Str_synth domain-containing protein

Overview
NameStr_synth domain-containing protein
Smed IDSMED30009611
Length (bp)1273
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Str_synth domain-containing protein (SMED30009611) t-SNE clustered cells

Violin plots show distribution of expression levels for Str_synth domain-containing protein (SMED30009611) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Str_synth domain-containing protein (SMED30009611) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Str_synth domain-containing protein (SMED30009611) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30009611

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30009611SMESG000052600.1 Contig1622GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
epidermisSMED30009611SMESG000052600.1 Contig1622GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30009611SMESG000052600.1 Contig1622GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30009611SMESG000052600.1 dd_Smed_v4_1480_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30009611SMESG000052600.1 dd_Smed_v4_1480_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Str_synth domain-containing protein vs. Ensembl Human
Match: APMAP (adipocyte plasma membrane associated protein [Source:HGNC Symbol;Acc:HGNC:13238])

HSP 1 Score: 150.984 bits (380), Expect = 1.004e-40
Identity = 108/374 (28.88%), Postives = 187/374 (50.00%), Query Frame = 2
Query:   89 IVGISVFLFLLAPKVIIDSKVKVINEEVSAPPNEVKRLSWN----EVDRKFPNQLIGPEAFTIDAITGDI-YTGTAEGMIWKLNRELTTIEPIIRVGEDHPNCGSEHVAHICGRVLGLKLFNSETLIVADSYRGIISINLKTKIKEILVEKDKSEMTKSLKLFNSLDISTNGV-IYFTISSLKWSLKDLIYSILEGDNSGRIYSFSMFTKELKILASDLYLPSGLALDPDGKSLIVSEVNKRRLIKLDLSK-QSNNIEVIMDKLNGFPANVRGDLRNNYYLAM----PMTGIIETLSFLYKYPIINYSIAYLVPKWAILKLIGSDSKIYKFDDHG---RIIAIIDGTHPGTDFVTEAYEADSKILLGSLSHPYL 1168
            ++ +S+ + LL   ++++S +         PP  +  L  N    + +R F NQL+GPE+    A  GD+ +TGTA+G + KL  E   IE I R G     C +     +CGR LG++   + TL VAD+Y+G+  +N   +  ++L+  +     K++   N L ++ +G  IYFT SS KW  +D +  ++EG + GR+  +   T+E+K+L   L  P+G+ L P    ++V+E    R+ ++ +S       ++ ++ + GFP N+R      Y++ M    P  G    L FL + P I   I  L  +  ++K +   S + +  D G   R +   DG      +++E +E D  + LGS   P+L
Sbjct:   45 MLAVSLTVPLLGAMMLLESPIDPQPLSFKEPPLLLGVLHPNTKLRQAERLFENQLVGPESI---AHIGDVMFTGTADGRVVKL--ENGEIETIARFGSG--PCKTRDDEPVCGRPLGIRAGPNGTLFVADAYKGLFEVNPWKREVKLLLSSETPIEGKNMSFVNDLTVTQDGRKIYFTDSSSKWQRRDYLLLVMEGTDDGRLLEYDTVTREVKVLLDQLRFPNGVQLSPAEDFVLVAETTMARIRRVYVSGLMKGGADLFVENMPGFPDNIRPSSSGGYWVGMSTIRPNPG-FSMLDFLSERPWIKRMIFKLFSQETVMKFVPRYSLVLELSDSGAFRRSLHDPDGLV--ATYISEVHEHDGHLYLGSFRSPFL 408          
BLAST of Str_synth domain-containing protein vs. Ensembl Human
Match: APMAP (adipocyte plasma membrane associated protein [Source:HGNC Symbol;Acc:HGNC:13238])

HSP 1 Score: 144.05 bits (362), Expect = 3.645e-38
Identity = 108/382 (28.27%), Postives = 187/382 (48.95%), Query Frame = 2
Query:   89 IVGISVFLFLLAPKVIIDSKVKVINEEVSAPPNEVKRLSWN----EVDRKFPNQLIGPEAFTIDAITGDI-YTGTAEGMIWKLNRELTTIEPIIRVGEDHPNCGSEHVAHICGRVLGLKLFNSETLIVADSYRGIISINLKTKIKEILVEKDKSEMTKSLKLFNSLDISTNGV-IYFTISSLKWSLKDLIYSILEGDNSGRIYSFSMFTKELKILASDLYLPSGLALDPDGKSLIVSEVNKRRLIKLDLSK-QSNNIEVIMDKLNGFPANVRGDLRNNYYLAM----PMTGIIETLSFLYKYPIINYSI--------AYLVPKWAILKLIGSDSKIYKFDDHG---RIIAIIDGTHPGTDFVTEAYEADSKILLGSLSHPYL 1168
            ++ +S+ + LL   ++++S +         PP  +  L  N    + +R F NQL+GPE+    A  GD+ +TGTA+G + KL  E   IE I R G     C +     +CGR LG++   + TL VAD+Y+G+  +N   +  ++L+  +     K++   N L ++ +G  IYFT SS KW  +D +  ++EG + GR+  +   T+E+K+L   L  P+G+ L P    ++V+E    R+ ++ +S       ++ ++ + GFP N+R      Y++ M    P  G    L FL + P I   I          L  +  ++K +   S + +  D G   R +   DG      +++E +E D  + LGS   P+L
Sbjct:   30 MLAVSLTVPLLGAMMLLESPIDPQPLSFKEPPLLLGVLHPNTKLRQAERLFENQLVGPESI---AHIGDVMFTGTADGRVVKL--ENGEIETIARFGSG--PCKTRDDEPVCGRPLGIRAGPNGTLFVADAYKGLFEVNPWKREVKLLLSSETPIEGKNMSFVNDLTVTQDGRKIYFTDSSSKWQRRDYLLLVMEGTDDGRLLEYDTVTREVKVLLDQLRFPNGVQLSPAEDFVLVAETTMARIRRVYVSGLMKGGADLFVENMPGFPDNIRPSSSGGYWVGMSTIRPNPG-FSMLDFLSERPWIKRMIFKGSCAGCDLLFSQETVMKFVPRYSLVLELSDSGAFRRSLHDPDGLV--ATYISEVHEHDGHLYLGSFRSPFL 401          
BLAST of Str_synth domain-containing protein vs. Ensembl Celegans
Match: C08E8.2 (pep chromosome:WBcel235:V:18353510:18355842:-1 gene:WBGene00007438.1 transcript:C08E8.2.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:C08E8.2)

HSP 1 Score: 105.145 bits (261), Expect = 5.080e-25
Identity = 89/333 (26.73%), Postives = 153/333 (45.95%), Query Frame = 2
Query:  236 QLIGPEAFTIDAITGDIYTGTAEGMIWKL------NRELTTIEPIIRVGEDHPNCGSEHVAHICGRVLGLKLF--NSETLIVADSYRGIISIN----LKTKIKEILVEKDKSEMTKSLK--LFNSLDISTNGVIYFTISSLKWSLKDLIYSILEGDNSGRIYSFSMFTKELKILASDLYLPSGLALDPDGKSLIVSEVNKRRLIKLDLSKQSNNIEVIMDKLNGFPANVRGDLRNNYYLAMPMT---GIIETLSFLYKYPIINYSIAYLVPKWAILKLI----GSDSKIYKFDDHGRII-AIIDGTHPGTDFVTEAYEADSKILLGSLSHPYL 1168
            Q+IGPE+  +D     IY    +  + K+         + +  PI       PN        ICGR LG++     ++  ++ D+Y G+  I+    L+ K  +IL   D S+     +    N LD+ +   +  T SS++   +     +LE    GRI    + T  +K+LA +LY P+G+ L PD KS I +E +  R+ KLDL  ++  I++  + L G P N+RG  R  +++ +  T        L  L  +P +      +VP    +K++       S I + D +G+II ++ D T      V++  E +  + LGS +  Y+
Sbjct:   13 QVIGPESMVVDDEA--IYVSVNDAKVLKIVDGKVRATAVYSKNPIFP-----PNMTRFEAEAICGRPLGIRKLVEGTKKFVLVDAYLGVFIIDFSDELRPKSTQIL---DASKPIDGFRPNFLNDLDVISEDELIITHSSIRHDCRHFFNLVLEHQGDGRILHLKISTGTVKVLAKNLYFPNGIQLTPDKKSAIFAECSMARIKKLDL--ETGKIDIFCENLPGLPDNIRGTPRGTFWVGLAATRSKNYPSLLDRLGNWPGVRQFFVDIVPAAHWMKILVFSKHPHSIIVELDSNGKIIRSLHDVTGKHVSDVSQVTEHNGFLYLGSFADTYI 333          
BLAST of Str_synth domain-containing protein vs. Ensembl Celegans
Match: F57C2.5 (pep chromosome:WBcel235:II:14526213:14528296:-1 gene:WBGene00010197.1 transcript:F57C2.5a.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F57C2.5)

HSP 1 Score: 93.5893 bits (231), Expect = 9.093e-21
Identity = 82/328 (25.00%), Postives = 148/328 (45.12%), Query Frame = 2
Query:  233 NQLIGPEAFTIDAITGDIYTGTAEGMIWKL-NRELTTIEPIIRVGEDHPNCGSEHVAHICGRVLGLK--LFNSETLIVADSYRGIISINLKTKIKEILVEKDKSEMT-KSLK--LFNSLDISTNGVIYFTISSLKWSLKDLIYSILEGDNSGRIYSFSMFTKELKILASDLYLPSGLALDPDGKSLIVSEVNKRRLIKLDLSKQSNNIEVIMDKLNGFPANVRGDLRNNYYLAMPMTGIIETLSFLYK---YPIINYSIAYLVPKWAILKLIG----SDSKIYKFDDHGRIIAI---IDGTHPGTDFVTEAYEADSKILLGSLSHPYL 1168
             +++GPE+  +D     IY    +  + K+ +  + +        +  P+CG       CGR LG++  +      +V D+Y G+  ++   +   I  +   S++    LK    N LD+ +   +  + SS +   +  + +ILE    GRI+   + TK +K+LA  LY P+G+ L  D KS+I +E +  R+ KL ++  S  +E+    L G P N+R   R  Y++ +  T      S L +    P I   +  +VP      L+G      S I + D  G+I+     + G H G    ++  E +  + +GS +  Y+
Sbjct:   65 GKIVGPESMVVDDEA--IYVSVNDAKVLKIVDGRVVSKASYSEKSKFFPDCGHFDTEPECGRPLGIRRLVAGKPKFVVCDAYLGVYIVDFTDEQNPISTQILDSKVPIDGLKPRFLNDLDVISEDELIISDSSTRHDRRHFMAAILEHQADGRIFHLKISTKSVKVLADKLYFPNGIQLTEDKKSVIFAECSMARIKKLTIA--SKKVEMFAANLPGLPDNIRSSGRGTYWVGLTATRSATHPSLLDRLGSLPGIRQFLVDIVPGPYWKPLLGLFKNPHSIIIELDSVGKIVRSLHDVTGKHVGD--ASQVTEHNGHLYIGSFADHYI 386          
BLAST of Str_synth domain-containing protein vs. Ensembl Celegans
Match: F57C2.5 (pep chromosome:WBcel235:II:14526213:14528239:-1 gene:WBGene00010197.1 transcript:F57C2.5a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F57C2.5)

HSP 1 Score: 93.5893 bits (231), Expect = 9.093e-21
Identity = 82/328 (25.00%), Postives = 148/328 (45.12%), Query Frame = 2
Query:  233 NQLIGPEAFTIDAITGDIYTGTAEGMIWKL-NRELTTIEPIIRVGEDHPNCGSEHVAHICGRVLGLK--LFNSETLIVADSYRGIISINLKTKIKEILVEKDKSEMT-KSLK--LFNSLDISTNGVIYFTISSLKWSLKDLIYSILEGDNSGRIYSFSMFTKELKILASDLYLPSGLALDPDGKSLIVSEVNKRRLIKLDLSKQSNNIEVIMDKLNGFPANVRGDLRNNYYLAMPMTGIIETLSFLYK---YPIINYSIAYLVPKWAILKLIG----SDSKIYKFDDHGRIIAI---IDGTHPGTDFVTEAYEADSKILLGSLSHPYL 1168
             +++GPE+  +D     IY    +  + K+ +  + +        +  P+CG       CGR LG++  +      +V D+Y G+  ++   +   I  +   S++    LK    N LD+ +   +  + SS +   +  + +ILE    GRI+   + TK +K+LA  LY P+G+ L  D KS+I +E +  R+ KL ++  S  +E+    L G P N+R   R  Y++ +  T      S L +    P I   +  +VP      L+G      S I + D  G+I+     + G H G    ++  E +  + +GS +  Y+
Sbjct:   65 GKIVGPESMVVDDEA--IYVSVNDAKVLKIVDGRVVSKASYSEKSKFFPDCGHFDTEPECGRPLGIRRLVAGKPKFVVCDAYLGVYIVDFTDEQNPISTQILDSKVPIDGLKPRFLNDLDVISEDELIISDSSTRHDRRHFMAAILEHQADGRIFHLKISTKSVKVLADKLYFPNGIQLTEDKKSVIFAECSMARIKKLTIA--SKKVEMFAANLPGLPDNIRSSGRGTYWVGLTATRSATHPSLLDRLGSLPGIRQFLVDIVPGPYWKPLLGLFKNPHSIIIELDSVGKIVRSLHDVTGKHVGD--ASQVTEHNGHLYIGSFADHYI 386          
BLAST of Str_synth domain-containing protein vs. Ensembl Celegans
Match: T12G3.4 (pep chromosome:WBcel235:IV:12048268:12049943:1 gene:WBGene00011739.1 transcript:T12G3.4.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:T12G3.4)

