Endoglin antigen

Overview
NameEndoglin antigen
Smed IDSMED30009630
Length (bp)2414
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Endoglin antigen (SMED30009630) t-SNE clustered cells

Violin plots show distribution of expression levels for Endoglin antigen (SMED30009630) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Endoglin antigen (SMED30009630) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Endoglin antigen (SMED30009630) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30009630

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30009630h1SMcG0021141 SmedASXL_007398SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30009630h1SMcG0021141 dd_Smed_v4_15256_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30009630h1SMcG0021141 dd_Smed_v4_15256_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30009630h1SMcG0021141 dd_Smed_v4_15256_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30009630h1SMcG0021141 dd_Smed_v4_15256_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30009630h1SMcG0021141 dd_Smed_v4_15256_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30009630h1SMcG0021141 dd_Smed_v6_15256_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Endoglin antigen vs. TrEMBL
Match: A0A068X171 (Uncharacterized protein OS=Echinococcus granulosus OX=6210 GN=EgrG_000926400 PE=4 SV=1)

HSP 1 Score: 216.083 bits (549), Expect = 8.475e-55
Identity = 208/774 (26.87%), Postives = 314/774 (40.57%), Query Frame = 2
Query:   77 FQVVDHGPCTTGGDYYCQQRVKNSYCSQATNKCFCQSNFVAIRERESITCKSLLTDLKCGMDQDCTDVYNSICHPGASECTCPAQTFYVPGTHX-XXXXXXXXXFMCNQCKNSGGQCYSRSTNVTTNEHSSKKQNLCSCPGIT-------IFNDNLGENEENAFQCNKIWVDIGDICDNVTRLCRSHKSLCMVNEIAGYGICQCRRYHLPVYQKNLNFHECYIEQQDNNHRNCRQCKQIEGACINMNEESSTDACICPLSRKAIFYDN---------------------------IIRKPSEIIASLKCVTTN----------EMVDVKCDMKRFSVCIHINEIEFPNFAE--------NIRKNLSKIFFSDRIIPNK-QFSVNGIQRDTDPLCYLAPTANVFNSNLQLCRSLIYDEKNGKFPCGINTVQYMNGYFYSGYIELWGNVHIPNLLVDKLFDVSCK--------SSNIRTVDTVGQAIDRSWPATSYQIVSREFQTDPDF--------------------------LSFSAVDINNRMSDFFIKFSPIRLQAKVNPNTTSYKHISADLCWAQNTSHLIPHQTERWNIIHRGCAFKDSGFTSNFLQV------YDSTTITSAL----------------FPLFQI--------------------SNSENIFFKCIFRLCTTETWCKTDYDCSTNLDR-SYSSDPPPQNMYDIKYISKSLVLTIGLQKQFQSDSRIKNGLSECHYFWCVTKLKLAIISMIIGGIVLLA 2005
             + +D GPC   GD+YC +RV NS+CS   N+CFCQ  FVAI+E   ITCK LLT L C +D+DC  V NSICHPGA  C CP  T YV   H+       S++  C  CK   G CY         E+S K++  C+CP  T       ++  N G   + AF C  I VD+GD+C+ V  LCR   S C      G   C+C+    PVYQ++L++HEC+ +Q     ++  +C    G C+++N + + D   C  +R     DN                           I+ + SEI   ++  T N           MV V C     S+ ++      P + +        N    L+    +  +IP      +    +D D    LA +      + Q C +L       + PCG+   +        G +E+  + H+ +  VD  FD+ C         ++   T      A   S   ++ +I S+E QT P                            LSF A     R     +  SPI+L+A +   T +Y     + C+A  TS     +     II+RGC   + GFT NFL         D   +  A+                FP F I                    + S N+   C FRLC  + WC   + CS   +R S ++  PP+    I +  +SL+L I      +S+     G   C   +C  +++L +I + +G ++ L+
Sbjct:   28 LRSLDLGPCVEEGDFYCSRRVPNSFCSVTKNECFCQPAFVAIQEEYGITCKPLLTSLNCHVDKDCVHVKNSICHPGAGFCACPGGTAYVAQEHACHNVAENSNNSFCETCKQMNGICYHA-------ENSKKQEFGCACPFNTAMPLPQRLYASNDGSIAQWAF-CKAILVDVGDLCNQVDLLCRPRNSECSSLN-GGPKSCRCKPGFFPVYQQSLHYHECF-KQVLCETKDIPECYN-SGICVDLNGDGTPDDNFC--ARNGSTLDNQSLRHSLRDSGERMSTSYSHSWPALDVILEENSEIKGIMEVGTRNTGAKDDYCCKPMVQVTCSSN--SILVYFLPPTRPPYEQLHQSLVEGNAIAYLTGEGNAAVVIPRSCVLRLCDFGQDGD---LLAASEWEVGYSRQFCVNLDLGSSPARPPCGLTLSRNETVVGIKGLLEVRTDAHVWSSSVDMRFDLRCSVIPTAATANATTTTAAAANTATAGSALTSTPRINSQERQTSPSQQEGSWSQRLSDQWNLDNVRPTPAALDLSFKAFSATKRAVSSVLLASPIQLKATLFDPTVTYTTFVVESCYA--TSVATTSEVMHVEIINRGCPNTECGFTGNFLSYSLSQPGRDGMPLALAIKSPPSSSSLISIASSLFPAFVITTGLHPNQSFRTDSSAFHANTTSTNVRITCAFRLCARQAWCALPHPCSGLQERNSMTTFMPPK----IHFAVRSLILEIINPSPHESEKSNSLGSQSCSSVFCQPRIQLLLIMVSLGTMLCLS 777          
