Calcium-transporting ATPase

Overview
NameCalcium-transporting ATPase
Smed IDSMED30009618
Length (bp)1172
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Calcium-transporting ATPase (SMED30009618) t-SNE clustered cells

Violin plots show distribution of expression levels for Calcium-transporting ATPase (SMED30009618) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30009618

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parapharyngeal regionSMED30009618SMESG000039058.1 SmedASXL_013854SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
cephalic gangliaSMED30009618SMESG000039058.1 dd_Smed_v4_9529_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30009618SMESG000039058.1 dd_Smed_v4_9529_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009618SMESG000051522.1 SMESG000039058.1 Contig15729newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009618SMESG000051522.1 SMESG000039058.1 Contig15729uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009618SMESG000039058.1 Contig39275uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009618SMESG000039058.1 Contig39275newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
head regionSMED30009618SMESG000039058.1 dd_Smed_v6_9529_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
zeta neoblastSMED30009618SMESG000039058.1 dd_Smed_v4_9529_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Calcium-transporting ATPase vs. Ensembl Human
Match: ATP2A2 (ATPase sarcoplasmic/endoplasmic reticulum Ca2+ transporting 2 [Source:HGNC Symbol;Acc:HGNC:812])

HSP 1 Score: 158.688 bits (400), Expect = 6.411e-42
Identity = 71/123 (57.72%), Postives = 97/123 (78.86%), Query Frame = 1
Query:  586 THHMQCLAERDTFQGIQCGIFTNPKPMSLALSVLVTIEMLNAVNSLSENQSLFVMPPWTNLWLIGAMCLSFGLHFVILEVDILSKIFQITPLTLIEWSAVMKISIPVIVIDETMKFISRKNMD 954
            +H +QC  +   F+G+ C IF +P PM++ALSVLVTIEM NA+NSLSENQSL  MPPW N+WL+G++CLS  LHF+IL V+ L  IFQITPL + +W  V+KIS+PVI++DET+KF++R  ++
Sbjct:  870 SHFLQCKEDNPDFEGVDCAIFESPYPMTMALSVLVTIEMCNALNSLSENQSLLRMPPWENIWLVGSICLSMSLHFLILYVEPLPLIFQITPLNVTQWLMVLKISLPVILMDETLKFVARNYLE 992          
BLAST of Calcium-transporting ATPase vs. Ensembl Human
Match: ATP2A2 (ATPase sarcoplasmic/endoplasmic reticulum Ca2+ transporting 2 [Source:HGNC Symbol;Acc:HGNC:812])

HSP 1 Score: 158.688 bits (400), Expect = 7.059e-42
Identity = 71/123 (57.72%), Postives = 97/123 (78.86%), Query Frame = 1
Query:  586 THHMQCLAERDTFQGIQCGIFTNPKPMSLALSVLVTIEMLNAVNSLSENQSLFVMPPWTNLWLIGAMCLSFGLHFVILEVDILSKIFQITPLTLIEWSAVMKISIPVIVIDETMKFISRKNMD 954
            +H +QC  +   F+G+ C IF +P PM++ALSVLVTIEM NA+NSLSENQSL  MPPW N+WL+G++CLS  LHF+IL V+ L  IFQITPL + +W  V+KIS+PVI++DET+KF++R  ++
Sbjct:  761 SHFLQCKEDNPDFEGVDCAIFESPYPMTMALSVLVTIEMCNALNSLSENQSLLRMPPWENIWLVGSICLSMSLHFLILYVEPLPLIFQITPLNVTQWLMVLKISLPVILMDETLKFVARNYLE 883          
BLAST of Calcium-transporting ATPase vs. Ensembl Human
Match: ATP2A2 (ATPase sarcoplasmic/endoplasmic reticulum Ca2+ transporting 2 [Source:HGNC Symbol;Acc:HGNC:812])

HSP 1 Score: 158.688 bits (400), Expect = 7.584e-42
Identity = 71/123 (57.72%), Postives = 97/123 (78.86%), Query Frame = 1
Query:  586 THHMQCLAERDTFQGIQCGIFTNPKPMSLALSVLVTIEMLNAVNSLSENQSLFVMPPWTNLWLIGAMCLSFGLHFVILEVDILSKIFQITPLTLIEWSAVMKISIPVIVIDETMKFISRKNMD 954
            +H +QC  +   F+G+ C IF +P PM++ALSVLVTIEM NA+NSLSENQSL  MPPW N+WL+G++CLS  LHF+IL V+ L  IFQITPL + +W  V+KIS+PVI++DET+KF++R  ++
Sbjct:  870 SHFLQCKEDNPDFEGVDCAIFESPYPMTMALSVLVTIEMCNALNSLSENQSLLRMPPWENIWLVGSICLSMSLHFLILYVEPLPLIFQITPLNVTQWLMVLKISLPVILMDETLKFVARNYLE 992          
BLAST of Calcium-transporting ATPase vs. Ensembl Human
Match: ATP2A1 (ATPase sarcoplasmic/endoplasmic reticulum Ca2+ transporting 1 [Source:HGNC Symbol;Acc:HGNC:811])

HSP 1 Score: 155.606 bits (392), Expect = 7.558e-41
Identity = 71/124 (57.26%), Postives = 94/124 (75.81%), Query Frame = 1
Query:  586 THHMQCLAERDTFQGIQCGIFTNPKPMSLALSVLVTIEMLNAVNSLSENQSLFVMPPWTNLWLIGAMCLSFGLHFVILEVDILSKIFQITPLTLIEWSAVMKISIPVIVIDETMKFISRKNMDD 957
            TH MQC  +   F+GI C +F  P+PM++ALSVLVTIEM NA+NSLSENQSL  MPPW N+WL+G++CLS  LHF+IL VD L  IF++  L L +W  V+KIS+PVI +DE +KF++R  ++D
Sbjct:  871 THFMQCTEDNTHFEGIDCEVFEAPEPMTMALSVLVTIEMCNALNSLSENQSLLRMPPWVNIWLLGSICLSMSLHFLILYVDPLPMIFKLRALDLTQWLMVLKISLPVIGLDEILKFVARNYLED 994          
BLAST of Calcium-transporting ATPase vs. Ensembl Human
Match: ATP2A1 (ATPase sarcoplasmic/endoplasmic reticulum Ca2+ transporting 1 [Source:HGNC Symbol;Acc:HGNC:811])

HSP 1 Score: 153.295 bits (386), Expect = 4.872e-40
Identity = 70/123 (56.91%), Postives = 93/123 (75.61%), Query Frame = 1
Query:  586 THHMQCLAERDTFQGIQCGIFTNPKPMSLALSVLVTIEMLNAVNSLSENQSLFVMPPWTNLWLIGAMCLSFGLHFVILEVDILSKIFQITPLTLIEWSAVMKISIPVIVIDETMKFISRKNMD 954
            TH MQC  +   F+GI C +F  P+PM++ALSVLVTIEM NA+NSLSENQSL  MPPW N+WL+G++CLS  LHF+IL VD L  IF++  L L +W  V+KIS+PVI +DE +KF++R  ++
Sbjct:  746 THFMQCTEDNTHFEGIDCEVFEAPEPMTMALSVLVTIEMCNALNSLSENQSLLRMPPWVNIWLLGSICLSMSLHFLILYVDPLPMIFKLRALDLTQWLMVLKISLPVIGLDEILKFVARNYLE 868          
BLAST of Calcium-transporting ATPase vs. Ensembl Celegans
Match: sca-1 (Calcium-transporting ATPase [Source:UniProtKB/TrEMBL;Acc:Q9XU13])

HSP 1 Score: 166.007 bits (419), Expect = 9.924e-45
Identity = 78/131 (59.54%), Postives = 100/131 (76.34%), Query Frame = 1
Query:  586 THHMQCLAERDTFQGIQCGIFTNPKPMSLALSVLVTIEMLNAVNSLSENQSLFVMPPWTNLWLIGAMCLSFGLHFVILEVDILSKIFQITPLTLIEWSAVMKISIPVIVIDETMKFISRKNMDDEPLMQGA 978
            TH M+C  E D F  + C +F +  P ++ALSVLVTIEMLNA+NSLSENQSL VMPPW N+WL+ A+ LS  LHFVIL VDI++ IFQITPL  +EW AV+KIS+PV+++DE +KFI+R  +D +P   GA
Sbjct:  872 THWMRCEIEPDNFADLDCAVFEDNHPNAMALSVLVTIEMLNAINSLSENQSLLVMPPWKNIWLMAAISLSMSLHFVILYVDIMATIFQITPLNWVEWIAVLKISLPVLLLDEILKFIARNYIDGKPETVGA 1002          
BLAST of Calcium-transporting ATPase vs. Ensembl Celegans
Match: sca-1 (Calcium-transporting ATPase [Source:UniProtKB/TrEMBL;Acc:Q9XU13])

HSP 1 Score: 165.622 bits (418), Expect = 1.086e-44
Identity = 78/131 (59.54%), Postives = 100/131 (76.34%), Query Frame = 1
Query:  586 THHMQCLAERDTFQGIQCGIFTNPKPMSLALSVLVTIEMLNAVNSLSENQSLFVMPPWTNLWLIGAMCLSFGLHFVILEVDILSKIFQITPLTLIEWSAVMKISIPVIVIDETMKFISRKNMDDEPLMQGA 978
            TH M+C  E D F  + C +F +  P ++ALSVLVTIEMLNA+NSLSENQSL VMPPW N+WL+ A+ LS  LHFVIL VDI++ IFQITPL  +EW AV+KIS+PV+++DE +KFI+R  +D +P   GA
Sbjct:  745 THWMRCEIEPDNFADLDCAVFEDNHPNAMALSVLVTIEMLNAINSLSENQSLLVMPPWKNIWLMAAISLSMSLHFVILYVDIMATIFQITPLNWVEWIAVLKISLPVLLLDEILKFIARNYIDGKPETVGA 875          
BLAST of Calcium-transporting ATPase vs. Ensembl Celegans
Match: sca-1 (Calcium-transporting ATPase [Source:UniProtKB/TrEMBL;Acc:Q9XU13])

HSP 1 Score: 161.384 bits (407), Expect = 3.252e-43
Identity = 76/125 (60.80%), Postives = 97/125 (77.60%), Query Frame = 1
Query:  586 THHMQCLAERDTFQGIQCGIFTNPKPMSLALSVLVTIEMLNAVNSLSENQSLFVMPPWTNLWLIGAMCLSFGLHFVILEVDILSKIFQITPLTLIEWSAVMKISIPVIVIDETMKFISRKNMDDE 960
            TH M+C  E D F  + C +F +  P ++ALSVLVTIEMLNA+NSLSENQSL VMPPW N+WL+ A+ LS  LHFVIL VDI++ IFQITPL  +EW AV+KIS+PV+++DE +KFI+R  +D E
Sbjct:  872 THWMRCEIEPDNFADLDCAVFEDNHPNAMALSVLVTIEMLNAINSLSENQSLLVMPPWKNIWLMAAISLSMSLHFVILYVDIMATIFQITPLNWVEWIAVLKISLPVLLLDEILKFIARNYIDVE 996          
BLAST of Calcium-transporting ATPase vs. Ensembl Celegans
Match: sca-1 (Calcium-transporting ATPase [Source:UniProtKB/TrEMBL;Acc:Q9XU13])

