SMED30009614

Overview
NameSMED30009614
Smed IDSMED30009614
Length (bp)604
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30009614 (SMED30009614) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30009614 (SMED30009614) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30009614 (SMED30009614) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30009614 (SMED30009614) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30009614

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30009614h1SMcG0006025 SmedASXL_082813SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30009614 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.017339:680..1371 +2461
v31.014955:8116..8807 +2399
v31.020681:9841..10535 -2155
v31.008335:2353..3046 -2113
v31.009437:21038..21724 +1982
v31.020401:393..1079 +1931
v31.020524:7139..7825 -1913
Homology
BLAST of SMED30009614 vs. Ensembl Zebrafish
Match: si:ch73-359m17.2 (si:ch73-359m17.2 [Source:ZFIN;Acc:ZDB-GENE-141222-90])

HSP 1 Score: 48.1358 bits (113), Expect = 8.305e-7
Identity = 24/60 (40.00%), Postives = 33/60 (55.00%), Query Frame = 2
Query:  170 PLWTSDKAVDGNYDCNMHHGHCYH-SEELNSTKWWLVILDSLSVVTRVVIYSRTECCTQR 346
            P   ++ AVDGN + +   G C H S E N   WW V L  +S V +V I +R +CC +R
Sbjct:   40 PNGNAEHAVDGNTEADYRKGSCTHTSREFN--PWWRVDLGGVSSVNKVTITNRGDCCEER 97          
BLAST of SMED30009614 vs. Ensembl Zebrafish
Match: si:ch73-359m17.2 (si:ch73-359m17.2 [Source:ZFIN;Acc:ZDB-GENE-141222-90])

HSP 1 Score: 47.7506 bits (112), Expect = 1.723e-6
Identity = 24/60 (40.00%), Postives = 33/60 (55.00%), Query Frame = 2
Query:  170 PLWTSDKAVDGNYDCNMHHGHCYH-SEELNSTKWWLVILDSLSVVTRVVIYSRTECCTQR 346
            P   ++ AVDGN + +   G C H S E N   WW V L  +S V +V I +R +CC +R
Sbjct:   40 PNGNAEHAVDGNTEADYRKGSCTHTSREFN--PWWRVDLGGVSSVNKVTITNRGDCCEER 97          
BLAST of SMED30009614 vs. Ensembl Zebrafish
Match: si:ch73-359m17.2 (si:ch73-359m17.2 [Source:ZFIN;Acc:ZDB-GENE-141222-90])

HSP 1 Score: 47.7506 bits (112), Expect = 2.719e-6
Identity = 24/60 (40.00%), Postives = 33/60 (55.00%), Query Frame = 2
Query:  170 PLWTSDKAVDGNYDCNMHHGHCYH-SEELNSTKWWLVILDSLSVVTRVVIYSRTECCTQR 346
            P   ++ AVDGN + +   G C H S E N   WW V L  +S V +V I +R +CC +R
Sbjct:   40 PNGNAEHAVDGNTEADYRKGSCTHTSREFN--PWWRVDLGGVSSVNKVTITNRGDCCEER 97          
BLAST of SMED30009614 vs. Ensembl Xenopus
Match: fucolectin (x-epilectin [Source:NCBI gene;Acc:100144955])

HSP 1 Score: 48.521 bits (114), Expect = 2.035e-6
Identity = 23/59 (38.98%), Postives = 32/59 (54.24%), Query Frame = 2
Query:  170 PLWTSDKAVDGNYDCNMHHGHCYHSEELNSTKWWLVILDSLSVVTRVVIYSRTECCTQR 346
            P + +  A+DGN D NM  G C H+   N   WW + L     V +VVI +R +CC +R
Sbjct:  206 PKYNAAAAIDGNKDTNMMAGSCSHTNSDNPA-WWQLDLKKRYQVEKVVIVNRGDCCGER 263          
BLAST of SMED30009614 vs. Ensembl Xenopus
Match: fucolectin (x-epilectin [Source:NCBI gene;Acc:100144955])