BLAST of Endoglin antigen vs. TrEMBL
Match: A0A4E0RS07 (Uncharacterized protein OS=Fasciola hepatica OX=6192 GN=D915_000222 PE=4 SV=1)

HSP 1 Score: 214.542 bits (545), Expect = 4.687e-54
Identity = 160/587 (27.26%), Postives = 258/587 (43.95%), Query Frame = 2
Query:   35 PFILWILKNSSSDPFQV--VDHGPCTTGGDYYCQQRVKNSYCSQATNKCFCQSNFVAIRERESITCKSLLTDLKCGMDQDCTDVYNSICHPGASECTCPAQTFYVPGTHX-XXXXXXXXXFMCNQCKNSGGQCYSR-------------STNVTTNEHSSKKQNL-------------CSCPGITIFN-------------------------DNLGENEENAFQCNKIWVDIGDICDNVTRLCRSHKSLCMVNEIAG---------YGICQCRRYHLPVYQKNLNFHECYIEQQDNNHRNCRQCKQIEGACINMNEESST-DACICPLSR------KAIFYDNIIRKP---SEIIASLKCVTTNEMVDVKCDMKRFSVCIHINEIEFPNFAENIRKNLSKIFFSDRIIPNKQFSVNGIQRDT--DPLCYLAPTANVFNSNLQ----LCRSLIYDEKNGKFPCGINTVQYMNGYFYSGYIELWGNVHIPNLLVDKLFDVSCKSSNIRTVDTVGQAIDRSWPATSYQIVSREFQTDPDFLSFSAVDINNRMSDFFIKFSPIRLQAKVNPNTTSYKHISADLCWAQNTS 1558
            P + W+ K+   +  ++  +D GPC   GD +C +RV NS CS   N+CFC+  +V+I+E   ITCK+LLT+LKC +D DC  ++NS CHPGA  C CP+ T YV   H+  +     S+  CN+C+   G CY R              TN     H++  Q               C CP  T                            D L +  + +F C  I+V++G+ C+N+  LCR+  S C+ NE               C C   ++PVYQ +L ++EC+ +Q   NH +C  C +  G C +MN ++ T   C+CP  R      K I  D+    P   S  + S  C  T  + +V C      VC         N   N   +     F     PN  F    +   T   P    A  +   N +++     C  L +    G+ PC +   +YM+G+ YSGY+ +  +    + +   LF  +CK++N       GQ  +R+W + ++ I +   + D   ++   V+   +  +   +++PIRL+A+++  +  Y  +  + C+A   S
Sbjct:   39 PGMYWLRKSQEKEYLRLRNLDIGPCLHEGDSFCTRRVANSMCSTEKNECFCKPGYVSIQESYGITCKTLLTNLKCQVDADCVHIFNSACHPGAGLCACPSGTIYVAQDHACQQMAEYESNIFCNKCRQVNGMCYKRDKTSAESPTILHSQTNSDDTYHAAWYQTHRSIRSLLLGYPYGCLCPYNTAMPLATPRRTWITNETHKKLPVRQADELDRLEDLPQWSF-CKAIFVNVGEYCNNIDVLCRAKFSHCIQNEDGSNRRGQSSPFVFTCTCAPGYVPVYQNHLGYYECF-QQIAANHTDCSACIKTGGRCFSMNLQNPTATGCLCPHDRAPGIASKPIGSDDSHGIPNFASSDVGSDSC--TESLAEVSCFRSHLEVCYRPPTQPPYNRLSNDLASQKAFAFVTDARPNLVFDDTCVLTPTTKHPFSLSAGLSPKLNESMKEDSLWCLVLDWRNDPGRQPCAVKVTEYMSGHLYSGYLAIVTDAEYQSPMRSMLFQFTCKTNNEIPQRVPGQVFERAWISENHDIDNSWSKVD---IALELVNQTGQSIETAFEYTPIRLRAQLHDQSGKYHALHMEACYASQAS 618          
BLAST of Endoglin antigen vs. TrEMBL
Match: A0A068YE62 (Uncharacterized protein OS=Echinococcus multilocularis OX=6211 GN=EmuJ_000926400 PE=4 SV=1)

HSP 1 Score: 211.075 bits (536), Expect = 4.116e-53
Identity = 205/779 (26.32%), Postives = 312/779 (40.05%), Query Frame = 2
Query:   77 FQVVDHGPCTTGGDYYCQQRVKNSYCSQATNKCFCQSNFVAIRERESITCKSLLTDLKCGMDQDCTDVYNSICHPGASECTCPAQTFYVPGTHX-XXXXXXXXXFMCNQCKNSGGQCYSRSTNVTTNEHSSKKQNLCSCPGIT-------IFNDNLGENEENAFQCNKIWVDIGDICDNVTRLCRSHKSLCMVNEIAGYGICQCRRYHLPVYQKNLNFHECYIEQQDNNHRNCRQCKQIEGACINMNEESSTDACICPLSRKAIFYDN---------------------------IIRKPSEIIASLKCVTTNE----------MVDVKCDMKRFSVCIHINEIEFPNFAE--------NIRKNLSKIFFSDRIIPNK-QFSVNGIQRDTDPLCYLAPTANVFNSNLQLCRSLIYDEKNGKFPCGINTVQYMNGYFYSGYIELWGNVHIPNLLVDKLFDVSCK-------------SSNIRTVDTVGQAIDRSWPATSYQIVSREFQTDPDF--------------------------LSFSAVDINNRMSDFFIKFSPIRLQAKVNPNTTSYKHISADLCWAQNTSHLIPHQTERWNIIHRGCAFKDSGFTSNFLQV------YDSTTITSAL----------------FPLFQI--------------------SNSENIFFKCIFRLCTTETWCKTDYDCSTNLDR-SYSSDPPPQNMYDIKYISKSLVLTIGLQKQFQSDSRIKNGLSECHYFWCVTKLKLAIISMIIGGIVLLA 2005
             + +D GPC   GD+YC +RV NS+CS   N+CFC   FVAI+E   ITCK LLT L C +D+DC  V NSICHPGA  C CP  T YV   H+       S++  C  CK   G CY         E+S K++  C+CP  T       +   N G   + AF C  I VD+G +C+    LCR   S C      G   C+C+    PVYQ++L++HEC+ +Q     ++  +C    G C+++N + + D   C  +R     DN                           I+ + SEI   ++  T N           MV V C   R  + ++      P + +        N    L+   ++  +IP      +    RD D    LA +      + Q C +L       + PCG+   +        G +E+  + H+ +  VD  FD+ C              ++      TVG A+      ++ +I S+E QT P                            LSF A     R     +  SPI+L+A +   T +Y     + C+A  TS     +     II+RGC   + GFT NFL         D   +  A+                FP F +                    + S N+   C FRLC  + WC   + CS   +R S ++  PP+    I +  +SL+L I      + +     G   C   +C  +++L +I + +G ++ L+
