGWGLRCVHDIKKGQFVSEYVGEVIDEEECRSRIRHAQENDICNFYMLTLDKDRIIDAGPKGNEARFMNHCCQPNCETQKWTVNGDTRVGLFALVDVKAGTELTFNYNLECLGNGKTVCKCGAPNCSGFLGVRPKNNPPSDDKGRKMKRRGHGRRK-----KKVVLAKEREDECFSCGDGGQMVS---CKKPGCPKVYHADCLNL--TKRPAGRWECPWHQCDVCGKEAASFCEMCPSSYC 2327          
BLAST of NSD-1 vs. Ensembl Medaka
Match: nsd1b (histone-lysine N-methyltransferase, H3 lysine-36 and H4 lysine-20 specific [Source:NCBI gene;Acc:101161079])

HSP 1 Score: 389.808 bits (1000), Expect = 2.482e-114
Identity = 239/700 (34.14%), Postives = 344/700 (49.14%), Query Frame = 3
Query:  693 CRYCLETKNIVQCNKCLFNNFHVKCLEFLQNSIETKINDLDRCLECSLGIIRCYACYKIVDISNEQGFMRCIIKTCTKWFHTNCLET-GPMLEMTKFPKPGQLVCPCHICHKCELVNP-SPKYRCTKLIVCIMCPATFHTGDWCIPAGSVELNTGEIICPRHLVDLNFSMNIMVPPFVARVKSDLQERIYGNTLTKISEPMTITPSTVTKPTNVNWCFKCGEGGELLCCETCPAAYHFKCTDLKEIPQKFYCPDCASFCYRSYGEIVWIKCGTHPWWPGQILHLENVPKNIAAKKHANGQFVVQFFGSRDYMWRDHGNVFLYEKEDECNSKTSKYRYNNIFLEGIKEAAIGY--VTREEKWQSGSCDHVMNSKI--YNKIQVNK--CPLELRRKVVPETPHCNCISFDPKSDCSIGSGCFNVASKCECDPQICNLGDKCKNQNFVKRIYPKQYTFWANDRGWGLKADEFIKTKQFVNEYIGEIITMEESEKRILWANENNITDFYFMELDNGRLIDARQFSNLSRFINNSCDPNLVAEKWIVNREHRIGLFALRDIQKGEELTFQYNLQNKSSNRIVCKCFSVNCSGFLGEAPKMAXXXXXXXXXXXXXXXXXXXXXXXCKSFLTDKNSNSQCFRCGEIIDMLSSIVCSVGPCMKTYHSVCLNLNMANYVQSSWICPHHYCDVCARPSHHFSSNTTESYC 2768
            C+ C +T  ++ C       FH+ C+  L ++ + K      C EC  G+  C+ C K       +   RC+I  C K++H  C+    P   + +        C  H+C  C + NP S      +L+ C+ CP  +H  D C+ AGSV L++  I+CP H              F  R      E +                       NV+WCF C EGG LLCCE+CPAA+H +C +++     +YC DC +     Y +I+W+K G + WWP ++ H + +P+NI   +H  G+F V FFGS DY+W     VF Y   D  + +      +  + + ++EAA+ +  +  E++ +    D   + K   Y  I+VN+    +++    + E P CNC + D +S C   S C N     EC+PQ+C  G+KC NQ F KR Y +   F    RGWGL+    IK  QFV+EY+GE+I  EE   RI  A EN+I +FY + LD  R+IDA    N +RF+N+ C PN   +KW VN + R+GLFAL D++ G ELTF YNL+   + + VCKC + NCSGFLG  PK    S  K    K+      +     K  +  K    +CF CG+   M+S   C    C K YH+ CLNL         W CP H CDVC + +  F      SYC
Sbjct: 1691 CQVCEKTGELLLCEGQCCGAFHLACIS-LADAPKGKF----VCPECKSGVHTCFVCKK-----RGEDVRRCMIPVCGKFYHGECITNHAPTAPVNRG-----FRCSIHVCLTCFIANPNSSSISKGRLVRCVRCPVAYHATDLCMAAGSVVLSSNSIVCPNH--------------FTPRRGVKNHEHV-----------------------NVSWCFVCTEGGSLLCCESCPAAFHRECLNIEMPKGSWYCNDCKAGKKPHYKDILWVKVGRYRWWPAEVSHPKTIPENIQRMRHDVGEFPVHFFGSNDYLWTYQARVFPYMDVDANSKEKMGKGVDTTYKKALEEAAVRFRELQAEKELRQLQEDRKNDRKPPPYKHIKVNRPIGKVQIFTADLSEVPRCNCKATD-ESPCGSDSECINRMLLYECNPQVCPAGEKCLNQAFTKRQYSQVEIFRTLSRGWGLRCVHDIKKGQFVSEYVGEVIDEEECRSRIRHAQENDICNFYMLTLDKDRIIDAGPKGNEARFMNHCCQPNCETQKWTVNGDTRVGLFALVDVKAGTELTFNYNLECLGNGKTVCKCGAPNCSGFLGVRPKNNPPSDDKGRKMKRRGHGRRK-----KKVVLAKEREDECFSCGDGGQMVS---CKKPGCPKVYHADCLNL--TKRPAGRWECPWHQCDVCGKEAASFCEMCPSSYC 2327          
BLAST of NSD-1 vs. Ensembl Medaka
Match: nsd1b (histone-lysine N-methyltransferase, H3 lysine-36 and H4 lysine-20 specific [Source:NCBI gene;Acc:101161079])

HSP 1 Score: 389.423 bits (999), Expect = 3.283e-114
Identity = 239/700 (34.14%), Postives = 344/700 (49.14%), Query Frame = 3
Query:  693 CRYCLETKNIVQCNKCLFNNFHVKCLEFLQNSIETKINDLDRCLECSLGIIRCYACYKIVDISNEQGFMRCIIKTCTKWFHTNCLET-GPMLEMTKFPKPGQLVCPCHICHKCELVNP-SPKYRCTKLIVCIMCPATFHTGDWCIPAGSVELNTGEIICPRHLVDLNFSMNIMVPPFVARVKSDLQERIYGNTLTKISEPMTITPSTVTKPTNVNWCFKCGEGGELLCCETCPAAYHFKCTDLKEIPQKFYCPDCASFCYRSYGEIVWIKCGTHPWWPGQILHLENVPKNIAAKKHANGQFVVQFFGSRDYMWRDHGNVFLYEKEDECNSKTSKYRYNNIFLEGIKEAAIGY--VTREEKWQSGSCDHVMNSKI--YNKIQVNK--CPLELRRKVVPETPHCNCISFDPKSDCSIGSGCFNVASKCECDPQICNLGDKCKNQNFVKRIYPKQYTFWANDRGWGLKADEFIKTKQFVNEYIGEIITMEESEKRILWANENNITDFYFMELDNGRLIDARQFSNLSRFINNSCDPNLVAEKWIVNREHRIGLFALRDIQKGEELTFQYNLQNKSSNRIVCKCFSVNCSGFLGEAPKMAXXXXXXXXXXXXXXXXXXXXXXXCKSFLTDKNSNSQCFRCGEIIDMLSSIVCSVGPCMKTYHSVCLNLNMANYVQSSWICPHHYCDVCARPSHHFSSNTTESYC 2768