HSP 1 Score: 48.521 bits (114), Expect = 2.191e-6
Identity = 23/59 (38.98%), Postives = 32/59 (54.24%), Query Frame = 2
Query:  170 PLWTSDKAVDGNYDCNMHHGHCYHSEELNSTKWWLVILDSLSVVTRVVIYSRTECCTQR 346
            P + +  A+DGN D NM  G C H+   N   WW + L     V +VVI +R +CC +R
Sbjct:  185 PKYNAAAAIDGNKDTNMMAGSCSHTNSDNPA-WWQLDLKKRYQVEKVVIVNRGDCCGER 242          
BLAST of SMED30009614 vs. Ensembl Xenopus
Match: fucolectin (x-epilectin [Source:NCBI gene;Acc:100144955])

HSP 1 Score: 48.1358 bits (113), Expect = 2.614e-6
Identity = 23/59 (38.98%), Postives = 32/59 (54.24%), Query Frame = 2
Query:  170 PLWTSDKAVDGNYDCNMHHGHCYHSEELNSTKWWLVILDSLSVVTRVVIYSRTECCTQR 346
            P + +  A+DGN D NM  G C H+   N   WW + L     V +VVI +R +CC +R
Sbjct:  184 PKYNAAAAIDGNKDTNMMAGSCSHTNSDNPA-WWQLDLKKRYQVEKVVIVNRGDCCGER 241          
BLAST of SMED30009614 vs. Ensembl Xenopus
Match: fucolectin (x-epilectin [Source:NCBI gene;Acc:100144955])

HSP 1 Score: 47.7506 bits (112), Expect = 3.463e-6
Identity = 23/59 (38.98%), Postives = 32/59 (54.24%), Query Frame = 2
Query:  170 PLWTSDKAVDGNYDCNMHHGHCYHSEELNSTKWWLVILDSLSVVTRVVIYSRTECCTQR 346
            P + +  A+DGN D NM  G C H+   N   WW + L     V +VVI +R +CC +R
Sbjct:  184 PKYNAAAAIDGNKDTNMMAGSCSHTNSDNPA-WWQLDLKKRYQVEKVVIVNRGDCCGER 241          
BLAST of SMED30009614 vs. UniProt/SwissProt
Match: sp|Q9I929|FUCL3_ANGJA (Fucolectin-3 OS=Anguilla japonica OX=7937 PE=2 SV=1)

HSP 1 Score: 59.6918 bits (143), Expect = 4.769e-10
Identity = 36/107 (33.64%), Postives = 52/107 (48.60%), Query Frame = 2
Query:   35 FIYYFIPLKIFMYKNMSNGKFSNGVNDQLLSRSRPTFAANVIANYPLWT-SDKAVDGNYDCNMHHGHCYHSEELNSTKWWLVILDSLSVVTRVVIYSRTECCTQRTS 352
             I  F  L I   K+ S       + + +  R R T +A +   +  +  +  A+DGN D N HHG C H+E  NS  WW V L  +  +T V I +R +CC +R S
Sbjct:    6 IILLFQILAISTLKSDSADIPEGYIQENVALRGRATQSAQLKGEFAGFAHASNAIDGNRDSNYHHGSCSHTEGDNS--WWRVDLKQVYTITSVTITNRGDCCGERIS 110          
BLAST of SMED30009614 vs. UniProt/SwissProt
Match: sp|Q9I928|FUCL4_ANGJA (Fucolectin-4 OS=Anguilla japonica OX=7937 PE=2 SV=1)

HSP 1 Score: 55.8398 bits (133), Expect = 1.094e-8
Identity = 35/107 (32.71%), Postives = 49/107 (45.79%), Query Frame = 2
Query:   35 FIYYFIPLKIFMYKNMSNGKFSNGVNDQLLSRSRPTFAANVIANYP-LWTSDKAVDGNYDCNMHHGHCYHSEELNSTKWWLVILDSLSVVTRVVIYSRTECCTQRTS 352
             +  F  L I   K  S       V + +  R R T +A +   +  L  +  A+DGN D N HHG C H+E  N   WW V L  +  +  V I +R +CC +R S
Sbjct:    6 IMLLFQILAISTLKQGSAHVPDGYVEENVALRGRATQSAQLRGEHAALAHASNAIDGNRDSNYHHGSCTHTEGAN--PWWRVDLLQVYTIASVTITNRGDCCGERIS 110          
BLAST of SMED30009614 vs. UniProt/SwissProt
Match: sp|Q7SIC1|FUCL_ANGAN (Fucolectin OS=Anguilla anguilla OX=7936 PE=1 SV=1)