Sbjct:   28 LRSLDLGPCVEEGDFYCSRRVPNSFCSVTKNECFCHPAFVAIQEEYGITCKPLLTSLNCHVDKDCVHVKNSICHPGAGFCACPGGTAYVAQEHACHNVAENSNNSFCETCKQMNGICYHA-------ENSKKQEFGCACPFNTAMPLPQRLHASNGGPIAQWAF-CKAILVDVGHLCNQEDLLCRPRNSECSSLN-GGPKSCRCKPGFFPVYQQSLHYHECF-KQVLCETKDIPECYN-SGICVDLNGDGTPDDNFC--ARNGFTLDNQSLRHCLRESGERMSTSYSHNWPALDVILEENSEIKGIMEVGTQNAGVKDDYCRKPMVQVTCSSNR--ILVYFLPPTRPPYEQLHQSLVEGNAIAYLTGEGYAAVVIPRGCVLRLCDFGRDGD---LLAASEWEVGHSRQFCVNLDLGSSPARPPCGLTLSRNETVVGIKGLLEVRTDAHVWSSSVDMRFDLRCSVIPTAATASATTTTAAAANNATVGSAL-----TSTPRINSQERQTLPSQQEGSWSQRLSDQWNLDNVRPTPAALDLSFKAFSATKRAVSSVLLASPIQLKATLFDPTVTYNTFVVESCYA--TSVATTSEIMHVEIINRGCPNTECGFTGNFLSYSLSQPGRDGMPLALAIKSPPASSSLISIASSLFPAFVLTTGLHPNQSFRTDSSAFHANTTSTNVRITCAFRLCARQAWCALPHPCSGLQERNSMTTFMPPK----IHFAVRSLILEIINPSPHEFEKSNSLGSQSCSSVFCQPRIQLLLIMVSLGTMLCLS 777          
BLAST of Endoglin antigen vs. TrEMBL
Match: A0A4S2M4V4 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_003951 PE=4 SV=1)

HSP 1 Score: 194.126 bits (492), Expect = 1.738e-47
Identity = 148/578 (25.61%), Postives = 249/578 (43.08%), Query Frame = 2
Query:   23 FSIFPFILWILKNSSSDPFQVVDHGPCTTGGDYYCQQRVKNSYCSQATNKCFCQSNFVAIRERESITCKSLLTDLKCGMDQDCTDVYNSICHPGASECTCPAQTFYVPGTHX-XXXXXXXXXFMCNQCKNSGGQCYSRSTNVT-------------TNEHSSKKQNL------CSCPGITIF-----------------------NDNLGENEENA-----FQCNKIWVDIGDICDNVTRLCRSHKSLCMVNEIAG----YGICQCRRYHLPVYQKNLNFHECYIEQQDNNHRNCRQCKQIEGACINMNEESS-TDACICPLSRKAIF--YDNIIRKPSEIIASLKCVTTNE-----MVDVKCDMKRFSVCIHI-NEIEFPNFAENIRKNLSKIFFSDRIIPNKQFSVNGIQRDTDPLCYLAPT----------ANVFNSNLQLCRSLIYDEKNGKFPCGINTVQYMNGYFYSGYIELWGNVHIPNLLVDKLFDVSCKSSNIRTVDTVGQAIDRSWPATSYQIVSREFQTDPDFLSFSAVDINNRMSDFFIKFSPIRLQAKVNPNTTSYKHISADLCW 1543
            +  F   L+  +++ +   + +D GPC   GD +C +RV NS CS+  N+CFC+  +VAI+E   +TCK+LL++LKC +D DC  V NS+CHPGA  C CP+ T YVP  HS         +  C+ C+   G CY+    ++              + H +  ++L      C CP  T                         N +  +NE+ +       C  + V+IG+ C+++  LCR+  + C    +      +  C C   ++PVYQ NL +HEC+  Q   NH +C QC +  G C  MNE ++    C CP  R + F   D   R   +   SL      E     + +V C      +C    + + +   + ++    +  F SD          + I  +  P C L P           A + N     C  L + ++    PCG+   +YM+G+ YSGY+ +  N      + +  F  +CK++N       GQ  +      +         ++   ++    +I+  + +   + +PIRL AK++  T  +K +  + C+
Sbjct:   32 YCAFTTALYAGEDAMNLRLRNLDLGPCLHEGDSFCTRRVANSMCSREKNECFCKPGYVAIQEIFGLTCKTLLSNLKCQVDNDCVHVANSVCHPGAGYCACPSGTIYVPQQHSCFPMAENDENQFCHHCRQINGVCYNNPRTLSEMVAETHQDQRDVNDAHEAFGKSLTRFPHGCKCPYNTAMPLAIPKTHVKTNNTSLRGSMGSSNQSKADNEDMSRLPQWSYCKAVLVNIGEFCNHIDLLCRAKNARCASTPVKSSSHPFLRCTCIEGYIPVYQYNLGYHECF-RQILTNHSSCLQCTRTGGKCYTMNERNALATGCQCPNHRSSTFGNLDVRDRNSEDAFPSLHSEENLESCAESLAEVSCFRNYLELCYKTPSHLPYNILSSHLINQRAIAFVSD----------SRINLNYRPECALTPVSAERLLERQRAVILNHTRIWCIQLDWRKQVENPPCGLRVTEYMSGHLYSGYLNIVINPEYAKAIENLFFRFTCKTNNEIPQQVPGQIFEHQPHLVAPLAWDNLPWSNSVRITMEVHNISGSLVETAFESTPIRLYAKLHERTGPFKAMQMENCY 598          
BLAST of Endoglin antigen vs. TrEMBL
Match: A0A5K4F052 (Uncharacterized protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 186.422 bits (472), Expect = 6.880e-45
Identity = 179/665 (26.92%), Postives = 284/665 (42.71%), Query Frame = 2
Query:   47 WILKNSSSDPFQVVDH---GPCTTGGDYYCQQRVKNSYCSQATNKCFCQSNFVAIRERESITCKSLLTDLKCGMDQDCTDVYNSICHPGASECTCPAQTFYVPGTHX-XXXXXXXXXFMCNQCKNSGGQC--YSRSTNVTTNEHSSKKQNLCSCPGITIFNDNLGENEENAFQCNKIWVDIGDICDNVTRLCRSHKSLCM---------VNEIAGYG---------------------ICQCRRYHLPVYQKNLNFHECYIEQQDNNHRNCRQCKQIEGACINMNEESSTDACICPLSRKAIFYDNIIRKPSEIIASLKCVTTNEMVDVKCDMKRFSVCIHINEI-EFPNFAENIRKNLSKI-FFSDRIIPNK-QFSVNGIQRDTDP---------LCYLAP------------TANVFNSNLQL--------CRSLIYDEKNGKFPCGINTVQYMNGYF-YSGYIELWGNVHIPNLLVDKLFDVSCKS------------SNIRTVDTVGQAIDRSWPATSYQIVSREFQTDPDFLSFSAVDINNRMSDFFIKFSPIRLQAKVNPNTTSYKHISADLCWAQNT---SHLIPHQTERWNIIHRGCAFKDSGFTSNFLQV-YDSTTITSALFPLFQISNSENIFFKCIFRLCT-----TETWCKTD 1771