            C+ C +T  ++ C       FH+ C+  L ++ + K      C EC  G+  C+ C K       +   RC+I  C K++H  C+    P   + +        C  H+C  C + NP S      +L+ C+ CP  +H  D C+ AGSV L++  I+CP H              F  R      E +                       NV+WCF C EGG LLCCE+CPAA+H +C +++     +YC DC +     Y +I+W+K G + WWP ++ H + +P+NI   +H  G+F V FFGS DY+W     VF Y   D  + +      +  + + ++EAA+ +  +  E++ +    D   + K   Y  I+VN+    +++    + E P CNC + D +S C   S C N     EC+PQ+C  G+KC NQ F KR Y +   F    RGWGL+    IK  QFV+EY+GE+I  EE   RI  A EN+I +FY + LD  R+IDA    N +RF+N+ C PN   +KW VN + R+GLFAL D++ G ELTF YNL+   + + VCKC + NCSGFLG  PK    S  K    K+      +     K  +  K    +CF CG+   M+S   C    C K YH+ CLNL         W CP H CDVC + +  F      SYC
Sbjct: 1608 CQVCEKTGELLLCEGQCCGAFHLACIS-LADAPKGKF----VCPECKSGVHTCFVCKK-----RGEDVRRCMIPVCGKFYHGECITNHAPTAPVNRG-----FRCSIHVCLTCFIANPNSSSISKGRLVRCVRCPVAYHATDLCMAAGSVVLSSNSIVCPNH--------------FTPRRGVKNHEHV-----------------------NVSWCFVCTEGGSLLCCESCPAAFHRECLNIEMPKGSWYCNDCKAGKKPHYKDILWVKVGRYRWWPAEVSHPKTIPENIQRMRHDVGEFPVHFFGSNDYLWTYQARVFPYMDVDANSKEKMGKGVDTTYKKALEEAAVRFRELQAEKELRQLQEDRKNDRKPPPYKHIKVNRPIGKVQIFTADLSEVPRCNCKATD-ESPCGSDSECINRMLLYECNPQVCPAGEKCLNQAFTKRQYSQVEIFRTLSRGWGLRCVHDIKKGQFVSEYVGEVIDEEECRSRIRHAQENDICNFYMLTLDKDRIIDAGPKGNEARFMNHCCQPNCETQKWTVNGDTRVGLFALVDVKAGTELTFNYNLECLGNGKTVCKCGAPNCSGFLGVRPKNNPPSDDKGRKMKRRGHGRRK-----KKVVLAKEREDECFSCGDGGQMVS---CKKPGCPKVYHADCLNL--TKRPAGRWECPWHQCDVCGKEAASFCEMCPSSYC 2244          
BLAST of NSD-1 vs. Planmine SMEST
Match: SMESG000015015.1 (SMESG000015015.1)

HSP 1 Score: 1719.13 bits (4451), Expect = 0.000e+0
Identity = 898/900 (99.78%), Postives = 899/900 (99.89%), Query Frame = 3
Query:   99 MFKEXXXXXXXXXXXXXXXXXXXRTEDSRSKSYKVGQIICGKVGKYPWWPCMVNTIPTSNEPRVLVSYFGKKNDYSYLFDDCTMYAQTKSDFENIFKLHNHDKKTLARLAHYKKQLDLAWKEVEIASLLDENSRFELYKIKCEIKESINXXXXXXXXXXXXXXXXXXXXQEIIKREPIKYAFDELTLPFVSVKLTNKNCRYCLETKNIVQCNKCLFNNFHVKCLEFLQNSIETKINDLDRCLECSLGIIRCYACYKIVDISNEQGFMRCIIKTCTKWFHTNCLETGPMLEMTKFPKPGQLVCPCHICHKCELVNPSPKYRCTKLIVCIMCPATFHTGDWCIPAGSVELNTGEIICPRHLVDLNFSMNIMVPPFVARVKSDLQERIYGNTLTKISEPMTITPSTVTKPTNVNWCFKCGEGGELLCCETCPAAYHFKCTDLKEIPQKFYCPDCASFCYRSYGEIVWIKCGTHPWWPGQILHLENVPKNIAAKKHANGQFVVQFFGSRDYMWRDHGNVFLYEKEDECNSKTSKYRYNNIFLEGIKEAAIGYVTREEKWQSGSCDHVMNSKIYNKIQVNKCPLELRRKVVPETPHCNCISFDPKSDCSIGSGCFNVASKCECDPQICNLGDKCKNQNFVKRIYPKQYTFWANDRGWGLKADEFIKTKQFVNEYIGEIITMEESEKRILWANENNITDFYFMELDNGRLIDARQFSNLSRFINNSCDPNLVAEKWIVNREHRIGLFALRDIQKGEELTFQYNLQNKSSNRIVCKCFSVNCSGFLGEAPKMAXXXXXXXXXXXXXXXXXXXXXXXCKSFLTDKNSNSQCFRCGEIIDMLSSIVCSVGPCMKTYHSVCLNLNMANYVQSSWICPHHYCDVCARPSHHFSSNTTESYCNKDFIKKFNS 2798
            MFKELTNLNNNSSNVSLLSTSSNRTEDSRSKSYKVGQIICGKVGKYPWWPCMVNTIPTSNEPRVLVSYFGKKNDYSYLFDDCTMYAQTKSDFENIFKLHNHDKKTLARLAHYKKQLDLAWKEVEIASLLDENSRFELYKIKCEIKESINPPKKRIRPPKPKKEKAASKPQEIIKREPIKYAFDELTLPFVSVKLTNKNCRYCLETKNIVQCNKCLFNNFHVKCLEFLQNSIETKINDLDRCLECSLGIIRCYACYKIVDISNEQGFMRCIIKTCTKWFHTNCLETGPMLEMTKFPKPGQLVCPCHICHKCELVNPSPKYRCTKLIVCIMCPATFHTGDWCIPAGSVELNTGEIICPRHLVDLNFSMNIMVPPFVARVKSDLQERIYGNTLTKISEPMTITPSTVTKPTNVNWCFKCGEGGELLCCETCPAAYHFKCTDLKEIPQKFYCPDCASFCYRSYGEIVWIKCGTHPWWPGQILHLENVPKNIAAKKHANGQFVVQFFGSRDYMWRDHGNVFLYEKEDECNSKTSKYRYNNIFLE IKEAAIGYVTREEKWQSGSCDHVMNSKIYNKIQVNKCPLELRRKVVPETPHCNCISFDPKSDCSIGSGCFNVASKCECDPQICNLGDKCKNQNFVKRIYPKQYTFWANDRGWGLKADEFIKTKQFVNEYIGEIITMEESEKRILWANENNI+DFYFMELDNGRLIDARQFSNLSRFINNSCDPNLVAEKWIVNREHRIGLFALRDIQKGEELTFQYNLQNKSSNRIVCKCFSVNCSGFLGEAPKMAKVSKLKSDTSKKSKGDTTESESSCKSFLTDKNSNSQCFRCGEIIDMLSSIVCSVGPCMKTYHSVCLNLNMANYVQSSWICPHHYCDVCARPSHHFSSNTTESYCNKDFIKKFNS
Sbjct:    1 MFKELTNLNNNSSNVSLLSTSSNRTEDSRSKSYKVGQIICGKVGKYPWWPCMVNTIPTSNEPRVLVSYFGKKNDYSYLFDDCTMYAQTKSDFENIFKLHNHDKKTLARLAHYKKQLDLAWKEVEIASLLDENSRFELYKIKCEIKESINPPKKRIRPPKPKKEKAASKPQEIIKREPIKYAFDELTLPFVSVKLTNKNCRYCLETKNIVQCNKCLFNNFHVKCLEFLQNSIETKINDLDRCLECSLGIIRCYACYKIVDISNEQGFMRCIIKTCTKWFHTNCLETGPMLEMTKFPKPGQLVCPCHICHKCELVNPSPKYRCTKLIVCIMCPATFHTGDWCIPAGSVELNTGEIICPRHLVDLNFSMNIMVPPFVARVKSDLQERIYGNTLTKISEPMTITPSTVTKPTNVNWCFKCGEGGELLCCETCPAAYHFKCTDLKEIPQKFYCPDCASFCYRSYGEIVWIKCGTHPWWPGQILHLENVPKNIAAKKHANGQFVVQFFGSRDYMWRDHGNVFLYEKEDECNSKTSKYRYNNIFLERIKEAAIGYVTREEKWQSGSCDHVMNSKIYNKIQVNKCPLELRRKVVPETPHCNCISFDPKSDCSIGSGCFNVASKCECDPQICNLGDKCKNQNFVKRIYPKQYTFWANDRGWGLKADEFIKTKQFVNEYIGEIITMEESEKRILWANENNISDFYFMELDNGRLIDARQFSNLSRFINNSCDPNLVAEKWIVNREHRIGLFALRDIQKGEELTFQYNLQNKSSNRIVCKCFSVNCSGFLGEAPKMAKVSKLKSDTSKKSKGDTTESESSCKSFLTDKNSNSQCFRCGEIIDMLSSIVCSVGPCMKTYHSVCLNLNMANYVQSSWICPHHYCDVCARPSHHFSSNTTESYCNKDFIKKFNS 900          
