SMED30009573

Overview
NameSMED30009573
Smed IDSMED30009573
Length (bp)435
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30009573 (SMED30009573) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30009573 (SMED30009573) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30009573 (SMED30009573) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30009573 (SMED30009573) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of SMED30009573 vs. Ensembl Human
Match: CENPBD1 (CENPB DNA-binding domain containing 1 [Source:HGNC Symbol;Acc:HGNC:28272])

HSP 1 Score: 71.2478 bits (173), Expect = 1.532e-15
Identity = 37/87 (42.53%), Postives = 65/87 (74.71%), Query Frame = -3
Query:  110 RKSISLETKMQVIRRLDSGERQSQISAALNLPTSTIRTILKNKEKILXXXXXXXXXXXTKITHSRNSIIEEMEKRLSIWIDDEIERN 370
            RK+I+L+ K++V+RR ++GE+ SQI+ AL+L  ST+ TI  +KEKI +S+   T   A+++T  R++++E ME+ LS+W++D+ + N
Sbjct:   19 RKAITLDLKLEVLRRFEAGEKLSQIAKALDLAISTVATIRDSKEKIKASSQIATPLRASRLTRHRSAVMESMEQLLSLWLEDQSQPN 105          
BLAST of SMED30009573 vs. Ensembl Human
Match: TIGD1 (tigger transposable element derived 1 [Source:HGNC Symbol;Acc:HGNC:14523])

HSP 1 Score: 51.9878 bits (123), Expect = 5.074e-8
Identity = 31/96 (32.29%), Postives = 57/96 (59.38%), Query Frame = -3
Query:   86 TRKSISLETKMQVIRRLDSGERQSQISAALNLPTSTIRTILKNKEKILXXXXXXXXXXXTKITHSRNSIIEEMEKRLSIWIDDEIERNMPSIQSIL 373
            +R S++L  K+++I+  + G  +++I   L L   T+  ++  KEK L    + T  +  ++   RNS+I +MEK L +WI+D+  RN+P  QS++
Sbjct:   11 SRTSLTLNQKLEMIKLSEEGMSKAEIGRRLGLLRQTVSQVVNAKEKFLKEVKSATPMNT-RMIRKRNSLIADMEKVLVVWIEDQTSRNIPLSQSLI 105          
BLAST of SMED30009573 vs. UniProt/SwissProt
Match: sp|B2RD01|CENP1_HUMAN (CENPB DNA-binding domain-containing protein 1 OS=Homo sapiens OX=9606 GN=CENPBD1 PE=2 SV=1)

HSP 1 Score: 71.2478 bits (173), Expect = 7.358e-15
Identity = 37/87 (42.53%), Postives = 65/87 (74.71%), Query Frame = -3
Query:  110 RKSISLETKMQVIRRLDSGERQSQISAALNLPTSTIRTILKNKEKILXXXXXXXXXXXTKITHSRNSIIEEMEKRLSIWIDDEIERN 370
            RK+I+L+ K++V+RR ++GE+ SQI+ AL+L  ST+ TI  +KEKI +S+   T   A+++T  R++++E ME+ LS+W++D+ + N
Sbjct:   19 RKAITLDLKLEVLRRFEAGEKLSQIAKALDLAISTVATIRDSKEKIKASSQIATPLRASRLTRHRSAVMESMEQLLSLWLEDQSQPN 105          
BLAST of SMED30009573 vs. UniProt/SwissProt
Match: sp|Q96MW7|TIGD1_HUMAN (Tigger transposable element-derived protein 1 OS=Homo sapiens OX=9606 GN=TIGD1 PE=1 SV=1)

HSP 1 Score: 51.9878 bits (123), Expect = 6.212e-8
Identity = 31/96 (32.29%), Postives = 57/96 (59.38%), Query Frame = -3
Query:   86 TRKSISLETKMQVIRRLDSGERQSQISAALNLPTSTIRTILKNKEKILXXXXXXXXXXXTKITHSRNSIIEEMEKRLSIWIDDEIERNMPSIQSIL 373
            +R S++L  K+++I+  + G  +++I   L L   T+  ++  KEK L    + T  +  ++   RNS+I +MEK L +WI+D+  RN+P  QS++
Sbjct:   11 SRTSLTLNQKLEMIKLSEEGMSKAEIGRRLGLLRQTVSQVVNAKEKFLKEVKSATPMNT-RMIRKRNSLIADMEKVLVVWIEDQTSRNIPLSQSLI 105          