HSP 1 Score: 48.9062 bits (115), Expect = 3.067e-6
Identity = 23/57 (40.35%), Postives = 32/57 (56.14%), Query Frame = 2
Query:  182 SDKAVDGNYDCNMHHGHCYHSEELNSTKWWLVILDSLSVVTRVVIYSRTECCTQRTS 352
            +  A+DGN D N +HG C HS    +  WW V L  +  +T V I +R +CC +R S
Sbjct:   33 ASNAIDGNRDSNFYHGSCTHSSG-QANPWWRVDLLQVYTITSVTITNRGDCCGERIS 88          
BLAST of SMED30009614 vs. UniProt/SwissProt
Match: sp|Q9I925|FUCL7_ANGJA (Fucolectin-7 OS=Anguilla japonica OX=7937 PE=2 SV=1)

HSP 1 Score: 49.2914 bits (116), Expect = 3.105e-6
Identity = 31/107 (28.97%), Postives = 50/107 (46.73%), Query Frame = 2
Query:   35 FIYYFIPLKIFMYKNMSNGKFSNGVNDQLLSRSRPTFAANVIANYP-LWTSDKAVDGNYDCNMHHGHCYHSEELNSTKWWLVILDSLSVVTRVVIYSRTECCTQRTS 352
             +  F  L I   K+ S       + + +  R R T +A +  ++  +  +  A+DGN D   +HG C H+E      WW V L  +  +T V I +R +CC +R S
Sbjct:   15 IMLLFQILAISTLKSDSADIPEGYIQENVALRGRATQSAQLRGDHSGIAHASNAIDGNRDSVFYHGSCTHTEA--DKPWWRVDLLQVYTITSVTITNRGDCCEERIS 119          
BLAST of SMED30009614 vs. TrEMBL
Match: A0A1S3KEU6 (fucolectin OS=Lingula unguis OX=7574 GN=LOC106181345 PE=4 SV=1)

HSP 1 Score: 58.5362 bits (140), Expect = 9.082e-7
Identity = 34/111 (30.63%), Postives = 59/111 (53.15%), Query Frame = 2
Query:  122 LSRSRPTFAANVIANYPLWTSDKAVDGNYDCNMHHGHCYHSEELNSTKWWLVILDSLSVVTRVVIYSRTECCTQRTSLLSFYVXXXXXXXXXXXXXDFVNISYYVGPPPPG 454
            +++ +P   ++       + +  AVDGNYD N   G C H+E+     WWLV L+S +++  VV+ +R ECC++R  L++F V    S   +++   +   + Y G  P G
Sbjct:   26 VAKGKPAHQSSTYMYEGSYNASLAVDGNYDDNWQQGSCSHTED-GQGNWWLVDLESTAILAGVVLTNRGECCSER--LVNFEVRVGYSFVGTSSFTQYRLCASYPGVAPVG 133          
BLAST of SMED30009614 vs. TrEMBL
Match: A0A1S3HEB9 (fucolectin-like OS=Lingula unguis OX=7574 GN=LOC106153850 PE=4 SV=1)

