SMED30009609

Overview
NameSMED30009609
Smed IDSMED30009609
Length (bp)1595
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30009609 (SMED30009609) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30009609 (SMED30009609) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30009609 (SMED30009609) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30009609 (SMED30009609) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30009609

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30009609 dd_Smed_v4_4983_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30009609 dd_Smed_v4_4983_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30009609 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.000012:228336..229862 -2973
Homology
BLAST of SMED30009609 vs. Ensembl Human
Match: FAM200B (family with sequence similarity 200 member B [Source:HGNC Symbol;Acc:HGNC:27740])

HSP 1 Score: 55.0694 bits (131), Expect = 2.553e-7
Identity = 43/118 (36.44%), Postives = 63/118 (53.39%), Query Frame = -1
Query:  117 YIEIGFI----PSENDS-SLPVCLKTLENESMIPNKLHRYLETKHPEMKNKQKIYFEQLPTNLEMQ*KKLR-----SLKTQISNYKIAQLFCKNKKPHIDAEKIILLALEISVEIILD 440
            Y++ GFI    P END     +C   L NES+ P+KL R+LET+H E+ +K   YF++   ++++  + L      S K  +S+Y +A    K K  +  AEKIIL A    V  I D
Sbjct:   67 YLKYGFIKCEKPFENDRPQCVICNNILANESLKPSKLKRHLETQHAELIDKPLEYFQRKKKDIKLSTQFLSCSTAVSEKALLSSYLVAYRVAKEKIANTAAEKIILPACLDMVRTIFD 184          
BLAST of SMED30009609 vs. Ensembl Human
Match: FAM200B (family with sequence similarity 200 member B [Source:HGNC Symbol;Acc:HGNC:27740])

HSP 1 Score: 55.0694 bits (131), Expect = 2.553e-7
Identity = 43/118 (36.44%), Postives = 63/118 (53.39%), Query Frame = -1
Query:  117 YIEIGFI----PSENDS-SLPVCLKTLENESMIPNKLHRYLETKHPEMKNKQKIYFEQLPTNLEMQ*KKLR-----SLKTQISNYKIAQLFCKNKKPHIDAEKIILLALEISVEIILD 440
            Y++ GFI    P END     +C   L NES+ P+KL R+LET+H E+ +K   YF++   ++++  + L      S K  +S+Y +A    K K  +  AEKIIL A    V  I D
Sbjct:   67 YLKYGFIKCEKPFENDRPQCVICNNILANESLKPSKLKRHLETQHAELIDKPLEYFQRKKKDIKLSTQFLSCSTAVSEKALLSSYLVAYRVAKEKIANTAAEKIILPACLDMVRTIFD 184          
BLAST of SMED30009609 vs. Ensembl Human
Match: ZBED9 (zinc finger BED-type containing 9 [Source:HGNC Symbol;Acc:HGNC:13851])

HSP 1 Score: 51.9878 bits (123), Expect = 3.298e-6
Identity = 33/105 (31.43%), Postives = 59/105 (56.19%), Query Frame = -1
Query:  156 AYIEIGFIPSENDSSLP----VCLKTLENESMIPNKLHRYLETKHPEMKNKQKIYFEQLPTNLEMQ*KKLR-----SLKTQISNYKIAQLFCKNKKPHIDAEKII 443
            +YIE GF+   +   L     +C   L NE+M P+KL R+L +KH E+ ++ K +FE+  + L+ Q K++      ++    ++YK+A    K+K P+  AE ++
Sbjct:  740 SYIEFGFVAVIDGEVLKPQCIICGDVLANEAMKPSKLKRHLYSKHKEISSQPKEFFERKSSELKSQPKQVFNVSHINISALRASYKVALPVAKSKTPYTIAETLV 844          
BLAST of SMED30009609 vs. Ensembl Human
Match: ZBED9 (zinc finger BED-type containing 9 [Source:HGNC Symbol;Acc:HGNC:13851])

