52 kDa repressor of the inhibitor of the protein kinase-like protein

Overview
Name52 kDa repressor of the inhibitor of the protein kinase-like protein
Smed IDSMED30009638
Length (bp)303
Neoblast Clusters

Zeng et. al., 2018




 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30009638

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
reproductive organSMED30009638SMESG000079542.1 SMESG000077227.1 SMESG000077225.1 SMESG000071441.1 SMESG000064845.1 SMESG000059570.1 SMESG000053255.1 SMESG000047025.1 SMESG000046893.1 SMESG000030741.1 SMESG000022456.1 SMESG000022362.1 SMESG000021111.1 SMESG000008969.1 SMESG000008086.1 SMESG000000957.1 SMESG000020914.1 Contig37318newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30009638SMESG000079542.1 SMESG000077227.1 SMESG000077225.1 SMESG000071441.1 SMESG000064845.1 SMESG000059570.1 SMESG000053255.1 SMESG000047025.1 SMESG000046893.1 SMESG000030741.1 SMESG000022456.1 SMESG000022362.1 SMESG000021111.1 SMESG000008969.1 SMESG000008086.1 SMESG000000957.1 SMESG000020914.1 Contig37318uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of 52 kDa repressor of the inhibitor of the protein kinase-like protein vs. Ensembl Zebrafish
Match: CR762475.1 (pep chromosome:GRCz11:4:55494751:55498830:1 gene:ENSDARG00000098243.2 transcript:ENSDART00000172605.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CR762475.1)

HSP 1 Score: 43.8986 bits (102), Expect = 5.918e-6
Identity = 23/65 (35.38%), Postives = 34/65 (52.31%), Query Frame = 3
Query:    9 AKYISETIISSLVKFGLDLSKMVGRAYDGCSTMAGKISDVQDQYSFAN----FYHCSSHRLNLVI 191
             K +   +IS L   GLDL  + G+ YDG + M+G    +Q +    N    + HC +H LNLV+
Sbjct:  448 GKELENVVISLLQDNGLDLKNIRGQGYDGAANMSGMYKGLQSRIRAHNEKALYVHCQAHCLNLVL 512          
BLAST of 52 kDa repressor of the inhibitor of the protein kinase-like protein vs. Ensembl Xenopus
Match: tbx18 (T-box 18 [Source:Xenbase;Acc:XB-GENE-489907])

HSP 1 Score: 120.939 bits (302), Expect = 6.893e-33
Identity = 56/103 (54.37%), Postives = 75/103 (72.82%), Query Frame = 3
Query:    6 DAKYISETIISSLVKFGLDLSKMVGRAYDGCSTMAGKISDVQ----DQYSFANFYHCSSHRLNLVINDLNDICEIRNAVGTIKSIINFFRESSLRRKHIPNIP 302
            DA  I+  I+   +KFGL++ K+ G+ YDGCSTMAGK   VQ    ++Y  A F HC+SH+LNLV+N+LN + EIRNA+G++K+II FFRES  RR  IPN+P
Sbjct:  196 DATSIANVIMEQCIKFGLNIDKLYGQGYDGCSTMAGKEGGVQAKIKEKYPRAIFVHCASHKLNLVVNNLNAVPEIRNAIGSVKAIIKFFRESPKRRSLIPNVP 298          
BLAST of 52 kDa repressor of the inhibitor of the protein kinase-like protein vs. Ensembl Xenopus
Match: slc10a6 (solute carrier family 10 (sodium/bile acid cotransporter), member 6 [Source:Xenbase;Acc:XB-GENE-988401])