HSP 1 Score: 56.9954 bits (136), Expect = 2.225e-6
Identity = 37/117 (31.62%), Postives = 61/117 (52.14%), Query Frame = 2
Query:  116 QLLSRSRPTFAANVIANY----PLWTSDKAVDGNYDCNMHHGHCYHSEELNSTKWWLVILDSLSVVTRVVIYSRTECCTQRTSLLSFYVXXXXXXXXXXXXXDFVNISYYVGPPPPG 454
            Q L++ +P + ++   N      L+ + +AVDGNY+ N +HG C H++      WWLV L + + V  V+I +R +CC+ R  L +F V    S   S++   +   + Y G  P G
Sbjct:   31 QNLAKGKPAYQSSTYQNRYGITDLYYASRAVDGNYNDNGNHGSCSHTDA-GQGGWWLVDLKTTARVAGVIITNRRDCCSYR--LTNFEVKVGTSYDNSSSFTQYKLCASYPGQAPVG 144          

HSP 2 Score: 22.3274 bits (46), Expect = 2.225e-6
Identity = 8/13 (61.54%), Postives = 12/13 (92.31%), Query Frame = 1
Query:  565 EQALNICELEVYG 603
            +QAL +CE+EV+G
Sbjct:  168 DQALQLCEVEVHG 180          
BLAST of SMED30009614 vs. TrEMBL
Match: A0A1S3I1T9 (fucolectin-like OS=Lingula unguis OX=7574 GN=LOC106160239 PE=4 SV=1)

HSP 1 Score: 57.3806 bits (137), Expect = 2.541e-6
Identity = 29/88 (32.95%), Postives = 51/88 (57.95%), Query Frame = 2
Query:   86 NGKFSNGVNDQLLSRSRPTFAANVIANY-PLWTSDKAVDGNYDCNMHHGHCYHSEELNSTKWWLVILDSLSVVTRVVIYSRTECCTQR 346
            +G    G   Q L++ +P + +    N   +  + ++VDGNYD  M +G C H++ L   +WWLV L++ + V  V+I +R +CC++R
Sbjct:   17 DGALCRGCT-QNLAKGKPAYQSTTYVNVNGVHPASRSVDGNYDNVMSNGRCSHTD-LGQGQWWLVDLETTASVAGVIITNRGDCCSER 102          
BLAST of SMED30009614 vs. Ensembl Cavefish
Match: ENSAMXT00000008051.2 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000995.1:49634:61503:-1 gene:ENSAMXG00000007830.2 transcript:ENSAMXT00000008051.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 46.9802 bits (110), Expect = 4.986e-6
Identity = 26/84 (30.95%), Postives = 38/84 (45.24%), Query Frame = 2
Query:  119 LLSRSRPTFAANVIANYPLWTSDKAVDGNYDCNMHHGHCYHSEELNSTKWWLVILDSLSVVTRVVIYSRTECCTQRTSLLSFYV 370
            L  R + T ++     +P     KA+D N D N H G C H+  +    WW V L     +T +VI +R +CC  R      +V
Sbjct:  177 LAPRGKATQSSLAFDGHP----SKAIDKNKDTNYHQGSCTHT-VIQQNPWWRVDLLDEFTITSIVITNRGDCCAGRLEGAEIHV 255          
BLAST of SMED30009614 vs. Planmine SMEST
Match: SMESG000046835.1 (SMESG000046835.1)

HSP 1 Score: 231.491 bits (589), Expect = 5.631e-75
Identity = 121/127 (95.28%), Postives = 126/127 (99.21%), Query Frame = 2
Query:  107 VNDQLLSRSRPTFAANVIANYPLWTSDKAVDGNYDCNMHHGHCYHSEELNSTKWWLVILDSLSVVTRVVIYSRTECCTQRTSLLSFYVXXXXXXXXXXXXXDFVNISYYVGPPPPGEYITTLSFTRL 487
            + +QLLSRSRPTFAANVIANYPLWTSDKAVDGNYDCNMHHG+CYHSEELNSTKWWLVILDSLSVVTRVVIYSRTECCTQRTSLLSFYVSYTNSTSLSTNSNDFVNISYYVGPPPPGE+ITTL+FTRL
Sbjct:  187 IRNQLLSRSRPTFAANVIANYPLWTSDKAVDGNYDCNMHHGYCYHSEELNSTKWWLVILDSLSVVTRVVIYSRTECCTQRTSLLSFYVSYTNSTSLSTNSNDFVNISYYVGPPPPGEFITTLNFTRL 313          