HSP 2 Score: 24.2534 bits (51), Expect = 6.212e-8
Identity = 12/24 (50.00%), Postives = 14/24 (58.33%), Query Frame = -2
Query:   24 FNYIQAE--ARNISETFVASRGWF 89
            FN ++AE       E F ASRGWF
Sbjct:  113 FNSMKAERGVEAAEEKFEASRGWF 136          
BLAST of SMED30009573 vs. TrEMBL
Match: A0A3Q0HKR4 (centrosomal protein of 89 kDa isoform X2 OS=Alligator sinensis OX=38654 GN=CEP89 PE=4 SV=1)

HSP 1 Score: 86.6557 bits (213), Expect = 6.022e-17
Identity = 46/92 (50.00%), Postives = 66/92 (71.74%), Query Frame = -3
Query:  104 KATRKSISLETKMQVIRRLDSGERQSQISAALNLPTSTIRTILKNKEKILXXXXXXXXXXXTKITHSRNSIIEEMEKRLSIWIDDEIERNMP 379
            K  RKSI+LE K+ V++R+++GERQ+++  ALNL  ST+RTILKNK+KI       T  +A K++ SR  I+ EME+ LS+WI+D  +R MP
Sbjct:  178 KKQRKSITLELKLDVLKRIEAGERQNEVCRALNLAGSTVRTILKNKDKIKECGRIVTPLNALKLSRSRAPIMLEMERLLSVWIEDTTQRRMP 269          
BLAST of SMED30009573 vs. TrEMBL
Match: A0A2Y9E4W0 (tigger transposable element-derived protein 1-like OS=Trichechus manatus latirostris OX=127582 GN=LOC101360615 PE=4 SV=1)

HSP 1 Score: 85.8853 bits (211), Expect = 1.012e-16
Identity = 50/109 (45.87%), Postives = 80/109 (73.39%), Query Frame = -3
Query:   68 EKQENKATRKSISLETKMQVIRRLDSGERQSQISAALNLPTSTIRTILKNKEKILXXXXXXXXXXXTKITHSRNSIIEEMEKRLSIWIDDEIERNMPSIQSILITFRLR 394
            E + +K  RK+I+L+ K++V+RR ++GE+ S+I+ AL L TST+ TI  NK+KI +S+ A T  +ATK+T SR+ ++E ME+ LS+WI+D+ +RN+P I  +LI  + R
Sbjct:   30 ECRGSKRDRKAINLQVKLEVLRRFEAGEKLSRIAKALGLSTSTVATIRDNKDKIRASSQAATPQAATKLTRSRSLVMENMERLLSVWIEDQNQRNVP-INVVLIQEKAR 137          
BLAST of SMED30009573 vs. TrEMBL
Match: F6ZCE3 (Uncharacterized protein OS=Ornithorhynchus anatinus OX=9258 PE=4 SV=1)

HSP 1 Score: 85.5001 bits (210), Expect = 1.458e-16
Identity = 34/98 (34.69%), Postives = 65/98 (66.33%), Query Frame = -3
Query:   86 KATRKSISLETKMQVIRRLDSGERQSQISAALNLPTSTIRTILKNKEKILXXXXXXXXXXXTKITHSRNSIIEEMEKRLSIWIDDEIERNMPSIQSIL 379
            +   K+++ ETKM+++RRLD GERQ Q++ +L LP ST+ TI+KN+ +I+    +     +  +   R  ++EEME+ L++W+D + ++ +P  Q+++
Sbjct:    9 RRAHKTVTFETKMEILRRLDGGERQGQVARSLGLPHSTVSTIVKNRARIVRYVQSAGSLQSVMVNPKRGVLLEEMERLLTMWLDHQAQKRVPVNQAVI 106          
BLAST of SMED30009573 vs. TrEMBL
Match: A0A2Y9ME37 (tigger transposable element-derived protein 1-like OS=Delphinapterus leucas OX=9749 GN=LOC111170024 PE=4 SV=1)