HSP 1 Score: 161.384 bits (407), Expect = 3.252e-43
Identity = 76/125 (60.80%), Postives = 97/125 (77.60%), Query Frame = 1
Query:  586 THHMQCLAERDTFQGIQCGIFTNPKPMSLALSVLVTIEMLNAVNSLSENQSLFVMPPWTNLWLIGAMCLSFGLHFVILEVDILSKIFQITPLTLIEWSAVMKISIPVIVIDETMKFISRKNMDDE 960
            TH M+C  E D F  + C +F +  P ++ALSVLVTIEMLNA+NSLSENQSL VMPPW N+WL+ A+ LS  LHFVIL VDI++ IFQITPL  +EW AV+KIS+PV+++DE +KFI+R  +D E
Sbjct:  872 THWMRCEIEPDNFADLDCAVFEDNHPNAMALSVLVTIEMLNAINSLSENQSLLVMPPWKNIWLMAAISLSMSLHFVILYVDIMATIFQITPLNWVEWIAVLKISLPVLLLDEILKFIARNYIDVE 996          
BLAST of Calcium-transporting ATPase vs. Ensembl Celegans
Match: sca-1 (Calcium-transporting ATPase [Source:UniProtKB/TrEMBL;Acc:Q9XU13])

HSP 1 Score: 161.384 bits (407), Expect = 3.252e-43
Identity = 76/125 (60.80%), Postives = 97/125 (77.60%), Query Frame = 1
Query:  586 THHMQCLAERDTFQGIQCGIFTNPKPMSLALSVLVTIEMLNAVNSLSENQSLFVMPPWTNLWLIGAMCLSFGLHFVILEVDILSKIFQITPLTLIEWSAVMKISIPVIVIDETMKFISRKNMDDE 960
            TH M+C  E D F  + C +F +  P ++ALSVLVTIEMLNA+NSLSENQSL VMPPW N+WL+ A+ LS  LHFVIL VDI++ IFQITPL  +EW AV+KIS+PV+++DE +KFI+R  +D E
Sbjct:  872 THWMRCEIEPDNFADLDCAVFEDNHPNAMALSVLVTIEMLNAINSLSENQSLLVMPPWKNIWLMAAISLSMSLHFVILYVDIMATIFQITPLNWVEWIAVLKISLPVLLLDEILKFIARNYIDVE 996          
BLAST of Calcium-transporting ATPase vs. Ensembl Fly
Match: SERCA (gene:FBgn0263006 transcript:FBtr0072216)

HSP 1 Score: 188.734 bits (478), Expect = 1.515e-52
Identity = 86/138 (62.32%), Postives = 108/138 (78.26%), Query Frame = 1
Query:  586 THHMQCLAERDTFQGIQCGIFTNPKPMSLALSVLVTIEMLNAVNSLSENQSLFVMPPWTNLWLIGAMCLSFGLHFVILEVDILSKIFQITPLTLIEWSAVMKISIPVIVIDETMKFISRKNMDDEPLMQGAYGVFLMW 999
            THH+ CL   D F+G+ C IF++P  M++ALSVLVTIEMLNA+NSLSENQSL  MPPW NLWLIG+M LSF LHFVIL VD+LS +FQ+TPL+  EW  VMK SIPV+++DET+KF++RK  D E  +   +G+ LMW
Sbjct:  871 THHLSCLGGGDEFKGVDCKIFSDPHAMTMALSVLVTIEMLNAMNSLSENQSLITMPPWCNLWLIGSMALSFTLHFVILYVDVLSTVFQVTPLSAEEWITVMKFSIPVVLLDETLKFVARKIADGESPIYKMHGIVLMW 1008          
BLAST of Calcium-transporting ATPase vs. Ensembl Fly
Match: SERCA (gene:FBgn0263006 transcript:FBtr0072211)

HSP 1 Score: 188.734 bits (478), Expect = 1.515e-52
Identity = 86/138 (62.32%), Postives = 108/138 (78.26%), Query Frame = 1
Query:  586 THHMQCLAERDTFQGIQCGIFTNPKPMSLALSVLVTIEMLNAVNSLSENQSLFVMPPWTNLWLIGAMCLSFGLHFVILEVDILSKIFQITPLTLIEWSAVMKISIPVIVIDETMKFISRKNMDDEPLMQGAYGVFLMW 999
            THH+ CL   D F+G+ C IF++P  M++ALSVLVTIEMLNA+NSLSENQSL  MPPW NLWLIG+M LSF LHFVIL VD+LS +FQ+TPL+  EW  VMK SIPV+++DET+KF++RK  D E  +   +G+ LMW
Sbjct:  871 THHLSCLGGGDEFKGVDCKIFSDPHAMTMALSVLVTIEMLNAMNSLSENQSLITMPPWCNLWLIGSMALSFTLHFVILYVDVLSTVFQVTPLSAEEWITVMKFSIPVVLLDETLKFVARKIADGESPIYKMHGIVLMW 1008          
BLAST of Calcium-transporting ATPase vs. Ensembl Fly
Match: SERCA (gene:FBgn0263006 transcript:FBtr0072214)

HSP 1 Score: 188.734 bits (478), Expect = 1.515e-52
Identity = 86/138 (62.32%), Postives = 108/138 (78.26%), Query Frame = 1
Query:  586 THHMQCLAERDTFQGIQCGIFTNPKPMSLALSVLVTIEMLNAVNSLSENQSLFVMPPWTNLWLIGAMCLSFGLHFVILEVDILSKIFQITPLTLIEWSAVMKISIPVIVIDETMKFISRKNMDDEPLMQGAYGVFLMW 999
            THH+ CL   D F+G+ C IF++P  M++ALSVLVTIEMLNA+NSLSENQSL  MPPW NLWLIG+M LSF LHFVIL VD+LS +FQ+TPL+  EW  VMK SIPV+++DET+KF++RK  D E  +   +G+ LMW
Sbjct:  871 THHLSCLGGGDEFKGVDCKIFSDPHAMTMALSVLVTIEMLNAMNSLSENQSLITMPPWCNLWLIGSMALSFTLHFVILYVDVLSTVFQVTPLSAEEWITVMKFSIPVVLLDETLKFVARKIADGESPIYKMHGIVLMW 1008          
BLAST of Calcium-transporting ATPase vs. Ensembl Fly
Match: SERCA (gene:FBgn0263006 transcript:FBtr0072212)

HSP 1 Score: 188.734 bits (478), Expect = 1.515e-52
Identity = 86/138 (62.32%), Postives = 108/138 (78.26%), Query Frame = 1
Query:  586 THHMQCLAERDTFQGIQCGIFTNPKPMSLALSVLVTIEMLNAVNSLSENQSLFVMPPWTNLWLIGAMCLSFGLHFVILEVDILSKIFQITPLTLIEWSAVMKISIPVIVIDETMKFISRKNMDDEPLMQGAYGVFLMW 999
            THH+ CL   D F+G+ C IF++P  M++ALSVLVTIEMLNA+NSLSENQSL  MPPW NLWLIG+M LSF LHFVIL VD+LS +FQ+TPL+  EW  VMK SIPV+++DET+KF++RK  D E  +   +G+ LMW
Sbjct:  871 THHLSCLGGGDEFKGVDCKIFSDPHAMTMALSVLVTIEMLNAMNSLSENQSLITMPPWCNLWLIGSMALSFTLHFVILYVDVLSTVFQVTPLSAEEWITVMKFSIPVVLLDETLKFVARKIADGESPIYKMHGIVLMW 1008          
BLAST of Calcium-transporting ATPase vs. Ensembl Fly
Match: SERCA (gene:FBgn0263006 transcript:FBtr0072217)

HSP 1 Score: 188.734 bits (478), Expect = 1.515e-52
Identity = 86/138 (62.32%), Postives = 108/138 (78.26%), Query Frame = 1
Query:  586 THHMQCLAERDTFQGIQCGIFTNPKPMSLALSVLVTIEMLNAVNSLSENQSLFVMPPWTNLWLIGAMCLSFGLHFVILEVDILSKIFQITPLTLIEWSAVMKISIPVIVIDETMKFISRKNMDDEPLMQGAYGVFLMW 999
            THH+ CL   D F+G+ C IF++P  M++ALSVLVTIEMLNA+NSLSENQSL  MPPW NLWLIG+M LSF LHFVIL VD+LS +FQ+TPL+  EW  VMK SIPV+++DET+KF++RK  D E  +   +G+ LMW
Sbjct:  871 THHLSCLGGGDEFKGVDCKIFSDPHAMTMALSVLVTIEMLNAMNSLSENQSLITMPPWCNLWLIGSMALSFTLHFVILYVDVLSTVFQVTPLSAEEWITVMKFSIPVVLLDETLKFVARKIADGESPIYKMHGIVLMW 1008          
BLAST of Calcium-transporting ATPase vs. Ensembl Zebrafish
Match: atp2a2b (ATPase sarcoplasmic/endoplasmic reticulum Ca2+ transporting 2b [Source:ZFIN;Acc:ZDB-GENE-030131-867])

HSP 1 Score: 157.918 bits (398), Expect = 9.449e-42
Identity = 72/123 (58.54%), Postives = 96/123 (78.05%), Query Frame = 1
Query:  586 THHMQCLAERDTFQGIQCGIFTNPKPMSLALSVLVTIEMLNAVNSLSENQSLFVMPPWTNLWLIGAMCLSFGLHFVILEVDILSKIFQITPLTLIEWSAVMKISIPVIVIDETMKFISRKNMD 954
            +H +QC  +   F+G+QC IF +P PM++ALSVLVTIEM NA+NS+SENQSL  MPPW N+WL+GA+CLS  LHF+IL V+ L  IFQITPL + +W  V+KIS+PVI++DE +KF +R  +D
Sbjct:  834 SHFLQCAPDNPEFEGLQCEIFGSPYPMTMALSVLVTIEMCNALNSVSENQSLLHMPPWENVWLLGAICLSMSLHFLILYVEPLPMIFQITPLNVTQWLMVLKISLPVILLDEVLKFAARNYLD 956          
BLAST of Calcium-transporting ATPase vs. Ensembl Zebrafish
Match: atp2a2b (ATPase sarcoplasmic/endoplasmic reticulum Ca2+ transporting 2b [Source:ZFIN;Acc:ZDB-GENE-030131-867])