            WI+        Q  ++   G CT     +C ++V+NS C+   N+CFC+  FVAIRE   +TCK+LLTDLKC +D+DC  V  S CHPGA  C+CP  T YVP  H+     +  S   C+ C    G C  Y     V T++  +     C CP   + + +   ++   + C+   VDIG  CD+ +  CRS  S+C           N++  +                       CQC+  +LPVYQ NL ++EC+ +      + C++C    G C ++N++   D C CP S  +I Y    ++ SEI     C T +  V V C     SVC + +    + N  +++  + S +   SD  + +     ++G+  + +          LC L              T ++ + N  L        C ++    KNG   CGI   +  +    Y G +E+  N  I     DK+  + C S             N++T+ T+  A   + P  S +I++                 N  +   F+  S +RL A +   + SYKHI+A+ C+  N    S      T    I HR C  K    T+ F  +   +  + + +F  F++ N   +FF C+FR+C       +T CKTD
Sbjct:   18 WIIAAPEERSVQKTENLAIGACTQYDSGFCSRQVENSVCNHEKNECFCRKGFVAIRENGRVTCKTLLTDLKCRVDRDCVHVNRSSCHPGAGYCSCPGNTIYVPEKHACRARFTYPSDPFCDVCLQLKGTCFKYELFERVITDQRVNPNGVGCVCPDHKV-SISTRTSDPLKYMCDGNLVDIGSECDDESLFCRSINSVCKPLQEELLLSTNQLHSFKSNLWSENFPSGDHLRRSQIIRTCQCKPGYLPVYQINLKYNECF-KILPMKAKYCQKCVDTGGQCYDLNDDGIGDGCDCPPSLSSIIYG---KENSEIY----CGTVH--VSVNCTNGYLSVCYYPHTYGPYSNLFDDLMNHRSVVRLASDNYLTDTLPLQISGLSSEANRTYHYSNFQNLCILKSENDTIDIGNTFVTESISHDNYHLHGAQTKRFCLNIDVWRKNGL--CGIRLYKLSHDTVQYEGILEVLVNTSIRTPSRDKIIPLKCISRTPNRPMNEINDGNLQTIGTMNLANTPTHPQISLRILNEN---------------NKEIPSTFVG-SRVRLDALLFNPSGSYKHIAAEYCYGNNRSLHSDYFSSDTSTLLIDHR-CLHKKPLLTAKFSSIGLLNGHLQTEIFQAFRLGNMTLVFFTCVFRICQLSTDCEQTRCKTD 652          
BLAST of Endoglin antigen vs. Planmine SMEST
Match: SMESG000024282.1 (SMESG000024282.1)

HSP 1 Score: 1612.82 bits (4175), Expect = 0.000e+0
Identity = 790/791 (99.87%), Postives = 791/791 (100.00%), Query Frame = 2
Query:    8 MLAKRFSIFPFILWILKNSSSDPFQVVDHGPCTTGGDYYCQQRVKNSYCSQATNKCFCQSNFVAIRERESITCKSLLTDLKCGMDQDCTDVYNSICHPGASECTCPAQTFYVPGTHXXXXXXXXXXFMCNQCKNSGGQCYSRSTNVTTNEHSSKKQNLCSCPGITIFNDNLGENEENAFQCNKIWVDIGDICDNVTRLCRSHKSLCMVNEIAGYGICQCRRYHLPVYQKNLNFHECYIEQQDNNHRNCRQCKQIEGACINMNEESSTDACICPLSRKAIFYDNIIRKPSEIIASLKCVTTNEMVDVKCDMKRFSVCIHINEIEFPNFAENIRKNLSKIFFSDRIIPNKQFSVNGIQRDTDPLCYLAPTANVFNSNLQLCRSLIYDEKNGKFPCGINTVQYMNGYFYSGYIELWGNVHIPNLLVDKLFDVSCKSSNIRTVDTVGQAIDRSWPATSYQIVSREFQTDPDFLSFSAVDINNRMSDFFIKFSPIRLQAKVNPNTTSYKHISADLCWAQNTSHLIPHQTERWNIIHRGCAFKDSGFTSNFLQVYDSTTITSALFPLFQISNSENIFFKCIFRLCTTETWCKTDYDCSTNLDRSYSSDPPPQNMYDIKYISKSLVLTIGLQKQFQSDSRIKNGLSECHYFWCVTKLKLAIISMIIGGIVLLATAIFLLLCYRQKIIRDINRCQRLSSRTVNVNTTSRQQQLNLLTSSNCNPVDCSSYMLVPVAHRSHHCQPVSFSYDRTDLYEAPLFINSSVCTVNRDSDLNNDRNPIFTSNHHNEIITINNSGDDL 2380
            MLAKRFSIFPFILWILKNSSSDPFQVVDHGPCTTGGDYYCQQRVKNSYCSQATNKCFCQSNFVAIRERESITCKSLLTDLKCGMDQDCTDVYNSICHPGASECTCPAQTFYVPGTHSCESESLSSSFMCNQCKNSGGQCYSRSTNVTTNEHSSKKQNLCSCPGITIFNDNLGENEENAFQCNKIWVDIGDICDNVTRLCRSHKSLCMVNEIAGYGICQCRRYHLPVYQKNLNFHECYIEQQDNNHRNCRQCKQIEGACINMNEESSTDACICPLSRKAIFYDNIIRKPSEIIASLKCVTTNEMVDVKCDMKRFSVCIHINEIEFPNFAENIRKNLSKIFFSDRIIPNKQFSVNGIQRDTDPLCYLAPTANVFNSNLQLCRSLIYDEKNGKFPCGINTVQYMNGYFYSGYIELWGNVHIPNLLVDKLFDVSCKSSNIRTVDTVGQAIDRSWPATSYQIVSREFQTDPDFLSFSAVDINNRMSDFFIKFSPIRLQAKVNPNTTSYKHISADLCWAQNTSHLIPHQTERWNIIHRGCAFKDSGFTSNFLQVYDSTTITSALFPLFQISNS+NIFFKCIFRLCTTETWCKTDYDCSTNLDRSYSSDPPPQNMYDIKYISKSLVLTIGLQKQFQSDSRIKNGLSECHYFWCVTKLKLAIISMIIGGIVLLATAIFLLLCYRQKIIRDINRCQRLSSRTVNVNTTSRQQQLNLLTSSNCNPVDCSSYMLVPVAHRSHHCQPVSFSYDRTDLYEAPLFINSSVCTVNRDSDLNNDRNPIFTSNHHNEIITINNSGDDL
Sbjct:    1 MLAKRFSIFPFILWILKNSSSDPFQVVDHGPCTTGGDYYCQQRVKNSYCSQATNKCFCQSNFVAIRERESITCKSLLTDLKCGMDQDCTDVYNSICHPGASECTCPAQTFYVPGTHSCESESLSSSFMCNQCKNSGGQCYSRSTNVTTNEHSSKKQNLCSCPGITIFNDNLGENEENAFQCNKIWVDIGDICDNVTRLCRSHKSLCMVNEIAGYGICQCRRYHLPVYQKNLNFHECYIEQQDNNHRNCRQCKQIEGACINMNEESSTDACICPLSRKAIFYDNIIRKPSEIIASLKCVTTNEMVDVKCDMKRFSVCIHINEIEFPNFAENIRKNLSKIFFSDRIIPNKQFSVNGIQRDTDPLCYLAPTANVFNSNLQLCRSLIYDEKNGKFPCGINTVQYMNGYFYSGYIELWGNVHIPNLLVDKLFDVSCKSSNIRTVDTVGQAIDRSWPATSYQIVSREFQTDPDFLSFSAVDINNRMSDFFIKFSPIRLQAKVNPNTTSYKHISADLCWAQNTSHLIPHQTERWNIIHRGCAFKDSGFTSNFLQVYDSTTITSALFPLFQISNSQNIFFKCIFRLCTTETWCKTDYDCSTNLDRSYSSDPPPQNMYDIKYISKSLVLTIGLQKQFQSDSRIKNGLSECHYFWCVTKLKLAIISMIIGGIVLLATAIFLLLCYRQKIIRDINRCQRLSSRTVNVNTTSRQQQLNLLTSSNCNPVDCSSYMLVPVAHRSHHCQPVSFSYDRTDLYEAPLFINSSVCTVNRDSDLNNDRNPIFTSNHHNEIITINNSGDDL 791          