HSP 1 Score: 51.6026 bits (122), Expect = 3.455e-6
Identity = 33/105 (31.43%), Postives = 59/105 (56.19%), Query Frame = -1
Query:  156 AYIEIGFIPSENDSSLP----VCLKTLENESMIPNKLHRYLETKHPEMKNKQKIYFEQLPTNLEMQ*KKLR-----SLKTQISNYKIAQLFCKNKKPHIDAEKII 443
            +YIE GF+   +   L     +C   L NE+M P+KL R+L +KH E+ ++ K +FE+  + L+ Q K++      ++    ++YK+A    K+K P+  AE ++
Sbjct:  589 SYIEFGFVAVIDGEVLKPQCIICGDVLANEAMKPSKLKRHLYSKHKEISSQPKEFFERKSSELKSQPKQVFNVSHINISALRASYKVALPVAKSKTPYTIAETLV 693          
BLAST of SMED30009609 vs. UniProt/SwissProt
Match: sp|P0CF97|F200B_HUMAN (Protein FAM200B OS=Homo sapiens OX=9606 GN=FAM200B PE=3 SV=1)

HSP 1 Score: 55.0694 bits (131), Expect = 1.226e-6
Identity = 43/118 (36.44%), Postives = 63/118 (53.39%), Query Frame = -1
Query:  117 YIEIGFI----PSENDS-SLPVCLKTLENESMIPNKLHRYLETKHPEMKNKQKIYFEQLPTNLEMQ*KKLR-----SLKTQISNYKIAQLFCKNKKPHIDAEKIILLALEISVEIILD 440
            Y++ GFI    P END     +C   L NES+ P+KL R+LET+H E+ +K   YF++   ++++  + L      S K  +S+Y +A    K K  +  AEKIIL A    V  I D
Sbjct:   67 YLKYGFIKCEKPFENDRPQCVICNNILANESLKPSKLKRHLETQHAELIDKPLEYFQRKKKDIKLSTQFLSCSTAVSEKALLSSYLVAYRVAKEKIANTAAEKIILPACLDMVRTIFD 184          
BLAST of SMED30009609 vs. TrEMBL
Match: A0A2H1CPP8 (Uncharacterized protein OS=Fasciola hepatica OX=6192 GN=D915_03095 PE=4 SV=1)

HSP 1 Score: 75.8702 bits (185), Expect = 3.909e-12
Identity = 43/83 (51.81%), Postives = 55/83 (66.27%), Query Frame = -1
Query:  129 MIPNKLHRYLETKHPEMKNKQKIYFEQLPTNLEMQ*KKLRSL-----KTQISNYKIAQLFCKNKKPHIDAEKIILLALEISVE 362
            M+P KL R+L T+H E  +K K YFE+L +NL+ Q K+LRS        Q+++YK AQL  K KKP IDAE IIL ALEI  +
Sbjct:    1 MLPRKLSRHLITRHSEHTDKPKDYFEELHSNLQKQSKRLRSFCSVSRNAQLASYKAAQLLPKKKKPQIDAENIILPALEIVAD 83          
BLAST of SMED30009609 vs. TrEMBL
Match: A0A5S6Q2S0 (Uncharacterized protein OS=Trichuris muris OX=70415 PE=4 SV=1)

HSP 1 Score: 69.707 bits (169), Expect = 1.126e-8
Identity = 43/119 (36.13%), Postives = 68/119 (57.14%), Query Frame = -1
Query:  117 YIEIGFIPSENDSSLPVCL---KTLENESMIPNKLHRYLETKHPEMKNKQKIYFEQLPTNLEMQ--*KKLRSLKTQ------ISNYKIAQLFCKNKKPHIDAEKIILLALEISVEIILD 440
            Y++ GFIPS  D SLP+CL    T  NE+M P KL ++L T HP+ K+K   +F+ L  N E +    +L + +TQ      +++YKI++L  K    H   E +IL +L I +  +++
Sbjct:  241 YLQYGFIPSPQDQSLPMCLNCMATFSNETMKPCKLKKHLVTSHPDKKDKPLEFFKALRNNFEKRPVLTQLLTERTQKLDKGVVASYKISKLIAKTGHGHNVGESLILPSLSIIISDVMN 359          
BLAST of SMED30009609 vs. TrEMBL
Match: A0A2S2NJ19 (Zinc finger BED domain-containing protein 5 (Fragment) OS=Schizaphis graminum OX=13262 GN=ZBED5_11 PE=4 SV=1)