BLAST of NSD-1 vs. Planmine SMEST
Match: SMESG000039925.1 (SMESG000039925.1)

HSP 1 Score: 515.383 bits (1326), Expect = 1.450e-165
Identity = 320/959 (33.37%), Postives = 482/959 (50.26%), Query Frame = 3
Query:  171 TEDSRSKSYKVGQIICGKVGKYPWWPCMVNTIPTSN-------EPRVLVSYFGKKNDYSYLFDDCTMYAQTKSDFENIFKL---HNHDKKTLARLAHYKKQLDL---AWKEVEIASLLDENSRFELYKIKCEIKESINXXXXXXXXXXXXXXXXXXXXQEIIKREPIK--YAFDELTLPFVSVKLTNKNCRYCLETKN------IVQCNKCLFNNFHVKCLEFLQNSIE-----TKINDLDRCLECSLGIIRCYACYKIVDISNEQGFMRCIIKTCTKWFHTNCLETGPMLEMTKFPKPGQLVCPCHICHKCELVNPSPKYRCTKLIVCIMCPATFHTGDWCIPAGSVELNTGEIICPRHLVDLNFSMNIMVPPFVARVKSDLQERIYGNT----LTKISEPMTITPSTVTKPT--------NVNWCFKCGEGGELLCCETCPAAYHFKCTDLKEIPQKFYCPDCASFCYRSYGEIVWIKCGTHPWWPGQILHLENVPKNIAAKKHANGQFVVQFFGSRDYMWRDHGNVFLYEKEDECNSKTSKYRYNNIFLE-------------------GIKEAAIGYVTREEKWQSGSCDHVMNSK----IYNKIQVNKCPLELRRKVVP----ETPHCNCISFDPKSD-CSIGSGCFNVASKCECDPQICNLGDKCKNQNFVKRIYPKQYTFWANDRGWGLKADEFIKTKQFVNEYIGEIITMEESEKRILWANENNITDFYFMELDNGRLIDARQFSNLSRFINNSCDPNLVAEKWIVNREHRIGLFALRDIQKGEELTFQYNLQNKSSNRIVCKCFSVNCSGFLGEAPKMAXXXXXXXXXXXXXXXXXX------------------XXXXXCKSFLTDKNSNSQCFRCGEIIDMLSSIVCSVGPCMKTYHSVCLNLNMANYVQSSWICPHHYCDVCARPSHHFSSNTTESYCNKDFIKKFN 2795
            T+++ S+ Y VG+++  KV  +PWWPCM+   P  N       +  + V+YFG      ++  +  M  + K  F++  K    +N  K  + +    + ++ +   +WKE E A ++    R ++Y I  +     +  +   +  + + +++        K++ +   + F  L LP  S    N  C  CLE  +      +  C       FH  CL  L + +      TK+ +  +C++C+  + RC+ C K+     +   M+C    C +++H+NCL  G   ++  + + G L CP HICH C + +P    +C+  + C+MCP++FH GDWCIPAGS E+N   IICP+HL  +  S  I V PF+  +K+    R+  N+    LT  ++P       + KP         NV WCF C +GG+L+CCE CPA+ H  C  + EIP  F C DC S  Y  YG+I W+K G++ WWPGQI+H  N P+ +    H +GQF+VQFFG+ DY W +  + F +E  D+   +  K   N+   E                    +K AA   V R  KW+S     ++N K     Y  I+ N  P+   R   P    E P C C   D  +D C   S C N     EC P +C  G+ C+NQ F++R YPKQ  F  ++RGW L+  E IK   FVNEY+GE+I   E+ +R+  A+E N+++FY MELD  R+IDA   +N+SRF+N+SC PN+  +KW VN + RIGLFAL  I+ GEELTF YN  +    ++ CKC + NCSGFLG+ PK A      SD     +   +                   +    ++F   K  + +C+RCG+       I CS   C + YH  C++L  +N  +S W+CP H CD C R S +F S  T SYC    + +FN
Sbjct:  126 TQENTSEEYYVGRLLWAKVKSHPWWPCMIYYSPEKNFYKEMFHKKVIHVAYFGPYVQRGWVSINSVMSFEGKLKFDDHVKELTENNSPKNIIQKYTIPQSRMKIFSESWKEAEEAMMMPVKDRIDVYGISYKNLNGESSSENEEKISEEEFDESDMDSSPCKKQKIVAETFEFQNLKLPTFSNCKKNPLCFLCLEENDESGNNLVANCTGGCGQQFHPDCLRLLFDYLTSKEPTTKVINYLKCVDCNRNVRRCFICQKLGKNDKKDEMMKCSTSNCGRYYHSNCLYNGHYQQLITYNRSGSLTCPSHICHACYIDDPEAVKQCSNHVRCLMCPSSFHKGDWCIPAGSKEINDNYIICPKHL-SMGGSAEITVTPFMDCIKNG---RVKLNSVNFKLTPFNDPQNKDFWVLEKPLKVSKSKSHNVTWCFLCPDGGKLICCERCPASLHQHCAAIDEIPVVFICDDCQSGRYPRYGDIYWLKIGSYRWWPGQIIHPNNAPEKVLKASHGDGQFLVQFFGTNDYYWMNKTHAFPFEDGDDKTGEMKKIIANSSLDEVTRDTSGNGNTKLDRDYRKSLKIAAKALVLRTSKWES-----ILNLKNKPSQYRSIKTN-VPIGNVRINKPADLTEIPQCECRPSDKCNDPCGPTSECMNRELMYECHPLVCRNGENCRNQRFMRREYPKQEVFSTDNRGWALRTLEPIKKGAFVNEYVGELIDEAEANRRLKKAHETNVSNFYMMELDGQRIIDAGPAANISRFMNHSCSPNVYTQKWSVNGDTRIGLFALHTIKAGEELTFNYNFFSLGQKKLPCKCGASNCSGFLGDPPKTASPDSEPSDKDSILELKKSYNSNNKIDKKKILINKKPNNTVDLQNFFQKKLVDQECYRCGQ---NNCEIFCSHQHCPRVYHLQCVSL--SNIPKSLWLCPWHCCDDCGRISEYFCSECTTSYC---LLHRFN 1066          
BLAST of NSD-1 vs. Planmine SMEST
Match: SMESG000039925.1 (SMESG000039925.1)

HSP 1 Score: 511.916 bits (1317), Expect = 4.555e-164
Identity = 322/974 (33.06%), Postives = 479/974 (49.18%), Query Frame = 3