HSP 1 Score: 114.39 bits (285), Expect = 1.243e-30
Identity = 54/104 (51.92%), Postives = 74/104 (71.15%), Query Frame = 3
Query:    3 MDAKYISETIISSLVKFGLDLSKMVGRAYDGCSTMAGKISDVQ----DQYSFANFYHCSSHRLNLVINDLNDICEIRNAVGTIKSIINFFRESSLRRKHIPNIP 302
            +DA  I+  I+   +KFGL++ K+ G+ YDGCSTMAGK   VQ    ++Y  A F +C+SH+LNLV+NDL  + +IRNA+G+ K+II FFRES  RR  IPN+P
Sbjct:  245 VDATSIANVIMEQCIKFGLNMDKLYGQGYDGCSTMAGKEGGVQAKIKEKYPRAIFVYCASHKLNLVVNDLKAVPDIRNAIGSGKAIIKFFRESPKRRSLIPNVP 348          
BLAST of 52 kDa repressor of the inhibitor of the protein kinase-like protein vs. TrEMBL
Match: X1WP09 (DUF4371 domain-containing protein OS=Acyrthosiphon pisum OX=7029 PE=4 SV=1)

HSP 1 Score: 127.487 bits (319), Expect = 2.271e-35
Identity = 60/104 (57.69%), Postives = 80/104 (76.92%), Query Frame = 3
Query:    3 MDAKYISETIISSLVKFGLDLSKMVGRAYDGCSTMAGKISDVQ----DQYSFANFYHCSSHRLNLVINDLNDICEIRNAVGTIKSIINFFRESSLRRKHIPNIP 302
            +DA  I+ +I++S+ K+ LD++K+VG  +DGCS MAGK + VQ    D+YS A F+HC+SHRLNLV+NDLN + EI+N VG IK +INFFRES LRRK + NIP
Sbjct:   42 LDAVGIATSILTSVEKYCLDMNKLVGLGFDGCSVMAGKENGVQKIICDKYSKATFFHCASHRLNLVVNDLNAVTEIQNTVGVIKEVINFFRESVLRRKLLTNIP 145          
BLAST of 52 kDa repressor of the inhibitor of the protein kinase-like protein vs. TrEMBL
Match: A0A0J7NNB2 (52 kDa repressor of the inhibitor of the protein kinase-like protein OS=Lasius niger OX=67767 GN=RF55_5874 PE=4 SV=1)

HSP 1 Score: 131.724 bits (330), Expect = 1.964e-33
Identity = 64/104 (61.54%), Postives = 78/104 (75.00%), Query Frame = 3
Query:    3 MDAKYISETIISSLVKFGLDLSKMVGRAYDGCSTMAGKISDVQ----DQYSFANFYHCSSHRLNLVINDLNDICEIRNAVGTIKSIINFFRESSLRRKHIPNIP 302
            +++K ISETII  L    LDL+++VG+ YDGC+ MAG IS VQ    D+Y  A F+HC+SH LNLVINDLND+ E+RN  GT K IINFFRES+LRR  IPNIP
Sbjct:  328 LNSKSISETIIRFLENCDLDLNRLVGQGYDGCAAMAGHISGVQKLINDKYPMALFFHCASHILNLVINDLNDVNEVRNTAGTTKEIINFFRESTLRRNMIPNIP 431          
BLAST of 52 kDa repressor of the inhibitor of the protein kinase-like protein vs. TrEMBL
Match: J9KNZ7 (Uncharacterized protein OS=Acyrthosiphon pisum OX=7029 PE=4 SV=2)

HSP 1 Score: 129.413 bits (324), Expect = 1.080e-32
Identity = 61/104 (58.65%), Postives = 81/104 (77.88%), Query Frame = 3
Query:    3 MDAKYISETIISSLVKFGLDLSKMVGRAYDGCSTMAGKISDVQ----DQYSFANFYHCSSHRLNLVINDLNDICEIRNAVGTIKSIINFFRESSLRRKHIPNIP 302
            +DA  I+ +I++S+ K+GLD++K+VG  +DGCS MAGK + VQ    D+YS A F+HC+SHRLNLV+NDLN + EI+N VG IK +INFFRES LRRK + NIP
Sbjct:  240 LDAVGIATSILTSVEKYGLDMNKLVGLGFDGCSVMAGKENGVQKIICDKYSKATFFHCASHRLNLVVNDLNAVTEIQNTVGVIKEVINFFRESVLRRKLLTNIP 343          
BLAST of 52 kDa repressor of the inhibitor of the protein kinase-like protein vs. TrEMBL
Match: J9KPM8 (DUF4371 domain-containing protein OS=Acyrthosiphon pisum OX=7029 PE=4 SV=2)