HSP 1 Score: 68.9366 bits (167), Expect = 1.321e-8
Identity = 46/120 (38.33%), Postives = 66/120 (55.00%), Query Frame = -1
Query:  108 YIEIGFIPSEN-DSSLPVCL---KTLENESMIPNKLHRYLETKHPEMKNKQKIYFEQLPTNLEMQ*KKLR-----SLKTQISNYKIAQLFCKNKKPHIDAEKIILLALEISVEIILDHQV 440
            Y+ IGF  S N D   P CL   + L NESM+P+KL R+  TKH  + +K   YF++L  +   Q  K+      S KTQ ++Y +A+L  K  KPH  AEK+IL A    V+++   + 
Sbjct:   34 YLNIGFSWSGNVDDPRPWCLVCGEKLSNESMVPSKLKRHFFTKHSHLVDKNASYFQRLLKSETQQSAKMTKIVNISDKTQEASYLVAELVAKQMKPHTIAEKLILPACREIVKVLFGEEA 153          
BLAST of SMED30009609 vs. TrEMBL
Match: A0A2S2Q1G3 (Uncharacterized protein (Fragment) OS=Sipha flava OX=143950 GN=g.158651 PE=4 SV=1)

HSP 1 Score: 64.3142 bits (155), Expect = 1.920e-8
Identity = 41/106 (38.68%), Postives = 62/106 (58.49%), Query Frame = -1
Query:  153 AYIEIGF----IPSENDSSLPVCLKTLENESMIPNKLHRYLETKHPEMKNKQKIYFEQLPTNLEMQ*K---KLRSLKTQ--ISNYKIAQLFCKNKKPHIDAEKIIL 443
            +Y++ GF    I +E      +CLK L  +SMIPNKL R+ ET H  + NK++ YF +    LE Q     K  S+ T+  +++YK+A    ++KKPH  AE++IL
Sbjct:   33 SYLDFGFTYIKIDNEERPKCVICLKVLAADSMIPNKLKRHFETNHGSLINKKRDYFVRQREQLEKQSTSFIKQTSVPTKALLASYKVAFRVAQSKKPHTIAEELIL 138          
BLAST of SMED30009609 vs. TrEMBL
Match: A0A2S2R4F2 (SCAN domain-containing protein 3 OS=Sipha flava OX=143950 GN=SCAND3_8 PE=4 SV=1)