BLAST of Endoglin antigen vs. Planmine SMEST
Match: SMESG000068315.1 (SMESG000068315.1)

HSP 1 Score: 352.058 bits (902), Expect = 9.990e-109
Identity = 226/683 (33.09%), Postives = 352/683 (51.54%), Query Frame = 2
Query:   77 FQVVDHGPCTTGGDYYCQQRVKNSYCSQATNKCFCQSNFVAIRERESITCKSLLTDLKCGMDQDCTDVYNSICHPGASECTCPAQTFYVPGTHX---XXXXXXXXXFMCNQCKNSGGQCYSRSTNVTTNEHSSKKQNL--------CSCPGITIFNDNLGENEENAFQCNKIWVDIGDICDNVTRLCRSHKSLCMVNEIAGYGICQCRRYHLPVYQKNLNFHECYIEQQDNNHRNCRQCKQIEGACINMNEESSTDACICPLSRKAIFYDNIIRKPSEIIASLKCVTTNEMVDVKCDMKRFSVCIHINEIEFPN---FAENIRKNLSKIFFSDRIIPNKQFSVNGIQRDTDPLCYLAPTANVFNSNLQLCRSLIYDEKNGKFPCGINTVQYMNGYFYSGYIELWGNVHIPNLLVDKLFDVSCKSSNIRTVDTVGQAIDRSWPATSYQI-VSREFQTDPDFLSFSAVDINNRMSDFFIKFSPIRLQAKVNPNTTSYKHISADLCWAQNTSHLIPHQTERWNIIHRGCAFKDSGFTSNFLQVYDSTT-------------ITSALFPLFQISNSENIFFKCIFRLCTTETWCKTDYDCSTNLDRSYSSDPPPQNMYDIKYISKSLVLTIGLQKQFQSDSRIKNGL-SECHYFWCVTKLKLAIISMIIGGIVLLATAIFLLLCYRQ 2038
            + VV  GPC   G+ +C+++V NS+C +  NKC+C+  FV I+E   +TCK LLT+LKC MD++C DV  S CHPGA  CTCP  T YVP  H+         + + +C +CK  GG+C+ + TN   N HS    N         CSCPGIT    +  ++  +A  CN+I VDIG  C+N+  +CRS K++C    +  Y IC C   H+ VYQ+ L +HECY   +  N  +CR C +  G C +MN +   D C C    K +  D           SL    +  +V++ C  +   +C +    + PN   F +NI K  + IF +D    +  F  +    + + L  +  T    +++++ C     +      PCGI+  +Y NGY YSGY+ +W + +  + + D+L D SCK        T GQAIDRSWP  +  +  +RE  T  +F +FS ++ +N +     K +PI+L A +N     Y  I+A+ CW  N+S        +W +I+RGC    SGFT+ FL   +S +             ++S  FP F + +S  + FKC+FR C  + WC     C+ +  + +++ PPP+   DI+++ KS  +++    +  S SR   G+ S C +FWC+   KL ++  ++  I+LL TA+  +L  R 
Sbjct:   24 YDVVHPGPCLEYGNRFCEEKVANSFCLKKKNKCYCKPQFVNIKESYGVTCKPLLTNLKCNMDKNCRDVDGSTCHPGAGACTCPYNTLYVPQLHACKKQILSPENDAILCIKCKEIGGECF-QYTNQIGNIHSYPVSNAGNNFPHIGCSCPGITTIQSDKVDDLSDAI-CNQILVDIGHPCNNMDLICRSSKAVCFETSLFSYSICHCPPGHVAVYQEYLGYHECYPSIKL-NVDSCRLCLRTNGLCFDMNADEQPDGCYCG-RLKTVQEDFKANGAHNDQNSLLQTCSKNIVEIFCWPENLKICYY--PPKAPNHARFIDNITKQRALIFITDG---HSLFREDDSGPNNECLLTIEETHRSRDNSIRFCIEKQLNTLEVNLPCGISATKYSNGYLYSGYVAVWVDKYFADPISDQLIDFSCKCDYSFLRMTPGQAIDRSWPVENINLNYNRESNTTTEFFNFSILNPDNSVVYSVFKMAPIKLYAVLNTEEIEYNSIAAESCWCTNSSD-DSSPNNKWKLINRGCIESRSGFTTPFLLSSNSASTNQSNPDRKAFVELSSGFFPAFTMFDSSQLIFKCLFRFCKHKHWCSLRKQCTDDHPQFFTT-PPPKRFDDIRFLVKSFKVSVVSVPKVDSVSR--GGVKSVCSFFWCLPGDKLLLVISLLTVILLLVTALAFVLFRRH 693          
BLAST of Endoglin antigen vs. Planmine SMEST
Match: SMESG000025327.1 (SMESG000025327.1)

HSP 1 Score: 239.965 bits (611), Expect = 2.257e-67
Identity = 183/653 (28.02%), Postives = 299/653 (45.79%), Query Frame = 2
Query:   95 GPCTTGGDYYCQQRVKNSYCSQATNKCFCQSNFVAIRERESITCKSLLTDLKCGMDQDCTDVYNSICHPGASECTCPAQTFYVPGTH--XXXXXXXXXXFMCNQCKNSGGQCYSRSTNVTTNEHSSKKQNLCSCPGITIFNDNLGENEENAFQCNKIWVDIGDICDNVTRLCRSHKSLCMVNEIAGYGICQCRRYHLPVYQKNLNFHECYIEQQDNNHRNCRQCKQIEGACINMNEESSTDACICPLSRKAIFYDNIIRKPSEIIASLKCVTTNEMVDVKCDMKRFSVCI--HINEIEFPNFAENIRKNLSKIFF------SDRIIP--NKQFSVNGIQRDTDPLCYLAPTANVFNSNLQLCRSLIYDEKNGKFPCGINTVQYMNGYFYSGYIELWGNVHIPNLLVDKLFDVSCKSSNIRTVDTVGQAIDR--SWPATSYQIVSR-EFQTDPDFLSFSAVDINNRMSDFFIKFSPIRLQAKVNPNTTSYKHISADLCWAQNT--SHLIPHQTERWNIIHRGCAFKDSGFTSNFLQVYDSTT----ITSALFPLFQI-SNSENIFFKCIFRLCTTETWCKTDYDCSTNLDRSYSSDPPPQNMYDIKYISKSLVLTIGLQKQFQSDSRI----KNGLSECHYFWCVTKLKLAIIS 1975