HSP 1 Score: 126.331 bits (316), Expect = 1.359e-32
Identity = 59/110 (53.64%), Postives = 80/110 (72.73%), Query Frame = 3
Query:    3 MDAKYISETIISSLVKFGLDLSKMVGRAYDGCSTMAGKISDVQ----------DQYSFANFYHCSSHRLNLVINDLNDICEIRNAVGTIKSIINFFRESSLRRKHIPNIP 302
            +DA  I+ +I++S+ K+GLD++K+VG  +DGCS MAGK + VQ          D+Y  A F+HC+SHRLNLV+NDLN + EI+N +G IK +INFFRES LRRK + NIP
Sbjct:  135 LDAVGIATSILTSVEKYGLDMNKLVGLGFDGCSVMAGKENGVQKRWVKSKIICDKYPKAKFFHCASHRLNLVVNDLNAVTEIQNTIGVIKEVINFFRESVLRRKLVTNIP 244          
BLAST of 52 kDa repressor of the inhibitor of the protein kinase-like protein vs. TrEMBL
Match: X1WV76 (DUF4371 domain-containing protein OS=Acyrthosiphon pisum OX=7029 PE=4 SV=1)

HSP 1 Score: 126.716 bits (317), Expect = 2.046e-32
Identity = 60/104 (57.69%), Postives = 78/104 (75.00%), Query Frame = 3
Query:    3 MDAKYISETIISSLVKFGLDLSKMVGRAYDGCSTMAGKISDVQ----DQYSFANFYHCSSHRLNLVINDLNDICEIRNAVGTIKSIINFFRESSLRRKHIPNIP 302
            +D+K I++TII  L    LDL+++VG+ YDGC+TMAG IS VQ    + Y  A F+HC+SH LNLV NDLN++ E+RN  G IK II+FFRES+LRR+ IPNIP
Sbjct:  214 LDSKSIAKTIIEFLESCNLDLNRLVGQGYDGCATMAGHISGVQKLINEAYPMALFFHCASHVLNLVFNDLNNVSEVRNTTGIIKEIIHFFRESTLRRQIIPNIP 317          
BLAST of 52 kDa repressor of the inhibitor of the protein kinase-like protein vs. Ensembl Cavefish
Match: ENSAMXT00000035789.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000101.1:2843018:2852765:1 gene:ENSAMXG00000037827.1 transcript:ENSAMXT00000035789.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 57.3806 bits (137), Expect = 1.079e-10
Identity = 38/97 (39.18%), Postives = 55/97 (56.70%), Query Frame = 3
Query:   24 ETIISSLVKF-GLDLSKMVGRAYDGCSTMAGKISDVQ----DQYSFANFYHCSSHRLNLVIND-LNDICEIRNAVGTIKSIINFFRESSLRRKHIPN 296
            ET I+ L++  GL L K  G+ YDG STM+G  S VQ    D+   A + HC++H LNLV+ND    I EI+     ++ +  FF +S  R + + N
Sbjct:  180 ETKITELIQSKGLPLHKCRGQGYDGASTMSGIYSGVQKRILDKEPNAVYVHCAAHNLNLVLNDACQHITEIKEYYDILQRLYVFFSQSIKRWELLEN 276          
BLAST of 52 kDa repressor of the inhibitor of the protein kinase-like protein vs. Ensembl Cavefish
Match: ENSAMXT00000042930.1 (pep primary_assembly:Astyanax_mexicanus-2.0:12:25471427:25473738:-1 gene:ENSAMXG00000037442.1 transcript:ENSAMXT00000042930.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 56.225 bits (134), Expect = 2.174e-10
Identity = 38/97 (39.18%), Postives = 55/97 (56.70%), Query Frame = 3
Query:   24 ETIISSLVKF-GLDLSKMVGRAYDGCSTMAGKISDVQ----DQYSFANFYHCSSHRLNLVIND-LNDICEIRNAVGTIKSIINFFRESSLRRKHIPN 296
            ET I+ L++  GL L K  G+ YDG STM+G  S VQ    D+   A + HC++H LNLV+ND    I EI+     ++ +  FF +S  R + + N
Sbjct:  222 ETKITELIQSNGLLLHKCRGQGYDGASTMSGIYSGVQKRILDKEPNAVYVHCAAHNLNLVLNDACQHITEIKEYYDILQRLYVFFSQSIKRWELLEN 318          
BLAST of 52 kDa repressor of the inhibitor of the protein kinase-like protein vs. Ensembl Cavefish
Match: ENSAMXT00000042613.1 (pep primary_assembly:Astyanax_mexicanus-2.0:15:33033943:33037804:1 gene:ENSAMXG00000040043.1 transcript:ENSAMXT00000042613.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 55.0694 bits (131), Expect = 5.714e-10
Identity = 37/109 (33.94%), Postives = 55/109 (50.46%), Query Frame = 3
Query:    6 DAKYISETIISSLVKFGLDLSKMVGRAYDGCSTMAGKISDVQD--QYSFAN---FYHCSSHRLNLV----------INDLNDICEIRNAVGTIKSIINFFRESSLRRKH 287