HSP 1 Score: 67.781 bits (164), Expect = 1.940e-8
Identity = 44/118 (37.29%), Postives = 67/118 (56.78%), Query Frame = -1
Query:  120 YIEIGFIPSENDSSLPVCL---KTLENESMIPNKLHRYLETKHPEMKNKQKIYFEQL-------PTNLEMQ*KKLRSLKTQI-SNYKIAQLFCKNKKPHIDAEKIILLALEISVEIIL 440
            Y++ GFIPS  D +LP+CL   K L N++M P+KL  +L+  HPE   K+  YF+ L       PT   M    L+     + ++Y I+ L  K+ KPH   E++ILLA+E  ++ +L
Sbjct:   15 YLKFGFIPSLPDKTLPMCLLCNKVLSNDAMKPSKLEDHLKRCHPEKTRKELKYFQTLKEKFQKRPTMDSMFAATLKKDDDGLRASYNISLLIAKSGKPHTIGEQLILLAIEEVLKTVL 132          
BLAST of SMED30009609 vs. Ensembl Cavefish
Match: ENSAMXT00000051422.1 (pep primary_assembly:Astyanax_mexicanus-2.0:15:35461191:35465166:-1 gene:ENSAMXG00000032672.1 transcript:ENSAMXT00000051422.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 59.3066 bits (142), Expect = 6.266e-9
Identity = 40/118 (33.90%), Postives = 61/118 (51.69%), Query Frame = -1
Query:  120 YIEIGFIPSENDSS-LP---VCLKTLENESMIPNKLHRYLETKHPEMKNKQKIYFE-------QLPTNLEMQ*KKLRSLKTQISNYKIAQLFCKNKKPHIDAEKIILLALEISVEIIL 440
            Y+ +GF  +  ++  LP   VC + L NE++ P KL R+LETKH E  +K   +FE            LE+      + K   ++Y++AQL  K  KPH   E +IL A +  V ++L
Sbjct:   89 YLALGFTCTGTENEPLPLCVVCSEVLANEALKPTKLRRHLETKHSEYASKPVEFFENKLKEYQSRKKTLELACSGTDNAKAVEASYRVAQLIAKAGKPHTIGESLILPAAKEMVSVML 206          
BLAST of SMED30009609 vs. Ensembl Cavefish
Match: ENSAMXT00000044261.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000070.1:2279767:2281653:1 gene:ENSAMXG00000037161.1 transcript:ENSAMXT00000044261.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 55.8398 bits (133), Expect = 8.151e-8
Identity = 39/118 (33.05%), Postives = 59/118 (50.00%), Query Frame = -1
Query:  120 YIEIGFIPSENDSS-LP---VCLKTLENESMIPNKLHRYLETKHPEMKNKQKIYFE-------QLPTNLEMQ*KKLRSLKTQISNYKIAQLFCKNKKPHIDAEKIILLALEISVEIIL 440
            Y+ +GF  +  ++  LP   VC + L NE++   KL R+LETKH E  +K   +FE            LE+        K   ++Y++AQL  K  KPH   E +IL A +  V ++L
Sbjct:   46 YLALGFTCTGTENEPLPLCVVCSEVLANEALKTTKLRRHLETKHSEYASKPVEFFENKLKEYQSRKKTLELACSGTDHAKAVEASYRVAQLIAKAGKPHTIGESLILPAAKEMVSVML 163          
BLAST of SMED30009609 vs. Ensembl Medaka
Match: ENSORLT00000035512.1 (pep primary_assembly:ASM223467v1:11:22712371:22714941:1 gene:ENSORLG00000026495.1 transcript:ENSORLT00000035512.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 62.003 bits (149), Expect = 8.388e-10
Identity = 41/118 (34.75%), Postives = 63/118 (53.39%), Query Frame = -1
Query:  117 AYIEIGF-IPSENDSSLPVCL---KTLENESMIPNKLHRYLETKHPEMKNKQKIYFEQLPTNLEMQ*KKLRSL-----KTQISNYKIAQLFCKNKKPHIDAEKIILLALEISVEIILD 443
            AY+ +GF + +  D   PVCL   K L  +SM PNKL R+L+T HP   +K   +F++       Q  +  S      +  +++YK+A    + KKPH  AE++IL A    V ++LD
Sbjct:   35 AYVALGFTVTTVGDEERPVCLLCLKMLAADSMKPNKLRRHLKTLHPNHADKPLEFFQRKRAEYCQQSSRFVSATSVNQRALLASYKVAYQIAQCKKPHTIAEELILPAALDMVSVMLD 152          
BLAST of SMED30009609 vs. Ensembl Medaka
Match: ENSORLT00000040389.1 (pep primary_assembly:ASM223467v1:19:265767:268275:-1 gene:ENSORLG00000025045.1 transcript:ENSORLT00000040389.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 62.003 bits (149), Expect = 8.685e-10
Identity = 41/118 (34.75%), Postives = 63/118 (53.39%), Query Frame = -1
Query:  117 AYIEIGF-IPSENDSSLPVCL---KTLENESMIPNKLHRYLETKHPEMKNKQKIYFEQLPTNLEMQ*KKLRSL-----KTQISNYKIAQLFCKNKKPHIDAEKIILLALEISVEIILD 443
            AY+ +GF + +  D   PVCL   K L  +SM PNKL R+L+T HP   +K   +F++       Q  +  S      +  +++YK+A    + KKPH  AE++IL A    V ++LD
Sbjct:   35 AYVALGFTVTTVGDEERPVCLLCLKMLAADSMKPNKLRRHLKTLHPNHADKPLEFFQRKRAEYCQQSSRFVSATSVNQRALLASYKVAYQIAQCKKPHTIAEELILPAALDMVSVMLD 152          
BLAST of SMED30009609 vs. Ensembl Medaka
Match: ENSORLT00000032459.1 (pep primary_assembly:ASM223467v1:8:14240678:14247355:1 gene:ENSORLG00000024991.1 transcript:ENSORLT00000032459.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 54.6842 bits (130), Expect = 2.038e-7
Identity = 36/115 (31.30%), Postives = 64/115 (55.65%), Query Frame = -1
Query:  123 IEIGFIPSENDSSLPV----CLKTLENESMIPNKLHRYLETKHPEMKNKQKIYFEQLPTNLEMQ*KKLRSLKTQI-----SNYKIAQLFCKNKKPHIDAEKIIL-LALEISVEII 437
            I  GF+   +++        C  TL NE++ P+KL R+LETKHP++  K   YF++    L+MQ + + SL         ++Y +A+   ++KK    AE+++L  A+++  E+I
Sbjct:   20 INFGFVNGGSEAEPRAQCVECGLTLSNEALKPSKLKRHLETKHPKLIGKPVDYFKRKDDGLQMQRRSIVSLTGDAKCALKASYLVARRVAQSKKAFTIAEELVLPAAVDMCREMI 134          
BLAST of SMED30009609 vs. Ensembl Medaka
Match: ENSORLT00000028620.1 (pep primary_assembly:ASM223467v1:3:35179252:35181570:1 gene:ENSORLG00000028714.1 transcript:ENSORLT00000028620.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 54.299 bits (129), Expect = 2.163e-7
Identity = 36/116 (31.03%), Postives = 65/116 (56.03%), Query Frame = -1
Query:  123 YIEIGFIPSENDSSLPV----CLKTLENESMIPNKLHRYLETKHPEMKNKQKIYFEQLPTNLEMQ*KKLRSLKTQI-----SNYKIAQLFCKNKKPHIDAEKIIL-LALEISVEII 440
            +I+ GF+   +++        C  TL NE++ P+KL R+LETK+P++  K   YF++    L+MQ + + SL         ++Y +A+    NKK    AE+++L  A+++  E+I
Sbjct:   65 FIKFGFVNGGSEAEPRAQCVECGLTLSNEALKPSKLKRHLETKYPKLIGKPVDYFKRKDDGLQMQRRSIVSLTGDAKCALKASYLVARRVALNKKAFTIAEELVLPAAVDMCREMI 180          
BLAST of SMED30009609 vs. Planmine SMEST
Match: SMESG000009288.1 (SMESG000009288.1)