HSP 1 Score: 157.532 bits (397), Expect = 1.039e-41
Identity = 72/123 (58.54%), Postives = 96/123 (78.05%), Query Frame = 1
Query:  586 THHMQCLAERDTFQGIQCGIFTNPKPMSLALSVLVTIEMLNAVNSLSENQSLFVMPPWTNLWLIGAMCLSFGLHFVILEVDILSKIFQITPLTLIEWSAVMKISIPVIVIDETMKFISRKNMD 954
            +H +QC  +   F+G+QC IF +P PM++ALSVLVTIEM NA+NS+SENQSL  MPPW N+WL+GA+CLS  LHF+IL V+ L  IFQITPL + +W  V+KIS+PVI++DE +KF +R  +D
Sbjct:  869 SHFLQCAPDNPEFEGLQCEIFGSPYPMTMALSVLVTIEMCNALNSVSENQSLLHMPPWENVWLLGAICLSMSLHFLILYVEPLPMIFQITPLNVTQWLMVLKISLPVILLDEVLKFAARNYLD 991          
BLAST of Calcium-transporting ATPase vs. Ensembl Zebrafish
Match: atp2a2b (ATPase sarcoplasmic/endoplasmic reticulum Ca2+ transporting 2b [Source:ZFIN;Acc:ZDB-GENE-030131-867])

HSP 1 Score: 157.532 bits (397), Expect = 1.086e-41
Identity = 72/123 (58.54%), Postives = 96/123 (78.05%), Query Frame = 1
Query:  586 THHMQCLAERDTFQGIQCGIFTNPKPMSLALSVLVTIEMLNAVNSLSENQSLFVMPPWTNLWLIGAMCLSFGLHFVILEVDILSKIFQITPLTLIEWSAVMKISIPVIVIDETMKFISRKNMD 954
            +H +QC  +   F+G+QC IF +P PM++ALSVLVTIEM NA+NS+SENQSL  MPPW N+WL+GA+CLS  LHF+IL V+ L  IFQITPL + +W  V+KIS+PVI++DE +KF +R  +D
Sbjct:  863 SHFLQCAPDNPEFEGLQCEIFGSPYPMTMALSVLVTIEMCNALNSVSENQSLLHMPPWENVWLLGAICLSMSLHFLILYVEPLPMIFQITPLNVTQWLMVLKISLPVILLDEVLKFAARNYLD 985          
BLAST of Calcium-transporting ATPase vs. Ensembl Zebrafish
Match: atp2a2a (ATPase sarcoplasmic/endoplasmic reticulum Ca2+ transporting 2a [Source:ZFIN;Acc:ZDB-GENE-040426-702])

HSP 1 Score: 155.992 bits (393), Expect = 4.319e-41
Identity = 71/126 (56.35%), Postives = 97/126 (76.98%), Query Frame = 1
Query:  586 THHMQCLAERDTFQGIQCGIFTNPKPMSLALSVLVTIEMLNAVNSLSENQSLFVMPPWTNLWLIGAMCLSFGLHFVILEVDILSKIFQITPLTLIEWSAVMKISIPVIVIDETMKFISRKNMDDEP 963
            +H +QC  +   FQ ++C +F +P PM++ALSVLVTIEM NA+NSLSENQSL  MPPW N+WL+GA+CLS  LHF+IL V+ L  IFQITPL + +W  V+KIS+PVI++DE +KF++R  ++  P
Sbjct:  869 SHFLQCSPDNPDFQDLECHVFESPYPMTMALSVLVTIEMCNALNSLSENQSLVRMPPWENIWLLGAICLSMSLHFLILYVEPLPVIFQITPLNVTQWMMVLKISLPVILLDELLKFVARTYLEPAP 994          
BLAST of Calcium-transporting ATPase vs. Ensembl Zebrafish
Match: si:dkey-28b4.8 (si:dkey-28b4.8 [Source:ZFIN;Acc:ZDB-GENE-090501-2])

HSP 1 Score: 155.606 bits (392), Expect = 6.262e-41
Identity = 70/123 (56.91%), Postives = 95/123 (77.24%), Query Frame = 1
Query:  586 THHMQCLAERDTFQGIQCGIFTNPKPMSLALSVLVTIEMLNAVNSLSENQSLFVMPPWTNLWLIGAMCLSFGLHFVILEVDILSKIFQITPLTLIEWSAVMKISIPVIVIDETMKFISRKNMD 954
            +H++QC      F G+QC +F +P PM++ALSVLVTIEM NA+NSLSENQSL  MPPW+N WL+GA+CLS  LHF+IL VD L  IFQI PL+  +W  V+K+S+PVI++DE +KF++R  ++
Sbjct:  878 SHYLQCSEGHAEFAGVQCSVFESPYPMTMALSVLVTIEMCNALNSLSENQSLLKMPPWSNPWLVGAICLSMALHFLILYVDPLPVIFQIRPLSWPQWVVVLKMSLPVILMDEALKFLARNYIE 1000          
BLAST of Calcium-transporting ATPase vs. Ensembl Xenopus
Match: ATP2A2 (ATPase, Ca++ transporting, cardiac muscle, slow twitch 2 [Source:NCBI gene;Acc:100489059])

HSP 1 Score: 163.31 bits (412), Expect = 1.748e-43
Identity = 75/127 (59.06%), Postives = 100/127 (78.74%), Query Frame = 1
Query:  586 THHMQCLAERDTFQGIQCGIFTNPKPMSLALSVLVTIEMLNAVNSLSENQSLFVMPPWTNLWLIGAMCLSFGLHFVILEVDILSKIFQITPLTLIEWSAVMKISIPVIVIDETMKFISRKNMDDEPL 966
            +H +QC  E   F G++C IF +P PM++ALSVLVTIEM NA+NSLSENQSL  MPPW N+WL+G++CLS  LHF+IL V+ L  IFQITPL LI+W  V+KIS+PVI++DET+K+++R  ++ E L
Sbjct:  870 SHFLQCREENPDFDGVECEIFESPYPMTMALSVLVTIEMCNALNSLSENQSLLRMPPWENVWLLGSICLSMSLHFLILYVEPLPLIFQITPLNLIQWLMVLKISLPVILLDETLKYVARNYLEPEKL 996          
BLAST of Calcium-transporting ATPase vs. Ensembl Xenopus
Match: ATP2A2 (ATPase, Ca++ transporting, cardiac muscle, slow twitch 2 [Source:NCBI gene;Acc:100489059])

HSP 1 Score: 162.155 bits (409), Expect = 4.273e-43
Identity = 74/125 (59.20%), Postives = 99/125 (79.20%), Query Frame = 1
Query:  586 THHMQCLAERDTFQGIQCGIFTNPKPMSLALSVLVTIEMLNAVNSLSENQSLFVMPPWTNLWLIGAMCLSFGLHFVILEVDILSKIFQITPLTLIEWSAVMKISIPVIVIDETMKFISRKNMDDE 960
            +H +QC  E   F G++C IF +P PM++ALSVLVTIEM NA+NSLSENQSL  MPPW N+WL+G++CLS  LHF+IL V+ L  IFQITPL LI+W  V+KIS+PVI++DET+K+++R  ++ E
Sbjct:  870 SHFLQCREENPDFDGVECEIFESPYPMTMALSVLVTIEMCNALNSLSENQSLLRMPPWENVWLLGSICLSMSLHFLILYVEPLPLIFQITPLNLIQWLMVLKISLPVILLDETLKYVARNYLEPE 994          
BLAST of Calcium-transporting ATPase vs. Ensembl Xenopus
Match: ATP2A2 (ATPase, Ca++ transporting, cardiac muscle, slow twitch 2 [Source:NCBI gene;Acc:100489059])

HSP 1 Score: 162.155 bits (409), Expect = 4.704e-43
Identity = 74/125 (59.20%), Postives = 99/125 (79.20%), Query Frame = 1
Query:  586 THHMQCLAERDTFQGIQCGIFTNPKPMSLALSVLVTIEMLNAVNSLSENQSLFVMPPWTNLWLIGAMCLSFGLHFVILEVDILSKIFQITPLTLIEWSAVMKISIPVIVIDETMKFISRKNMDDE 960
            +H +QC  E   F G++C IF +P PM++ALSVLVTIEM NA+NSLSENQSL  MPPW N+WL+G++CLS  LHF+IL V+ L  IFQITPL LI+W  V+KIS+PVI++DET+K+++R  ++ E
Sbjct:  870 SHFLQCREENPDFDGVECEIFESPYPMTMALSVLVTIEMCNALNSLSENQSLLRMPPWENVWLLGSICLSMSLHFLILYVEPLPLIFQITPLNLIQWLMVLKISLPVILLDETLKYVARNYLEPE 994          
BLAST of Calcium-transporting ATPase vs. Ensembl Xenopus
Match: ATP2A2 (ATPase, Ca++ transporting, cardiac muscle, slow twitch 2 [Source:NCBI gene;Acc:100489059])

HSP 1 Score: 160.999 bits (406), Expect = 9.637e-43
Identity = 73/123 (59.35%), Postives = 98/123 (79.67%), Query Frame = 1
Query:  586 THHMQCLAERDTFQGIQCGIFTNPKPMSLALSVLVTIEMLNAVNSLSENQSLFVMPPWTNLWLIGAMCLSFGLHFVILEVDILSKIFQITPLTLIEWSAVMKISIPVIVIDETMKFISRKNMD 954
            +H +QC  E   F G++C IF +P PM++ALSVLVTIEM NA+NSLSENQSL  MPPW N+WL+G++CLS  LHF+IL V+ L  IFQITPL LI+W  V+KIS+PVI++DET+K+++R  ++
Sbjct:  870 SHFLQCREENPDFDGVECEIFESPYPMTMALSVLVTIEMCNALNSLSENQSLLRMPPWENVWLLGSICLSMSLHFLILYVEPLPLIFQITPLNLIQWLMVLKISLPVILLDETLKYVARNYLE 992          
BLAST of Calcium-transporting ATPase vs. Ensembl Xenopus
Match: ATP2A2 (ATPase, Ca++ transporting, cardiac muscle, slow twitch 2 [Source:NCBI gene;Acc:100489059])

HSP 1 Score: 160.999 bits (406), Expect = 1.134e-42
Identity = 73/123 (59.35%), Postives = 98/123 (79.67%), Query Frame = 1
Query:  586 THHMQCLAERDTFQGIQCGIFTNPKPMSLALSVLVTIEMLNAVNSLSENQSLFVMPPWTNLWLIGAMCLSFGLHFVILEVDILSKIFQITPLTLIEWSAVMKISIPVIVIDETMKFISRKNMD 954
            +H +QC  E   F G++C IF +P PM++ALSVLVTIEM NA+NSLSENQSL  MPPW N+WL+G++CLS  LHF+IL V+ L  IFQITPL LI+W  V+KIS+PVI++DET+K+++R  ++
Sbjct:  853 SHFLQCREENPDFDGVECEIFESPYPMTMALSVLVTIEMCNALNSLSENQSLLRMPPWENVWLLGSICLSMSLHFLILYVEPLPLIFQITPLNLIQWLMVLKISLPVILLDETLKYVARNYLE 975          
BLAST of Calcium-transporting ATPase vs. Ensembl Mouse
Match: Atp2a1 (ATPase, Ca++ transporting, cardiac muscle, fast twitch 1 [Source:MGI Symbol;Acc:MGI:105058])