Query:  171 TEDSRSKSYKVGQIICGKVGKYPWWPCMVNTIPTSN-------EPRVLVSYFGKKNDYSYLFDDCTMYAQTKSDFENIFKL---HNHDKKTLARLAHYKKQLDL---AWKEVEIASLLDENSRFELYKIKCE-----IKESINXXXXXXXXXXXXXXXXXXXXQEIIKREPI------------KYAFDELTLPFVSVKLTNKNCRYCLETKN------IVQCNKCLFNNFHVKCLEFLQNSIE-----TKINDLDRCLECSLGIIRCYACYKIVDISNEQGFMRCIIKTCTKWFHTNCLETGPMLEMTKFPKPGQLVCPCHICHKCELVNPSPKYRCTKLIVCIMCPATFHTGDWCIPAGSVELNTGEIICPRHLVDLNFSMNIMVPPFVARVKSDLQERIYGNT----LTKISEPMTITPSTVTKPT--------NVNWCFKCGEGGELLCCETCPAAYHFKCTDLKEIPQKFYCPDCASFCYRSYGEIVWIKCGTHPWWPGQILHLENVPKNIAAKKHANGQFVVQFFGSRDYMWRDHGNVFLYEKEDECNSKTSKYRYNNIFLE-------------------GIKEAAIGYVTREEKWQSGSCDHVMNSK----IYNKIQVNKCPLELRRKVVP----ETPHCNCISFDPKSD-CSIGSGCFNVASKCECDPQICNLGDKCKNQNFVKRIYPKQYTFWANDRGWGLKADEFIKTKQFVNEYIGEIITMEESEKRILWANENNITDFYFMELDNGRLIDARQFSNLSRFINNSCDPNLVAEKWIVNREHRIGLFALRDIQKGEELTFQYNLQNKSSNRIVCKCFSVNCSGFLGEAPKMAXXXXXXXXXXXXXXXXXX------------------XXXXXCKSFLTDKNSNSQCFRCGEIIDMLSSIVCSVGPCMKTYHSVCLNLNMANYVQSSWICPHHYCDVCARPSHHFSSNTTESYCNKDFIKKFN 2795
            T+++ S+ Y VG+++  KV  +PWWPCM+   P  N       +  + V+YFG      ++  +  M  + K  F++  K    +N  K  + +    + ++ +   +WKE E A ++    R ++Y I  +                    +   + +  K Q+I+    +             + F  L LP  S    N  C  CLE  +      +  C       FH  CL  L + +      TK+ +  +C++C+  + RC+ C K+     +   M+C    C +++H+NCL  G   ++  + + G L CP HICH C + +P    +C+  + C+MCP++FH GDWCIPAGS E+N   IICP+HL  +  S  I V PF+  +K+    R+  N+    LT  ++P       + KP         NV WCF C +GG+L+CCE CPA+ H  C  + EIP  F C DC S  Y  YG+I W+K G++ WWPGQI+H  N P+ +    H +GQF+VQFFG+ DY W +  + F +E  D+   +  K   N+   E                    +K AA   V R  KW+S     ++N K     Y  I+ N  P+   R   P    E P C C   D  +D C   S C N     EC P +C  G+ C+NQ F++R YPKQ  F  ++RGW L+  E IK   FVNEY+GE+I   E+ +R+  A+E N+++FY MELD  R+IDA   +N+SRF+N+SC PN+  +KW VN + RIGLFAL  I+ GEELTF YN  +    ++ CKC + NCSGFLG+ PK A      SD     +   +                   +    ++F   K  + +C+RCG+       I CS   C + YH  C++L  +N  +S W+CP H CD C R S +F S  T SYC    + +FN
Sbjct:  126 TQENTSEEYYVGRLLWAKVKSHPWWPCMIYYSPEKNFYKEMFHKKVIHVAYFGPYVQRGWVSINSVMSFEGKLKFDDHVKELTENNSPKNIIQKYTIPQSRMKIFSESWKEAEEAMMMPVKDRIDVYGISYKNLNGESSSENEEKISEEEFDESDMDSSPCKKQKIVAETALTIVYIGRFSIVLNFEFQNLKLPTFSNCKKNPLCFLCLEENDESGNNLVANCTGGCGQQFHPDCLRLLFDYLTSKEPTTKVINYLKCVDCNRNVRRCFICQKLGKNDKKDEMMKCSTSNCGRYYHSNCLYNGHYQQLITYNRSGSLTCPSHICHACYIDDPEAVKQCSNHVRCLMCPSSFHKGDWCIPAGSKEINDNYIICPKHL-SMGGSAEITVTPFMDCIKNG---RVKLNSVNFKLTPFNDPQNKDFWVLEKPLKVSKSKSHNVTWCFLCPDGGKLICCERCPASLHQHCAAIDEIPVVFICDDCQSGRYPRYGDIYWLKIGSYRWWPGQIIHPNNAPEKVLKASHGDGQFLVQFFGTNDYYWMNKTHAFPFEDGDDKTGEMKKIIANSSLDEVTRDTSGNGNTKLDRDYRKSLKIAAKALVLRTSKWES-----ILNLKNKPSQYRSIKTN-VPIGNVRINKPADLTEIPQCECRPSDKCNDPCGPTSECMNRELMYECHPLVCRNGENCRNQRFMRREYPKQEVFSTDNRGWALRTLEPIKKGAFVNEYVGELIDEAEANRRLKKAHETNVSNFYMMELDGQRIIDAGPAANISRFMNHSCSPNVYTQKWSVNGDTRIGLFALHTIKAGEELTFNYNFFSLGQKKLPCKCGASNCSGFLGDPPKTASPDSEPSDKDSILELKKSYNSNNKIDKKKILINKKPNNTVDLQNFFQKKLVDQECYRCGQ---NNCEIFCSHQHCPRVYHLQCVSL--SNIPKSLWLCPWHCCDDCGRISEYFCSECTTSYC---LLHRFN 1081          
BLAST of NSD-1 vs. Planmine SMEST
Match: SMESG000081033.1 (SMESG000081033.1)

HSP 1 Score: 261.536 bits (667), Expect = 1.807e-73
Identity = 182/610 (29.84%), Postives = 274/610 (44.92%), Query Frame = 3
Query:  693 CRYCLETKNIVQCNKCLFNNFHVKCLEFLQNSIETKINDLDRCLECSLGIIRCYACYKIVDISNEQGFMRCIIKTCTKWFHTNCLETGPMLEMTKFPKPGQLVCPCHICHKCELVNPS-PKYRCTKLIVCIMCPATFHTGDWCIPAGSVELNTGEIICPRHLVDLNFSMNIMVPPFVARVKSDLQERIYGNTLTKISEPMTITPSTVTKPTNVNWCFKCGEGGELLCCETCPAAYHFKCTDLKEIPQKFYCPDCASFCYRSYGEIVWIKCGTHPWWPGQILHLENVPKNIAAKKHANGQFVVQFFGSRDYMWRDHGNVFLYE--------KEDECNSKTSKYRYNNIFLEG-IKEAAIGYVTREEKWQSGSCDHVMNSKIYNKIQVNKC-----------------PLELRRKVVPETPHCNCISFDPKSDCSIGSGCFNVASKCECDPQICNLGDKCKNQNFVKRIYPKQYTFWANDRGWGLKADEFIKTKQFVNEYIGEIITMEESEKRILWANENNITDFYFMELDNGRLIDARQFSNLSRFINNSCDPNLVAEKWIVNREHRIGLFALRDIQKGEELTFQYNLQNK-SSNRIVCKCFSVNCSGFLG 2438
            C    E   ++QC       FH+ CL+ L+ +  T   +  +CL+C  GI  C  C K+  I +    + C    C + +H +CLE    + + +      L CP H C  C   + +  +  C KL+ C+ CP +FH  D C+ AG+ EL+   +ICP+H                           + N L K++           KP +  WCFKC + G  L C  CPA+YH +C        ++ C +C +F    YGE++++K   + WWP +I+H  N P NI      +G + V F GS +Y W        +         KE    ++  +   + + + G I +  +  +      +S S   +   ++Y  + V +                  P +L  KV  +   C+C+   PK DC       N  +K EC    C    KCKNQ F    +     F  ++RG+GLK    I    F+ EY+GE+IT  ESE R+L A + N  DFY + L    +IDA    NLSR++N+SCDPN   E WIVN   + G+FAL++I   +ELTF Y +          C C S NC+GFLG