            G C   GD YC QRV NS+CS   N+CFC+   V++++     CK LLT++KC +D DCTDV  SICHPGA  CTCP  T +VP  H           + +C  CKN  G C+    + T N+ + K   LCS  G         ++  N   C  + +DIGD C++   +CRS K++C     +   +C C +  + VYQ +L ++EC I +       C++C    G C   +  S    C C   R +   D  I    ++ +S        +V + C+ KR  VC   H N   + N    + KN +K+F       +D  +P  N  +  NG       +C L    +  ++  + C  +    ++   PCG+  ++Y NG  YSG +++W +   P    D  F+++CKS   +  + +GQ++DR  S     + I S  EF + P         ++N ++   I  + I++   +      +  I  + C+  N   S   P +     II RGC+  +     N        +    + S+LFP FQ+    EN++++C+ ++C   TWCK   +C     R +S +    N  D+K++ +S+ L +       S  RI    +N    C Y  C++   L++I+
Sbjct:   32 GECAQDGDSYCLQRVPNSFCSLEKNECFCKVGHVSVQDDGGTVCKPLLTNVKCRLDTDCTDVKGSICHPGAGFCTCPEGTIFVPQRHQCMKRVHWSVQNNLCKACKNIKGTCFQEELDSTNNDTTLKFGCLCS--GKNAMPTKFIDDFSNV--CEALLMDIGDFCNDQYLICRSPKAVCKRRTGSIENVCLCSQDSIAVYQYHLKYYEC-IPKLSFKDVGCQKCYSKGGQCYVNSVTSRKLQCDCGRLRISQLRDLRITDSDDVCSS-------SLVYISCNYKRLQVCYVPHSNP-PYGNLQSALDKNQAKVFLSSDSSENDESLPNFNNAYQENGESSFHHNMCQLKLMRSQTSTQDKYCIDI--SLRSSVLPCGLIQMKYKNGNMYSGLLQIWTDSKFPTPSRDMKFEINCKSQPNKPTNQLGQSLDRTESMFGKDFSISSNGEFLSTPQITLKILNSLDNEITTIDIG-TAIKIDILLVDRNAEFNGIEVESCYVSNISFSKFDPIKHSEQFIIDRGCSVSNFPLFQNLFSDAKIPSTPVHLQSSLFPAFQVFPKDENVYYRCLLKVCRHTTWCKKPTNCQEKSHRKFSIN----NEGDVKFVVRSIKLQVRSFDDNISPVRINQRKENYNHVCQYPMCLSLGHLSMIA 664          
BLAST of Endoglin antigen vs. Planmine SMEST
Match: SMESG000039966.1 (SMESG000039966.1)

HSP 1 Score: 226.483 bits (576), Expect = 4.775e-63
Identity = 183/684 (26.75%), Postives = 317/684 (46.35%), Query Frame = 2
Query:   68 SDPFQVVDHGPCTTGGDYYCQQRVKNSYCSQATNKCFCQSNFVAIRERESITCKSLLTDLKCGMDQDCTDVYNSICHPGASECTCPAQTFYVPGTHX-XXXXXXXXXFMCNQCKNSGGQCYSRSTNVTTNEHSSKKQNL----CSCPGITIFNDNLGENEENAFQ-----CNKIWVDIGDICDNVTRLCRSHKSLCMVNEIAGYGICQCRRYHLPVYQKNLNFHECYIEQQDNNHRNCRQCKQIEGACINMNEESSTDACICPLSRKAIF--YDNIIRKPSEIIASLKCVTTNEMVDVKCDMKRFSVCIHINEIEFPNFAENIRKNLSKIFFSDRIIPNKQF-SVNGIQRDTDPLCYLAPTANVFNSNLQLCRSLIYDEKNGKFPCGINTVQYM--NGYFYSGYIELWGNVHIPNLLVDKLFDVSCKSSNIRTVDTVGQAIDRSWPATSYQIVSRE--FQTDPDFLSFSAVDINNR-----------MSDFFIKFSPIRLQAKVNPNTTSYKHISADLCWAQNTSHLI---PHQTERWNIIHRGCAFKDSGFTSNFLQVYDSTTITSALFPLFQISNSENIFFKCIFRLCTTETWCKTDYDCSTNLDRSYSSDPPPQNMYDIKYISKSLVLTIGLQKQFQSDSRIKNGLSECHYFWCVTKLKLAIISMIIGGIVLLATAIFLLL 2026
            +D F +V  GPC   G  YCQ  V NS+CS+  N+CFCQ+ FVAI+E+  + CK+LLTDLKC  D+DC DVY S CHPG  +C+CPA+TFYV   H   +        +C  C+N GG+CY    N  +      KQN+    C+CPG  I +     NE++        C  I VD+G  C++    CR+  + C  + +  Y +C C + ++ VYQ  L ++ECY  + +   + C  C+  +G+CI++N + + D+C C    K+I    D  + +P         +  ++M+ +KC      VCI+ N+   P     I +  + IF+++ +  +  F SV G+++     C+            Q+ + +    ++  F    +T+ +   N  +YS ++ +  +  I + + D  +++SCK+   R+  ++GQ  ++SW     +I S E   +T  D LS   VD  ++             D F+K   ++    +    +     S  + +++  S  +   P+Q E  N+     AF     T+  +   +   + S  FP F + +     F C+FRLC   + C  +++  +           P +  DIK++       IG +      S  K     C    C+T  ++  I + +  + +L + I  +L
Sbjct:   19 ADNFHIVASGPCLKKGKNYCQNIVPNSFCSEEKNECFCQNGFVAIKEKNGLICKTLLTDLKCSTDRDCKDVYGSSCHPGPGQCSCPAETFYVAQEHVCKDYPKNIPDPLCKHCRNIGGKCY---FNTISPLSVIPKQNIYSGKCNCPG--ILSTPTATNEKSQLMPSLEICQGIMVDLGSYCNDYDITCRAKIAECAHSTVMKYKVCVCPKDYIAVYQHYLKYYECY-PKIERLTKFCEHCQNSQGSCIDVNSDGNEDSCYCG-KWKSISNQEDTELSQP---------ICKDDMLIIKCSSVHLEVCIN-NDKYIPKKRMAISEYSTGIFYTNLVSKSTNFCSVTGLRKSKSLTCF------------QMSKPI----QSTSFENNCSTISFGQDNSVYYSTFLFIPMDKFIFDPINDFNYEISCKADFKRSNPSMGQITEKSWKG---EINSIEPLIETMEDLLSLKVVDFQSKTLKEVKIEQMFALDVFMKKRNVKFNYFLPEKCSLINGKSNQVIYSRIKSISMSSSPNQNE-LNMF----AFS----TTPKVDQNEPHKLRSNYFPAFMLKSKGISTFSCVFRLCQDSSMCNQNFEWKSQNKEEIKI---PASHDDIKFVESHFEFFIGDENCCTRTSVAKENKVPCSDSLCLTPAQILTIVISVCTLTILLSFITPIL 654          
BLAST of Endoglin antigen vs. Planmine SMEST
Match: SMESG000039966.1 (SMESG000039966.1)

HSP 1 Score: 226.483 bits (576), Expect = 6.482e-63
Identity = 179/680 (26.32%), Postives = 309/680 (45.44%), Query Frame = 2