HSP 1 Score: 150.984 bits (380), Expect = 3.762e-44
Identity = 70/124 (56.45%), Postives = 91/124 (73.39%), Query Frame = 1
Query:  586 THHMQCLAERDTFQGIQCGIFTNPKPMSLALSVLVTIEMLNAVNSLSENQSLFVMPPWTNLWLIGAMCLSFGLHFVILEVDILSKIFQITPLTLIEWSAVMKISIPVIVIDETMKFISRKNMDD 957
            TH MQC      F G+ C +F  P+PM++ALSVLVTIEM NA+NSLSENQSL  MPPW N+WL+G++CLS  LHF+IL VD L  IF++  L   +W  V+KIS+PVI +DE +KFI+R  ++D
Sbjct:   16 THFMQCTEHNPEFDGLDCEVFEAPEPMTMALSVLVTIEMCNALNSLSENQSLLRMPPWVNIWLLGSICLSMSLHFLILYVDPLPMIFKLRALDFTQWLMVLKISLPVIGLDELLKFIARNYLED 139          
BLAST of Calcium-transporting ATPase vs. Ensembl Mouse
Match: Atp2a2 (ATPase, Ca++ transporting, cardiac muscle, slow twitch 2 [Source:MGI Symbol;Acc:MGI:88110])

HSP 1 Score: 159.844 bits (403), Expect = 1.771e-42
Identity = 72/129 (55.81%), Postives = 99/129 (76.74%), Query Frame = 1
Query:  586 THHMQCLAERDTFQGIQCGIFTNPKPMSLALSVLVTIEMLNAVNSLSENQSLFVMPPWTNLWLIGAMCLSFGLHFVILEVDILSKIFQITPLTLIEWSAVMKISIPVIVIDETMKFISRKNMDDEPLMQ 972
            +H +QC  +   F G+ C IF +P PM++ALSVLVTIEM NA+NSLSENQSL  MPPW N+WL+G++CLS  LHF+IL V+ L  IFQITPL L +W  V+KIS+PVI++DET+KF++R  ++   +++
Sbjct:  870 SHFLQCKEDNPDFDGVDCAIFESPYPMTMALSVLVTIEMCNALNSLSENQSLLRMPPWENIWLVGSICLSMSLHFLILYVEPLPLIFQITPLNLTQWLMVLKISLPVILMDETLKFVARNYLEQPAILE 998          
BLAST of Calcium-transporting ATPase vs. Ensembl Mouse
Match: Atp2a2 (ATPase, Ca++ transporting, cardiac muscle, slow twitch 2 [Source:MGI Symbol;Acc:MGI:88110])

HSP 1 Score: 159.073 bits (401), Expect = 3.812e-42
Identity = 72/123 (58.54%), Postives = 96/123 (78.05%), Query Frame = 1
Query:  586 THHMQCLAERDTFQGIQCGIFTNPKPMSLALSVLVTIEMLNAVNSLSENQSLFVMPPWTNLWLIGAMCLSFGLHFVILEVDILSKIFQITPLTLIEWSAVMKISIPVIVIDETMKFISRKNMD 954
            +H +QC  +   F G+ C IF +P PM++ALSVLVTIEM NA+NSLSENQSL  MPPW N+WL+G++CLS  LHF+IL V+ L  IFQITPL L +W  V+KIS+PVI++DET+KF++R  ++
Sbjct:  870 SHFLQCKEDNPDFDGVDCAIFESPYPMTMALSVLVTIEMCNALNSLSENQSLLRMPPWENIWLVGSICLSMSLHFLILYVEPLPLIFQITPLNLTQWLMVLKISLPVILMDETLKFVARNYLE 992          
BLAST of Calcium-transporting ATPase vs. Ensembl Mouse
Match: Atp2a2 (ATPase, Ca++ transporting, cardiac muscle, slow twitch 2 [Source:MGI Symbol;Acc:MGI:88110])

HSP 1 Score: 159.073 bits (401), Expect = 3.812e-42
Identity = 72/123 (58.54%), Postives = 96/123 (78.05%), Query Frame = 1
Query:  586 THHMQCLAERDTFQGIQCGIFTNPKPMSLALSVLVTIEMLNAVNSLSENQSLFVMPPWTNLWLIGAMCLSFGLHFVILEVDILSKIFQITPLTLIEWSAVMKISIPVIVIDETMKFISRKNMD 954
            +H +QC  +   F G+ C IF +P PM++ALSVLVTIEM NA+NSLSENQSL  MPPW N+WL+G++CLS  LHF+IL V+ L  IFQITPL L +W  V+KIS+PVI++DET+KF++R  ++
Sbjct:  870 SHFLQCKEDNPDFDGVDCAIFESPYPMTMALSVLVTIEMCNALNSLSENQSLLRMPPWENIWLVGSICLSMSLHFLILYVEPLPLIFQITPLNLTQWLMVLKISLPVILMDETLKFVARNYLE 992          
BLAST of Calcium-transporting ATPase vs. Ensembl Mouse
Match: Atp2a1 (ATPase, Ca++ transporting, cardiac muscle, fast twitch 1 [Source:MGI Symbol;Acc:MGI:105058])

HSP 1 Score: 149.443 bits (376), Expect = 6.753e-39
Identity = 69/123 (56.10%), Postives = 90/123 (73.17%), Query Frame = 1
Query:  586 THHMQCLAERDTFQGIQCGIFTNPKPMSLALSVLVTIEMLNAVNSLSENQSLFVMPPWTNLWLIGAMCLSFGLHFVILEVDILSKIFQITPLTLIEWSAVMKISIPVIVIDETMKFISRKNMD 954
            TH MQC      F G+ C +F  P+PM++ALSVLVTIEM NA+NSLSENQSL  MPPW N+WL+G++CLS  LHF+IL VD L  IF++  L   +W  V+KIS+PVI +DE +KFI+R  ++
Sbjct:  871 THFMQCTEHNPEFDGLDCEVFEAPEPMTMALSVLVTIEMCNALNSLSENQSLLRMPPWVNIWLLGSICLSMSLHFLILYVDPLPMIFKLRALDFTQWLMVLKISLPVIGLDELLKFIARNYLE 993          
BLAST of Calcium-transporting ATPase vs. UniProt/SwissProt
Match: sp|P22700|ATC1_DROME (Calcium-transporting ATPase sarcoplasmic/endoplasmic reticulum type OS=Drosophila melanogaster OX=7227 GN=SERCA PE=1 SV=2)

HSP 1 Score: 188.734 bits (478), Expect = 1.518e-51
Identity = 86/138 (62.32%), Postives = 108/138 (78.26%), Query Frame = 1
Query:  586 THHMQCLAERDTFQGIQCGIFTNPKPMSLALSVLVTIEMLNAVNSLSENQSLFVMPPWTNLWLIGAMCLSFGLHFVILEVDILSKIFQITPLTLIEWSAVMKISIPVIVIDETMKFISRKNMDDEPLMQGAYGVFLMW 999
            THH+ CL   D F+G+ C IF++P  M++ALSVLVTIEMLNA+NSLSENQSL  MPPW NLWLIG+M LSF LHFVIL VD+LS +FQ+TPL+  EW  VMK SIPV+++DET+KF++RK  D E  +   +G+ LMW
Sbjct:  871 THHLSCLGGGDEFKGVDCKIFSDPHAMTMALSVLVTIEMLNAMNSLSENQSLITMPPWCNLWLIGSMALSFTLHFVILYVDVLSTVFQVTPLSAEEWITVMKFSIPVVLLDETLKFVARKIADGESPIYKMHGIVLMW 1008          
BLAST of Calcium-transporting ATPase vs. UniProt/SwissProt
Match: sp|Q7PPA5|ATC1_ANOGA (Calcium-transporting ATPase sarcoplasmic/endoplasmic reticulum type OS=Anopheles gambiae OX=7165 GN=SERCA PE=3 SV=5)

HSP 1 Score: 183.341 bits (464), Expect = 1.348e-49
Identity = 82/138 (59.42%), Postives = 106/138 (76.81%), Query Frame = 1
Query:  586 THHMQCLAERDTFQGIQCGIFTNPKPMSLALSVLVTIEMLNAVNSLSENQSLFVMPPWTNLWLIGAMCLSFGLHFVILEVDILSKIFQITPLTLIEWSAVMKISIPVIVIDETMKFISRKNMDDEPLMQGAYGVFLMW 999
            THH+ CL   + F+GI C IF +P PM++ALSVLVTIEMLNA+NSLSENQSL  MPPW N+WLI +MCLSF LHFVIL VD+LS +FQ+TPL   EW  VMK S+PV+++DE +KF++R+  D E  ++  +G+ L W
Sbjct:  870 THHLSCLGGGEEFKGIDCKIFNDPHPMTMALSVLVTIEMLNAMNSLSENQSLVQMPPWCNIWLIASMCLSFALHFVILYVDVLSTVFQVTPLDGNEWMTVMKFSLPVVLLDEILKFVARRISDGESYIKNMHGLVLAW 1007          
BLAST of Calcium-transporting ATPase vs. UniProt/SwissProt
Match: sp|Q292Q0|ATC1_DROPS (Calcium-transporting ATPase sarcoplasmic/endoplasmic reticulum type OS=Drosophila pseudoobscura pseudoobscura OX=46245 GN=SERCA PE=3 SV=2)

HSP 1 Score: 181.8 bits (460), Expect = 3.739e-49
Identity = 82/123 (66.67%), Postives = 101/123 (82.11%), Query Frame = 1
Query:  586 THHMQCLAERDTFQGIQCGIFTNPKPMSLALSVLVTIEMLNAVNSLSENQSLFVMPPWTNLWLIGAMCLSFGLHFVILEVDILSKIFQITPLTLIEWSAVMKISIPVIVIDETMKFISRKNMD 954
            THH+ CL   D F+G+ C IF++PK M++ALSVLVTIEMLNA+NSLSENQSL  MPPW NLWLIG+M LSF LHFVIL VD+LS +FQ+TPL+  EW  VMK SIPV+++DET+KF++RK  D
Sbjct:  871 THHLSCLGGGDEFKGVDCKIFSDPKAMTMALSVLVTIEMLNAMNSLSENQSLISMPPWCNLWLIGSMALSFTLHFVILYVDVLSTVFQVTPLSAEEWITVMKFSIPVVLLDETLKFVARKIAD 993          
BLAST of Calcium-transporting ATPase vs. UniProt/SwissProt
Match: sp|P35316|ATC_ARTSF (Calcium-transporting ATPase sarcoplasmic/endoplasmic reticulum type OS=Artemia franciscana OX=6661 PE=2 SV=1)