Sbjct:  149 CEIYTENNAVLQCTGICKRYFHLHCLKNLKENQPTSKPNF-QCLDCFSGIYHCILCQKVDKIDD---LLACENSDCGRLYHKSCLEMSNFIGI-EIHDNKILSCPSHYCISCVREDATFAQNPCKKLVECLRCPLSFHCNDLCMAAGAYELSLSHVICPQH---------------------------FENKLVKLN---------AHKPFHPAWCFKCFKTGVKLHCNYCPASYHIECVSDYSEESRYVCYNCRNFRQPRYGEVLFVKVHQYRWWPCEIIHPRNAPMNILKLNRPDGTYPVLFLGSNEYQWVAKTRSIDFNTAQFSSIFKESGGTTRMDRDFSSGLRVAGKIHQVYVNILLMHVPLRSISASSMTAEELYPYVNVKEINQKTVKFKLIKANIIVPPAKLPPKV--QASICDCVDNCPKQDCK------NYLNKIECQITQC---PKCKNQQFTNVDHKNIAVFKTSNRGFGLKTTIPINKNDFIIEYLGELITKNESELRMLNAKKFNAKDFYMIHLTGDLVIDAGPKGNLSRYMNHSCDPNCYLENWIVNGYPKKGVFALKEIGSDQELTFDYRISGVIMKEDAFCLCSSNNCTGFLG 706          

HSP 2 Score: 50.0618 bits (118), Expect = 9.328e-6
Identity = 30/86 (34.88%), Postives = 42/86 (48.84%), Query Frame = 3
Query: 2535 FLTDKNSNSQ-------CFRCGEIIDMLSSIVCSVGPCMKTYHSVCLNLNMANYVQSSWICPHHYCDVCARPSHHFSSNTTESYCN 2771
            F+ DK+S          C+RC    D  + ++C    C KTYH  CL L  A     +W CP H+CD+C +PS  F      S+C+
Sbjct:  785 FIKDKDSVESKTIHENFCYRC---FDGGNLVLCDKMNCPKTYHLSCLGLEEA--PSGTWYCPWHFCDICGQPSKLFCVRCPASFCD 865          
BLAST of NSD-1 vs. Planmine SMEST
Match: SMESG000015096.1 (SMESG000015096.1)

HSP 1 Score: 177.563 bits (449), Expect = 2.028e-51
Identity = 81/81 (100.00%), Postives = 81/81 (100.00%), Query Frame = 3
Query:  897 MRCIIKTCTKWFHTNCLETGPMLEMTKFPKPGQLVCPCHICHKCELVNPSPKYRCTKLIVCIMCPATFHTGDWCIPAGSVE 1139
            MRCIIKTCTKWFHTNCLETGPMLEMTKFPKPGQLVCPCHICHKCELVNPSPKYRCTKLIVCIMCPATFHTGDWCIPAGSVE
Sbjct:    1 MRCIIKTCTKWFHTNCLETGPMLEMTKFPKPGQLVCPCHICHKCELVNPSPKYRCTKLIVCIMCPATFHTGDWCIPAGSVE 81          
The following BLAST results are available for this feature:
BLAST of NSD-1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
NSD21.548e-11633.62nuclear receptor binding SET domain protein 2 [Sou... [more]
NSD21.548e-11633.62nuclear receptor binding SET domain protein 2 [Sou... [more]
NSD21.548e-11633.62nuclear receptor binding SET domain protein 2 [Sou... [more]
NSD21.548e-11633.62nuclear receptor binding SET domain protein 2 [Sou... [more]
NSD22.384e-11634.92nuclear receptor binding SET domain protein 2 [Sou... [more]
back to top
BLAST of NSD-1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
met-11.167e-2439.89Histone-lysine N-methyltransferase [Source:UniPro... [more]
met-11.201e-2439.89Histone-lysine N-methyltransferase [Source:UniPro... [more]
mes-48.868e-2224.49Histone-lysine N-methyltransferase mes-4 [Source:... [more]
set-126.439e-2135.87Histone-lysine N-methyltransferase [Source:UniPro... [more]
set-24.795e-1633.74Histone-lysine N-methyltransferase set-2 [Source:... [more]
back to top
BLAST of NSD-1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
NSD1.121e-8334.15gene:FBgn0039559 transcript:FBtr0085267[more]
NSD1.167e-8334.15gene:FBgn0039559 transcript:FBtr0335014[more]
Set26.365e-3335.92gene:FBgn0030486 transcript:FBtr0301559[more]
Set26.577e-3335.92gene:FBgn0030486 transcript:FBtr0073779[more]
ash11.392e-2935.43gene:FBgn0005386 transcript:FBtr0306009[more]
back to top
BLAST of NSD-1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nsd1b6.227e-11534.00nuclear receptor binding SET domain protein 1b [So... [more]
nsd1a4.521e-11434.13nuclear receptor binding SET domain protein 1a [So... [more]
nsd1a5.643e-11434.13nuclear receptor binding SET domain protein 1a [So... [more]
nsd1b7.773e-11434.00nuclear receptor binding SET domain protein 1b [So... [more]
nsd23.898e-11133.95nuclear receptor binding SET domain protein 2 [Sou... [more]
back to top
BLAST of NSD-1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
NSD22.386e-11734.09nuclear receptor binding SET domain protein 2 [Sou... [more]
NSD12.725e-11733.61nuclear receptor binding SET domain protein 1 [Sou... [more]
NSD12.808e-11733.75nuclear receptor binding SET domain protein 1 [Sou... [more]
NSD21.175e-11634.09nuclear receptor binding SET domain protein 2 [Sou... [more]