            DAK +++TII+ L K GL  SK++ + YDG S M+GK   VQ   Q        + HC +H+L+LV          I D  DIC          ++  FFR+ S+  ++
Sbjct:  334 DAKTLTDTIITELTKAGLSTSKILSQVYDGASLMSGKHGGVQKLLQEKLGREIPYVHCLNHQLHLVVVHALTAEKAITDFFDIC---------NTMYKFFRKPSVAAQY 433          
BLAST of 52 kDa repressor of the inhibitor of the protein kinase-like protein vs. Ensembl Cavefish
Match: ENSAMXT00000056429.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000470.1:7274:9337:1 gene:ENSAMXG00000039382.1 transcript:ENSAMXT00000056429.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 55.0694 bits (131), Expect = 7.035e-10
Identity = 37/109 (33.94%), Postives = 55/109 (50.46%), Query Frame = 3
Query:    6 DAKYISETIISSLVKFGLDLSKMVGRAYDGCSTMAGKISDVQD--QYSFAN---FYHCSSHRLNLV----------INDLNDICEIRNAVGTIKSIINFFRESSLRRKH 287
            DAK +++TII+ L K GL  SK++ + YDG S M+GK   VQ   Q        + HC +H+L+LV          I D  DIC          ++  FFR+ S+  ++
Sbjct:  334 DAKTLTDTIITELTKAGLSTSKILSQVYDGASLMSGKHGGVQKLLQEKLGREIPYVHCLNHQLHLVVVHALTAEKAITDFFDIC---------NTMYKFFRKPSVAAQY 433          
BLAST of 52 kDa repressor of the inhibitor of the protein kinase-like protein vs. Ensembl Cavefish
Match: ENSAMXT00000057644.1 (pep primary_assembly:Astyanax_mexicanus-2.0:10:17620682:17622807:-1 gene:ENSAMXG00000043641.1 transcript:ENSAMXT00000057644.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 51.9878 bits (123), Expect = 6.697e-9
Identity = 30/70 (42.86%), Postives = 43/70 (61.43%), Query Frame = 3
Query:    3 MDAKYISETIISSLVKFGLDL-SKMVGRAYDGCSTMAGKISDVQ----DQYSFANFYHCSSHRLNLVIND 197
            +DA  +++ II  L   GL+    +VG+AYDG S M+GK + VQ    +Q   A + HCS+H LNLV+ D
Sbjct:  176 LDAAGLTDKIIHILQSHGLEYRDNLVGQAYDGASVMSGKYTGVQARIKEQAKHAFYVHCSAHCLNLVLVD 245          
BLAST of 52 kDa repressor of the inhibitor of the protein kinase-like protein vs. Ensembl Medaka
Match: ENSORLT00000027735.1 (pep primary_assembly:ASM223467v1:9:30712608:30715295:1 gene:ENSORLG00000030268.1 transcript:ENSORLT00000027735.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 52.7582 bits (125), Expect = 3.722e-9
Identity = 30/70 (42.86%), Postives = 44/70 (62.86%), Query Frame = 3
Query:    3 MDAKYISETIISSLVKFGLDL-SKMVGRAYDGCSTMAGKISDVQ----DQYSFANFYHCSSHRLNLVIND 197
            ++A  +S+ II  L K GLD  + +VG+AYDG S M+GK + VQ     +   A + HC++H LNLV+ D
Sbjct:  354 LNAAALSQKIIEILQKHGLDYKNHLVGQAYDGASVMSGKNTGVQARIKSEAPLAFYVHCNAHCLNLVLVD 423          
BLAST of 52 kDa repressor of the inhibitor of the protein kinase-like protein vs. Ensembl Medaka
Match: ENSORLT00000037532.1 (pep primary_assembly:ASM223467v1:15:7541192:7543189:-1 gene:ENSORLG00000028110.1 transcript:ENSORLT00000037532.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 43.5134 bits (101), Expect = 6.428e-6
Identity = 29/96 (30.21%), Postives = 49/96 (51.04%), Query Frame = 3
Query:    9 AKYISETIISSLVKFGLDLSKMVGRAYDGCSTMAGKISDV----QDQYSFANFYHCSSHRLNLVINDL-NDICEIRNAVGTIKSIINFFRESSLRR 281
            A+ I + I     K GLD+ +MV    DG S M GK + V    + Q       HC +HR +L I+D   D+  +R+    ++++ + F  S+++R
Sbjct:   68 AQDIVQAIRQFYTKHGLDMQRMVMLTSDGASVMLGKRNGVAALLKQQIPHLTEQHCVAHREDLSIDDAWKDLPLMRDVETFLRTVYSTFSRSTVKR 163          
BLAST of 52 kDa repressor of the inhibitor of the protein kinase-like protein vs. Planmine SMEST
Match: SMESG000011006.1 (SMESG000011006.1)