HSP 1 Score: 93.9745 bits (232), Expect = 3.925e-22
Identity = 51/119 (42.86%), Postives = 79/119 (66.39%), Query Frame = -1
Query:  108 YIEIGFIPSENDSSLPVCL---KTLENESMIPNKLHRYLETKHPEMKNKQKIYFEQLPTNLEMQ*KKLR-----SLKTQISNYKIAQLFCKNKKPHIDAEKIILLALEISVEIILDHQV 440
            YIE   +PS ++SSLPVCL   +T  NE+M+ +KL R+L+T HPE   K + YFE++ +  + Q KKL+     S+  QI+++KI QL  + KKPH D EKII+ +LEI++  +++ + 
Sbjct:   38 YIEFAIVPSVSESSLPVCLLCSQTPLNEAMVSSKLKRHLKTNHPEYVLKPRAYFEEIFSKSQKQTKKLKNYCKISINAQIASFKITQLLARKKKPHSDGEKIIVPSLEIAISSMVNGKA 156          
BLAST of SMED30009609 vs. Planmine SMEST
Match: SMESG000021780.1 (SMESG000021780.1)

HSP 1 Score: 91.2781 bits (225), Expect = 1.975e-20
Identity = 50/119 (42.02%), Postives = 78/119 (65.55%), Query Frame = -1
Query:  108 YIEIGFIPSENDSSLPVCL---KTLENESMIPNKLHRYLETKHPEMKNKQKIYFEQLPTNLEMQ*KKLR-----SLKTQISNYKIAQLFCKNKKPHIDAEKIILLALEISVEIILDHQV 440
            YIE  F+PS +DSSLPVCL   +T  NE+M+P+ L  +L+T HP      + YFE++ +  + Q KKL+     S+ +QI+++KIAQL  + KKP+ D E I+L +LEI+V  +++ + 
Sbjct:   56 YIEFDFVPSISDSSLPVCLLCSQTRSNEAMVPSNLKYHLKTNHPVYVLNPRAYFEEIFSKSQKQTKKLKNYRKISINSQIASFKIAQLLARKKKPYSDGEYILLPSLEIAVSSMVNGKA 174          
BLAST of SMED30009609 vs. Planmine SMEST
Match: SMESG000028779.1 (SMESG000028779.1)