HSP 1 Score: 93.2041 bits (230), Expect = 1.964e-20
Identity = 75/279 (26.88%), Postives = 142/279 (50.90%), Query Frame = 2
Query:  233 NQLIGPEAFTIDAITGDIYTGTAEGMIWKLNRE--LTTIEPIIRVGEDHPNC-GSEHVAHICGRVLGLKLFNSETLIVADSYRGIISINLKT-KIKEILVEKD---KSEMTKSLKLFNSLDISTNGVIYFTISSLKWSLKDLIYSILEGDNSGRIYSFSMFTKELKILASDLYLPSGLALDPD---GKS----LIVSEVNKRRLIKL-----DLSKQSNNIEVIMDKLNGFPANVRGDLRNNYYLAMPMTG-IIETLSFLYKYPIINYSIAYLVPKWAI 1009
            +Q+ GPE+  +D     +Y G   G+I +++ +     I   +++ + + +C GS    ++CGR LGL+L +   L++AD+Y G+ +IN +  K+ +IL   +    +E    +K  N LDI  +G + FT SS K+  +D I  + E   +GR+  +    K+L++L   LY P+G+ L  +   GK+    ++ SE+   R++++       S        +++ L G+P N+R  L  + +L +P+     E   FL + P +   I  ++   A+
Sbjct:  107 DQVYGPESLVLDEKNSKLYAGFKTGIIAEIDMKEGREKIVHAVQLAQGNHDCDGSYKKMNLCGRPLGLRLSDVGELVIADAYLGLFAINWQEEKVVKILGAGELPANNENAAPIKYLNDLDILPDGRVIFTESSTKFDDRDFILDLFEHRPNGRLLIYDPRKKDLRVLKDGLYFPNGVQLSIEKGMGKNAPWRVLYSEMGLARVMQIWVPRDHYSTAPVKTSPLIENLPGYPDNIR--LTKSGHLLIPIASHRSEEDRFLEQNPSVREFITKILSPQAL 383          
BLAST of Str_synth domain-containing protein vs. Ensembl Celegans
Match: T12G3.4 (pep chromosome:WBcel235:IV:12048256:12049928:1 gene:WBGene00011739.1 transcript:T12G3.4.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:T12G3.4)

HSP 1 Score: 93.2041 bits (230), Expect = 1.964e-20
Identity = 75/279 (26.88%), Postives = 142/279 (50.90%), Query Frame = 2
Query:  233 NQLIGPEAFTIDAITGDIYTGTAEGMIWKLNRE--LTTIEPIIRVGEDHPNC-GSEHVAHICGRVLGLKLFNSETLIVADSYRGIISINLKT-KIKEILVEKD---KSEMTKSLKLFNSLDISTNGVIYFTISSLKWSLKDLIYSILEGDNSGRIYSFSMFTKELKILASDLYLPSGLALDPD---GKS----LIVSEVNKRRLIKL-----DLSKQSNNIEVIMDKLNGFPANVRGDLRNNYYLAMPMTG-IIETLSFLYKYPIINYSIAYLVPKWAI 1009
            +Q+ GPE+  +D     +Y G   G+I +++ +     I   +++ + + +C GS    ++CGR LGL+L +   L++AD+Y G+ +IN +  K+ +IL   +    +E    +K  N LDI  +G + FT SS K+  +D I  + E   +GR+  +    K+L++L   LY P+G+ L  +   GK+    ++ SE+   R++++       S        +++ L G+P N+R  L  + +L +P+     E   FL + P +   I  ++   A+
Sbjct:  107 DQVYGPESLVLDEKNSKLYAGFKTGIIAEIDMKEGREKIVHAVQLAQGNHDCDGSYKKMNLCGRPLGLRLSDVGELVIADAYLGLFAINWQEEKVVKILGAGELPANNENAAPIKYLNDLDILPDGRVIFTESSTKFDDRDFILDLFEHRPNGRLLIYDPRKKDLRVLKDGLYFPNGVQLSIEKGMGKNAPWRVLYSEMGLARVMQIWVPRDHYSTAPVKTSPLIENLPGYPDNIR--LTKSGHLLIPIASHRSEEDRFLEQNPSVREFITKILSPQAL 383          
BLAST of Str_synth domain-containing protein vs. Ensembl Fly
Match: Ssl2 (gene:FBgn0041780 transcript:FBtr0345060)

HSP 1 Score: 97.4413 bits (241), Expect = 7.639e-22
Identity = 71/233 (30.47%), Postives = 119/233 (51.07%), Query Frame = 2
Query:  209 NEVDRKFPNQLIGPEAFTIDAITGDIYTGTAEGMIWKLNRELTTIEPIIRVGEDHPNCGSEHVAHICGRVLGLKL-FNSETLIVADSYRGIISINLKTKIKEILVEKDK----SEMTKSLKLFNSLDISTNGVIYFTISSLKWSLKDLIYSILEGDNSGRIYSFSMFTKELKILASDLYLPSGLALDPDGKSLIVSEVNKRRLIKLDL-SKQSNNIEVIMDKLNGFPANVRGD 889
            N   + + +Q+ GPE   +  +   IYTG   G + +LN E  +++PI ++G+    C       +CG  +GL L      LIV+D+Y GI  ++L+TK K +LV  ++        +  KLFNSL IS  G I++T S  +    D +++    + SGR++ +    K  ++L  +L   +GLAL P    +I++E    RL +  L   ++   EV ++ L G P N+  D
Sbjct:   57 NGARKLWKDQIFGPECLIV--LEDKIYTGIHSGEVIRLNNE-ESVQPITKIGQP---CDYIFDDELCGYPVGLALDTQGNNLIVSDAYYGIWQVDLETKKKTVLVPAEQILPGKGANRRAKLFNSLVISRQGDIFWTDSFSE----DFVFAAF-ANPSGRLFRYDRVKKTNEVLLDELSFANGLALSPSEDFIILAETTAMRLRRYYLKGSRAGESEVFVEGLPGCPDNLTAD 278          
BLAST of Str_synth domain-containing protein vs. Ensembl Fly
Match: Hmu (gene:FBgn0015737 transcript:FBtr0085164)

HSP 1 Score: 97.0561 bits (240), Expect = 2.129e-21
Identity = 73/252 (28.97%), Postives = 126/252 (50.00%), Query Frame = 2
Query:  170 VSAPPNEVK-----RLSWNEVDRKFPNQLIGPEAFTIDAITGDIYTGTAEGMIWKLNRELTTIEPIIRVGEDHPNCGSEHVAHICGRVLGLKLFNSE--TLIVADSYRGIISINLKTKIKEILVEKDKSEMTKSL----KLFNSLDISTNGVIYFTISSLKWSLKDLIYSILEGDNSGRIYSFSMFTKELKILASDLYLPSGLALDPDGKSLIVSEVNKRRLIKLDL-SKQSNNIEVIMDKLNGFPANVRGD 889
            +  PP ++K            +R    ++ GPE     A   +IYTG   G + KL     T   + ++G+    C   +    CGR LGL  F+++   LI+AD+Y G+  ++L T  K +LV   +    KS+    K+FN + +S  G +Y+T SS  ++++DL+++    + SGR++ ++      ++L  +L   +GLAL P+   ++V+E    RL K  L   ++   EV +D L G P N+  D
Sbjct:   39 IVTPPKDLKGALESNFHLEGAERLLEGRVYGPECLI--ARNNEIYTGIHGGEVIKLTSNHVTH--VTKIGQP---CEDIYEESRCGRPLGLA-FDTQGNNLIIADAYYGLWQVDLGTNKKTLLVSPAQELAGKSINRPAKIFNGVTVSKEGDVYWTDSSSDFTIEDLVFASF-ANPSGRLFKYNRSKNVSEVLLDELAFANGLALSPNEDFIVVAETGAMRLTKYHLKGAKAGQSEVFVDGLPGLPDNLTPD 281          
BLAST of Str_synth domain-containing protein vs. Ensembl Zebrafish
Match: apmap (adipocyte plasma membrane associated protein [Source:NCBI gene;Acc:266637])

HSP 1 Score: 158.688 bits (400), Expect = 9.874e-44
Identity = 104/331 (31.42%), Postives = 171/331 (51.66%), Query Frame = 2
Query:  200 LSWNEVDRKFPNQLIGPEAFTIDAITGDI-YTGTAEGMIWKLNRELTTIEPIIRVGEDHPNCGSEHVAHICGRVLGLKLFNSETLIVADSYRGIISINLKTKIKEILVEKDKSEMTKSLKLFNSLDISTNGV-IYFTISSLKWSLKDLIYSILEGDNSGRIYSFSMFTKELKILASDLYLPSGLALDPDGKSLIVSEVNKRRLIKLDLSK-QSNNIEVIMDKLNGFPANVRGDLRNNYYLAM----PMTGIIETLSFLYKYPIINYSIAYLVPKWAILKLIGSDSKIYKFDDHGRII-AIIDGTHPGTDFVTEAYEADSKILLGSLSHPYL 1168
            L   + +R F  +L+GPE+    A  GD+ YTGTA+G I K+  E   I  +  +G+  P CGS    H CGR LG+++  + TL VAD+Y G+  +N  T   + LV  +K    + L   N LD++ +G  +YFT SS +W  +D ++ I+E    GR+  +   TKE+ ++  +L  P+G+ L PD +S++V+E    R+ ++ +S      ++  ++ L GFP N+R      Y++AM    P  G    L FL + P +   I  L  +  +LK +   S + +    G  + +  D     + + +EA+E    + LGS   PYL
Sbjct:   85 LKLRQAERLFEERLVGPESL---ANIGDVFYTGTADGKIVKI--EGRNIHVLATIGK--PPCGSREHEHTCGRPLGIRVGPNGTLFVADAYLGLFEVNPVTGEVKSLVSTEKRIAGRRLGFVNDLDVTQDGKKVYFTDSSSRWQRRDFMHLIMEATADGRVLEYDTETKEVNVMMENLRFPNGIQLFPDEESVLVAETTMARIKRVHVSGLNKGGMDTFIENLPGFPDNIRRSSSGGYWVAMSAVRPNPG-FSMLDFLSQRPWLKKLIFKLFSQDTLLKFVPRYSLVVELQGDGTCVRSFHDPQGLVSAYSSEAHEYSGHLYLGSFRSPYL 407          
BLAST of Str_synth domain-containing protein vs. Ensembl Zebrafish
Match: zgc:194209 (zgc:194209 [Source:ZFIN;Acc:ZDB-GENE-081022-75])

HSP 1 Score: 155.992 bits (393), Expect = 1.325e-42
Identity = 101/323 (31.27%), Postives = 167/323 (51.70%), Query Frame = 2
Query:  227 FPNQLIGPEAFTIDAITGDIYTGTAEGMIWKLNRELTTIEPIIRVGEDHPNCG-SEHVAHICGRVLGLKLFNSETLIVADSYRGIISINLKTKIKEILVEKDKSEMTKSLKLFNSLDISTNGVIYFTISSLKWSLKDLIYSILEGDNSGRIYSFSMFTKELKILASDLYLPSGLALDPDGKSLIVSEVNKRRLIKLDLSKQSNNI-EVIMDKLNGFPANVRGDLRNNYYLAMPMTGIIET-----LSFLYKYPIINYSIAYLVP-KWAILKLIGSDSKIYKFDDHGRII-AIIDGTHPGTDFVTEAYEADSKILLGSLSHPYL 1168
            F  QL GPE+FT D   G++YTGT +G +W++N E  +++ I ++G++ P CG S     +CGR  GL+L     LIVADSY G+  ++  T  K +L               N L+IS NG ++FT SS KW  + + Y +LE +  GR+ +F   +  ++ L   LY+P+G A  PD   L+++E +  R+IK  L      + EV+++ + G+P N+R   R  + + +             L  +  YP +  +I  LVP  W  L L+     + + D  G++I ++ D T   T  V++ ++  +   LG+   P+L
Sbjct:  107 FSGQLKGPESFTADQ-NGNVYTGTVDGKLWRINNE--SLKFITQMGQNIPQCGFSTDYEPVCGRPHGLRLDRDGQLIVADSYYGLFKVDPSTGEKTLLHSSKDGADGIPFGFLNGLEISKNGTVFFTDSSSKWGRRHVRYEVLETNRLGRLLTFDPTSGRVRTLLDSLYMPNGFAFSPDEDFLLLAETSIGRIIKFWLKGPKAGMKEVVLNNMIGYPDNIRLSDRGTFLVGISTVRFAGRLFPPFLDLIGPYPALKRAIVKLVPLSWYDL-LLPKYGVVLELDSAGQVIDSLHDPTGHLTWAVSDVFQHGTVYYLGNTDLPFL 425          
BLAST of Str_synth domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000037041.1 (adipocyte plasma membrane associated protein LIKE [Source:NCBI gene;Acc:548386])