HSP 2 Score: 53.9138 bits (128), Expect = 1.496e-8
Identity = 24/25 (96.00%), Postives = 25/25 (100.00%), Query Frame = 1
Query:  529 YVRTLAISKPFGEQALNICELEVYG 603
            Y+RTLAISKPFGEQALNICELEVYG
Sbjct:  314 YMRTLAISKPFGEQALNICELEVYG 338          
BLAST of SMED30009614 vs. Planmine SMEST
Match: SMESG000046841.1 (SMESG000046841.1)

HSP 1 Score: 196.823 bits (499), Expect = 2.311e-63
Identity = 107/127 (84.25%), Postives = 114/127 (89.76%), Query Frame = 2
Query:  107 VNDQLLSRSRPTFAANVIANYPLWTSDKAVDGNYDCNMHHGHCYHSEELNSTKWWLVILDSLSVVTRVVIYSRTECCTQRTSLLSFYVXXXXXXXXXXXXXDFVNISYYVGPPPPGEYITTLSFTRL 487
              + LLSR RPTFAANVI N P W+SDKAVDGNYD NM  GHCYHS+ELNSTKWWL+ILDSLSVVTRVVIYSRTECCTQRTSLLSFYVSYTNSTSLSTNSNDF N+SYY G PPPGE+ITTL+FTRL
Sbjct:   21 AQNALLSRGRPTFAANVIDNQPYWSSDKAVDGNYDGNMVDGHCYHSKELNSTKWWLIILDSLSVVTRVVIYSRTECCTQRTSLLSFYVSYTNSTSLSTNSNDFTNVSYYPGSPPPGEFITTLNFTRL 147          

HSP 2 Score: 47.3654 bits (111), Expect = 1.771e-6
Identity = 20/25 (80.00%), Postives = 21/25 (84.00%), Query Frame = 1
Query:  529 YVRTLAISKPFGEQALNICELEVYG 603
            Y RTLAISKPF EQ  N+CELEVYG
Sbjct:  148 YARTLAISKPFAEQPFNLCELEVYG 172          
BLAST of SMED30009614 vs. Planmine SMEST
Match: SMESG000046835.1 (SMESG000046835.1)

HSP 1 Score: 195.282 bits (495), Expect = 5.594e-61
Identity = 108/126 (85.71%), Postives = 115/126 (91.27%), Query Frame = 2
Query:  107 VNDQLLSRSRPTFAANVIANYPLWTSDKAVDGNYDCNMHHGHCYHSEELNSTKWWLVILDSLSVVTRVVIYSRTECCTQRTSLLSFYVXXXXXXXXXXXXXDFVNISYYVGPPPPGEYITTLSFTR 484
            + +QLLSRSRPTFAANVIANYPLWTSDKAVDGNYDCNMHHG+CYHSEELNSTKWWLVILDSLSVVTRVVIYSRTECCTQRTSLLSFYVSYTNSTSLSTNSNDFVNISYY        Y+ TL+ ++
Sbjct:  187 IRNQLLSRSRPTFAANVIANYPLWTSDKAVDGNYDCNMHHGYCYHSEELNSTKWWLVILDSLSVVTRVVIYSRTECCTQRTSLLSFYVSYTNSTSLSTNSNDFVNISYY--------YMRTLAISK 304          

HSP 2 Score: 54.299 bits (129), Expect = 1.249e-8
Identity = 24/25 (96.00%), Postives = 25/25 (100.00%), Query Frame = 1
Query:  529 YVRTLAISKPFGEQALNICELEVYG 603
            Y+RTLAISKPFGEQALNICELEVYG
Sbjct:  296 YMRTLAISKPFGEQALNICELEVYG 320          
BLAST of SMED30009614 vs. Planmine SMEST
Match: SMESG000024705.1 (SMESG000024705.1)