HSP 1 Score: 184.882 bits (468), Expect = 8.594e-61
Identity = 91/104 (87.50%), Postives = 95/104 (91.35%), Query Frame = 3
Query:    3 MDAKYISETIISSLVKFGLDLSKMVGRAYDGCSTMAGKISDVQ----DQYSFANFYHCSSHRLNLVINDLNDICEIRNAVGTIKSIINFFRESSLRRKHIPNIP 302
            MDA+YISETIISSL KFGLDLSKMVG++YDGCSTMAGKIS VQ    DQY  ANFYHCSSHRLNLVINDLND+C IRNAVGTIKSIINFFRESSLRRKHIPNIP
Sbjct:    1 MDAEYISETIISSLEKFGLDLSKMVGQSYDGCSTMAGKISGVQKRIQDQYPCANFYHCSSHRLNLVINDLNDVCGIRNAVGTIKSIINFFRESSLRRKHIPNIP 104          
BLAST of 52 kDa repressor of the inhibitor of the protein kinase-like protein vs. Planmine SMEST
Match: SMESG000008969.1 (SMESG000008969.1)

HSP 1 Score: 190.66 bits (483), Expect = 3.778e-60
Identity = 94/104 (90.38%), Postives = 97/104 (93.27%), Query Frame = 3
Query:    3 MDAKYISETIISSLVKFGLDLSKMVGRAYDGCSTMAGKISDV----QDQYSFANFYHCSSHRLNLVINDLNDICEIRNAVGTIKSIINFFRESSLRRKHIPNIP 302
            MDA+YISETIISSLVKFGLDLSKMVG+AY GCSTMAGKIS V    QDQY FANFYHCSSHRLNLVINDLND+CEIRNAVGTIKSIINFFRESSLRRKHIPNIP
Sbjct:  289 MDAEYISETIISSLVKFGLDLSKMVGQAYYGCSTMAGKISGVKKRIQDQYPFANFYHCSSHRLNLVINDLNDVCEIRNAVGTIKSIINFFRESSLRRKHIPNIP 392          
BLAST of 52 kDa repressor of the inhibitor of the protein kinase-like protein vs. Planmine SMEST
Match: SMESG000003943.1 (SMESG000003943.1)