HSP 1 Score: 149.443 bits (376), Expect = 1.235e-39
Identity = 106/374 (28.34%), Postives = 184/374 (49.20%), Query Frame = 2
Query:   83 LSIVGISVFLFLLAPKVIIDSKVKVINEEVSAPPNEVKRLSWN----EVDRKFPNQLIGPEAFTIDAITGDIYTGTAEGMIWKLNRELTTIEPIIRVGEDHPNCGSEHVAHICGRVLGLKLFNSETLIVADSYRGIISINLKTKIKEILVEKDKSEMTKSLKLFNSLDISTNGVIYFTISSLKWSLKDLIYSILEGDNSGRIYSFSMFTKELKILASDLYLPSGLALDPDGKSLIVSEVNKRRLIKLDLSKQSNNI-EVIMDKLNGFPANVRGDLRNNYYLAMPMT----GIIETLSFLYKYPIINYSIAYLVPKWAILKLIGSDSKIYKFDDHGRIIAII---DGTHPGTDFVTEAYEADSKILLGSLSHPYL 1168
            ++++ ++V ++LL     ID +    ++    PP  V  L+ N    +  R F  QL GPE+FT D   G++YTGT +G +W +  E      I ++G++ P CG+     ICGR  G+++     LIVADSY G+  +   T  K +L+  +        +  N L++S NG IYFT SS KW  +   Y +LE ++ GR+  +   T++ K L   LY+ +G+AL P+   ++V+E +  R+++  L+     + EV +D L G+P N+R      Y + M  T         L  +  YP++   I  + P      L+       +  + G ++A     DG+   T  +++ +E    + +G+   P+L
Sbjct:  103 IALLAVAVGVYLLPSP--IDPEPFTFDK---PPPTLVGSLAINRKLQQGRRIFYGQLKGPESFTTDT-EGNLYTGTVDGKLWVIRGEQLFF--ITQMGQNVPECGTPEYEPICGRPHGIRMAPDGYLIVADSYFGLYRVQPHTGEKSLLISNEAGLDQIPFRFLNGLEVSKNGTIYFTDSSSKWGRRHHRYEVLETNHLGRLLQYDPVTQKAKSLLDKLYMANGIALSPEEDFILVAETSICRIVRYWLTGTKAGMKEVFVDNLPGYPDNIRLSSVGTYRVGMSTTRFPGHFTPFLDAIAPYPVLKRLIVKVTPLSLYSILLRKHGLFLEVGEDGEVLASYHDPDGS--VTWAISDVFEHKENLYIGNTDLPFL 466          
BLAST of Str_synth domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000024163.1 (adipocyte plasma membrane associated protein LIKE [Source:NCBI gene;Acc:548386])

HSP 1 Score: 144.436 bits (363), Expect = 2.045e-38
Identity = 106/376 (28.19%), Postives = 184/376 (48.94%), Query Frame = 2
Query:   83 LSIVGISVFLFLLAPKVIIDSKVKVINEEVSAPPNEVKRLSWN----EVDRKFPNQLIGPEAFTIDAITGDIYTGTAEGMIWKLNRELTTIEPIIRVGEDHPNCG--SEHVAHICGRVLGLKLFNSETLIVADSYRGIISINLKTKIKEILVEKDKSEMTKSLKLFNSLDISTNGVIYFTISSLKWSLKDLIYSILEGDNSGRIYSFSMFTKELKILASDLYLPSGLALDPDGKSLIVSEVNKRRLIKLDLSKQSNNI-EVIMDKLNGFPANVRGDLRNNYYLAMPMT----GIIETLSFLYKYPIINYSIAYLVPKWAILKLIGSDSKIYKFDDHGRIIAII---DGTHPGTDFVTEAYEADSKILLGSLSHPYL 1168
            ++++ ++V ++LL     ID +    ++    PP  V  L+ N    +  R F  QL GPE+FT D   G++YTGT +G +W +  E      I ++G++ P CG  +     ICGR  G+++     LIVADSY G+  +   T  K +L+  +        +  N L++S NG IYFT SS KW  +   Y +LE ++ GR+  +   T++ K L   LY+ +G+AL P+   ++V+E +  R+++  L+     + EV +D L G+P N+R      Y + M  T         L  +  YP++   I  + P      L+       +  + G ++A     DG+   T  +++ +E    + +G+   P+L
Sbjct:   26 IALLAVAVGVYLLPSP--IDPEPFTFDK---PPPTLVGSLAINRKLQQGRRIFYGQLKGPESFTTDT-EGNLYTGTVDGKLWVIRGEQLFF--ITQMGQNVPECGRCTPEYEPICGRPHGIRMAPDGYLIVADSYFGLYRVQPHTGEKSLLISNEAGLDQIPFRFLNGLEVSKNGTIYFTDSSSKWGRRHHRYEVLETNHLGRLLQYDPVTQKAKSLLDKLYMANGIALSPEEDFILVAETSICRIVRYWLTGTKAGMKEVFVDNLPGYPDNIRLSSVGTYRVGMSTTRFPGHFTPFLDAIAPYPVLKRLIVKVTPLSLYSILLRKHGLFLEVGEDGEVLASYHDPDGSV--TWAISDVFEHKENLYIGNTDLPFL 391          
BLAST of Str_synth domain-containing protein vs. Ensembl Xenopus
Match: edem2 (ER degradation enhancer, mannosidase alpha-like 2 [Source:Xenbase;Acc:XB-GENE-941890])

HSP 1 Score: 143.28 bits (360), Expect = 7.548e-38
Identity = 111/386 (28.76%), Postives = 182/386 (47.15%), Query Frame = 2
Query:   68 SLINSLSIVGISVFLFLLAPKVIIDSKVKVINEEVSAPPNEVKRLSWN----EVDRKFPNQLIGPEAFTIDAITGDI-YTGTAEGMIWKLNRELTTIEPIIRVGEDHPNCGSEHVAHICGRVLGLKLFNSETLIVADSYRGIISINLKTKIKEILVEKDKSEMTKSLKLFNSLDISTNGV-IYFTISSLKWSLKDLIYSILEGDNSGRIYSFSMFTKELKILASDLYLPSGLALDPDGKSLIVSEVNKRRLIKLDLSK-QSNNIEVIMDKLNGFPANVRGDLRNNYYLAMPMTGI---IETLSFLYKYPIINY---------SIAYLVPKWAILKLIGSDSKIYKFDDHGRIIAIIDGTHPGTDFVTEAYEADSKILLGSLSHPYL 1168
            +L+ S+ I  ++ F FL +P       ++        PP     L  N    +  R +  +L+GPE+    A  GD+ +TGTA+G I K+  E   I  I R+G+  P CG     H CGR LGL++  + TL V+D+Y+GI  +N  T    +LV        K +   N L ++++G  IYFT SS KW  +D  Y I+EG + GR+  +   TK +K+L   L   +G+ L P    ++V+E    R+ +  +S       ++ ++ + GFP N+R      Y++AM    +      + FL   P I           ++   VP+++++  IG     YK   H       D       F++EA+E D  + +GS   P++
Sbjct:   46 TLVLSILIPTVAAFWFLESP-------IEPQYLSFHTPPVMTGVLEPNLKLRQAKRLYEGELVGPESL---ANIGDVLFTGTADGQILKI--EDGKIHTIARLGK--PPCGFREHEHTCGRPLGLRVGPNGTLYVSDAYQGIFEVNPVTGAVAMLVSSKVPVEGKIMSFVNDLTVTSDGRKIYFTDSSSKWQRRDYPYLIMEGTDDGRLLEYDTVTKVVKVLMGGLRFANGVQLSPAEDFVLVAETTMARIRRYYVSGLTKGGADMFVENMPGFPDNIRLSSSGGYWVAMSAVRLNPGFSMIDFLSDKPWIRRNVFKLFSHDTVMQFVPRYSLVVEIGEKGS-YKRSFH-------DPNGEVATFISEAHEHDGYLYMGSFRSPFI 409          
BLAST of Str_synth domain-containing protein vs. Ensembl Xenopus
Match: edem2 (ER degradation enhancer, mannosidase alpha-like 2 [Source:Xenbase;Acc:XB-GENE-941890])

HSP 1 Score: 142.124 bits (357), Expect = 2.051e-37
Identity = 107/378 (28.31%), Postives = 182/378 (48.15%), Query Frame = 2
Query:   68 SLINSLSIVGISVFLFLLAPKVIIDSKVKVINEEVSAPPNEVKRLSWN----EVDRKFPNQLIGPEAFTIDAITGDI-YTGTAEGMIWKLNRELTTIEPIIRVGEDHPNCGSEHVAHICGRVLGLKLFNSETLIVADSYRGIISINLKTKIKEILVEKDKSEMTKSLKLFNSLDISTNGV-IYFTISSLKWSLKDLIYSILEGDNSGRIYSFSMFTKELKILASDLYLPSGLALDPDGKSLIVSEVNKRRLIKLDLSKQS-NNIEVIMDKLNGFPANVRGDLRNNYYLAMPMTGI---IETLSFLYKYPIINYSIAYLVPKWAILKLIGSDSKIYKFDDHGRI-IAIIDGTHPGTDFVTEAYEADSKILLGSLSHPYL 1168
            +L+ S+ I  ++ F FL +P       ++        PP     L  N    +  R +  +L+GPE+    A  GD+ +TGTA+G I K+  E   I  I R+G+  P CG     H CGR LGL++  + TL V+D+Y+GI  +N  T    +LV        K +   N L ++++G  IYFT SS KW  +D  Y I+EG + GR+  +   TK +K+L   L   +G+ L P    ++V+E    R+ +  +S  +    ++ ++ + GFP N+R      Y++AM    +      + FL   P I  ++  L     +++ +   S + +  + G    +  D       F++EA+E D  + +GS   P++
Sbjct:   55 TLVLSILIPTVAAFWFLESP-------IEPQYLSFHTPPVMTGVLEPNLKLRQAKRLYEGELVGPESL---ANIGDVLFTGTADGQILKI--EDGKIHTIARLGK--PPCGFREHEHTCGRPLGLRVGPNGTLYVSDAYQGIFEVNPVTGAVAMLVSSKVPVEGKIMSFVNDLTVTSDGRKIYFTDSSSKWQRRDYPYLIMEGTDDGRLLEYDTVTKVVKVLMGGLRFANGVQLSPAEDFVLVAETTMARIRRYYVSGLTKGGADMFVENMPGFPDNIRLSSSGGYWVAMSAVRLNPGFSMIDFLSDKPWIRRNVFKLFSHDTVMQFVPRYSLVVEIGEKGSYKRSFHDPNGEVATFISEAHEHDGYLYMGSFRSPFI 418          
BLAST of Str_synth domain-containing protein vs. Ensembl Mouse
Match: Apmap (adipocyte plasma membrane associated protein [Source:MGI Symbol;Acc:MGI:1919131])