HSP 1 Score: 180.644 bits (457), Expect = 8.551e-49
Identity = 81/124 (65.32%), Postives = 103/124 (83.06%), Query Frame = 1
Query:  586 THHMQCLAERDTFQGIQCGIFTNPKPMSLALSVLVTIEMLNAVNSLSENQSLFVMPPWTNLWLIGAMCLSFGLHFVILEVDILSKIFQITPLTLIEWSAVMKISIPVIVIDETMKFISRKNMDD 957
            +HH+QC  E + F+GI C IF++P PM++ALSVLVTIEMLNA+NSLSENQSL VMPPW+N+WLI A+CLS  LHFVIL V+ILS +FQI PLTL EW  V+KIS PV+++DE +KF++RK  D+
Sbjct:  875 SHHLQCTPENEYFEGIDCEIFSDPHPMTMALSVLVTIEMLNAINSLSENQSLLVMPPWSNIWLISAICLSMTLHFVILYVEILSTVFQICPLTLTEWIVVLKISFPVLLLDEVLKFVARKYTDE 998          
BLAST of Calcium-transporting ATPase vs. UniProt/SwissProt
Match: sp|Q00779|AT2A2_FELCA (Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 OS=Felis catus OX=9685 GN=ATP2A2 PE=2 SV=1)

HSP 1 Score: 159.844 bits (403), Expect = 1.286e-41
Identity = 72/123 (58.54%), Postives = 97/123 (78.86%), Query Frame = 1
Query:  586 THHMQCLAERDTFQGIQCGIFTNPKPMSLALSVLVTIEMLNAVNSLSENQSLFVMPPWTNLWLIGAMCLSFGLHFVILEVDILSKIFQITPLTLIEWSAVMKISIPVIVIDETMKFISRKNMD 954
            +H +QC  +   F+G+ C IF +P PM++ALSVLVTIEM NA+NSLSENQSL  MPPW N+WL+G++CLS  LHF+IL V+ L  IFQITPL L +W  V+KIS+PVI++DET+KF++R  ++
Sbjct:  870 SHFLQCKDDNPDFEGVDCAIFESPYPMTMALSVLVTIEMCNALNSLSENQSLLRMPPWENIWLVGSICLSMSLHFLILYVEPLPLIFQITPLNLTQWLMVLKISLPVILMDETLKFVARNYLE 992          
BLAST of Calcium-transporting ATPase vs. TrEMBL
Match: A0A210R2G3 (Calcium-transporting ATPase sarcoplasmic/endoplasmic reticulum type OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT00256 PE=4 SV=1)

HSP 1 Score: 184.111 bits (466), Expect = 6.087e-52
Identity = 88/125 (70.40%), Postives = 102/125 (81.60%), Query Frame = 1
Query:  586 THHMQCLAERDTFQGIQCGIFTNPKPMSLALSVLVTIEMLNAVNSLSENQSLFVMPPWTNLWLIGAMCLSFGLHFVILEVDILSKIFQITPLTLIEWSAVMKISIPVIVIDETMKFISRKNMDDE 960
            THHMQCLAE   F GI C IF  P+PM++ALSVLVTIEMLNA+NSLSENQSL VMPPW N WL+GAM LS GLHF IL +D++S IFQITPL   EW AV+KIS+PVI+IDET+KF +RK  DD+
Sbjct:  139 THHMQCLAEPKMFPGIDCKIFGAPEPMTMALSVLVTIEMLNALNSLSENQSLLVMPPWCNKWLLGAMALSMGLHFCILYIDVMSTIFQITPLGFEEWFAVLKISMPVILIDETLKFCARKFTDDK 263          
BLAST of Calcium-transporting ATPase vs. TrEMBL
Match: A0A194PE72 (Calcium-transporting ATPase sarcoplasmic/endoplasmic reticulum type OS=Papilio xuthus OX=66420 GN=RR46_15155 PE=4 SV=1)

HSP 1 Score: 180.644 bits (457), Expect = 6.569e-52
Identity = 85/143 (59.44%), Postives = 111/143 (77.62%), Query Frame = 1
Query:  586 THHMQCLAERDTFQGIQCGIFTNPKPMSLALSVLVTIEMLNAVNSLSENQSLFVMPPWTNLWLIGAMCLSFGLHFVILEVDILSKIFQITPLTLIEWSAVMKISIPVIVIDETMKFISRKNMDD-----EPLMQGAYGVFLMW 999
            THH+QCL+  D F+GI C IFT+P PM++ALSVLVTIEMLNA+NSLSENQSL  MPPW+N+WL+G+M LSF LHFVIL V++LS +FQ+TPL++ EW  VMK SIPV+++DE +KF++RK  D      +  + G   + LMW
Sbjct:   15 THHLQCLSGGDEFKGIDCKIFTDPHPMTMALSVLVTIEMLNAMNSLSENQSLVTMPPWSNMWLVGSMALSFTLHFVILYVEVLSAVFQVTPLSVDEWVTVMKFSIPVVLLDEVLKFVARKISDGNASSLQHWLDGMQWIVLMW 157          
BLAST of Calcium-transporting ATPase vs. TrEMBL
Match: A1DU39 (Sarcoplasmic/endoplasmic reticulum Ca2+-transporting ATPase (Fragment) OS=Artemia franciscana OX=6661 PE=2 SV=1)

HSP 1 Score: 178.333 bits (451), Expect = 2.115e-51
Identity = 81/123 (65.85%), Postives = 102/123 (82.93%), Query Frame = 1
Query:  586 THHMQCLAERDTFQGIQCGIFTNPKPMSLALSVLVTIEMLNAVNSLSENQSLFVMPPWTNLWLIGAMCLSFGLHFVILEVDILSKIFQITPLTLIEWSAVMKISIPVIVIDETMKFISRKNMD 954
            +HH+QC  E + F+GI C IF++P PM++ALSVLVTIEMLNA+NSLSENQSL VMPPW+N+WLI A+CLS  LHFVIL V+ILS +FQI PLTL EW  V+KIS PV+++DE +KF++RK  D
Sbjct:   10 SHHLQCTPENEYFEGIDCEIFSDPHPMTMALSVLVTIEMLNAINSLSENQSLLVMPPWSNIWLISAICLSMTLHFVILYVEILSTVFQICPLTLTEWIVVLKISFPVLLLDEVLKFVARKYTD 132          
BLAST of Calcium-transporting ATPase vs. TrEMBL
Match: A0A0B7AD87 (Cation_ATPase_C domain-containing protein (Fragment) OS=Arion vulgaris OX=1028688 GN=ORF112704 PE=4 SV=1)

HSP 1 Score: 179.104 bits (453), Expect = 2.258e-51
Identity = 86/123 (69.92%), Postives = 101/123 (82.11%), Query Frame = 1
Query:  586 THHMQCLAERDTFQGIQCGIFTNPKPMSLALSVLVTIEMLNAVNSLSENQSLFVMPPWTNLWLIGAMCLSFGLHFVILEVDILSKIFQITPLTLIEWSAVMKISIPVIVIDETMKFISRKNMD 954
            THHMQC AE   F+G+ C IF  P+PMS+ALSVLVTIEMLNA+NSLSENQSL VMPPWTN WL+GA+ LS  LHF IL VDI+S +FQITPL L EW AV+KIS PVI++DET+KF++RK  D
Sbjct:   32 THHMQCPAEPRMFKGVDCSIFQAPEPMSMALSVLVTIEMLNALNSLSENQSLIVMPPWTNKWLLGAIALSMVLHFFILYVDIMSVVFQITPLNLEEWIAVIKISFPVIILDETLKFVARKFAD 154          
BLAST of Calcium-transporting ATPase vs. TrEMBL
Match: A0A1J1HKW7 (Calcium-transporting ATPase OS=Clunio marinus OX=568069 GN=endoplasmic reticulum type PE=3 SV=1)

HSP 1 Score: 194.126 bits (492), Expect = 5.808e-51
Identity = 85/138 (61.59%), Postives = 111/138 (80.43%), Query Frame = 1
Query:  586 THHMQCLAERDTFQGIQCGIFTNPKPMSLALSVLVTIEMLNAVNSLSENQSLFVMPPWTNLWLIGAMCLSFGLHFVILEVDILSKIFQITPLTLIEWSAVMKISIPVIVIDETMKFISRKNMDDEPLMQGAYGVFLMW 999
            +HHMQCL   D F+G+ C +F +P PM++ALSVLVTIEMLNA+NSLSENQSL  MPPWTN+WL+G+MCLSF LHFVIL V++LS +FQ+TPL + EW  VMK SIPVI++DET+KF++R+  D E  ++  +G+ L W
Sbjct:  817 SHHMQCLGGGDDFKGVDCKVFLDPHPMTMALSVLVTIEMLNAMNSLSENQSLVAMPPWTNMWLVGSMCLSFALHFVILYVEVLSGVFQVTPLGVDEWVTVMKFSIPVILLDETLKFVARRISDGESFIKTIHGLVLAW 954          
BLAST of Calcium-transporting ATPase vs. Ensembl Cavefish
Match: ENSAMXT00000010500.2 (pep primary_assembly:Astyanax_mexicanus-2.0:6:36296634:36328247:1 gene:ENSAMXG00000010004.2 transcript:ENSAMXT00000010500.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 157.532 bits (397), Expect = 9.194e-42
Identity = 77/141 (54.61%), Postives = 104/141 (73.76%), Query Frame = 1
Query:  586 THHMQCLAERDTFQGIQCGIFTNPKPMSLALSVLVTIEMLNAVNSLSENQSLFVMPPWTNLWLIGAMCLSFGLHFVILEVDILSKIFQITPLTLIEWSAVMKISIPVIVIDETMKFISR------KNMDDEPLM-QGAYGV 987
            +H +QC  +   FQ ++C +F +P PM++ALSVLVTIEM NA+NSLSENQSL  MPPW N+WL+GA+CLS  LHF+IL V+ L  IFQITPL + +W  V+KIS+PVI++DE +KF++R      K+++ EP    GA GV
Sbjct:  863 SHFLQCSPDNPDFQDLECHVFESPYPMTMALSVLVTIEMCNALNSLSENQSLLRMPPWENVWLLGAICLSMSLHFLILYVEPLPVIFQITPLNVTQWLMVLKISLPVILLDELLKFVARNYLEPGKDLEAEPRRGGGAQGV 1003          
BLAST of Calcium-transporting ATPase vs. Ensembl Cavefish
Match: si:dkey-28b4.8 (sarcoplasmic/endoplasmic reticulum calcium ATPase 2-like [Source:NCBI gene;Acc:103021660])