NSD11.325e-11633.75nuclear receptor binding SET domain protein 1 [Sou... [more]
back to top
BLAST of NSD-1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Nsd21.027e-11733.20nuclear receptor binding SET domain protein 2 [Sou... [more]
Nsd21.027e-11733.20nuclear receptor binding SET domain protein 2 [Sou... [more]
Nsd21.066e-11733.06nuclear receptor binding SET domain protein 2 [Sou... [more]
Nsd11.293e-11133.02nuclear receptor-binding SET-domain protein 1 [Sou... [more]
Nsd11.366e-11133.02nuclear receptor-binding SET-domain protein 1 [Sou... [more]
back to top
BLAST of NSD-1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8BVE8|NSD2_MOUSE7.455e-11733.06Histone-lysine N-methyltransferase NSD2 OS=Mus mus... [more]
sp|O96028|NSD2_HUMAN7.434e-11633.62Histone-lysine N-methyltransferase NSD2 OS=Homo sa... [more]
sp|Q96L73|NSD1_HUMAN5.937e-11133.61Histone-lysine N-methyltransferase, H3 lysine-36 s... [more]
sp|O88491|NSD1_MOUSE1.585e-11032.89Histone-lysine N-methyltransferase, H3 lysine-36 s... [more]
sp|Q6P2L6|NSD3_MOUSE7.865e-10433.15Histone-lysine N-methyltransferase NSD3 OS=Mus mus... [more]
back to top
BLAST of NSD-1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
H9CXT10.000e+0100.00NSD-1 OS=Schmidtea mediterranea OX=79327 PE=2 SV=1[more]
A0A2T7PCE11.659e-12034.99Uncharacterized protein OS=Pomacea canaliculata OX... [more]
A0A267ERM72.243e-12034.18Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A267FZR22.618e-12034.18Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A1I8IAL62.722e-12034.18Histone-lysine N-methyltransferase OS=Macrostomum ... [more]
back to top
BLAST of NSD-1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nsd21.083e-11734.53nuclear receptor binding SET domain protein 2 [Sou... [more]
nsd22.209e-11734.53nuclear receptor binding SET domain protein 2 [Sou... [more]
nsd1a5.021e-11233.75nuclear receptor binding SET domain protein 1a [So... [more]
nsd1b8.850e-11036.59nuclear receptor binding SET domain protein 1b [So... [more]
nsd34.105e-8737.90nuclear receptor binding SET domain protein 3 [Sou... [more]
back to top
BLAST of NSD-1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nsd21.614e-11234.48nuclear receptor binding SET domain protein 2 [Sou... [more]
ENSPMAT00000003690.13.491e-2540.26pep scaffold:Pmarinus_7.0:GL484755:705:3732:1 gene... [more]
ENSPMAT00000005461.15.936e-2530.32pep scaffold:Pmarinus_7.0:GL477205:1717:42601:-1 g... [more]
SUV39H23.324e-2335.23suppressor of variegation 3-9 homolog 2 [Source:HG... [more]
ENSPMAT00000004922.11.087e-1733.94pep scaffold:Pmarinus_7.0:GL479351:23010:32607:-1 ... [more]
back to top
BLAST of NSD-1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
SET21.369e-3239.66Histone methyltransferase with a role in transcrip... [more]
SET17.519e-1938.46Histone methyltransferase, subunit of the COMPASS ... [more]
back to top
BLAST of NSD-1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO431566.299e-10332.38Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO437631.088e-3039.43Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO362312.699e-2036.02Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO498084.792e-1833.52Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO303226.720e-1833.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of NSD-1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nsd21.202e-11734.76nuclear receptor binding SET domain protein 2 [Sou... [more]
nsd1b1.230e-11434.14histone-lysine N-methyltransferase, H3 lysine-36 a... [more]
nsd1b2.482e-11434.14histone-lysine N-methyltransferase, H3 lysine-36 a... [more]
nsd1b2.482e-11434.14histone-lysine N-methyltransferase, H3 lysine-36 a... [more]
nsd1b3.283e-11434.14histone-lysine N-methyltransferase, H3 lysine-36 a... [more]
back to top
BLAST of NSD-1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000015015.10.000e+099.78SMESG000015015.1[more]
SMESG000039925.11.450e-16533.37SMESG000039925.1[more]
SMESG000039925.14.555e-16433.06SMESG000039925.1[more]