HSP 1 Score: 144.821 bits (364), Expect = 1.325e-38
Identity = 104/372 (27.96%), Postives = 181/372 (48.66%), Query Frame = 2
Query:   89 IVGISVFLFLLAPKVIIDSKVKVINEEVSAPPNEVKRLSWN----EVDRKFPNQLIGPEAFTIDAITGDIYTGTAEGMIWKLNRELTTIEPIIRVGEDHPNCGSEHVAHICGRVLGLKLFNSETLIVADSYRGIISINLKTKIKEILVEKDKSEMTKSLKLFNSLDISTNGV-IYFTISSLKWSLKDLIYSILEGDNSGRIYSFSMFTKELKILASDLYLPSGLALDPDGKSLIVSEVNKRRLIKLDLSK-QSNNIEVIMDKLNGFPANVRGDLRNNYYLAMPMTGI---IETLSFLYKYPIINYSIAYLVPKWAILKLIGSDSKIYKFDDHG---RIIAIIDGTHPGTDFVTEAYEADSKILLGSLSHPYL 1168
            ++ +S+ + LL   ++++S +   +     PP     L  N    + +R F NQL GPE  +I  I   ++TGTA+G + KL  E   IE I R G     C +      CGR LG++   + TL V D+Y+G+  +N + +  ++L+  +     K +   N L ++ +G  IYFT SS KW  +D +  ++E  + GR+  +   TKE+K+L   L  P+G+ L P+   ++V+E    R+ ++ +S       ++ ++ + GFP N+R      Y++A            L FL   P I   I  +  +  ++K +   S + +  D G   R +   DG      +V+EA+E D  + LGS   P++
Sbjct:   44 MLAVSLAIPLLGAMMLLESPIDPQSFSFKEPPFMFGVLHPNTKLRQAERLFENQLSGPE--SIVNIGDVLFTGTADGRVVKL--ENGEIETIARFGSGP--CKTRDDEPTCGRPLGIRAGPNGTLFVVDAYKGLFEVNPQKRSVKLLLSSETPIEGKKMSFVNDLTVTRDGRKIYFTDSSSKWQRRDYLLLVMEATDDGRLLEYDTVTKEVKVLLDQLQFPNGVQLSPEEDFVLVAETTMARIRRVYVSGLMKGGADMFVENMPGFPDNIRPSSSGGYWVAAATIRANPGFSMLDFLSDKPFIKRMIFKMFSQETVMKFVPRYSLVLEVSDSGAFRRSLHDPDGQV--VTYVSEAHEHDGYLYLGSFRSPFI 407          
BLAST of Str_synth domain-containing protein vs. UniProt/SwissProt
Match: sp|Q803F5|APMAP_DANRE (Adipocyte plasma membrane-associated protein OS=Danio rerio OX=7955 GN=apmap PE=2 SV=1)

HSP 1 Score: 159.073 bits (401), Expect = 6.063e-43
Identity = 104/331 (31.42%), Postives = 171/331 (51.66%), Query Frame = 2
Query:  200 LSWNEVDRKFPNQLIGPEAFTIDAITGDI-YTGTAEGMIWKLNRELTTIEPIIRVGEDHPNCGSEHVAHICGRVLGLKLFNSETLIVADSYRGIISINLKTKIKEILVEKDKSEMTKSLKLFNSLDISTNGV-IYFTISSLKWSLKDLIYSILEGDNSGRIYSFSMFTKELKILASDLYLPSGLALDPDGKSLIVSEVNKRRLIKLDLSK-QSNNIEVIMDKLNGFPANVRGDLRNNYYLAM----PMTGIIETLSFLYKYPIINYSIAYLVPKWAILKLIGSDSKIYKFDDHGRII-AIIDGTHPGTDFVTEAYEADSKILLGSLSHPYL 1168
            L   + +R F  +L+GPE+    A  GD+ YTGTA+G I K+  E   I  +  +G+  P CGS    H CGR LG+++  + TL VAD+Y G+  +N  T   + LV  +K    + L   N LD++ +G  +YFT SS +W  +D ++ I+E    GR+  +   TKE+ ++  +L  P+G+ L PD +S++V+E    R+ ++ +S      ++  ++ L GFP N+R      Y++AM    P  G    L FL + P +   I  L  +  +LK +   S + +    G  + +  D     + + +EA+E    + LGS   PYL
Sbjct:   85 LKLRQAERLFEERLVGPESL---ANIGDVFYTGTADGKIVKI--EGRNIHVLATIGK--PPCGSREHEHTCGRPLGIRVGPNGTLFVADAYLGLFEVNPVTGEVKSLVSTEKRIAGRRLGFVNDLDVTQDGKKVYFTDSSSRWQRRDFMHLIMEATADGRVLEYDTETKEVNVMMENLRFPNGIQLFPDEESVLVAETTMARIKRVHVSGLNKGGMDTFIENLPGFPDNIRRSSSGGYWVAMSAVRPNPG-FSMLDFLSQRPWLKKLIFKLFSQDTLLKFVPRYSLVVELQSDGTCVRSFHDPQGLVSAYSSEAHEYSGHLYLGSFRSPYL 407          
BLAST of Str_synth domain-containing protein vs. UniProt/SwissProt
Match: sp|B5X3B2|APMAP_SALSA (Adipocyte plasma membrane-associated protein OS=Salmo salar OX=8030 GN=apmap PE=2 SV=1)

HSP 1 Score: 155.606 bits (392), Expect = 9.411e-42
Identity = 108/329 (32.83%), Postives = 169/329 (51.37%), Query Frame = 2
Query:  209 NEVDRKFPNQLIGPEAFTIDAITGD-IYTGTAEGMIWKLNRELTTIEPIIRVGEDHPNC-GSEHVAHICGRVLGLKLFNSETLIVADSYRGIISINLKTKIKEILVEKDKSEMTKSLKLFNSLDISTNGV-IYFTISSLKWSLKDLIYSILEGDNSGRIYSFSMFTKELKILASDLYLPSGLALDPDGKSLIVSEVNKRRLIKLDLSK-QSNNIEVIMDKLNGFPANVRGDLRNNYYLAM----PMTGIIETLSFLYKYPIINYSIAYLVPKWAILKLIGSDSKIYKFDDHGRIIAIIDGTHPG-TDFVTEAYEADSKILLGSLSHPYL 1168
             E  R F +QL+GPE+    A  GD IYTGTA+G I K+  +  T+  I R+G+  P C GS      CGR LG+++  + TL VAD+Y G+  +N  T     LV   +    + L   N LD++ +G  +YFT SS +W  +D ++ I+E    GR+  +   TKE+ +L  +L   +G+ L PD +S++V+E    R+ ++ +S      ++  +D L GFP N+R      Y++AM    P  G    L FL + P I   I  L  +  ++K +   S + +  + G  +      H     +V+EA+E D  + LGS   PYL
Sbjct:   88 REAQRLFEDQLVGPESI---ANFGDLIYTGTADGKIVKIEGKSITV--IARLGK--PPCDGSREQEPSCGRPLGIRVGPNGTLFVADAYLGLFKVNPVTGEVTNLVSAGQMVGGRRLSFVNDLDVTQDGRKVYFTDSSSRWQRRDYLHLIMEATADGRVLEYDTETKEVTVLMENLRFANGIQLFPDEESVLVAETTMARIRRVHVSGLNKGGMDTFVDNLPGFPDNIRRSSSGGYWVAMSAVRPNPG-FSMLDFLSQKPWIKKLIFKLFSQDVLMKFVPRYSLVIELQESGACMRSFHDPHGMVAAYVSEAHEHDGHLYLGSFRSPYL 408          
BLAST of Str_synth domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9HDC9|APMAP_HUMAN (Adipocyte plasma membrane-associated protein OS=Homo sapiens OX=9606 GN=APMAP PE=1 SV=2)

HSP 1 Score: 150.984 bits (380), Expect = 4.821e-40
Identity = 108/374 (28.88%), Postives = 187/374 (50.00%), Query Frame = 2
Query:   89 IVGISVFLFLLAPKVIIDSKVKVINEEVSAPPNEVKRLSWN----EVDRKFPNQLIGPEAFTIDAITGDI-YTGTAEGMIWKLNRELTTIEPIIRVGEDHPNCGSEHVAHICGRVLGLKLFNSETLIVADSYRGIISINLKTKIKEILVEKDKSEMTKSLKLFNSLDISTNGV-IYFTISSLKWSLKDLIYSILEGDNSGRIYSFSMFTKELKILASDLYLPSGLALDPDGKSLIVSEVNKRRLIKLDLSK-QSNNIEVIMDKLNGFPANVRGDLRNNYYLAM----PMTGIIETLSFLYKYPIINYSIAYLVPKWAILKLIGSDSKIYKFDDHG---RIIAIIDGTHPGTDFVTEAYEADSKILLGSLSHPYL 1168
            ++ +S+ + LL   ++++S +         PP  +  L  N    + +R F NQL+GPE+    A  GD+ +TGTA+G + KL  E   IE I R G     C +     +CGR LG++   + TL VAD+Y+G+  +N   +  ++L+  +     K++   N L ++ +G  IYFT SS KW  +D +  ++EG + GR+  +   T+E+K+L   L  P+G+ L P    ++V+E    R+ ++ +S       ++ ++ + GFP N+R      Y++ M    P  G    L FL + P I   I  L  +  ++K +   S + +  D G   R +   DG      +++E +E D  + LGS   P+L
Sbjct:   45 MLAVSLTVPLLGAMMLLESPIDPQPLSFKEPPLLLGVLHPNTKLRQAERLFENQLVGPESI---AHIGDVMFTGTADGRVVKL--ENGEIETIARFGSG--PCKTRDDEPVCGRPLGIRAGPNGTLFVADAYKGLFEVNPWKREVKLLLSSETPIEGKNMSFVNDLTVTQDGRKIYFTDSSSKWQRRDYLLLVMEGTDDGRLLEYDTVTREVKVLLDQLRFPNGVQLSPAEDFVLVAETTMARIRRVYVSGLMKGGADLFVENMPGFPDNIRPSSSGGYWVGMSTIRPNPG-FSMLDFLSERPWIKRMIFKLFSQETVMKFVPRYSLVLELSDSGAFRRSLHDPDGLV--ATYISEVHEHDGHLYLGSFRSPFL 408          
BLAST of Str_synth domain-containing protein vs. UniProt/SwissProt
Match: sp|Q7TP48|APMAP_RAT (Adipocyte plasma membrane-associated protein OS=Rattus norvegicus OX=10116 GN=Apmap PE=2 SV=2)

HSP 1 Score: 148.288 bits (373), Expect = 2.252e-39
Identity = 107/372 (28.76%), Postives = 183/372 (49.19%), Query Frame = 2
Query:   89 IVGISVFLFLLAPKVIIDSKVKVINEEVSAPPNEVKRLSWN----EVDRKFPNQLIGPEAFTIDAITGDIYTGTAEGMIWKLNRELTTIEPIIRVGEDHPNCGSEHVAHICGRVLGLKLFNSETLIVADSYRGIISINLKTKIKEILVEKDKSEMTKSLKLFNSLDISTNGV-IYFTISSLKWSLKDLIYSILEGDNSGRIYSFSMFTKELKILASDLYLPSGLALDPDGKSLIVSEVNKRRLIKLDLSK-QSNNIEVIMDKLNGFPANVRGDLRNNYYLAMPMTGI---IETLSFLYKYPIINYSIAYLVPKWAILKLIGSDSKIYKFDDHG---RIIAIIDGTHPGTDFVTEAYEADSKILLGSLSHPYL 1168
            ++ +S+ + LL   ++++S +   +     PP     L  N    + +R F NQL GPE  +I  I   ++TGTA+G + KL  E   IE I R G     C +      CGR LG+++  + TL V D+Y+G+  +N + +  ++L+  +     K +   N L I+ +G  IYFT SS KW  +D +  ++EG + GR+  +   TKE+K+L   L  P+G+ L P+   ++V+E    R+ ++ +S       ++ ++ + GFP N+R      Y++A            L FL   P I   I  L  +  ++K +   S + +  D G   R +   DG      +V+EA+E D  + LGS   P++
Sbjct:    5 MLAVSLAIPLLGAMMLLESPIDPQSFSFKEPPFMFGVLQPNTKLRQAERLFENQLNGPE--SIVNIGDVLFTGTADGRVVKL--ENGEIETIARFGSGP--CKTRDDEPTCGRPLGIRVGPNGTLFVVDAYKGLFEVNPQKRSVKLLLSSETPIEGKKMSFVNDLTITRDGRKIYFTDSSSKWQRRDYLLLVMEGTDDGRLLEYDTVTKEVKVLLDQLQFPNGVQLSPEEDFVLVAETAMARIRRVYVSGLMKGGADMFVENMPGFPDNIRPSSSGGYWVAAATIRANPGFSMLDFLSDKPFIKRMIFKLFSQETVMKFVPRYSLVLEVSDSGAFRRSLHDPDGQV--VTYVSEAHEHDGYLYLGSFRSPFI 368          
BLAST of Str_synth domain-containing protein vs. UniProt/SwissProt
Match: sp|Q5ZIF1|APMAP_CHICK (Adipocyte plasma membrane-associated protein OS=Gallus gallus OX=9031 GN=APMAP PE=2 SV=1)