Query:   68 SDPFQVVDHGPCTTGGDYYCQQRVKNSYCSQATNKCFCQSNFVAIRERESITCKSLLTDLKCGMDQDCTDVYNSICHPGASECTCPAQTFYVPGTHX-XXXXXXXXXFMCNQCKNSGGQCYSRSTNVTTNEHSSKKQNL----CSCPGITIFNDNLGENEENAFQ-----CNKIWVDIGDICDNVTRLCRSHKSLCMVNEIAGYGICQCRRYHLPVYQKNLNFHECYIEQQDNNHRNCRQCKQIEGACINMNEESSTDACICPLSRKAIF--YDNIIRKPSEIIASLKCVTTNEMVDVKCDMKRFSVCIHINEIEFPNFAENIRKNLSKIFFSDRIIPNKQF-SVNGIQRDTDPLCYLAPTANVFNSNLQLCRSLIYDEKNGKFPCGINTVQYMNGYFYSGYIELWGNVHIPNLLVDKLFDVSCKSSNIRTVDTVGQAIDRSWPATSYQIVSREFQTDPDFLSFSAVDINNR-----------MSDFFIKFSPIRLQAKVNPNTTSYKHISADLCWAQNTSHLI---PHQTERWNIIHRGCAFKDSGFTSNFLQVYDSTTITSALFPLFQISNSENIFFKCIFRLCTTETWCKTDYDCSTNLDRSYSSDPPPQNMYDIKYISKSLVLTIGLQKQFQSDSRIKNGLSECHYFWCVTKLKLAIISMIIGGIVLLATAIFLLL 2026
            +D F +V  GPC   G  YCQ  V NS+CS+  N+CFCQ+ FVAI+E+  + CK+LLTDLKC  D+DC DVY S CHPG  +C+CPA+TFYV   H   +        +C  C+N GG+CY    N  +      KQN+    C+CPG  I +     NE++        C  I VD+G  C++    CR+  + C  + +  Y +C C + ++ VYQ  L ++ECY  + +   + C  C+  +G+CI++N + + D+C C    K+I    D  + +P         +  ++M+ +KC      VCI+ N+   P     I +  + IF+++ +  +  F SV G+++     C+         S    C ++ + +               N  +YS ++ +  +  I + + D  +++SCK+   R+  ++GQ  ++SW       +    +T  D LS   VD  ++             D F+K   ++    +    +     S  + +++  S  +   P+Q E  N+     AF     T+  +   +   + S  FP F + +     F C+FRLC   + C  +++  +           P +  DIK++       IG +      S  K     C    C+T  ++  I + +  + +L + I  +L
Sbjct:   27 ADNFHIVASGPCLKKGKNYCQNIVPNSFCSEEKNECFCQNGFVAIKEKNGLICKTLLTDLKCSTDRDCKDVYGSSCHPGPGQCSCPAETFYVAQEHVCKDYPKNIPDPLCKHCRNIGGKCY---FNTISPLSVIPKQNIYSGKCNCPG--ILSTPTATNEKSQLMPSLEICQGIMVDLGSYCNDYDITCRAKIAECAHSTVMKYKVCVCPKDYIAVYQHYLKYYECY-PKIERLTKFCEHCQNSQGSCIDVNSDGNEDSCYCG-KWKSISNQEDTELSQP---------ICKDDMLIIKCSSVHLEVCIN-NDKYIPKKRMAISEYSTGIFYTNLVSKSTNFCSVTGLRKSKSLTCFQMSKPIQSTSFENNCSTISFGQD--------------NSVYYSTFLFIPMDKFIFDPINDFNYEISCKADFKRSNPSMGQITEKSWKG-EINSIEPLIETMEDLLSLKVVDFQSKTLKEVKIEQMFALDVFMKKRNVKFNYFLPEKCSLINGKSNQVIYSRIKSISMSSSPNQNE-LNMF----AFS----TTPKVDQNEPHKLRSNYFPAFMLKSKGISTFSCVFRLCQDSSMCNQNFEWKSQNKEEIKI---PASHDDIKFVESHFEFFIGDENCCTRTSVAKENKVPCSDSLCLTPAQILTIVISVCTLTILLSFITPIL 662          
The following BLAST results are available for this feature:
BLAST of Endoglin antigen vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Endoglin antigen vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Endoglin antigen vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Endoglin antigen vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Endoglin antigen vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Endoglin antigen vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Endoglin antigen vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Endoglin antigen vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A068X1718.475e-5526.87Uncharacterized protein OS=Echinococcus granulosus... [more]
A0A4E0RS074.687e-5427.26Uncharacterized protein OS=Fasciola hepatica OX=61... [more]
A0A068YE624.116e-5326.32Uncharacterized protein OS=Echinococcus multilocul... [more]
A0A4S2M4V41.738e-4725.61Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A5K4F0526.880e-4526.92Uncharacterized protein OS=Schistosoma mansoni OX=... [more]
back to top
BLAST of Endoglin antigen vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Endoglin antigen vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Endoglin antigen vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Endoglin antigen vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Endoglin antigen vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Endoglin antigen vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000024282.10.000e+099.87SMESG000024282.1[more]
SMESG000068315.19.990e-10933.09SMESG000068315.1[more]
SMESG000025327.12.257e-6728.02SMESG000025327.1[more]
SMESG000039966.14.775e-6326.75SMESG000039966.1[more]
SMESG000039966.16.482e-6326.32SMESG000039966.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30009630 ID=SMED30009630|Name=Endoglin antigen|organism=Schmidtea mediterranea sexual|type=transcript|length=2414bp