SMESG000081033.11.807e-7329.84SMESG000081033.1[more]
SMESG000015096.12.028e-51100.00SMESG000015096.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30009651
GenBankAFD29602.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30009651 ID=SMED30009651|Name=NSD-1|organism=Schmidtea mediterranea sexual|type=transcript|length=2967bp
TTGTTAATTAAATCATTCTTTAAAATTACAATTCTAAATGATTTTGCTTT
TACTTTATGTTATTTAACTCAATTATCATTAATTCTATTAGTTATAATAT
GTTTAAAGAATTGACTAATTTAAATAATAATTCATCAAATGTTAGTCTTC
TAAGCACAAGTTCAAATCGCACAGAAGATTCTCGTTCCAAATCATACAAG
GTAGGTCAAATAATATGTGGAAAAGTGGGAAAATATCCATGGTGGCCTTG
CATGGTTAACACAATCCCTACTAGCAATGAACCTAGAGTTCTTGTTAGTT
ATTTTGGAAAGAAAAATGATTACAGTTATTTATTCGATGATTGCACCATG
TATGCTCAAACCAAATCAGATTTTGAAAATATTTTTAAACTTCACAATCA
TGATAAAAAGACGCTGGCACGACTTGCACATTACAAGAAACAGTTGGACT
TAGCCTGGAAAGAAGTTGAAATTGCATCTCTATTAGACGAAAATTCAAGA
TTCGAATTATATAAAATCAAATGTGAAATAAAAGAATCTATTAATCCACC
AAAAAAACGAATTCGTCCACCGAAACCGAAGAAAGAAAAAGCAGCGAGTA
AACCACAGGAAATTATCAAAAGAGAACCTATTAAGTATGCGTTTGATGAG
TTGACATTGCCGTTCGTTTCTGTGAAGTTGACCAACAAAAATTGTCGCTA
TTGTCTTGAAACTAAAAATATAGTTCAATGCAATAAATGTTTATTTAATA
ATTTCCACGTGAAATGTTTGGAATTTCTACAAAATTCAATTGAAACGAAA
ATCAACGATTTAGACAGATGCCTGGAGTGTTCTCTGGGAATTATCAGGTG
CTACGCGTGCTATAAAATTGTTGACATTAGCAATGAACAAGGGTTTATGA
GATGCATCATTAAAACATGCACGAAATGGTTTCATACAAACTGCTTGGAA
ACAGGACCGATGCTAGAAATGACAAAATTTCCCAAACCTGGACAATTGGT
TTGTCCTTGCCACATTTGCCATAAATGCGAATTAGTAAATCCATCTCCGA
AATATAGATGTACGAAATTGATTGTTTGTATTATGTGCCCTGCTACGTTC
CATACCGGTGATTGGTGTATTCCGGCTGGTTCTGTCGAGCTAAATACTGG
AGAAATAATTTGTCCAAGACATCTTGTCGATCTCAATTTTTCAATGAACA
TTATGGTCCCACCATTTGTTGCTAGAGTTAAGAGTGATTTACAGGAAAGA
ATTTATGGAAACACATTAACCAAAATATCAGAACCAATGACAATTACTCC
TAGCACAGTGACGAAGCCTACAAATGTTAATTGGTGTTTCAAATGTGGGG
AAGGAGGAGAATTACTGTGCTGTGAAACCTGTCCGGCTGCTTACCATTTC
AAATGTACCGATTTAAAGGAGATTCCTCAGAAATTCTACTGTCCTGATTG
CGCATCTTTCTGTTATCGGAGCTACGGAGAGATAGTTTGGATAAAATGTG
GAACCCATCCATGGTGGCCAGGACAAATCCTGCATTTGGAAAATGTTCCG
AAAAATATTGCTGCCAAAAAACACGCAAACGGACAATTTGTTGTTCAGTT
TTTCGGTTCTCGGGATTATATGTGGCGAGATCATGGAAATGTGTTTCTTT
ATGAAAAAGAAGATGAGTGTAATTCTAAGACTTCCAAATACAGATACAAT
AACATTTTCCTTGAAGGAATTAAAGAAGCTGCAATTGGATATGTAACAAG
AGAAGAAAAGTGGCAATCAGGTTCTTGTGATCACGTGATGAACTCCAAAA
TTTATAATAAAATTCAGGTGAATAAATGTCCATTGGAACTTAGACGAAAA
GTTGTTCCAGAAACACCACATTGTAACTGTATTTCATTCGATCCAAAGAG
TGATTGTAGTATCGGTAGCGGATGTTTCAATGTTGCCTCAAAGTGTGAAT
GTGACCCTCAAATTTGTAATCTTGGAGATAAATGCAAAAATCAAAATTTT
GTTAAAAGAATTTATCCAAAACAATACACATTTTGGGCTAACGATCGCGG
ATGGGGTTTAAAAGCAGATGAATTTATCAAAACGAAACAATTTGTAAATG
AATATATTGGAGAAATTATTACCATGGAAGAATCAGAAAAGAGAATTTTA
TGGGCTAATGAAAACAATATAACCGATTTTTATTTTATGGAACTTGATAA
TGGTAGATTAATTGATGCTCGACAGTTCTCCAACCTTTCACGATTTATTA
ATAATTCATGTGACCCAAACCTGGTTGCTGAAAAATGGATAGTTAATCGT
GAACATCGCATTGGTTTGTTTGCTTTGAGAGATATTCAGAAAGGTGAAGA
GCTAACTTTTCAATATAATCTTCAAAACAAATCATCTAACCGAATAGTTT
GTAAATGTTTTTCAGTAAATTGTTCTGGATTTTTAGGCGAAGCACCTAAA
ATGGCAAAAGTTTCTAAACTAAAATCTGACACATCAAAGAAATCCAAAGG
CGACACTACTGAATCCGAGTCCAGCTGCAAATCATTTCTAACGGATAAAA
ATTCAAATTCGCAATGCTTTCGATGCGGGGAGATTATCGACATGTTGAGC
AGCATTGTATGTAGCGTTGGCCCTTGTATGAAAACTTATCATTCTGTATG
TTTAAATTTAAACATGGCGAACTATGTTCAAAGCTCATGGATATGTCCGC
ATCATTATTGTGACGTTTGCGCTCGACCATCACATCACTTTTCGTCGAAT
ACTACCGAATCATACTGCAATAAAGATTTTATAAAAAAATTTAATTCATA
ATTTTGAAATTATATTTTTTACTTGAAATTTTAATTAAATGTGAGAAATG
CAACTTTTTGAATGATTGAAGAATGATCTGAAATTTTTGTCACTTTTTGC
ATTGGATTAGTTCGACTACTATTGCTATTGATTGAAAGAATTATATTTTT
TAAATGTCATTTTTTTG
back to top

protein sequence of SMED30009651-orf-1

>SMED30009651-orf-1 ID=SMED30009651-orf-1|Name=SMED30009651-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=915bp
MLFNSIIINSISYNMFKELTNLNNNSSNVSLLSTSSNRTEDSRSKSYKVG
QIICGKVGKYPWWPCMVNTIPTSNEPRVLVSYFGKKNDYSYLFDDCTMYA
QTKSDFENIFKLHNHDKKTLARLAHYKKQLDLAWKEVEIASLLDENSRFE
LYKIKCEIKESINPPKKRIRPPKPKKEKAASKPQEIIKREPIKYAFDELT
LPFVSVKLTNKNCRYCLETKNIVQCNKCLFNNFHVKCLEFLQNSIETKIN
DLDRCLECSLGIIRCYACYKIVDISNEQGFMRCIIKTCTKWFHTNCLETG
PMLEMTKFPKPGQLVCPCHICHKCELVNPSPKYRCTKLIVCIMCPATFHT
GDWCIPAGSVELNTGEIICPRHLVDLNFSMNIMVPPFVARVKSDLQERIY