HSP 1 Score: 149.058 bits (375), Expect = 2.843e-39
Identity = 107/366 (29.23%), Postives = 182/366 (49.73%), Query Frame = 2
Query:  101 SVFLFLLAPKVIIDSKVKVINEEVSAPPNEVKRLSWN----EVDRKFPNQLIGPEAFTIDAITGDIYTGTAEGMIWKLNRELTTIEPIIRVGEDHPNCGSEHVAHICGRVLGLKLFNSETLIVADSYRGIISINLKTKIKEILVEKDKSEMTKSLKLFNSLDISTNGV-IYFTISSLKWSLKDLIYSILEGDNSGRIYSFSMFTKELKILASDLYLPSGLALDPDGKSLIVSEVNKRRLIKLDLSK-QSNNIEVIMDKLNGFPANVRGDLRNNYYLAMPMTGI---IETLSFLYKYPIINYSIAYLVPKWAILKLIGSDSKIYKFDDHGRI-IAIIDGTHPGTDFVTEAYEADSKILLGSLSHPYL 1168
            S+ + LL   V++D  +      +  PP     L  N    + +R + NQL+GPE+  I  I   ++TGTA+G I K+  E   ++ + R+G  H  CG+      CGR LG+++  + TL VAD+Y G+  +N  T   ++LV        + L   N L ++ +G  IYFT SS KW  +D ++ ++EG + GR+  +   TKE+K+L   L  P+G+ L P    ++V E    R+ +  +S       ++ ++ + G P N+R      Y++AMP+         L FL + P I   I  L+ +  + KL+   S + +  + G    +  D T     +V+EA+E +  + LGS   P++
Sbjct:   48 SLAVPLLGATVLLDCPIDPQPISLKEPPLLTGVLEPNNKLQKAERLWENQLVGPES--IVNIGDVLFTGTADGKILKI--EDGEVQTVARIG--HGPCGTPEDEPTCGRPLGIRVGPNNTLFVADAYYGLYEVNPGTGETKMLVSTKTLIEGQKLSFLNDLTVTQDGRKIYFTDSSSKWQRRDFLFLVMEGTDDGRLLEYDTVTKEVKVLMVGLRFPNGVQLSPAEDFVLVLETAMARIRRYYVSGLMKGGADMFVENMPGLPDNIRLSSSGGYWVAMPVVRPNPGFSMLDFLSEKPWIKRMIFKLLSQETVTKLLPKRSLVVELSETGSYRRSFHDPTGLTVPYVSEAHEHNGYLYLGSFRSPFI 407          
BLAST of Str_synth domain-containing protein vs. TrEMBL
Match: T2M5K2 (Adipocyte plasma membrane-associated protein (Fragment) OS=Hydra vulgaris OX=6087 GN=APMAP PE=2 SV=1)

HSP 1 Score: 183.726 bits (465), Expect = 9.807e-50
Identity = 115/319 (36.05%), Postives = 171/319 (53.61%), Query Frame = 2
Query:  233 NQLIGPEAFTIDAITGDIYTGTAEGMIWKLNRELTTIEPIIRVGEDHPNCGSEHVAHICGRVLGLKL-FNSETLIVADSYRGIISINLKTKIKEILVEKDKSEMTKSLKLFNSLDISTNGVIYFTISSLKWSLKDLIYSILEGDNSGRIYSFSMFTKELKILASDLYLPSGLALDPDGKSLIVSEVNKRRLIKLDLSKQSNNI-EVIMDKLNGFPANVRGDLRNNYYLAMPMTGIIE-TLSFL---YKYPIINYSIAYLVPKWAILKLIGSDSKIYKFDDHGRII-AIIDGTHPGTDFVTEAYEADSKILLGSLSHPYL 1168
             +L GPE+  +D   GD+YTG  +G I K+ +    I+ + R GE+H NCG + + HICGR LG++L    E L + D Y G++S+NL ++    LV   K       K  N L +++NG IYFT SS +W  K   Y +LEG   GR+ S+   T E ++L S L+ P+G+ L PD   L++ E    R+++L +S     I +V  D L GFP N+R  L   Y++A+P  GI +   SFL     YP I   IA LVPK  I   +       K D++G II +  D +     F++E +E    + LGS  + ++
Sbjct:  104 GKLQGPESIQVDR-NGDVYTGLHDGRIVKILKS-GEIKELARTGENHKNCGEDTMEHICGRPLGIQLDKKEENLFICDGYFGLMSLNLASERLTTLVPASKGIKNVPFKFLNHLTVASNGKIYFTDSSWRWDRKSYAYMLLEGGGKGRVLSYDTKTGETELLLSGLFFPNGITLSPDEDFLLICETASSRILRLFISGSQKGIYDVFQDNLPGFPDNIRTSLEGGYWVALP--GIRKWPFSFLDIVGPYPKIKSLIAKLVPKVHIDGFLKPYGLFIKIDEYGDIIKSYHDPSGATIGFISEVFEDKGVLYLGSFKNNFM 418          
BLAST of Str_synth domain-containing protein vs. TrEMBL
Match: V3ZMC1 (Str_synth domain-containing protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_197037 PE=4 SV=1)

HSP 1 Score: 171.4 bits (433), Expect = 3.362e-45
Identity = 103/327 (31.50%), Postives = 177/327 (54.13%), Query Frame = 2
Query:  212 EVDRKFPNQLIGPEAFTIDAITGDIYTGTAEGMIWKLNRELTTIEPIIRVGEDHPNCGSEHVAHICGRVLGLKLFNSETLIVADSYRGIISINLKTKIKEILVEKDKSEMTKSLKLFNSLDISTNGVIYFTISSLKWSLKDLIYSILEGDNSGRIYSFSMFTKELKILASDLYLPSGLALDPDGKSLIVSEVNKRRLIKLDLS-KQSNNIEVIMDKLNGFPANVRGDLRNNYYLAM---PMTGIIETLSFL---YKYPIINYSIAYLVPKWAILKLIGSDSKIYKFDDHGRIIAII-DGTHPGTDFVTEAYEADSKILLGSLSHPYL 1168
             VD+ F NQ+IGPE+FT D   G +YTG+A+G IW+       +E + R G ++ +CGS  +   CGR  G+K+  +  L++ D+Y+G++ +NL+ K  E+LV  D  ++ + L+  N L I+++G+I+FT SS KW  ++  Y ++E ++ GR+ SF+  T ++K++   LYL +GL L  D   L++ E+   R+IK  L+  ++   EV ++ L G+P N++ +   NY++ M      G      FL     YP     +A + P+      +   + + +    G+I A   D T      V E Y+    I +G  S P++
Sbjct:   66 RVDKLFENQVIGPESFTADQ-NGFVYTGSADGKIWRFKD--GQLEMLARTGINNSHCGSFELEPECGRPKGMKIDKNGDLVLVDAYKGLLKVNLQNKNIEVLVRPDTDQLREPLRFLNGLAITSDGMIFFTDSSTKWDRRNYRYEVIETNSYGRLLSFNPTTDQVKVVLEGLYLANGLVLSQDESYLLIVEMTVSRIIKYHLTGSRAGEREVFIENLPGYPDNIQLNSAGNYFVGMGSVKFEGSSRLGPFLDNIGPYPWFKRFLAKVTPRPLFDVFLPRHAMLVEISPKGKIAASYHDPTGSVVRGVGEGYQHGVYIYIGHFSMPFV 389          
BLAST of Str_synth domain-containing protein vs. TrEMBL
Match: A0A2D0QP06 (adipocyte plasma membrane-associated protein OS=Ictalurus punctatus OX=7998 GN=apmap PE=4 SV=1)

HSP 1 Score: 169.088 bits (427), Expect = 2.912e-44
Identity = 115/378 (30.42%), Postives = 195/378 (51.59%), Query Frame = 2
Query:   83 LSIVGISVFLFL--LAPKVIIDSKVKVINEEVSAPPNEV----KRLSWNEVDRKFPNQLIGPEAFTIDAITGDI-YTGTAEGMIWKLN-RELTTIEPIIRVGEDHPNCGSEHVAHICGRVLGLKLFNSETLIVADSYRGIISINLKTKIKEILVEKDKSEMTKSLKLFNSLDISTNGV-IYFTISSLKWSLKDLIYSILEGDNSGRIYSFSMFTKELKILASDLYLPSGLALDPDGKSLIVSEVNKRRLIKLDLSK-QSNNIEVIMDKLNGFPANVRGDLRNNYYLAM----PMTGIIETLSFLYKYPIINYSIAYLVPKWAILKLIGSDSKIYKFDDHGRIIAIIDGTHPGT--DFVTEAYEADSKILLGSLSHPYL 1168
            ++++ ++VFL L  L    ++DS ++     ++ PP         L   + +R F +QLIGPE+    A  GDI YTGTA+G I K++ R++  +  + +     P CGS    H+CGR LG+++  + TL VAD+Y G+  +N  T    +LV        + L   N LD++ +G  +YFT SS +W  +D +  I+E    GR+  +   TKE+ ++  +L  P+G+ L PD +S++V+E    R+ ++ ++      ++  ++ L GFP N+R      Y++AM    P  G    L FL + P I   I  L  +  ++K +   S + +  D G  +      H GT   +++EA+E +  + LGS   PYL
Sbjct:   40 VTLLSLAVFLILPVLVVTFLLDSPIQPEAFSLNEPPLMTGCFEPNLKLRQAERLFEDQLIGPESI---ANIGDILYTGTADGRIVKIDGRKINVVATLGK-----PPCGSPEQEHVCGRPLGIRVGPNGTLFVADAYLGLFEVNPVTGETTLLVSTKMMVGGRRLSFVNDLDVTQDGKKVYFTDSSSRWQRRDFMKLIMEATADGRVLEYDTETKEVAVMMENLRFPNGIQLLPDEESVLVAETTMARIRRIHVAGLNKGGMDTFIENLPGFPDNIRRSSSGGYWVAMSAIRPNPG-FSMLDFLSQRPWIKNVIFKLFSQETLMKFVPRYSLVVELQDGGTCVRSFHDPH-GTVAAYISEAHEHNGHLYLGSFRSPYL 407          
BLAST of Str_synth domain-containing protein vs. TrEMBL
Match: E3TDF7 (Adipocyte plasma membrane-associated protein OS=Ictalurus furcatus OX=66913 GN=APMAP PE=2 SV=1)

HSP 1 Score: 167.933 bits (424), Expect = 8.411e-44
Identity = 114/378 (30.16%), Postives = 194/378 (51.32%), Query Frame = 2
Query:   83 LSIVGISVFLFL--LAPKVIIDSKVKVINEEVSAPPNEV----KRLSWNEVDRKFPNQLIGPEAFTIDAITGDI-YTGTAEGMIWKLN-RELTTIEPIIRVGEDHPNCGSEHVAHICGRVLGLKLFNSETLIVADSYRGIISINLKTKIKEILVEKDKSEMTKSLKLFNSLDISTNGV-IYFTISSLKWSLKDLIYSILEGDNSGRIYSFSMFTKELKILASDLYLPSGLALDPDGKSLIVSEVNKRRLIKLDLSK-QSNNIEVIMDKLNGFPANVRGDLRNNYYLAM----PMTGIIETLSFLYKYPIINYSIAYLVPKWAILKLIGSDSKIYKFDDHGRIIAIIDGTHPGT--DFVTEAYEADSKILLGSLSHPYL 1168
            ++++ ++VFL L  L    ++DS ++     ++ PP         L   + +R F +QLIGPE+    A  GDI YTGTA+G I K++ R++  +  + +     P CGS    H+CGR LG+++  + TL VAD+Y G+  +N  T    +LV        + L   N LD++ +G  +YFT SS +W  +D +  I+E    GR+  +   TKE+ ++  +L  P+G+ L PD +S++V+E    R+ ++ ++      ++  ++ L GFP N+R      Y++AM    P  G    L FL + P I   I     +  ++K +   S + +  D G  +      H GT   +++EA+E +  + LGS   PYL
Sbjct:   40 VTLLSLAVFLILPVLVVTFLLDSPIQPEAFSLNEPPLMTGCFEPNLKLRQAERLFEDQLIGPESI---ANIGDILYTGTADGRIVKIDGRKINVVATLGK-----PPCGSPEQEHVCGRPLGIRVGPNGTLFVADAYLGLFEVNPVTGETTLLVSTKMMVGGRRLSFVNDLDVTQDGKKVYFTDSSSRWQRRDFMKLIMEATADGRVLEYDTETKEVAVMMENLRFPNGIQLLPDEESVLVAETTMARIRRIHVAGLNKGGMDTFIENLPGFPDNIRRSSSGGYWVAMSAIRPNPG-FSMLDFLSQRPWIKNVIFKFFSQETLMKFVPRYSLVVELQDGGTCVRSFHDPH-GTVAAYISEAHEHNGHLYLGSFRSPYL 407          
BLAST of Str_synth domain-containing protein vs. TrEMBL
Match: A0A5N5PSG1 (Uncharacterized protein OS=Pangasianodon hypophthalmus OX=310915 GN=PHYPO_G00181520 PE=4 SV=1)