HSP 1 Score: 82.4185 bits (202), Expect = 2.286e-15
Identity = 45/109 (41.28%), Postives = 77/109 (70.64%), Query Frame = -3
Query:   68 EKQENKATRKSISLETKMQVIRRLDSGERQSQISAALNLPTSTIRTILKNKEKILXXXXXXXXXXXTKITHSRNSIIEEMEKRLSIWIDDEIERNMPSIQSILITFRLR 394
            +++  K  RK+I+L+ K++V+RR ++GE+ S+I  AL L TST+ TI  NK+KI +S+ A T  +A K+T SR+ ++E ME+ LS+WI+D+  R++P +  +L+  + R
Sbjct:  205 QRRSAKRDRKAINLQVKLEVLRRFEAGEKLSRIGRALGLSTSTVATIRDNKDKIRASSQAATPHAACKLTRSRSLVMENMERLLSVWIEDQNRRDVP-VSVVLVQEKAR 312          
BLAST of SMED30009573 vs. TrEMBL
Match: A0A341B4F2 (tigger transposable element-derived protein 1-like isoform X3 OS=Neophocaena asiaeorientalis asiaeorientalis OX=1706337 GN=LOC112396907 PE=4 SV=1)

HSP 1 Score: 82.4185 bits (202), Expect = 2.308e-15
Identity = 45/109 (41.28%), Postives = 77/109 (70.64%), Query Frame = -3
Query:   68 EKQENKATRKSISLETKMQVIRRLDSGERQSQISAALNLPTSTIRTILKNKEKILXXXXXXXXXXXTKITHSRNSIIEEMEKRLSIWIDDEIERNMPSIQSILITFRLR 394
            +++  K  RK+I+L+ K++V+RR ++GE+ S+I  AL L TST+ TI  NK+KI +S+ A T  +A K+T SR+ ++E ME+ LS+WI+D+  R++P +  +L+  + R
Sbjct:  205 QRRSAKRDRKAINLQVKLEVLRRFEAGEKLSRIGRALGLSTSTVATIRDNKDKIRASSQAATPHAACKLTRSRSLVMENMERLLSVWIEDQNRRDVP-VSVVLVQEKAR 312          
BLAST of SMED30009573 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000018.1 (pep scaffold:Pmarinus_7.0:GL482463:8529:10142:1 gene:ENSPMAG00000000016.1 transcript:ENSPMAT00000000018.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 73.559 bits (179), Expect = 1.583e-16
Identity = 38/93 (40.86%), Postives = 59/93 (63.44%), Query Frame = -3
Query:  104 NKATRKSISLETKMQVIRRLDSGERQSQISAALNLPTSTIRTILKNKEKILXXXXXXXXXXXTKITHSRNSIIEEMEKRLSIWIDDEIERNMP 382
            +K  R +IS E K+ V+ R D+GER   IS+ L LP +++RTI  N  KI   A + T  +A +I   R+ + + ME+ LS+WI+D+ +RN+P
Sbjct:    8 SKKPRNTISFEVKLDVLNRFDAGERAVDISSELGLPPTSVRTIRANAHKIREYARSVTTLNAARIIRGRDKVKDNMERLLSLWIEDQGQRNVP 100          
BLAST of SMED30009573 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003106.1 (pep scaffold:Pmarinus_7.0:GL476998:37517:41189:1 gene:ENSPMAG00000002845.1 transcript:ENSPMAT00000003106.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 67.0106 bits (162), Expect = 8.640e-15
Identity = 36/92 (39.13%), Postives = 56/92 (60.87%), Query Frame = -3
Query:  104 KATRKSISLETKMQVIRRLDSGERQSQISAALNLPTSTIRTILKNKEKILXXXXXXXXXXXTKITHSRNSIIEEMEKRLSIWIDDEIERNMP 379
            K +RKS++LE K ++I+  D+GE  ++I+  L LP +T+ TILK+K +IL          A  I   R  +I EMEK L +W+DD+   ++P
Sbjct:    9 KRSRKSVTLEIKYKIIKLADNGESNTEIARKLELPRTTVVTILKDKARILEEVKGQAPMQAAYI-RQRAGLIAEMEKHLIVWLDDQTRHHVP 99          