HSP 1 Score: 175.252 bits (443), Expect = 5.039e-55
Identity = 97/126 (76.98%), Postives = 106/126 (84.13%), Query Frame = 2
Query:  110 NDQLLSRSRPTFAANVIANYPLWTSDKAVDGNYDCNMHHGHCYHSEELNSTKWWLVILDSLSVVTRVVIYSRTECCTQRTSLLSFYVXXXXXXXXXXXXXDFVNISYYVGPPPPGEYITTLSFTRL 487
             D LLS  RPTFA N  A +P WTSDKAVDGNY+ NM  G CYHSE  N  KWWLVILDSLSVVT+VVIYSRT+CCTQRTSLLSFYVSY +STSLS N+NDFVN+SYY GPPPPGE+ITTL+FTRL
Sbjct:   22 EDSLLSIGRPTFANN--AMFP-WTSDKAVDGNYNGNMSKGSCYHSETFNYDKWWLVILDSLSVVTKVVIYSRTDCCTQRTSLLSFYVSYKSSTSLSNNNNDFVNVSYYAGPPPPGEFITTLNFTRL 144          
BLAST of SMED30009614 vs. Planmine SMEST
Match: SMESG000024705.1 (SMESG000024705.1)

HSP 1 Score: 176.022 bits (445), Expect = 7.916e-55
Identity = 97/127 (76.38%), Postives = 106/127 (83.46%), Query Frame = 2
Query:  107 VNDQLLSRSRPTFAANVIANYPLWTSDKAVDGNYDCNMHHGHCYHSEELNSTKWWLVILDSLSVVTRVVIYSRTECCTQRTSLLSFYVXXXXXXXXXXXXXDFVNISYYVGPPPPGEYITTLSFTRL 487
              D LLS  RPTFA N  A +P WTSDKAVDGNY+ NM  G CYHSE  N  KWWLVILDSLSVVT+VVIYSRT+CCTQRTSLLSFYVSY +STSLS N+NDFVN+SYY GPPPPGE+ITTL+FTRL
Sbjct:   60 AEDSLLSIGRPTFANN--AMFP-WTSDKAVDGNYNGNMSKGSCYHSETFNYDKWWLVILDSLSVVTKVVIYSRTDCCTQRTSLLSFYVSYKSSTSLSNNNNDFVNVSYYAGPPPPGEFITTLNFTRL 183          
The following BLAST results are available for this feature:
BLAST of SMED30009614 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30009614 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30009614 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30009614 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
si:ch73-359m17.28.305e-740.00si:ch73-359m17.2 [Source:ZFIN;Acc:ZDB-GENE-141222-... [more]
si:ch73-359m17.21.723e-640.00si:ch73-359m17.2 [Source:ZFIN;Acc:ZDB-GENE-141222-... [more]
si:ch73-359m17.22.719e-640.00si:ch73-359m17.2 [Source:ZFIN;Acc:ZDB-GENE-141222-... [more]
back to top
BLAST of SMED30009614 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 4
Match NameE-valueIdentityDescription
fucolectin2.035e-638.98x-epilectin [Source:NCBI gene;Acc:100144955][more]
fucolectin2.191e-638.98x-epilectin [Source:NCBI gene;Acc:100144955][more]
fucolectin2.614e-638.98x-epilectin [Source:NCBI gene;Acc:100144955][more]
fucolectin3.463e-638.98x-epilectin [Source:NCBI gene;Acc:100144955][more]
back to top
BLAST of SMED30009614 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30009614 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 4
Match NameE-valueIdentityDescription
sp|Q9I929|FUCL3_ANGJA4.769e-1033.64Fucolectin-3 OS=Anguilla japonica OX=7937 PE=2 SV=... [more]
sp|Q9I928|FUCL4_ANGJA1.094e-832.71Fucolectin-4 OS=Anguilla japonica OX=7937 PE=2 SV=... [more]
sp|Q7SIC1|FUCL_ANGAN3.067e-640.35Fucolectin OS=Anguilla anguilla OX=7936 PE=1 SV=1[more]
sp|Q9I925|FUCL7_ANGJA3.105e-628.97Fucolectin-7 OS=Anguilla japonica OX=7937 PE=2 SV=... [more]
back to top
BLAST of SMED30009614 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 3
Match NameE-valueIdentityDescription
A0A1S3KEU69.082e-730.63fucolectin OS=Lingula unguis OX=7574 GN=LOC1061813... [more]
A0A1S3HEB92.225e-631.62fucolectin-like OS=Lingula unguis OX=7574 GN=LOC10... [more]
A0A1S3I1T92.541e-632.95fucolectin-like OS=Lingula unguis OX=7574 GN=LOC10... [more]
back to top
BLAST of SMED30009614 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSAMXT00000008051.24.986e-630.95pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
back to top
BLAST of SMED30009614 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30009614 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30009614 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30009614 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30009614 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000046835.15.631e-7595.28SMESG000046835.1[more]
SMESG000046841.12.311e-6384.25SMESG000046841.1[more]
SMESG000046835.15.594e-6185.71SMESG000046835.1[more]
SMESG000024705.15.039e-5576.98SMESG000024705.1[more]
SMESG000024705.17.916e-5576.38SMESG000024705.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30009614 ID=SMED30009614|Name=SMED30009614|organism=Schmidtea mediterranea sexual|type=transcript|length=604bp
TAATATTTAGTATATAAAACAGTGTTTTCACTATTTTATTTATTATTTCA
TCCCACTCAAAATTTTCATGTACAAAAATATGTCAAACGGAAAATTTTCA
AATGGAGTTAATGATCAACTTTTGTCAAGAAGCCGACCGACCTTTGCGGC
TAACGTCATTGCTAATTACCCTTTGTGGACAAGTGATAAAGCAGTGGACG
GAAATTATGATTGCAATATGCATCACGGACATTGCTATCATAGCGAAGAA
TTAAATTCCACAAAATGGTGGCTCGTCATTCTTGATTCTTTGTCCGTTGT
TACGAGGGTTGTCATTTACAGTCGGACTGAATGCTGTACACAGAGAACAA
GTCTCCTCTCGTTCTATGTCAGCTATACAAACTCAACGTCTCTCTCTACT
AATTCCAATGATTTCGTCAATATTTCATATTATGTGGGTCCTCCGCCACC
GGGTGAATACATTACCACTCTAAGTTTCACGAGATTGGTTAAGTTATTTA
AATGAAATATAATGATTTATTATTTTAGTATGTGAGAACTCTAGCTATAT
CCAAACCTTTTGGGGAGCAAGCTCTGAATATCTGTGAACTAGAGGTGTAT
GGCT
back to top