HSP 1 Score: 65.855 bits (159), Expect = 8.404e-14
Identity = 35/104 (33.65%), Postives = 61/104 (58.65%), Query Frame = 3
Query:    9 AKYISETIISSLVKFGLDLSKMVGRAYDGCSTMAGKISDVQ----DQYSFANFYHCSSHRLNLVINDLNDICEIRNAVGTIK---SIINFFRESSLRRKHIPNI 299
            +K +  T++  L   GL+LS + G+ YDG + M+G+ + VQ    D Y    + HC+SH LNL ++D+  I +IRN +G ++   S +N  +  ++ +K I +I
Sbjct: 1425 SKSLENTLVQFLSSIGLNLSYLKGQGYDGAAAMSGRFNRVQAKIMDLYPSTLYVHCASHSLNLSLSDVCQIQDIRNCIGVVEKCYSFMNTLKRDAVLQKKISDI 1528          
BLAST of 52 kDa repressor of the inhibitor of the protein kinase-like protein vs. Planmine SMEST
Match: SMESG000073041.1 (SMESG000073041.1)

HSP 1 Score: 48.521 bits (114), Expect = 1.436e-8
Identity = 24/65 (36.92%), Postives = 38/65 (58.46%), Query Frame = 3
Query:    3 MDAKYISETIISSLVKFGLDLSKMVGRAYDGCSTMAGKISDVQDQY--SFANFYHCSSHRLNLVI 191
             DA  I++ II+   KFGL+L K+ G+ YDGCST+A +   VQ +    +     C  H ++L++
Sbjct:   35 FDATSIADEIINQCTKFGLNLDKLFGQGYDGCSTVADREGGVQAKIRNKYPKAVLCIVHHIDLIL 99          
BLAST of 52 kDa repressor of the inhibitor of the protein kinase-like protein vs. Planmine SMEST
Match: SMESG000067013.1 (SMESG000067013.1)