HSP 1 Score: 155.606 bits (392), Expect = 4.735e-41
Identity = 70/123 (56.91%), Postives = 95/123 (77.24%), Query Frame = 1
Query:  586 THHMQCLAERDTFQGIQCGIFTNPKPMSLALSVLVTIEMLNAVNSLSENQSLFVMPPWTNLWLIGAMCLSFGLHFVILEVDILSKIFQITPLTLIEWSAVMKISIPVIVIDETMKFISRKNMD 954
            +H++QC      F G+QC +F +P PM++ALSVLVTIEM NA+NSLSENQSL  MPPW+N WL+GA+CLS  LHF+IL VD L  IFQI PL+  +W  V+K+S+PVI++DE +KF++R  ++
Sbjct:  868 SHYLQCSEGHADFAGVQCSVFESPYPMTMALSVLVTIEMCNALNSLSENQSLLKMPPWSNPWLVGAICLSMALHFLILYVDPLPVIFQIRPLSWPQWVTVLKMSLPVILMDEALKFLARNYIE 990          
BLAST of Calcium-transporting ATPase vs. Ensembl Cavefish
Match: si:dkey-28b4.8 (sarcoplasmic/endoplasmic reticulum calcium ATPase 2-like [Source:NCBI gene;Acc:103021660])

HSP 1 Score: 155.606 bits (392), Expect = 4.846e-41
Identity = 70/123 (56.91%), Postives = 95/123 (77.24%), Query Frame = 1
Query:  586 THHMQCLAERDTFQGIQCGIFTNPKPMSLALSVLVTIEMLNAVNSLSENQSLFVMPPWTNLWLIGAMCLSFGLHFVILEVDILSKIFQITPLTLIEWSAVMKISIPVIVIDETMKFISRKNMD 954
            +H++QC      F G+QC +F +P PM++ALSVLVTIEM NA+NSLSENQSL  MPPW+N WL+GA+CLS  LHF+IL VD L  IFQI PL+  +W  V+K+S+PVI++DE +KF++R  ++
Sbjct:  878 SHYLQCSEGHADFAGVQCSVFESPYPMTMALSVLVTIEMCNALNSLSENQSLLKMPPWSNPWLVGAICLSMALHFLILYVDPLPVIFQIRPLSWPQWVTVLKMSLPVILMDEALKFLARNYIE 1000          
BLAST of Calcium-transporting ATPase vs. Ensembl Cavefish
Match: atp2a1 (sarcoplasmic/endoplasmic reticulum calcium ATPase 1-like [Source:NCBI gene;Acc:103045170])

HSP 1 Score: 154.836 bits (390), Expect = 9.048e-41
Identity = 75/130 (57.69%), Postives = 100/130 (76.92%), Query Frame = 1
Query:  586 THHMQCLAERDTFQGIQCGIFTNPKPMSLALSVLVTIEMLNAVNSLSENQSLFVMPPWTNLWLIGAMCLSFGLHFVILEVDILSKIFQITPLTLIEWSAVMKISIPVIVIDETMKFISRKNMD--DEPLM 969
            +H MQC AE + F+GI+C +F +  PM++ALSVLVTIEM NA+NSLSENQSL  MPPW+NLWL+ AM LS  LHF+I+ VD L  IF++T LTL +W  V+K+S PVI+IDE +KF++R  ++  DE L+
Sbjct:  871 SHFMQCSAENEDFEGIECEVFESAPPMTMALSVLVTIEMCNALNSLSENQSLVRMPPWSNLWLVAAMSLSMSLHFMIIYVDPLPMIFKLTHLTLEQWLVVLKLSFPVILIDELLKFVARNYLEQKDENLV 1000          
BLAST of Calcium-transporting ATPase vs. Ensembl Cavefish
Match: ENSAMXT00000016753.2 (sarcoplasmic/endoplasmic reticulum calcium ATPase 2 [Source:NCBI gene;Acc:103040450])

HSP 1 Score: 154.451 bits (389), Expect = 1.029e-40
Identity = 73/135 (54.07%), Postives = 99/135 (73.33%), Query Frame = 1
Query:  586 THHMQCLAERDTFQGIQCGIFTNPKPMSLALSVLVTIEMLNAVNSLSENQSLFVMPPWTNLWLIGAMCLSFGLHFVILEVDILSKIFQITPLTLIEWSAVMKISIPVIVIDETMKFISRKNMD-----DEPLMQG 975
            +H +QC  +   ++G+ C IF +P PM++ALSVLVTIEM NA+NS+SENQSL  MPPW N+WL+GA+CLS  LHF+IL V+ L  IFQITPL L +W  V+KIS+PVI++DE +KF +R  ++     D P  +G
Sbjct:  863 SHFLQCGPDNPEYKGVNCEIFESPYPMTMALSVLVTIEMCNALNSVSENQSLLRMPPWENVWLLGAICLSMSLHFLILYVEPLPMIFQITPLNLTQWLMVLKISLPVILLDEVLKFAARNYLEPGKELDTPEHKG 997          
BLAST of Calcium-transporting ATPase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010373.1 (pep scaffold:Pmarinus_7.0:GL481096:3909:20014:1 gene:ENSPMAG00000009373.1 transcript:ENSPMAT00000010373.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 162.925 bits (411), Expect = 2.608e-44
Identity = 76/127 (59.84%), Postives = 99/127 (77.95%), Query Frame = 1
Query:  586 THHMQCLAERDTFQGIQCGIFTNPKPMSLALSVLVTIEMLNAVNSLSENQSLFVMPPWTNLWLIGAMCLSFGLHFVILEVDILSKIFQITPLTLIEWSAVMKISIPVIVIDETMKFISRKNMDDEPL 966
            +H MQC  E   F+G+ C +F +P PM++ALSVLVTIEM NA+NSLSENQSL  MPPW N+WL+GA+CLS  LHF+IL V+ L  IFQITPL L +W  V+KIS+PVI++DET+KFI+R  ++ + L
Sbjct:  718 SHFMQCTPEHPDFEGLDCHVFESPYPMTMALSVLVTIEMCNALNSLSENQSLLRMPPWDNIWLLGAICLSMSLHFLILYVEPLPIIFQITPLNLEQWLVVLKISLPVILLDETLKFIARNYLEGKEL 844          
BLAST of Calcium-transporting ATPase vs. Ensembl Nematostella
Match: EDO47465 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RM93])

HSP 1 Score: 135.961 bits (341), Expect = 8.681e-35
Identity = 67/119 (56.30%), Postives = 86/119 (72.27%), Query Frame = 1
Query:  586 THHMQCLAERDTFQGIQCGIFTNPKPMSLALSVLVTIEMLNAVNSLSENQSLFVMPPWTNLWLIGAMCLSFGLHFVILEVDILSKIFQITPLTLIEWSAVMKISIPVIVIDETMKFISR 942
            THHMQC    D   G+ C +F +  PM++ALSVLVTIEM NA+NSL+EN+SL  MPPW N  L+ A+  SF +HF+IL   I + IF+ITPL  +EW AV+K S PVI++DE +KFISR
Sbjct:  874 THHMQCGT--DPSFGLDCAVFGDLHPMTMALSVLVTIEMFNALNSLAENESLLTMPPWRNPSLLTAIAASFLMHFLILYFPITNTIFRITPLNWVEWMAVLKFSFPVILLDEVLKFISR 990          
BLAST of Calcium-transporting ATPase vs. Ensembl Medaka
Match: si:dkey-28b4.8 (sarcoplasmic/endoplasmic reticulum calcium ATPase 2-like [Source:NCBI gene;Acc:101159722])

HSP 1 Score: 159.458 bits (402), Expect = 2.267e-42
Identity = 75/140 (53.57%), Postives = 102/140 (72.86%), Query Frame = 1
Query:  586 THHMQCLAERDTFQGIQCGIFTNPKPMSLALSVLVTIEMLNAVNSLSENQSLFVMPPWTNLWLIGAMCLSFGLHFVILEVDILSKIFQITPLTLIEWSAVMKISIPVIVIDETMKFISRKNMDDEPLMQ--GAYGVFLMW 999
            +H++QC      F G+QC +F +P PM++ALSVLVTIEM NA+NSLSENQSL  MPPW N WL+GA+CLS  LHF+IL VD L  +FQI PL+  +W  V+K+S+PVI++DE +KF++R  ++    MQ  GA  VF ++
Sbjct:  871 SHYLQCSEGHAEFAGVQCSVFESPYPMTMALSVLVTIEMCNALNSLSENQSLLKMPPWANPWLVGAICLSMALHFLILYVDPLPVVFQIRPLSWTQWVVVLKLSLPVILMDEALKFLARNYIEPGSQMQVGGASSVFRLF 1010          
BLAST of Calcium-transporting ATPase vs. Ensembl Medaka
Match: ENSORLT00000019901.2 (sarcoplasmic/endoplasmic reticulum calcium ATPase 2 [Source:NCBI gene;Acc:101160819])

HSP 1 Score: 158.303 bits (399), Expect = 5.211e-42
Identity = 71/119 (59.66%), Postives = 95/119 (79.83%), Query Frame = 1
Query:  586 THHMQCLAERDTFQGIQCGIFTNPKPMSLALSVLVTIEMLNAVNSLSENQSLFVMPPWTNLWLIGAMCLSFGLHFVILEVDILSKIFQITPLTLIEWSAVMKISIPVIVIDETMKFISR 942
            +H++QC  E   F+G+ C +F +P PM++ALSVLVTIEM NA+NSLSENQSL  MPPW N+WL+GA+CLS  LHF+IL V+ L  IFQITPL + +W  V+KIS+PVI++DE +KF++R
Sbjct:  869 SHYLQCSPENPEFEGLDCQVFESPYPMTMALSVLVTIEMCNALNSLSENQSLLRMPPWENIWLLGAICLSMSLHFLILYVEPLPVIFQITPLDMTQWMMVLKISLPVILLDELLKFVAR 987          
BLAST of Calcium-transporting ATPase vs. Ensembl Medaka
Match: ENSORLT00000019902.2 (sarcoplasmic/endoplasmic reticulum calcium ATPase 2 [Source:NCBI gene;Acc:101160819])

HSP 1 Score: 158.303 bits (399), Expect = 5.858e-42
Identity = 71/119 (59.66%), Postives = 95/119 (79.83%), Query Frame = 1
Query:  586 THHMQCLAERDTFQGIQCGIFTNPKPMSLALSVLVTIEMLNAVNSLSENQSLFVMPPWTNLWLIGAMCLSFGLHFVILEVDILSKIFQITPLTLIEWSAVMKISIPVIVIDETMKFISR 942
            +H++QC  E   F+G+ C +F +P PM++ALSVLVTIEM NA+NSLSENQSL  MPPW N+WL+GA+CLS  LHF+IL V+ L  IFQITPL + +W  V+KIS+PVI++DE +KF++R
Sbjct:  845 SHYLQCSPENPEFEGLDCQVFESPYPMTMALSVLVTIEMCNALNSLSENQSLLRMPPWENIWLLGAICLSMSLHFLILYVEPLPVIFQITPLDMTQWMMVLKISLPVILLDELLKFVAR 963          
BLAST of Calcium-transporting ATPase vs. Ensembl Medaka
Match: si:dkey-28b4.8 (sarcoplasmic/endoplasmic reticulum calcium ATPase 2-like [Source:NCBI gene;Acc:101159722])