protein sequence of SMED30009614-orf-1

>SMED30009614-orf-1 ID=SMED30009614-orf-1|Name=SMED30009614-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=146bp
MYKNMSNGKFSNGVNDQLLSRSRPTFAANVIANYPLWTSDKAVDGNYDCN
MHHGHCYHSEELNSTKWWLVILDSLSVVTRVVIYSRTECCTQRTSLLSFY
VSYTNSTSLSTNSNDFVNISYYVGPPPPGEYITTLSFTRLVKLFK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000464GABAergic neuron
Vocabulary: INTERPRO
TermDefinition
IPR008979Galactose-bd-like_sf
Vocabulary: biological process
TermDefinition
GO:0001868regulation of complement activation, lectin pathway
GO:0010185regulation of cellular defense response
GO:0045088regulation of innate immune response
Vocabulary: molecular function
TermDefinition
GO:0005509calcium ion binding
GO:0030246carbohydrate binding
GO:0042806fucose binding
GO:0046872metal ion binding
Vocabulary: cellular component
TermDefinition
GO:0005576extracellular region
GO:0005615extracellular space
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR008979Galactose-binding-like domain superfamilyGENE3DG3DSA:2.60.120.260coord: 4..128
e-value: 1.5E-17
score: 65.8
IPR008979Galactose-binding-like domain superfamilySUPERFAMILYSSF49785Galactose-binding domain-likecoord: 9..117
NoneNo IPR availablePANTHERPTHR45713:SF6SI:CABZ01040626.2-RELATEDcoord: 24..102
NoneNo IPR availablePANTHERPTHR45713FAMILY NOT NAMEDcoord: 24..102