HSP 1 Score: 167.548 bits (423), Expect = 9.728e-44
Identity = 113/378 (29.89%), Postives = 196/378 (51.85%), Query Frame = 2
Query:   83 LSIVGISVFLFL--LAPKVIIDSKVKVINEEVSAPPNEV----KRLSWNEVDRKFPNQLIGPEAFTIDAITGDI-YTGTAEGMIWKLN-RELTTIEPIIRVGEDHPNCGSEHVAHICGRVLGLKLFNSETLIVADSYRGIISINLKTKIKEILVEKDKSEMTKSLKLFNSLDISTNGV-IYFTISSLKWSLKDLIYSILEGDNSGRIYSFSMFTKELKILASDLYLPSGLALDPDGKSLIVSEVNKRRLIKLDLSK-QSNNIEVIMDKLNGFPANVRGDLRNNYYLAM----PMTGIIETLSFLYKYPIINYSIAYLVPKWAILKLIGSDSKIYKFDDHGRIIAIIDGTHPGT--DFVTEAYEADSKILLGSLSHPYL 1168
            ++++ ++ FL L  L    +++S ++     ++ PP         L   + +R F +QL+GPE+    A  GDI YTGTA+G I K++ R+++ +  + +     P CGS    H+CGR LG+++  + TL VAD+Y G+  +N  T    +LV   K    + L   N LD++ +G  +YFT SS +W  +D +  I+E    GR+  +   TKE+ ++  +L  P+G+ L PD +S++V+E    R+ ++ ++      ++  ++ L GFP N+R      Y++AM    P  G    L FL + P I   I  L  +  ++K +   S + +  D G  +      H GT   +++EA+E +  + LGS   PYL
Sbjct:   40 VTLLSLAAFLILPVLVVTFLLESPIQPEAFSLNEPPLMTGCFEPNLKLRQAERLFEDQLVGPESI---ANIGDILYTGTADGRIVKIDGRKISVVATLGK-----PPCGSPEQEHVCGRPLGIRVGPNGTLFVADAYLGLFEVNPVTGETTLLVSTKKMIGGRRLSFVNDLDVTQDGKKVYFTDSSSRWQRRDFMKLIMEATADGRVLEYDTETKEVAVMMENLRFPNGIQLLPDEESVLVAETTMARIRRIHVAGLNKGGMDTFIENLPGFPDNIRRSSSGGYWVAMSAIRPNPG-FSMLDFLSQRPWIKNIIFKLFSQETLMKFVPRYSLVVELQDGGTCVRSFHDPH-GTVAAYISEAHEHNGHLYLGSFRSPYL 407          
BLAST of Str_synth domain-containing protein vs. Ensembl Cavefish
Match: apmap (adipocyte plasma membrane associated protein [Source:NCBI gene;Acc:103045944])

HSP 1 Score: 163.696 bits (413), Expect = 1.364e-45
Identity = 113/376 (30.05%), Postives = 188/376 (50.00%), Query Frame = 2
Query:   80 SLSIVGISVFLFLLAPKVIIDSKVKVINEEVSAPPNEV----KRLSWNEVDRKFPNQLIGPEAFTIDAITGDI-YTGTAEGMIWKLN-RELTTIEPIIRVGEDHPNCGSEHVAHICGRVLGLKLFNSETLIVADSYRGIISINLKTKIKEILVEKDKSEMTKSLKLFNSLDISTNG-VIYFTISSLKWSLKDLIYSILEGDNSGRIYSFSMFTKELKILASDLYLPSGLALDPDGKSLIVSEVNKRRLIKLDLSK-QSNNIEVIMDKLNGFPANVRGDLRNNYYLAM----PMTGIIETLSFLYKYPIINYSIAYLVPKWAILKLIGSDSKIYKFDDHGRIIAIIDGTHPG-TDFVTEAYEADSKILLGSLSHPYL 1168
            +L  +G  V   LL    I++S ++     ++ PP         L   + +R   +QL+GPE+    A  GD+ YTGT++G I K++ R++T +  +       P CGS    H+CGR LG+K+  + TL VAD+Y G+  +N  T    +LV   K    + L   N LD++ +G  +YFT SS +W  +D +  I+E    GR+  +   TKE+ ++  +L  P+G+ L PD +S++V+E    R+ ++ ++      ++  +D L GFP N+R      Y++AM    P  G    L FL + P I   I  L  +  ++K +   S + +  D G  +      H      ++EA+E +  + LGS   PYL
Sbjct:   41 TLLTLGGFVLFPLLVVVFILESPIQPEAFSLNEPPLMTGCFEPNLKLRQAERLLEDQLVGPESI---ANIGDVLYTGTSDGKIVKIDGRKITVLATL-----GQPPCGSREQEHVCGRPLGIKVGPNGTLFVADAYLGLFEVNPVTGESTLLVSTRKMVGGRRLSFVNDLDVTQDGKKLYFTDSSSRWQRRDYLNLIMEATADGRVLEYDFETKEVTVMMENLRFPNGIQLFPDEESVLVAETTMARIRRVHVAGLNKGGMDTFIDNLPGFPDNIRRSSSGGYWVAMSAVRPNPG-FSMLDFLSQRPWIKKLIFKLFSQDMLMKFVPRYSLVVELQDGGTCVRSFHDPHGMVAAHISEAHEHNGHLYLGSFRSPYL 407          
BLAST of Str_synth domain-containing protein vs. Ensembl Cavefish
Match: zgc:194209 (adipocyte plasma membrane-associated protein-like [Source:NCBI gene;Acc:111192870])

HSP 1 Score: 137.502 bits (345), Expect = 2.426e-36
Identity = 76/223 (34.08%), Postives = 121/223 (54.26%), Query Frame = 2
Query:  221 RKFPNQLIGPEAFTIDAITGDIYTGTAEGMIWKLNRELTTIEPIIRVGEDHPNCG-SEHVAHICGRVLGLKLFNSETLIVADSYRGIISINLKTKIKEILVEKDKSEMTKSLKLFNSLDISTNGVIYFTISSLKWSLKDLIYSILEGDNSGRIYSFSMFTKELKILASDLYLPSGLALDPDGKSLIVSEVNKRRLIKLDL-SKQSNNIEVIMDKLNGFPANVR 883
            R F  QL GPE+FT D   G++YTGT +G +W++N E  T   I ++G++ P CG S     +CGR  GL+L     LIVADSY G+  ++  T  K +L    +          N L+IS NG ++FT SS +W  + + Y +LE +  GR+ S+   +  ++ L   LY+P+G A   D   L+++E +   + +  L   ++   E  M+ + G+P N+R
Sbjct:   54 RLFAGQLKGPESFTADQ-NGNVYTGTVDGKLWRINNETLTF--ITQMGQNLPECGTSTDYEPVCGRPHGLRLDRHGQLIVADSYFGLFKVDPWTGQKTLLHSSKEGADGIPFGFLNGLEISKNGTVFFTDSSSRWGRRHVRYEVLETNRLGRLLSYDPESGSVRTLLDSLYMPNGFAFSADEDFLLLAETSIGHISRFWLKGHKAGTKETAMNNMVGYPDNIR 273          
BLAST of Str_synth domain-containing protein vs. Ensembl Cavefish
Match: zgc:194209 (zgc:194209 [Source:ZFIN;Acc:ZDB-GENE-081022-75])

HSP 1 Score: 79.7221 bits (195), Expect = 4.328e-16
Identity = 43/100 (43.00%), Postives = 60/100 (60.00%), Query Frame = 2
Query:  221 RKFPNQLIGPEAFTIDAITGDIYTGTAEGMIWKLNRELTTIEPIIRVGEDHPNCG-SEHVAHICGRVLGLKLFNSETLIVADSYRGIISINLKTKIKEIL 517
            R F  QL GPE+FT D   G++YTGT +G +W++N E  T   I ++G++ P CG S     +CGR  GL+L     LIVADSY G+  ++  T  K +L
Sbjct:   64 RLFAGQLKGPESFTADQ-NGNVYTGTVDGKLWRINNETLTF--ITQMGQNLPECGTSTDYEPVCGRPHGLRLDRHGQLIVADSYFGLFKVDPWTGQKTLL 160          
BLAST of Str_synth domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000047164.1 (pep primary_assembly:Astyanax_mexicanus-2.0:22:30628974:30637974:1 gene:ENSAMXG00000043132.1 transcript:ENSAMXT00000047164.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 63.5438 bits (153), Expect = 7.771e-11
Identity = 39/100 (39.00%), Postives = 56/100 (56.00%), Query Frame = 2
Query:  221 RKFPNQLIGPEAFTIDAITGDIYTGTAEGMIWKLNRE-LTTIEPIIRVGED--HPNCGSEHVAHICGRVLGLKLFNSETLIVADSYRGI-ISINLKTKIK 508
            R F  QL GPE+FT D   G++YTGT +G +W++N E LT I  + R+ ++             +CGR  GL+L     LIVADSY G+ + I   T ++
Sbjct:   48 RLFAGQLKGPESFTADQ-NGNVYTGTVDGKLWRINNETLTFITQMARIFQNVVRNQILRTDYEPVCGRPHGLRLDRHGQLIVADSYFGLFVYIFFHTAVR 146          
BLAST of Str_synth domain-containing protein vs. Ensembl Sea Lamprey
Match: apmap (adipocyte plasma membrane associated protein [Source:NCBI gene;Acc:266637])

HSP 1 Score: 95.5153 bits (236), Expect = 4.781e-23
Identity = 65/223 (29.15%), Postives = 107/223 (47.98%), Query Frame = 2
Query:  551 LKLFNSLDISTNGV-IYFTISSLKWSLKDLIYSILEGDNSGRIYSFSMFTKELKILASDLYLPSGLALDPDGKSLIVSEVNKRRLIKLDLSKQ-SNNIEVIMDKLNGFPANVRGDLRNNYYLAM----PMTGIIETLSFLYKYPII---------NYSIAYLVPKWAILKLIGSDSKIYK--FDDHGRIIAIIDGTHPGTDFVTEAYEADSKILLGSLSHPYL 1168
            +   N L ++++G  IYFT SS KW  ++  Y ++E    GR++ ++M    L++L   L  P+G+ L P+  +L+V+E    R++K  LS Q +   E+  D L GFP N+R      Y+LAM    P  G    + FL   P +            I   VP+  +L  +G D  +++   D  G ++            V+EA+E D  + LGS   P++
Sbjct:    9 MGFINDLTVTSDGTRIYFTDSSSKWQRRNNRYLVMEATADGRLFEYNMVQDSLRLLMDGLRFPNGVQLTPNEDALLVAETTMARVLKYRLSGQLAGASEIFADNLPGFPDNIRASGTGGYWLAMAGVRPNPG-FSFVDFLAPRPWLKSLIFKVLSQEVIMQFVPRHGLLLELGPDGAVWRSLHDPAGTMVPS----------VSEAHEHDGWLYLGSYHAPFI 220          
BLAST of Str_synth domain-containing protein vs. Ensembl Nematostella
Match: EDO43012 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZV5])

HSP 1 Score: 152.525 bits (384), Expect = 1.910e-42
Identity = 97/330 (29.39%), Postives = 169/330 (51.21%), Query Frame = 2
Query:  209 NEVDRKFPNQLIGPEAFTIDAITGDIYTGTAEGMIWKLNRELTTIEPIIRVGEDHPNCGSEHVAHICGRVLGLKLFNSET-LIVADSYRGIISINLKTKIKEILVEKDKSEMTKSLKLFNSLDISTNGVIYFTISSLKWSLKDLIYSILEGDNSGRIYSFSMFTKELKILASDLYLPSGLALDPDGKSLIVSEVNKRRLIK-LDLSKQSNNIEVIMDKLNGFPANVRGDLRNNYYLAM-----PMTGIIETL-------SFLYKYPIINYSIAYLVPKWAILKLIGSDSKIYK--FDDHGRIIAIIDGTHPGTDFVTEAYEADSKILLGS 1150
             E ++ F  Q++GPE+  +D+ +G IYTG A+G I K   +   +  ++R G  +  CG   + H+CGR LG++     T LIV D+Y G++ ++ K+     LV        + ++  N LDI+ +G IYFT SS KW       ++LEGDN+GR+ +F   T EL++L SDL+  +G+ L P+G  ++V E+   R+++     +    +EV  + L G P N+R      Y++ M     P   +++TL       S L K+ +    +  L P++ ++  +     + +   D  G++I          + V+E +E +  + LGS
Sbjct:   40 QESEQLFKGQVVGPESIAVDS-SGIIYTGLADGRIVKFVGD--KVVDVVRTGTHNDGCGRPELEHVCGRPLGMRFNRYGTKLIVVDAYFGLLEVDTKSSSISTLVPCQPGVDGEPIRFMNDLDIAQDGTIYFTDSSTKWQRMHFSNALLEGDNTGRLLAFHPKTGELEVLMSDLHFANGVQLSPEGDFVLVVELLTARILRYYTRGENEGKMEVFAENLPGHPDNIRPSFGGGYWVGMAAPRRPGLSLLDTLSTRPWLRSLLAKF-VTPEMLHVLAPRYGLIVKLSKGGSVQRTLHDPTGQVI----------NGVSEVHEENGVLYLGS 355          
BLAST of Str_synth domain-containing protein vs. Ensembl Medaka
Match: apmap (adipocyte plasma membrane associated protein [Source:NCBI gene;Acc:101173572])