CTGAGAAATGCTAGCCAAAAGATTTTCAATTTTCCCCTTCATTTTATGGA
TATTAAAGAATTCGTCGTCAGATCCCTTTCAAGTCGTTGACCACGGACCT
TGCACGACTGGCGGCGATTATTATTGCCAACAGCGAGTCAAAAATAGCTA
TTGCAGTCAGGCGACTAATAAATGCTTTTGTCAGTCGAATTTCGTTGCTA
TTAGAGAGCGAGAGAGTATAACTTGCAAATCACTGCTCACCGATCTAAAA
TGCGGAATGGATCAGGATTGTACAGATGTATATAACAGCATTTGTCATCC
TGGTGCCAGTGAGTGTACCTGTCCAGCACAAACATTTTATGTTCCCGGAA
CTCATTCATGTGAATCAGAATCCTTATCATCAAGCTTCATGTGCAACCAG
TGTAAAAATTCCGGTGGACAGTGCTACTCAAGAAGCACGAACGTAACAAC
TAATGAACATTCATCAAAAAAACAAAATCTTTGCTCATGTCCGGGAATTA
CAATTTTTAACGACAATTTAGGGGAGAATGAAGAAAACGCATTTCAATGT
AACAAAATATGGGTTGACATTGGGGATATTTGTGACAATGTGACTCGCCT
TTGTCGATCCCACAAATCGCTCTGTATGGTCAATGAGATCGCTGGTTACG
GGATCTGCCAATGTCGACGGTATCATTTGCCGGTCTATCAAAAAAATTTA
AATTTTCATGAATGCTATATTGAACAACAAGATAACAATCACAGAAATTG
CAGACAATGCAAGCAAATCGAAGGAGCCTGTATAAATATGAACGAAGAGA
GCTCCACAGATGCCTGCATTTGTCCATTGTCAAGAAAAGCTATTTTCTAT
GATAATATTATTCGCAAACCATCGGAAATAATCGCATCATTGAAATGCGT
TACAACAAATGAAATGGTTGACGTCAAATGTGACATGAAAAGGTTCTCAG
TCTGCATACATATCAATGAAATTGAGTTTCCAAATTTTGCGGAAAATATC
CGAAAGAATTTATCGAAAATATTTTTCTCTGATCGAATAATTCCCAATAA
ACAATTCAGCGTGAATGGCATTCAAAGGGACACAGATCCACTCTGCTATT
TGGCCCCCACAGCAAATGTGTTCAATTCTAATTTGCAACTTTGCCGGAGT
TTAATTTATGATGAGAAAAATGGAAAATTTCCGTGCGGCATTAACACTGT
TCAGTACATGAACGGCTATTTCTATTCCGGCTACATAGAATTATGGGGCA
ATGTACATATTCCCAATCTGCTCGTTGACAAGTTATTTGATGTGAGCTGC
AAATCTAGCAACATTCGAACTGTTGACACTGTTGGCCAGGCTATAGATAG
ATCCTGGCCTGCGACATCTTATCAAATTGTCAGTCGGGAATTCCAAACAG
ATCCAGATTTTCTCTCTTTCAGTGCGGTCGACATCAACAATCGGATGAGT
GATTTCTTCATTAAATTCTCCCCAATCCGTTTGCAGGCAAAAGTCAACCC
AAATACAACCTCATATAAACATATCAGTGCTGATTTATGCTGGGCTCAAA
ACACAAGTCACTTAATTCCGCATCAAACGGAAAGGTGGAACATCATTCAT
AGAGGGTGCGCTTTCAAAGACAGTGGATTCACGTCAAACTTTCTGCAGGT
TTATGACAGTACAACTATAACCAGTGCGTTGTTTCCTTTATTCCAGATTT
CTAACAGTGAGAATATATTTTTCAAATGCATATTCCGTCTTTGTACAACT
GAAACTTGGTGCAAAACAGATTACGATTGTTCAACAAATCTCGACCGGTC
CTATTCATCGGATCCGCCTCCACAAAATATGTACGATATAAAGTACATAT
CTAAATCTTTGGTACTTACAATAGGTCTTCAGAAACAGTTTCAATCTGAT
TCCAGAATTAAAAATGGTCTATCGGAGTGTCACTATTTTTGGTGTGTGAC
CAAATTGAAATTGGCTATTATCTCCATGATAATCGGAGGAATTGTTCTGC
TAGCCACTGCCATTTTCCTGTTGCTATGCTACCGACAGAAAATTATTAGA
GATATAAATCGCTGTCAAAGATTATCATCAAGAACGGTCAATGTGAATAC
AACGAGCCGACAACAACAACTGAATCTTTTGACATCTTCTAATTGTAATC
CCGTTGATTGTTCGAGTTACATGCTTGTTCCAGTTGCCCACAGATCACAT
CATTGTCAGCCAGTGAGCTTTAGCTATGATAGGACTGACTTGTACGAAGC
CCCGCTTTTCATTAACTCTTCTGTTTGTACAGTAAATCGTGATTCAGATC
TCAATAATGATCGAAATCCTATTTTTACATCAAACCATCACAACGAGATC
ATCACTATTAATAACTCTGGAGATGATTTATAAAAGTTTATTTGTAAATA
GATTATAAATTCGG
back to top

protein sequence of SMED30009630-orf-1

>SMED30009630-orf-1 ID=SMED30009630-orf-1|Name=SMED30009630-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=792bp
MLAKRFSIFPFILWILKNSSSDPFQVVDHGPCTTGGDYYCQQRVKNSYCS
QATNKCFCQSNFVAIRERESITCKSLLTDLKCGMDQDCTDVYNSICHPGA
SECTCPAQTFYVPGTHSCESESLSSSFMCNQCKNSGGQCYSRSTNVTTNE
HSSKKQNLCSCPGITIFNDNLGENEENAFQCNKIWVDIGDICDNVTRLCR
SHKSLCMVNEIAGYGICQCRRYHLPVYQKNLNFHECYIEQQDNNHRNCRQ
CKQIEGACINMNEESSTDACICPLSRKAIFYDNIIRKPSEIIASLKCVTT
NEMVDVKCDMKRFSVCIHINEIEFPNFAENIRKNLSKIFFSDRIIPNKQF
SVNGIQRDTDPLCYLAPTANVFNSNLQLCRSLIYDEKNGKFPCGINTVQY
MNGYFYSGYIELWGNVHIPNLLVDKLFDVSCKSSNIRTVDTVGQAIDRSW
PATSYQIVSREFQTDPDFLSFSAVDINNRMSDFFIKFSPIRLQAKVNPNT
TSYKHISADLCWAQNTSHLIPHQTERWNIIHRGCAFKDSGFTSNFLQVYD
STTITSALFPLFQISNSENIFFKCIFRLCTTETWCKTDYDCSTNLDRSYS
SDPPPQNMYDIKYISKSLVLTIGLQKQFQSDSRIKNGLSECHYFWCVTKL
KLAIISMIIGGIVLLATAIFLLLCYRQKIIRDINRCQRLSSRTVNVNTTS
RQQQLNLLTSSNCNPVDCSSYMLVPVAHRSHHCQPVSFSYDRTDLYEAPL
FINSSVCTVNRDSDLNNDRNPIFTSNHHNEIITINNSGDDL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR001507ZP_dom
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001507Zona pellucida domainPROSITEPS51034ZP_2coord: 307..598
score: 12.226
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..21
score: 0.624
NoneNo IPR availableTMHMMTMhelixcoord: 653..675