HSP 1 Score: 157.147 bits (396), Expect = 1.279e-41
Identity = 71/129 (55.04%), Postives = 96/129 (74.42%), Query Frame = 1
Query:  586 THHMQCLAERDTFQGIQCGIFTNPKPMSLALSVLVTIEMLNAVNSLSENQSLFVMPPWTNLWLIGAMCLSFGLHFVILEVDILSKIFQITPLTLIEWSAVMKISIPVIVIDETMKFISRKNMDDEPLMQ 972
            +H++QC      F G+QC +F +P PM++ALSVLVTIEM NA+NSLSENQSL  MPPW N WL+GA+CLS  LHF+IL VD L  +FQI PL+  +W  V+K+S+PVI++DE +KF++R  ++    MQ
Sbjct:  877 SHYLQCSEGHAEFAGVQCSVFESPYPMTMALSVLVTIEMCNALNSLSENQSLLKMPPWANPWLVGAICLSMALHFLILYVDPLPVVFQIRPLSWTQWVVVLKLSLPVILMDEALKFLARNYIEPGSQMQ 1005          
BLAST of Calcium-transporting ATPase vs. Ensembl Medaka
Match: atp2a1 (ATPase sarcoplasmic/endoplasmic reticulum Ca2+ transporting 1 [Source:NCBI gene;Acc:101160483])

HSP 1 Score: 150.599 bits (379), Expect = 2.118e-39
Identity = 71/125 (56.80%), Postives = 95/125 (76.00%), Query Frame = 1
Query:  586 THHMQCLAERDTFQGIQCGIFTNPKPMSLALSVLVTIEMLNAVNSLSENQSLFVMPPWTNLWLIGAMCLSFGLHFVILEVDILSKIFQITPLTLIEWSAVMKISIPVIVIDETMKFISRKNMDDE 960
            +H MQC  + + F GI+C +F +  PM++ALSVLVTIEM NA+NSLSENQSL  MPPW+NLWL+GAM LS  LHF+I+ VD L  IF++T L L +W  V+K+S PVI+IDE +KF++R  ++ E
Sbjct:  865 SHFMQCSEDNEDFDGIRCEVFESAPPMTMALSVLVTIEMCNALNSLSENQSLVRMPPWSNLWLMGAMSLSMSLHFMIIYVDPLPMIFKLTHLNLEQWLMVLKLSFPVILIDELLKFVARTYLEGE 989          
BLAST of Calcium-transporting ATPase vs. Planmine SMEST
Match: SMESG000039058.1 (SMESG000039058.1)

HSP 1 Score: 291.582 bits (745), Expect = 1.357e-89
Identity = 138/138 (100.00%), Postives = 138/138 (100.00%), Query Frame = 1
Query:  586 THHMQCLAERDTFQGIQCGIFTNPKPMSLALSVLVTIEMLNAVNSLSENQSLFVMPPWTNLWLIGAMCLSFGLHFVILEVDILSKIFQITPLTLIEWSAVMKISIPVIVIDETMKFISRKNMDDEPLMQGAYGVFLMW 999
            THHMQCLAERDTFQGIQCGIFTNPKPMSLALSVLVTIEMLNAVNSLSENQSLFVMPPWTNLWLIGAMCLSFGLHFVILEVDILSKIFQITPLTLIEWSAVMKISIPVIVIDETMKFISRKNMDDEPLMQGAYGVFLMW
Sbjct:  871 THHMQCLAERDTFQGIQCGIFTNPKPMSLALSVLVTIEMLNAVNSLSENQSLFVMPPWTNLWLIGAMCLSFGLHFVILEVDILSKIFQITPLTLIEWSAVMKISIPVIVIDETMKFISRKNMDDEPLMQGAYGVFLMW 1008          
BLAST of Calcium-transporting ATPase vs. Planmine SMEST
Match: SMESG000039058.1 (SMESG000039058.1)

HSP 1 Score: 272.322 bits (695), Expect = 1.793e-82
Identity = 137/170 (80.59%), Postives = 137/170 (80.59%), Query Frame = 1
Query:  586 THHMQCLAERDTFQGIQCGIFTNPKPMSLALS--------------------------------VLVTIEMLNAVNSLSENQSLFVMPPWTNLWLIGAMCLSFGLHFVILEVDILSKIFQITPLTLIEWSAVMKISIPVIVIDETMKFISRKNMDDEPLMQGAYGVFLMW 999
            THHMQCLAERDTFQGIQCGIFTNPKPMSLALS                                VLV IEMLNAVNSLSENQSLFVMPPWTNLWLIGAMCLSFGLHFVILEVDILSKIFQITPLTLIEWSAVMKISIPVIVIDETMKFISRKNMDDEPLMQGAYGVFLMW
Sbjct:  868 THHMQCLAERDTFQGIQCGIFTNPKPMSLALSTHQAQCLAQEELFDRMDCAIFMHPKPMSMALSVLVVIEMLNAVNSLSENQSLFVMPPWTNLWLIGAMCLSFGLHFVILEVDILSKIFQITPLTLIEWSAVMKISIPVIVIDETMKFISRKNMDDEPLMQGAYGVFLMW 1037          
BLAST of Calcium-transporting ATPase vs. Planmine SMEST
Match: SMESG000039058.1 (SMESG000039058.1)

HSP 1 Score: 258.84 bits (660), Expect = 1.255e-77
Identity = 123/138 (89.13%), Postives = 128/138 (92.75%), Query Frame = 1
Query:  586 THHMQCLAERDTFQGIQCGIFTNPKPMSLALSVLVTIEMLNAVNSLSENQSLFVMPPWTNLWLIGAMCLSFGLHFVILEVDILSKIFQITPLTLIEWSAVMKISIPVIVIDETMKFISRKNMDDEPLMQGAYGVFLMW 999
            TH  QCLA+ + F  + C IF +PKPMS+ALSVLV IEMLNAVNSLSENQSLFVMPPWTNLWLIGAMCLSFGLHFVILEVDILSKIFQITPLTLIEWSAVMKISIPVIVIDETMKFISRKNMDDEPLMQGAYGVFLMW
Sbjct:  871 THQAQCLAQEELFDRMDCAIFMHPKPMSMALSVLVVIEMLNAVNSLSENQSLFVMPPWTNLWLIGAMCLSFGLHFVILEVDILSKIFQITPLTLIEWSAVMKISIPVIVIDETMKFISRKNMDDEPLMQGAYGVFLMW 1008          
BLAST of Calcium-transporting ATPase vs. Planmine SMEST
Match: SMESG000039058.1 (SMESG000039058.1)

HSP 1 Score: 258.84 bits (660), Expect = 1.282e-77
Identity = 123/138 (89.13%), Postives = 128/138 (92.75%), Query Frame = 1
Query:  586 THHMQCLAERDTFQGIQCGIFTNPKPMSLALSVLVTIEMLNAVNSLSENQSLFVMPPWTNLWLIGAMCLSFGLHFVILEVDILSKIFQITPLTLIEWSAVMKISIPVIVIDETMKFISRKNMDDEPLMQGAYGVFLMW 999
            TH  QCLA+ + F  + C IF +PKPMS+ALSVLV IEMLNAVNSLSENQSLFVMPPWTNLWLIGAMCLSFGLHFVILEVDILSKIFQITPLTLIEWSAVMKISIPVIVIDETMKFISRKNMDDEPLMQGAYGVFLMW
Sbjct:  868 THQAQCLAQEELFDRMDCAIFMHPKPMSMALSVLVVIEMLNAVNSLSENQSLFVMPPWTNLWLIGAMCLSFGLHFVILEVDILSKIFQITPLTLIEWSAVMKISIPVIVIDETMKFISRKNMDDEPLMQGAYGVFLMW 1005          
BLAST of Calcium-transporting ATPase vs. Planmine SMEST
Match: SMESG000050554.1 (SMESG000050554.1)