GNTLTKISEPMTITPSTVTKPTNVNWCFKCGEGGELLCCETCPAAYHFKC
TDLKEIPQKFYCPDCASFCYRSYGEIVWIKCGTHPWWPGQILHLENVPKN
IAAKKHANGQFVVQFFGSRDYMWRDHGNVFLYEKEDECNSKTSKYRYNNI
FLEGIKEAAIGYVTREEKWQSGSCDHVMNSKIYNKIQVNKCPLELRRKVV
PETPHCNCISFDPKSDCSIGSGCFNVASKCECDPQICNLGDKCKNQNFVK
RIYPKQYTFWANDRGWGLKADEFIKTKQFVNEYIGEIITMEESEKRILWA
NENNITDFYFMELDNGRLIDARQFSNLSRFINNSCDPNLVAEKWIVNREH
RIGLFALRDIQKGEELTFQYNLQNKSSNRIVCKCFSVNCSGFLGEAPKMA
KVSKLKSDTSKKSKGDTTESESSCKSFLTDKNSNSQCFRCGEIIDMLSSI
VCSVGPCMKTYHSVCLNLNMANYVQSSWICPHHYCDVCARPSHHFSSNTT
ESYCNKDFIKKFNS*
back to top
Aliases
The feature 'NSD-1' has the following synonyms
Synonym
NSD-1
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000070intestinal phagocyte
PLANA:0000420parapharyngeal region
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0002111X2 cell
PLANA:0002142parenchyma
Vocabulary: INTERPRO
TermDefinition
IPR006560AWS_dom
IPR001965Znf_PHD
IPR000313PWWP_dom
IPR001214SET_dom
IPR013083Znf_RING/FYVE/PHD
IPR019786Zinc_finger_PHD-type_CS
IPR003616Post-SET_dom
IPR011011Znf_FYVE_PHD
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
Vocabulary: molecular function
TermDefinition
GO:0018024histone-lysine N-methyltransferase activity
GO:0008270zinc ion binding
GO:0005515protein binding
GO:0003677DNA binding
GO:0008168methyltransferase activity
GO:0016740transferase activity
GO:0046872metal ion binding
Vocabulary: biological process
TermDefinition
GO:0032259methylation
GO:0034968histone lysine methylation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000313PWWP domainSMARTSM00293PWWP_4coord: 47..97
e-value: 0.15
score: 9.4
coord: 471..533
e-value: 3.3E-11
score: 53.2
IPR000313PWWP domainPFAMPF00855PWWPcoord: 47..120
e-value: 5.8E-7
score: 29.8
coord: 473..558
e-value: 1.8E-16
score: 60.3
IPR000313PWWP domainPROSITEPS50812PWWPcoord: 49..102
score: 10.051
IPR000313PWWP domainPROSITEPS50812PWWPcoord: 473..535
score: 16.55
IPR001214SET domainSMARTSM00317set_7coord: 654..777
e-value: 4.0E-32
score: 122.7
IPR001214SET domainPFAMPF00856SETcoord: 665..771
e-value: 1.3E-16
score: 61.5
IPR001214SET domainPROSITEPS50280SETcoord: 650..771
score: 16.884
IPR006560AWS domainSMARTSM00570shorttest3coord: 601..653
e-value: 0.0019
score: 25.8
IPR006560AWS domainPFAMPF17907AWScoord: 615..651
e-value: 5.9E-7
score: 29.4
IPR006560AWS domainPROSITEPS51215AWScoord: 601..652
score: 11.637
IPR001965Zinc finger, PHD-typeSMARTSM00249PHD_3coord: 212..259
e-value: 2.7
score: 12.6
coord: 836..884
e-value: 0.0057
score: 25.9
coord: 320..373
e-value: 3.2
score: 11.8
coord: 426..466
e-value: 2.8E-7
score: 40.2
coord: 264..319
e-value: 4.6
score: 9.9
IPR013083Zinc finger, RING/FYVE/PHD-typeGENE3DG3DSA:3.30.40.10coord: 417..468
e-value: 7.2E-12
score: 46.9
IPR013083Zinc finger, RING/FYVE/PHD-typeGENE3DG3DSA:3.30.40.10coord: 829..913
e-value: 2.1E-13
score: 52.2
NoneNo IPR availableGENE3DG3DSA:2.170.270.10coord: 578..802
e-value: 2.0E-60
score: 206.1
NoneNo IPR availableGENE3DG3DSA:2.30.30.140coord: 35..147
e-value: 1.8E-13
score: 52.4
NoneNo IPR availableGENE3DG3DSA:2.30.30.140coord: 471..568
e-value: 1.0E-21
score: 79.1
NoneNo IPR availablePANTHERPTHR22884SET DOMAIN PROTEINScoord: 211..906
NoneNo IPR availablePANTHERPTHR22884:SF293HISTONE-LYSINE N-METHYLTRANSFERASE NSD2coord: 211..906
NoneNo IPR availableCDDcd15567PHD4_NSDcoord: 426..465
e-value: 2.20086E-14
score: 65.7306
NoneNo IPR availableCDDcd15566PHD3_NSDcoord: 321..372
e-value: 3.68998E-12
score: 59.7501
NoneNo IPR availableSUPERFAMILYSSF63748Tudor/PWWP/MBTcoord: 43..121
NoneNo IPR availableSUPERFAMILYSSF63748Tudor/PWWP/MBTcoord: 472..558
NoneNo IPR availableSUPERFAMILYSSF82199SET domaincoord: 581..784
IPR019786Zinc finger, PHD-type, conserved sitePROSITEPS01359ZF_PHD_1coord: 427..465
IPR003616Post-SET domainPROSITEPS50868POST_SETcoord: 778..794
score: 8.462
IPR011011Zinc finger, FYVE/PHD-typeSUPERFAMILYSSF57903FYVE/PHD zinc fingercoord: 422..467
IPR011011Zinc finger, FYVE/PHD-typeSUPERFAMILYSSF57903FYVE/PHD zinc fingercoord: 831..892