HSP 1 Score: 65.0846 bits (157), Expect = 8.061e-13
Identity = 33/70 (47.14%), Postives = 51/70 (72.86%), Query Frame = -1
Query:  240 YIEIGFIPSENDSSLPVCL---KTLENESMIPNKLHRYLETKHPEMKNKQKIYFEQLPTNLEMQ*KKLRS 440
            YIE  F+PS +DSS+PVCL   +TL NE+++P+KL R+L+T HPE   K + YF+++ +  + Q KKL++
Sbjct:   38 YIEFFFVPSVSDSSIPVCLLCSQTLSNEAVVPSKLKRHLKTNHPEYVLKPRAYFKEIFSKSQKQTKKLKN 107          
BLAST of SMED30009609 vs. Planmine SMEST
Match: SMESG000050182.1 (SMESG000050182.1)

HSP 1 Score: 69.707 bits (169), Expect = 2.080e-12
Identity = 38/92 (41.30%), Postives = 60/92 (65.22%), Query Frame = -1
Query:  111 NESMIPNKLHRYLETKHPEMKNKQKIYFEQLPTNLEMQ*KKLRSL-----KTQISNYKIAQLFCKNKKPHIDAEKIILLALEISVEIILDHQ 371
            NESM+P+KL R++ET H E  N    YFE L ++ + + KK +       ++QI++YKIAQL  + KKPH +AE+I+L AL+I+   ++ + 
Sbjct:  397 NESMLPSKLLRHIETNHYEQMNNPSTYFENLISSQQSESKKFQKFVVTNDQSQIASYKIAQLIARKKKPHAEAEEIVLPALKIAAGCMMTND 488          
BLAST of SMED30009609 vs. Planmine SMEST
Match: SMESG000069616.1 (SMESG000069616.1)