HSP 1 Score: 146.747 bits (369), Expect = 2.330e-39
Identity = 102/331 (30.82%), Postives = 167/331 (50.45%), Query Frame = 2
Query:  200 LSWNEVDRKFPNQLIGPEAFTIDAITGDI-YTGTAEGMIWKL-NRELTTIEPIIRVGEDHPNCGSEHVAHICGRVLGLKLFNSETLIVADSYRGIISINLKTKIKEILVEKDKSEMTKSLKLFNSLDISTNGV-IYFTISSLKWSLKDLIYSILEGDNSGRIYSFSMFTKELKILASDLYLPSGLALDPDGKSLIVSEVNKRRLIKLDLSK-QSNNIEVIMDKLNGFPANVRGDLRNNYYLAMPMTGI---IETLSFLYKYPIINYSIAYLVPKWAILKLIGSDSKIYKFDDHGRII-AIIDGTHPGTDFVTEAYEADSKILLGSLSHPYL 1168
            L   E  R F +Q++GPE+ T     GD+ YTGTA+G I KL  R + T+    R+G+  P CGS+    +CGR LG+++  + TL VAD+Y G+  +N  T  K  LV   +    + L   N + ++ +G  +YFT SS +W  ++ +  I+E    GR+  F   TKEL ++  +L  P+G+ L PD +S++V+E    R+ ++ ++      ++  ++ L GFP N+R      Y++AM           L FL + P I   I  L     ++K +   S + +  D G    +  D       +V+E +E    + LGS   PY+
Sbjct:   85 LKLRESQRLFEDQILGPESITN---IGDVLYTGTADGQILKLIGRRILTV---TRLGK--PPCGSKEDEPVCGRPLGIRVGPNGTLFVADAYLGLFEVNPSTGEKTRLVAGGEVVGGRKLSFINDVTVTRDGKKLYFTDSSSRWQRRNYMQLIMEATADGRVLEFDTETKELTVIMDNLRFPNGIHLLPDEESVLVAETTMARIRRVHVAGLNKGGMDTFVENLPGFPDNIRPSSSGGYWVAMSAVRANPGFSLLDFLSQRPWIKKLIFKLFSPDVLVKFVPRYSLVAELHDGGICTRSFHDPNGLVVAYVSEVHEHAGSLYLGSFRSPYI 407          
BLAST of Str_synth domain-containing protein vs. Ensembl Medaka
Match: zgc:194209 (adipocyte plasma membrane-associated protein-like [Source:NCBI gene;Acc:101166676])

HSP 1 Score: 138.272 bits (347), Expect = 4.115e-36
Identity = 96/334 (28.74%), Postives = 168/334 (50.30%), Query Frame = 2
Query:  221 RKFPNQLIGPEAFTIDAITGDIYTGTAEGMIWKLNRELTTIEPIIRVGEDHPNCG-SEHVAHICGRVLGLKLFNSETLIVADSYRGIISINLKTKIKEILVEKDKSEMTKSLKLFNSLDISTN-GVIYFTISSLKWSLKDLIYSILEGDNSGRIYSFSMFTKELKILASDLYLPSGLALDPDGKSLIVSEVNKRRLIKLDLSKQ-SNNIEVIMDKLNGFPANVRGDLRNNYYLAMPMTGIIE-TLSFL---YKYPIINYSIAYLV---------PKWAILKLIGSDSKIYK--FDDHGRIIAIIDGTHPGTDFVTEAYEADSKILLGSLSHPYL 1168
            R F  +L GPE+FT D   G++YTGT +G +W+++ +   +  I ++G++ P CG S     +CGR  GL++     LIVADSY G+ +++ +T  K +L    +          N L+IS   G IYFT SS +W  + +   ++E ++ GR+ S+   +  + +L   LY+P+G+AL PD   L+++E +  R+ +  L  Q +   EV++D + G+P N+R      + + +        T  FL     YP +   +A +V         P++A++  +G D +I     D  GR+   I          ++ ++   +  LGS   P+L
Sbjct:  111 RLFTGKLHGPESFTADE-DGNVYTGTVDGKLWRISPD-DNLTFITQMGQNLPECGFSTDYEPVCGRPHGLRMDRHNRLIVADSYLGLFAVDPQTGEKTLLRPNAEGADGVPFAFLNGLEISAQTGTIYFTDSSSRWGRRHVKLEVIELNSLGRLLSYDPRSGAVSVLLDSLYMPNGIALSPDEDFLLLAETSIGRIHRFWLKGQKAGTGEVVLDNMIGYPDNIRLSDHGTFLVGITTPRFRRLTPPFLDAIAPYPAVKRFLAKVVPLSWYNILLPRYALVLELGLDGRIVGSLHDPEGRLTWAI----------SDVFQHRGRTYLGSTDLPFL 432          
BLAST of Str_synth domain-containing protein vs. Planmine SMEST
Match: SMESG000052600.1 (SMESG000052600.1)

HSP 1 Score: 740.339 bits (1910), Expect = 0.000e+0
Identity = 368/369 (99.73%), Postives = 368/369 (99.73%), Query Frame = 2
Query:   65 MSLINSLSIVGISVFLFLLAPKVIIDSKVKVINEEVSAPPNEVKRLSWNEVDRKFPNQLIGPEAFTIDAITGDIYTGTAEGMIWKLNRELTTIEPIIRVGEDHPNCGSEHVAHICGRVLGLKLFNSETLIVADSYRGIISINLKTKIKEILVEKDKSEMTKSLKLFNSLDISTNGVIYFTISSLKWSLKDLIYSILEGDNSGRIYSFSMFTKELKILASDLYLPSGLALDPDGKSLIVSEVNKRRLIKLDLSKQSNNIEVIMDKLNGFPANVRGDLRNNYYLAMPMTGIIETLSFLYKYPIINYSIAYLVPKWAILKLIGSDSKIYKFDDHGRIIAIIDGTHPGTDFVTEAYEADSKILLGSLSHPYLD 1171
            MSLINSLSIVGISVFLFLLAPKVIIDSKVKVINEEVSAPPNEVKRLSWNEVDRKFPNQLIGPEAFTIDAITGDIYTGTAEGMIWKLNRELTTIEPIIRVGEDHPNCGSEHVAHICGRVLGLKLFNSETLIVADSYRGIISINLKTKIKEILVEKDKSEMTKSLKLFNSLDISTNGVIYFTISSLKWSLKD IYSILEGDNSGRIYSFSMFTKELKILASDLYLPSGLALDPDGKSLIVSEVNKRRLIKLDLSKQSNNIEVIMDKLNGFPANVRGDLRNNYYLAMPMTGIIETLSFLYKYPIINYSIAYLVPKWAILKLIGSDSKIYKFDDHGRIIAIIDGTHPGTDFVTEAYEADSKILLGSLSHPYLD
Sbjct:    1 MSLINSLSIVGISVFLFLLAPKVIIDSKVKVINEEVSAPPNEVKRLSWNEVDRKFPNQLIGPEAFTIDAITGDIYTGTAEGMIWKLNRELTTIEPIIRVGEDHPNCGSEHVAHICGRVLGLKLFNSETLIVADSYRGIISINLKTKIKEILVEKDKSEMTKSLKLFNSLDISTNGVIYFTISSLKWSLKDFIYSILEGDNSGRIYSFSMFTKELKILASDLYLPSGLALDPDGKSLIVSEVNKRRLIKLDLSKQSNNIEVIMDKLNGFPANVRGDLRNNYYLAMPMTGIIETLSFLYKYPIINYSIAYLVPKWAILKLIGSDSKIYKFDDHGRIIAIIDGTHPGTDFVTEAYEADSKILLGSLSHPYLD 369          
BLAST of Str_synth domain-containing protein vs. Planmine SMEST
Match: SMESG000052602.1 (SMESG000052602.1)

HSP 1 Score: 314.694 bits (805), Expect = 2.222e-104
Identity = 162/371 (43.67%), Postives = 246/371 (66.31%), Query Frame = 2
Query:   71 LINSLSIVGISVFLFLLAPKVIIDSKVKVINEEVSAPPNEVKRLSWNEVDRKFPNQLIGPEAFTIDAITGDIYTGTAEGMIWKL--NRELTTIEPIIRVGEDHPNCGSEHVAHICGRVLGLKLFNSETLIVADSYRGIISINLKTKI--KEILVEKDKSEMTKSLKLFNSLDISTNGVIYFTISSLKWSLKDLIYSILEGDNSGRIYSFSMFTKELKILASDLYLPSGLALDPDGKSLIVSEVNKRRLIKLDLSKQSNNIEVIMDKLNGFPANVRGDLRNNYYLAMPMTGIIETLSFLYKYPIINYSIAYLVPKWAILKLIGSDSKIYKFDDHGRIIAIIDGTHPGTDFVTEAYEADSKILLGSLSHPYLD 1171
            LI  + +V + + ++  APK+  D K+ +         +  KR+SW+   R F     GPE+FT D +TG IYTG A+G ++ L  N   TT++  +R+ E++ NC S      CGR+LGLK  + + LIVAD+Y GI +I+L   +  K++LV  DK  +T+SLK FNSLD+S NG+IYFT+SS+KW+L D +Y+ LEGD+SGR+YS+ + T++L ++A++L  P+GL+L  +  SL+V+E+ K RL+K++L K  +N+EV +D L G   NV+ D ++N+Y+A+P T     LSF+++YP+INY +A+L+PK      + S S+I K ++ G II  I G   G DF+TEAYE + KILLG+L +PYLD
Sbjct:    2 LIKFVIVVSLGILIYWAAPKIETDPKLVIKKNTQLKFSSTFKRISWDNSSRLFVGDFAGPESFTHDPVTGAIYTGAADGKLYILDINDISTTLKSFVRIMENNLNCESNEFGKACGRILGLKYVDKDKLIVADAYNGIYAIHLGMDMATKQVLVSPDKDMLTRSLKFFNSLDVSKNGIIYFTVSSMKWTLDDSLYAFLEGDSSGRVYSYDLVTRKLHLIAANLSFPNGLSLTQNQTSLVVAELTKGRLLKINLLKSQDNVEVFVDGLLGTVDNVKRDNQDNFYVALP-TEDSYLLSFIHRYPLINYYVAWLIPKRFFNIFLKSKSRILKINNEGEIILEISGNKVGMDFITEAYETNGKILLGNLFNPYLD 371          
BLAST of Str_synth domain-containing protein vs. Planmine SMEST
Match: SMESG000052602.1 (SMESG000052602.1)

HSP 1 Score: 294.664 bits (753), Expect = 7.393e-97
Identity = 156/371 (42.05%), Postives = 238/371 (64.15%), Query Frame = 2
Query:   71 LINSLSIVGISVFLFLLAPKVIIDSKVKVINEEVSAPPNEVKRLSWNEVDRKFPNQLIGPEAFTIDAITGDIYTGTAEGMIWKL--NRELTTIEPIIRVGEDHPNCGSEHVAHICGRVLGLKLFNSETLIVADSYRGIISINLKTKI--KEILVEKDKSEMTKSLKLFNSLDISTNGVIYFTISSLKWSLKDLIYSILEGDNSGRIYSFSMFTKELKILASDLYLPSGLALDPDGKSLIVSEVNKRRLIKLDLSKQSNNIEVIMDKLNGFPANVRGDLRNNYYLAMPMTGIIETLSFLYKYPIINYSIAYLVPKWAILKLIGSDSKIYKFDDHGRIIAIIDGTHPGTDFVTEAYEADSKILLGSLSHPYLD 1171
            LI  + +V + + ++  APK+  D K+ +         +  KR+SW+   R F     GPE+FT D +TG IYTG A+G ++ L  N   TT++  +R+ E++ NC S      CGR+LGLK  + + LIVAD+Y GI +I+L   +  K++LV  DK  +T+SLK FNSLD+S NG+IYFT+SS+KW+L D +Y+ LEGD+SGR+YS+ + T++L ++A++L  P+GL+L  +  SL+V+E+ K RL+K++L K  +N+EV +D L G   NV+ D ++N+Y+A+P T     LSF+++YP+INY +A+L+PK              +F      +  I G   G DF+TEAYE + KILLG+L +PYLD
Sbjct:    2 LIKFVIVVSLGILIYWAAPKIETDPKLVIKKNTQLKFSSTFKRISWDNSSRLFVGDFAGPESFTHDPVTGAIYTGAADGKLYILDINDISTTLKSFVRIMENNLNCESNEFGKACGRILGLKYVDKDKLIVADAYNGIYAIHLGMDMATKQVLVSPDKDMLTRSLKFFNSLDVSKNGIIYFTVSSMKWTLDDSLYAFLEGDSSGRVYSYDLVTRKLHLIAANLSFPNGLSLTQNQTSLVVAELTKGRLLKINLLKSQDNVEVFVDGLLGTVDNVKRDNQDNFYVALP-TEDSYLLSFIHRYPLINYYVAWLIPK--------------RF--FNIFLKKISGNKVGMDFITEAYETNGKILLGNLFNPYLD 355          
BLAST of Str_synth domain-containing protein vs. Planmine SMEST
Match: SMESG000009666.1 (SMESG000009666.1)