HSP 1 Score: 187.578 bits (475), Expect = 3.155e-52
Identity = 87/123 (70.73%), Postives = 103/123 (83.74%), Query Frame = 1
Query:  586 THHMQCLAERDTFQGIQCGIFTNPKPMSLALSVLVTIEMLNAVNSLSENQSLFVMPPWTNLWLIGAMCLSFGLHFVILEVDILSKIFQITPLTLIEWSAVMKISIPVIVIDETMKFISRKNMD 954
            THHMQCLAE ++F GI C IF NPKPM++ALSVLV IEMLNA+NSLSENQSL  MPPW NLWL+G+M LS  LHF+ILEVD LSK+FQITPL++ EW AV+KIS PVI++DE +K I+RK  D
Sbjct:  867 THHMQCLAETESFNGIDCKIFQNPKPMTMALSVLVLIEMLNAMNSLSENQSLLKMPPWVNLWLVGSMVLSMSLHFLILEVDFLSKVFQITPLSVEEWFAVVKISFPVILLDEVLKLIARKFTD 989          
The following BLAST results are available for this feature:
BLAST of Calcium-transporting ATPase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ATP2A26.411e-4257.72ATPase sarcoplasmic/endoplasmic reticulum Ca2+ tra... [more]
ATP2A27.059e-4257.72ATPase sarcoplasmic/endoplasmic reticulum Ca2+ tra... [more]
ATP2A27.584e-4257.72ATPase sarcoplasmic/endoplasmic reticulum Ca2+ tra... [more]
ATP2A17.558e-4157.26ATPase sarcoplasmic/endoplasmic reticulum Ca2+ tra... [more]
ATP2A14.872e-4056.91ATPase sarcoplasmic/endoplasmic reticulum Ca2+ tra... [more]
back to top
BLAST of Calcium-transporting ATPase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sca-19.924e-4559.54Calcium-transporting ATPase [Source:UniProtKB/TrE... [more]
sca-11.086e-4459.54Calcium-transporting ATPase [Source:UniProtKB/TrE... [more]
sca-13.252e-4360.80Calcium-transporting ATPase [Source:UniProtKB/TrE... [more]
sca-13.252e-4360.80Calcium-transporting ATPase [Source:UniProtKB/TrE... [more]
sca-13.252e-4360.80Calcium-transporting ATPase [Source:UniProtKB/TrE... [more]
back to top
BLAST of Calcium-transporting ATPase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SERCA1.515e-5262.32gene:FBgn0263006 transcript:FBtr0072216[more]
SERCA1.515e-5262.32gene:FBgn0263006 transcript:FBtr0072211[more]
SERCA1.515e-5262.32gene:FBgn0263006 transcript:FBtr0072214[more]
SERCA1.515e-5262.32gene:FBgn0263006 transcript:FBtr0072212[more]
SERCA1.515e-5262.32gene:FBgn0263006 transcript:FBtr0072217[more]
back to top
BLAST of Calcium-transporting ATPase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
atp2a2b9.449e-4258.54ATPase sarcoplasmic/endoplasmic reticulum Ca2+ tra... [more]
atp2a2b1.039e-4158.54ATPase sarcoplasmic/endoplasmic reticulum Ca2+ tra... [more]
atp2a2b1.086e-4158.54ATPase sarcoplasmic/endoplasmic reticulum Ca2+ tra... [more]
atp2a2a4.319e-4156.35ATPase sarcoplasmic/endoplasmic reticulum Ca2+ tra... [more]
si:dkey-28b4.86.262e-4156.91si:dkey-28b4.8 [Source:ZFIN;Acc:ZDB-GENE-090501-2][more]
back to top
BLAST of Calcium-transporting ATPase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ATP2A21.748e-4359.06ATPase, Ca++ transporting, cardiac muscle, slow tw... [more]
ATP2A24.273e-4359.20ATPase, Ca++ transporting, cardiac muscle, slow tw... [more]
ATP2A24.704e-4359.20ATPase, Ca++ transporting, cardiac muscle, slow tw... [more]
ATP2A29.637e-4359.35ATPase, Ca++ transporting, cardiac muscle, slow tw... [more]
ATP2A21.134e-4259.35ATPase, Ca++ transporting, cardiac muscle, slow tw... [more]
back to top
BLAST of Calcium-transporting ATPase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Atp2a13.762e-4456.45ATPase, Ca++ transporting, cardiac muscle, fast tw... [more]
Atp2a21.771e-4255.81ATPase, Ca++ transporting, cardiac muscle, slow tw... [more]
Atp2a23.812e-4258.54ATPase, Ca++ transporting, cardiac muscle, slow tw... [more]
Atp2a23.812e-4258.54ATPase, Ca++ transporting, cardiac muscle, slow tw... [more]
Atp2a16.753e-3956.10ATPase, Ca++ transporting, cardiac muscle, fast tw... [more]
back to top
BLAST of Calcium-transporting ATPase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P22700|ATC1_DROME1.518e-5162.32Calcium-transporting ATPase sarcoplasmic/endoplasm... [more]
sp|Q7PPA5|ATC1_ANOGA1.348e-4959.42Calcium-transporting ATPase sarcoplasmic/endoplasm... [more]
sp|Q292Q0|ATC1_DROPS3.739e-4966.67Calcium-transporting ATPase sarcoplasmic/endoplasm... [more]
sp|P35316|ATC_ARTSF8.551e-4965.32Calcium-transporting ATPase sarcoplasmic/endoplasm... [more]
sp|Q00779|AT2A2_FELCA1.286e-4158.54Sarcoplasmic/endoplasmic reticulum calcium ATPase ... [more]
back to top
BLAST of Calcium-transporting ATPase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A210R2G36.087e-5270.40Calcium-transporting ATPase sarcoplasmic/endoplasm... [more]
A0A194PE726.569e-5259.44Calcium-transporting ATPase sarcoplasmic/endoplasm... [more]
A1DU392.115e-5165.85Sarcoplasmic/endoplasmic reticulum Ca2+-transporti... [more]
A0A0B7AD872.258e-5169.92Cation_ATPase_C domain-containing protein (Fragmen... [more]
A0A1J1HKW75.808e-5161.59Calcium-transporting ATPase OS=Clunio marinus OX=5... [more]
back to top
BLAST of Calcium-transporting ATPase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000010500.29.194e-4254.61pep primary_assembly:Astyanax_mexicanus-2.0:6:3629... [more]
si:dkey-28b4.84.735e-4156.91sarcoplasmic/endoplasmic reticulum calcium ATPase ... [more]
si:dkey-28b4.84.846e-4156.91sarcoplasmic/endoplasmic reticulum calcium ATPase ... [more]
atp2a19.048e-4157.69sarcoplasmic/endoplasmic reticulum calcium ATPase ... [more]
ENSAMXT00000016753.21.029e-4054.07sarcoplasmic/endoplasmic reticulum calcium ATPase ... [more]
back to top
BLAST of Calcium-transporting ATPase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000010373.12.608e-4459.84pep scaffold:Pmarinus_7.0:GL481096:3909:20014:1 ge... [more]
back to top
BLAST of Calcium-transporting ATPase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Calcium-transporting ATPase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO474658.681e-3556.30Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Calcium-transporting ATPase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:dkey-28b4.82.267e-4253.57sarcoplasmic/endoplasmic reticulum calcium ATPase ... [more]
ENSORLT00000019901.25.211e-4259.66sarcoplasmic/endoplasmic reticulum calcium ATPase ... [more]
ENSORLT00000019902.25.858e-4259.66sarcoplasmic/endoplasmic reticulum calcium ATPase ... [more]
si:dkey-28b4.81.279e-4155.04sarcoplasmic/endoplasmic reticulum calcium ATPase ... [more]
atp2a12.118e-3956.80ATPase sarcoplasmic/endoplasmic reticulum Ca2+ tra... [more]
back to top
BLAST of Calcium-transporting ATPase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000039058.11.357e-89100.00SMESG000039058.1[more]
SMESG000039058.11.793e-8280.59SMESG000039058.1[more]
SMESG000039058.11.255e-7789.13SMESG000039058.1[more]
SMESG000039058.11.282e-7789.13SMESG000039058.1[more]
SMESG000050554.13.155e-5270.73SMESG000050554.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30009618 ID=SMED30009618|Name=Calcium-transporting ATPase|organism=Schmidtea mediterranea sexual|type=transcript|length=1172bp
CTTTTGTACTCTCGAAGCATTTGATTATTGAAAACAATACATTTATAAAT
GCTGGGATTATTTTTTACGATAAATTATCAACAAACGTTCCGTTGTGAAA
TTCAGAAATAATTTCTTTTCGAAAAATCGTTAGTTAGGATAATTGTAAAG
AAGCATTAAATAGCAAGCTACCTCACAAAAAAATTATTCAATTTTCGATA
TTTTTTCAAAAAATATCGCCAAGGTTTTCAAATTTGTGCACGTGTGCAAG
GCAATAATTTCACAGACAAAATTCAATCAAAGTACATTTTAAGGATCACT
TTTGGGCGGAAACCTCTGACATCGACTTAGTTGTGCTTCGACAAATTCCG
GAGTAGATTTAAGCAAGCTCGAGTAAAACGTAACGTTTCCAATTTCATTC
TATGAATTTATTAAATTAGTATTTGTATTATTGATTTTTTAACTATAATT
TATTTTATATGCGGTCTGTAGAAAAATTAAATTTAAGTAGACTTGATATA
AATTATGGTTTTTCCGACTTTGTTCGATAAATGAGGACTAAAATTTCTTA
AATTTTTGATGTATATTAGCAAACGTTTAATTTAGACCCATCACATGCAG
TGCTTAGCCGAACGGGATACTTTTCAAGGTATTCAATGTGGCATTTTTAC
GAATCCTAAACCAATGTCGTTGGCATTGTCTGTATTAGTAACCATAGAAA
TGCTTAATGCTGTCAACAGTTTATCGGAAAACCAATCGCTTTTTGTCATG
CCTCCGTGGACCAATTTATGGCTCATAGGTGCAATGTGCTTGAGTTTTGG
ACTTCATTTCGTGATTTTAGAAGTGGACATTTTATCAAAAATTTTTCAAA
TTACTCCCTTGACCTTGATTGAGTGGTCAGCAGTGATGAAGATCTCGATC
CCAGTTATTGTGATAGATGAAACAATGAAGTTCATATCCCGCAAAAATAT
GGATGACGAACCTTTGATGCAGGGTGCTTATGGCGTATTTCTCATGTGGG
CGGCTTATTTTGCTTTGTTATTTCTGTGTCCATAATTTTGAGCATGACAT
TAGGCATGTGAAAAATCAGAAATAAATCTTAATTAATTTTTTATTACAAT
TCTGACAGCTCATGTGATCTAGGATTAATAAATGACTTTAGAAATACTTT
TGTTTAAGTCTTACCAATTCAG
back to top

protein sequence of SMED30009618-orf-1

>SMED30009618-orf-1 ID=SMED30009618-orf-1|Name=SMED30009618-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=147bp
MQCLAERDTFQGIQCGIFTNPKPMSLALSVLVTIEMLNAVNSLSENQSLF
VMPPWTNLWLIGAMCLSFGLHFVILEVDILSKIFQITPLTLIEWSAVMKI
SIPVIVIDETMKFISRKNMDDEPLMQGAYGVFLMWAAYFALLFLCP*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000101muscle cell
PLANA:0000418head
PLANA:0000420parapharyngeal region
Vocabulary: INTERPRO
TermDefinition
IPR030332SERCA1/2
IPR023298ATPase_P-typ_TM_dom_sf
IPR006068ATPase_P-typ_cation-transptr_C
Vocabulary: molecular function
TermDefinition
GO:0000166nucleotide binding
GO:0005388calcium-transporting ATPase activity
GO:0005524ATP binding
GO:0016787hydrolase activity
GO:0046872metal ion binding
Vocabulary: cellular component
TermDefinition
GO:0005783endoplasmic reticulum
GO:0016020membrane
GO:0016021integral component of membrane
GO:0033017sarcoplasmic reticulum membrane
Vocabulary: biological process
TermDefinition
GO:0006810transport
GO:0006811ion transport
GO:0006816calcium ion transport
GO:0070588calcium ion transmembrane transport
GO:0099132ATP hydrolysis coupled cation transmembrane transport
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:1.20.1110.10coord: 1..116
e-value: 4.0E-45
score: 156.1
NoneNo IPR availablePANTHERPTHR42861FAMILY NOT NAMEDcoord: 7..121
NoneNo IPR availableTMHMMTMhelixcoord: 85..107
NoneNo IPR availableTMHMMTMhelixcoord: 127..144
NoneNo IPR availableTMHMMTMhelixcoord: 58..75
IPR006068Cation-transporting P-type ATPase, C-terminalPFAMPF00689Cation_ATPase_Ccoord: 23..114
e-value: 4.4E-16
score: 59.1
IPR030332Sarcoplasmic/endoplasmic reticulum calcium ATPase 1/2PANTHERPTHR42861:SF18SARCOPLASMIC/ENDOPLASMIC RETICULUM CALCIUM ATPASE 2coord: 7..121
IPR023298P-type ATPase, transmembrane domain superfamilySUPERFAMILYSSF81665Calcium ATPase, transmembrane domain Mcoord: 3..118