HSP 1 Score: 66.2402 bits (160), Expect = 3.011e-12
Identity = 43/118 (36.44%), Postives = 68/118 (57.63%), Query Frame = -1
Query:  120 YIEIGFIPSENDSSLPVCL---KTLENESMIPNKLHRYLETKHPEMKNKQKIYFEQLPTNLEMQ--*KKLRSLKTQ------ISNYKIAQLFCKNKKPHIDAEKIILLALEISVEIIL 440
            Y+++GFIPS +D  LP+CL   K L N++M P+KL  +L   HP+  NK   YF+ L   L+ +    ++ +L +Q       ++Y I+ L  K+ KPH   EK IL A+E  ++ +L
Sbjct:   69 YLKLGFIPSLSDKQLPMCLLCNKVLGNDAMKPSKLQDHLRRFHPDKTNKDLKYFQTLKDKLQKRPMLDRMFALTSQRNDDGLRASYNISLLIAKSGKPHTIEEKSILPAVEEVLKTVL 186          
The following BLAST results are available for this feature:
BLAST of SMED30009609 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 4
Match NameE-valueIdentityDescription
FAM200B2.553e-736.44family with sequence similarity 200 member B [Sour... [more]
FAM200B2.553e-736.44family with sequence similarity 200 member B [Sour... [more]
ZBED93.298e-631.43zinc finger BED-type containing 9 [Source:HGNC Sym... [more]
ZBED93.455e-631.43zinc finger BED-type containing 9 [Source:HGNC Sym... [more]
back to top
BLAST of SMED30009609 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30009609 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30009609 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30009609 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30009609 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30009609 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 1
Match NameE-valueIdentityDescription
sp|P0CF97|F200B_HUMAN1.226e-636.44Protein FAM200B OS=Homo sapiens OX=9606 GN=FAM200B... [more]
back to top
BLAST of SMED30009609 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2H1CPP83.909e-1251.81Uncharacterized protein OS=Fasciola hepatica OX=61... [more]
A0A5S6Q2S01.126e-836.13Uncharacterized protein OS=Trichuris muris OX=7041... [more]
A0A2S2NJ191.321e-838.33Zinc finger BED domain-containing protein 5 (Fragm... [more]
A0A2S2Q1G31.920e-838.68Uncharacterized protein (Fragment) OS=Sipha flava ... [more]
A0A2S2R4F21.940e-837.29SCAN domain-containing protein 3 OS=Sipha flava OX... [more]
back to top
BLAST of SMED30009609 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSAMXT00000051422.16.266e-933.90pep primary_assembly:Astyanax_mexicanus-2.0:15:354... [more]
ENSAMXT00000044261.18.151e-833.05pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
back to top
BLAST of SMED30009609 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30009609 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30009609 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30009609 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ENSORLT00000035512.18.388e-1034.75pep primary_assembly:ASM223467v1:11:22712371:22714... [more]
ENSORLT00000040389.18.685e-1034.75pep primary_assembly:ASM223467v1:19:265767:268275:... [more]
ENSORLT00000032459.12.038e-731.30pep primary_assembly:ASM223467v1:8:14240678:142473... [more]
ENSORLT00000028620.12.163e-731.03pep primary_assembly:ASM223467v1:3:35179252:351815... [more]
back to top
BLAST of SMED30009609 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000009288.13.925e-2242.86SMESG000009288.1[more]
SMESG000021780.11.975e-2042.02SMESG000021780.1[more]
SMESG000028779.18.061e-1347.14SMESG000028779.1[more]
SMESG000050182.12.080e-1241.30SMESG000050182.1[more]
SMESG000069616.13.011e-1236.44SMESG000069616.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30009609 ID=SMED30009609|Name=SMED30009609|organism=Schmidtea mediterranea sexual|type=transcript|length=1595bp
TATTGTAGGAGTTCTTATTCATCCGAACTTCTATTGTTTTGTAATATTAA
AAAAAATCAATAAGTTTATAATATTGATTTTTTTAGAATTTGCTTAATTT
TTTCAATTACTTGATGGTCTAAGATAATTTCAACGGAAATTTCTAACGCC
AGCAAAATTATCTTTTCAGCATCAATATGTGGCTTTTTATTTTTACAAAA
AAGTTGTGCAATTTTATAGTTAGAAATTTGGGTTTTTAAGGACCTTAATT
TTTTTTACTGCATTTCTAAATTAGTTGGGAGCTGCTCAAAGTAAATTTTT
TGTTTATTCTTCATTTCTGGATGTTTTGTTTCCAAATATCGATGAAGCTT
ATTTGGGATCATTGATTCATTTTCAAGAGTTTTTAAACAAACAGGAAGAG
AACTATCATTTTCTGATGGAATAAACCCAATTTCAATATAGGCGCCTTAA
TGTTTGCGTTTTGTCGAACTACTTGATTTCGCCTTTGATTTTGGATATTT
TCTTGCCCAGTTTTAACAGATATTGACACAAATTTATCAATGAGGTTGCC
TTGTATTAAAATAAAATAGTAATGGCATTTAAGAAAAAATATTAAGTTAC
TTGCTTCGAATGCAAGCAATTAAGATCACTAACGAATAATTAATAACATT
GATCAAATCGAAAAAATGTCTGTAATTTTTATCAGTTATTAATAATAAGA
CCTAGATGTAAACACATCGATAGAAAAACTGAAGAAGAAACTACTAATTT
ATGATACACACTTATGATACAAATAAAATAATGAGCTCTACAAATTTCCC
CATTAAAAACCTTGAAAAATTTTATGAATGACTTTATTTAACGCAGTAAG
TTTGAATCATGGTATTAAAAATTTCAAAAAAAAAATAGAAAAGGTTGATA
TGGGAAATTTAAAGTAAATATATTCGCATTAACGACAAATTAATATGTCG
CGCACATAGTTTGCGTACCACTGGTTTATGTTAAAGAAACATACAAACAT
AAGTTGAATGCACAAACAAATTACATAGTAAAAGAATGCATGCCAACTTT
TTATGTGTACTAGTTGCATGTAATAAATTAAATTTTTAAAGTTTTATTTT
TTGGAATAAAATGCCAGATAAAAATTTAGAATAAGTATGGTGAAGGCACT
ATGAATTTGATTTTAAAAATATGAGTTCTCGAGAAAATAAAGAGATAAAA
TATAAAGCCATAAGAACTAATTTCATTTTGGAATATCCTTAGTAATACAT
AGCAGTTTGTTTAGCTTTATAGTTTGCAAATTTGAAGAGATACAGTTAAA
AAGCATATAAAAGTATAAAAAAACCTTATGAATATTCGTAAATTTACCAA
AAATATTGTAACAAATAGAAAAACCCTAATTTTCTAAATCCATAATTTGA
AAACAAACAATTGCTGACAAATCATAAGTCATCATTGATTTACACACCAA
CCTGTATTATACATATCTTTATTTCATAAAACGAAGTGTAATAAGATTTA
TAAATTTTTTATAGTATTATCAGTTATTATCAATTACAACGTGGTGTGTT
GTATGTTCAAATTATAAAATTATAGATTTTTTGGGCTTCGACCTT
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0003116parenchymal cell