HSP 1 Score: 91.6633 bits (226), Expect = 5.160e-20
Identity = 103/380 (27.11%), Postives = 172/380 (45.26%), Query Frame = 2
Query:   98 ISVFLFLLAPKVIIDSKVKVINEEVSAPPNEVKRLSWNE----VDRKFPNQLIGPEAFTIDAITGD-IYTGTAEGMIWKLNRELTTIEPIIRVGEDHPNCGSEHVAHICGRVLGLKL-FNSETLIVADSYRGIISINLKTKIKEILVEKDKSEMTKSLKLFNSLDISTNGVIYFTISSLKWSLKDLIYSILEGDNSGRIYSFSMFTKELKILASDLYLPSGLAL-DPDGKSLIVSEVNKRRLIKLDLSKQSN---NIEVIMDKLNGFPANVRGDL-RNNYYLAMP---------MTGIIETLSFLYKYPIINYSIAYLVPKWAILKLIGSDSK--IYKFDDHGRII-AIIDGTHPGTDFVTEAYEADSKILLGSLSHPYL 1168
             S+F  +    ++ DSK+  I+     PP+ +  L+ NE           Q+ G E+       GD IY  T +G I K N   T IE +  +         E     CGR LG++    +  L++ D+Y G+  ++L T     L  KD S     +  FN LDI  NG +  + SS K+ L ++I  I E   +GR+   +  T E  IL  +LY P+G+ L   D ++++V+E  K R++ +++  +S      +V +D L GFP N+R    +  Y++            +T II +       P +  SI  L+   +IL ++   S   + + D+ G +I ++ D         +E  E  + + LG+   PYL
Sbjct:   23 FSIFTLIFGSLLVFDSKINPISLSFPEPPDLIGPLAVNERLTFAKILHTRQVKGCESM---VKVGDYIYGTTQDGKIIKFND--THIELLTLLNPSFCKTIQE-----CGRPLGIRYDAVNNRLMIVDAYFGLFEVDLLTGKANRLFPKDNSGF--KVTFFNDLDILPNGDVIISESSTKYQLHNMISIIFESKPNGRVLRVNPNTGEYHILIDNLYFPNGVQLYRNDDETVLVAETLKLRVLAINVKPKSAISVRSKVFVDFLPGFPDNIRPSFSKQGYWINFASIRHSQNSFVTDIIAS------SPFLKNSIKKLLSD-SILHMLMRTSHGIVVRVDELGNLIESLHDSKGVNVSTSSETLEVGNHLYLGNYYLPYL 383          
The following BLAST results are available for this feature:
BLAST of Str_synth domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
APMAP1.004e-4028.88adipocyte plasma membrane associated protein [Sour... [more]
APMAP3.645e-3828.27adipocyte plasma membrane associated protein [Sour... [more]
back to top
BLAST of Str_synth domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
C08E8.25.080e-2526.73pep chromosome:WBcel235:V:18353510:18355842:-1 gen... [more]
F57C2.59.093e-2125.00pep chromosome:WBcel235:II:14526213:14528296:-1 ge... [more]
F57C2.59.093e-2125.00pep chromosome:WBcel235:II:14526213:14528239:-1 ge... [more]
T12G3.41.964e-2026.88pep chromosome:WBcel235:IV:12048268:12049943:1 gen... [more]
T12G3.41.964e-2026.88pep chromosome:WBcel235:IV:12048256:12049928:1 gen... [more]
back to top
BLAST of Str_synth domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Ssl27.639e-2230.47gene:FBgn0041780 transcript:FBtr0345060[more]
Hmu2.129e-2128.97gene:FBgn0015737 transcript:FBtr0085164[more]
back to top
BLAST of Str_synth domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
apmap9.874e-4431.42adipocyte plasma membrane associated protein [Sour... [more]
zgc:1942091.325e-4231.27zgc:194209 [Source:ZFIN;Acc:ZDB-GENE-081022-75][more]
back to top
BLAST of Str_synth domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ENSXETT00000037041.11.235e-3928.34adipocyte plasma membrane associated protein LIKE ... [more]
ENSXETT00000024163.12.045e-3828.19adipocyte plasma membrane associated protein LIKE ... [more]
edem27.548e-3828.76ER degradation enhancer, mannosidase alpha-like 2 ... [more]
edem22.051e-3728.31ER degradation enhancer, mannosidase alpha-like 2 ... [more]
back to top
BLAST of Str_synth domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Apmap1.325e-3827.96adipocyte plasma membrane associated protein [Sour... [more]
back to top
BLAST of Str_synth domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q803F5|APMAP_DANRE6.063e-4331.42Adipocyte plasma membrane-associated protein OS=Da... [more]
sp|B5X3B2|APMAP_SALSA9.411e-4232.83Adipocyte plasma membrane-associated protein OS=Sa... [more]
sp|Q9HDC9|APMAP_HUMAN4.821e-4028.88Adipocyte plasma membrane-associated protein OS=Ho... [more]
sp|Q7TP48|APMAP_RAT2.252e-3928.76Adipocyte plasma membrane-associated protein OS=Ra... [more]
sp|Q5ZIF1|APMAP_CHICK2.843e-3929.23Adipocyte plasma membrane-associated protein OS=Ga... [more]
back to top
BLAST of Str_synth domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
T2M5K29.807e-5036.05Adipocyte plasma membrane-associated protein (Frag... [more]
V3ZMC13.362e-4531.50Str_synth domain-containing protein OS=Lottia giga... [more]
A0A2D0QP062.912e-4430.42adipocyte plasma membrane-associated protein OS=Ic... [more]
E3TDF78.411e-4430.16Adipocyte plasma membrane-associated protein OS=Ic... [more]
A0A5N5PSG19.728e-4429.89Uncharacterized protein OS=Pangasianodon hypophtha... [more]
back to top
BLAST of Str_synth domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
apmap1.364e-4530.05adipocyte plasma membrane associated protein [Sour... [more]
zgc:1942092.426e-3634.08adipocyte plasma membrane-associated protein-like ... [more]
zgc:1942094.328e-1643.00zgc:194209 [Source:ZFIN;Acc:ZDB-GENE-081022-75][more]
ENSAMXT00000047164.17.771e-1139.00pep primary_assembly:Astyanax_mexicanus-2.0:22:306... [more]
back to top
BLAST of Str_synth domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
apmap4.781e-2329.15adipocyte plasma membrane associated protein [Sour... [more]
back to top
BLAST of Str_synth domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Str_synth domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO430121.910e-4229.39Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Str_synth domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
apmap2.330e-3930.82adipocyte plasma membrane associated protein [Sour... [more]
zgc:1942094.115e-3628.74adipocyte plasma membrane-associated protein-like ... [more]
back to top
BLAST of Str_synth domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000052600.10.000e+099.73SMESG000052600.1[more]
SMESG000052602.12.222e-10443.67SMESG000052602.1[more]
SMESG000052602.17.393e-9742.05SMESG000052602.1[more]
SMESG000009666.15.160e-2027.11SMESG000009666.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30009611 ID=SMED30009611|Name=Str_synth domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1273bp
CAAAAAATGAATACAAATATTTATTAATAATCAAAATAACTAATTTAATT
ATTGATATCAGTCAATGTCGCTGATAAACTCATTATCGATTGTCGGCATT
TCTGTTTTTTTGTTTTTGTTGGCACCGAAAGTGATTATTGATTCTAAAGT
GAAGGTTATCAACGAAGAAGTTTCAGCGCCTCCAAATGAAGTGAAACGGT
TATCCTGGAATGAAGTAGATAGAAAATTTCCTAACCAACTAATTGGGCCT
GAAGCTTTCACTATTGACGCCATTACAGGCGATATTTATACCGGCACTGC
AGAGGGAATGATTTGGAAACTAAACCGAGAACTAACAACAATCGAACCGA
TCATTCGAGTCGGTGAAGATCATCCTAATTGTGGATCAGAACATGTTGCT
CATATTTGCGGACGAGTTTTGGGATTAAAACTTTTTAACAGTGAAACTCT
CATTGTTGCCGACTCTTATCGGGGAATTATTTCTATAAATCTGAAAACAA
AAATCAAGGAAATATTAGTAGAAAAAGATAAAAGCGAAATGACGAAGTCA
TTGAAGTTGTTCAATTCCTTAGACATATCGACAAACGGGGTTATTTATTT
CACAATTTCTTCATTGAAATGGTCATTAAAAGACCTTATTTATTCAATTC
TTGAAGGTGACAATTCAGGAAGAATTTACAGTTTCAGTATGTTTACCAAA
GAATTGAAAATTCTAGCATCAGATTTGTACCTTCCGAGTGGACTGGCCTT
AGATCCTGATGGAAAGAGTCTCATTGTAAGTGAGGTAAACAAAAGACGAT
TGATAAAGTTAGATCTCTCCAAACAATCAAATAATATTGAGGTAATTATG
GACAAGTTAAATGGTTTCCCTGCTAATGTCCGAGGCGATTTGCGCAACAA
TTATTACCTAGCAATGCCCATGACGGGCATTATAGAGACACTTTCCTTTC
TTTACAAATATCCCATTATAAACTATTCCATAGCATATTTGGTTCCGAAA
TGGGCGATTTTAAAGCTTATTGGAAGCGATAGTAAAATTTATAAATTTGA
TGACCATGGGAGAATAATTGCAATTATCGACGGGACCCACCCTGGAACGG
ACTTTGTCACGGAGGCTTATGAGGCTGACAGTAAAATATTATTAGGAAGT
TTGAGCCATCCTTATTTGGATGTAATTAAAGTTTAATTAAACATTCTAAA
AATAATTTTCTATCAGTATAAATGGTTAAAATGGTAATGGAAAGAACCTT
TTGTATGAATTTTAATTAAAAAA
back to top

protein sequence of SMED30009611-orf-1

>SMED30009611-orf-1 ID=SMED30009611-orf-1|Name=SMED30009611-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=374bp
MSLINSLSIVGISVFLFLLAPKVIIDSKVKVINEEVSAPPNEVKRLSWNE
VDRKFPNQLIGPEAFTIDAITGDIYTGTAEGMIWKLNRELTTIEPIIRVG
EDHPNCGSEHVAHICGRVLGLKLFNSETLIVADSYRGIISINLKTKIKEI
LVEKDKSEMTKSLKLFNSLDISTNGVIYFTISSLKWSLKDLIYSILEGDN
SGRIYSFSMFTKELKILASDLYLPSGLALDPDGKSLIVSEVNKRRLIKLD
LSKQSNNIEVIMDKLNGFPANVRGDLRNNYYLAMPMTGIIETLSFLYKYP
IINYSIAYLVPKWAILKLIGSDSKIYKFDDHGRIIAIIDGTHPGTDFVTE
AYEADSKILLGSLSHPYLDVIKV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR018119Strictosidine_synth_cons-reg
IPR0110426-blade_b-propeller_TolB-like
Vocabulary: biological process
TermDefinition
GO:0009058biosynthetic process
Vocabulary: molecular function
TermDefinition
GO:0016844strictosidine synthase activity
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR018119Strictosidine synthase, conserved regionPFAMPF03088Str_synthcoord: 167..248
e-value: 2.7E-21
score: 75.5
IPR011042Six-bladed beta-propeller, TolB-likeGENE3DG3DSA:2.120.10.30coord: 47..373
e-value: 2.1E-54
score: 186.5
NoneNo IPR availablePANTHERPTHR10426STRICTOSIDINE SYNTHASE-RELATEDcoord: 15..368
NoneNo IPR availablePANTHERPTHR10426:SF65FI18644P1-RELATEDcoord: 15..368
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..25
score: 0.615
NoneNo IPR availableSUPERFAMILYSSF63829Calcium-dependent phosphotriesterasecoord: 48..343