HSP 1 Score: 47.7506 bits (112), Expect = 1.255e-7
Identity = 31/95 (32.63%), Postives = 51/95 (53.68%), Query Frame = 3
Query:   18 ISETIISSLVKFGLDLSKMVGRAYDGCSTMAGKISDV----QDQYSFANFYHCSSHRLNLVINDLNDICEIRNAVGTIKSIINFFRESSLRRKHI 290
            IS  I+ ++ +  +DLS  V + Y G + M G+ S V    +D +  A + HC SH LNL +     I  +++   TIK I NFF  ++ +R+ +
Sbjct:  164 ISSKIMRTVQELNVDLSFCVRQCYGGAAVMKGEKSGVTRRIKDSFPSAIYIHCMSHCLNLALTYSCYIALLKSCTETIKQIFNFF--NTPKRQQV 256          
The following BLAST results are available for this feature:
BLAST of 52 kDa repressor of the inhibitor of the protein kinase-like protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of 52 kDa repressor of the inhibitor of the protein kinase-like protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of 52 kDa repressor of the inhibitor of the protein kinase-like protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of 52 kDa repressor of the inhibitor of the protein kinase-like protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
CR762475.15.918e-635.38pep chromosome:GRCz11:4:55494751:55498830:1 gene:E... [more]
back to top
BLAST of 52 kDa repressor of the inhibitor of the protein kinase-like protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
tbx186.893e-3354.37T-box 18 [Source:Xenbase;Acc:XB-GENE-489907][more]
slc10a61.243e-3051.92solute carrier family 10 (sodium/bile acid cotrans... [more]
back to top
BLAST of 52 kDa repressor of the inhibitor of the protein kinase-like protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of 52 kDa repressor of the inhibitor of the protein kinase-like protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of 52 kDa repressor of the inhibitor of the protein kinase-like protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
X1WP092.271e-3557.69DUF4371 domain-containing protein OS=Acyrthosiphon... [more]
A0A0J7NNB21.964e-3361.5452 kDa repressor of the inhibitor of the protein k... [more]
J9KNZ71.080e-3258.65Uncharacterized protein OS=Acyrthosiphon pisum OX=... [more]
J9KPM81.359e-3253.64DUF4371 domain-containing protein OS=Acyrthosiphon... [more]
X1WV762.046e-3257.69DUF4371 domain-containing protein OS=Acyrthosiphon... [more]
back to top
BLAST of 52 kDa repressor of the inhibitor of the protein kinase-like protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000035789.11.079e-1039.18pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000042930.12.174e-1039.18pep primary_assembly:Astyanax_mexicanus-2.0:12:254... [more]
ENSAMXT00000042613.15.714e-1033.94pep primary_assembly:Astyanax_mexicanus-2.0:15:330... [more]
ENSAMXT00000056429.17.035e-1033.94pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000057644.16.697e-942.86pep primary_assembly:Astyanax_mexicanus-2.0:10:176... [more]
back to top
BLAST of 52 kDa repressor of the inhibitor of the protein kinase-like protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of 52 kDa repressor of the inhibitor of the protein kinase-like protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of 52 kDa repressor of the inhibitor of the protein kinase-like protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of 52 kDa repressor of the inhibitor of the protein kinase-like protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSORLT00000027735.13.722e-942.86pep primary_assembly:ASM223467v1:9:30712608:307152... [more]
ENSORLT00000037532.16.428e-630.21pep primary_assembly:ASM223467v1:15:7541192:754318... [more]
back to top
BLAST of 52 kDa repressor of the inhibitor of the protein kinase-like protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000011006.18.594e-6187.50SMESG000011006.1[more]
SMESG000008969.13.778e-6090.38SMESG000008969.1[more]
SMESG000003943.18.404e-1433.65SMESG000003943.1[more]
SMESG000073041.11.436e-836.92SMESG000073041.1[more]
SMESG000067013.11.255e-732.63SMESG000067013.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30009638 ID=SMED30009638|Name=52 kDa repressor of the inhibitor of the protein kinase-like protein|organism=Schmidtea mediterranea sexual|type=transcript|length=303bp
ATATGGACGCCAAATATATATCAGAAACTATTATCTCGTCTCTTGTAAAA
TTTGGCCTTGATCTATCAAAAATGGTTGGTCGAGCCTACGACGGTTGCTC
GACAATGGCGGGAAAAATTAGTGACGTGCAAGATCAATACTCATTTGCAA
ATTTTTACCATTGCAGTTCACATAGACTGAACCTTGTGATAAACGACCTA
AATGATATATGTGAAATTAGAAATGCGGTTGGGACTATTAAATCGATTAT
TAACTTCTTTCGAGAGAGCTCTTTAAGAAGAAAACATATTCCAAATATTC
CTC
back to top

protein sequence of SMED30009638-orf-1

>SMED30009638-orf-1 ID=SMED30009638-orf-1|Name=SMED30009638-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=100bp
MDAKYISETIISSLVKFGLDLSKMVGRAYDGCSTMAGKISDVQDQYSFAN
FYHCSSHRLNLVINDLNDICEIRNAVGTIKSIINFFRESSLRRKHIPNIP
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR012337RNaseH-like_sf
Vocabulary: molecular function
TermDefinition
GO:0003676nucleic acid binding
GO:0016301kinase activity
GO:0046983protein dimerization activity
Vocabulary: biological process
TermDefinition
GO:0016310phosphorylation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePANTHERPTHR45749FAMILY NOT NAMEDcoord: 3..99
NoneNo IPR availablePANTHERPTHR45749:SF1AC-LIKE TRANSPOSASE-RELATEDcoord: 3..99
IPR012337Ribonuclease H-like superfamilySUPERFAMILYSSF53098Ribonuclease H-likecoord: 2..101