HSP 2 Score: 27.7202 bits (60), Expect = 8.640e-15
Identity = 15/38 (39.47%), Postives = 20/38 (52.63%), Query Frame = -2
Query:   24 PIYFNYIQAEARNI-------------SETFVASRGWF 98
            P+    IQA+AR++             SETF AS+GWF
Sbjct:   99 PVSLAIIQAKARSLFEHLKARRGEGSQSETFQASKGWF 136          
BLAST of SMED30009573 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006798.1 (pep scaffold:Pmarinus_7.0:GL478691:31611:33359:1 gene:ENSPMAG00000006139.1 transcript:ENSPMAT00000006798.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 65.4698 bits (158), Expect = 1.062e-13
Identity = 36/86 (41.86%), Postives = 57/86 (66.28%), Query Frame = -3
Query:  113 RKSISLETKMQVIRRLDSGERQSQISAALNLPTSTIRTILKNKEKILXXXXXXXXXXXTKITHSRNSIIEEMEKRLSIWIDDEIER 370
            R +++LE K++++RR ++GE  + +  A NL  STIR I KN  KI SS   +T  SA K T  RN ++E+MEK L +W++D+ ++
Sbjct:   12 RTALTLEVKLEILRRAEAGEGPAALGRAFNLGESTIRAINKNSAKIRSSVMHSTPLSAKKTTRVRNPLLEKMEKMLVVWVEDQYQK 97          
BLAST of SMED30009573 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003825.1 (pep scaffold:Pmarinus_7.0:GL476420:1061824:1069341:1 gene:ENSPMAG00000003503.1 transcript:ENSPMAT00000003825.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 60.077 bits (144), Expect = 3.193e-12
Identity = 36/89 (40.45%), Postives = 52/89 (58.43%), Query Frame = -3
Query:  104 RKSISLETKMQVIRRLDSGERQSQISAALNLPTSTIRTILKNKEKILXXXXXXXXXXXTKITHSRNSIIEEMEKRLSIWIDDEIERNMP 370
            R  I++E KM +IRR + GE  + I  AL L  STI TI+K+KE+I+          +  IT  ++ ++ EMEKRL +WI+D   R  P
Sbjct:   12 RTIITMEMKMDIIRRSEKGETSAAIGRALGLNRSTIGTIIKDKERIVEHVKIAAPVKSIIIT-KQSGVLSEMEKRLLMWIEDRNRRCAP 99          
BLAST of SMED30009573 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003826.1 (pep scaffold:Pmarinus_7.0:GL476420:1061824:1069341:1 gene:ENSPMAG00000003503.1 transcript:ENSPMAT00000003826.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 60.077 bits (144), Expect = 3.293e-12
Identity = 36/89 (40.45%), Postives = 52/89 (58.43%), Query Frame = -3
Query:  104 RKSISLETKMQVIRRLDSGERQSQISAALNLPTSTIRTILKNKEKILXXXXXXXXXXXTKITHSRNSIIEEMEKRLSIWIDDEIERNMP 370
            R  I++E KM +IRR + GE  + I  AL L  STI TI+K+KE+I+          +  IT  ++ ++ EMEKRL +WI+D   R  P
Sbjct:   12 RTIITMEMKMDIIRRSEKGETSAAIGRALGLNRSTIGTIIKDKERIVEHVKIAAPVKSIIIT-KQSGVLSEMEKRLLMWIEDRNRRCAP 99          
BLAST of SMED30009573 vs. Planmine SMEST
Match: SMESG000071434.1 (SMESG000071434.1)

HSP 1 Score: 51.6026 bits (122), Expect = 2.410e-8
Identity = 38/97 (39.18%), Postives = 55/97 (56.70%), Query Frame = -3
Query:  116 DNEKQENKATRKSISLETKM--QVIRRLDSGERQSQISAALNLPTSTIRTILKNKEKILXXXXXXXXXXXTKITHSRNSIIEEMEKRLSIWIDDEIE 400
            D  K +N   + S  L  KM  Q++ RL  GE+ S I+  LNL  +T+RTI K +++I  +  A    S+   +  R  IIE+MEK LSIWI+D  +
Sbjct:  117 DQTKNDNVKRKWSSKLMMKMKKQILDRLLKGEKASHIAKTLNLNEATVRTIKKKEKEIRCAVAAGCSLSSKYSSRLRVPIIEKMEKALSIWINDSCQ 213          
The following BLAST results are available for this feature:
BLAST of SMED30009573 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
CENPBD11.532e-1542.53CENPB DNA-binding domain containing 1 [Source:HGNC... [more]
TIGD15.074e-832.29tigger transposable element derived 1 [Source:HGNC... [more]
back to top
BLAST of SMED30009573 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30009573 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30009573 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30009573 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30009573 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30009573 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 2
Match NameE-valueIdentityDescription
sp|B2RD01|CENP1_HUMAN7.358e-1542.53CENPB DNA-binding domain-containing protein 1 OS=H... [more]
sp|Q96MW7|TIGD1_HUMAN6.212e-832.29Tigger transposable element-derived protein 1 OS=H... [more]
back to top
BLAST of SMED30009573 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3Q0HKR46.022e-1750.00centrosomal protein of 89 kDa isoform X2 OS=Alliga... [more]
A0A2Y9E4W01.012e-1645.87tigger transposable element-derived protein 1-like... [more]
F6ZCE31.458e-1634.69Uncharacterized protein OS=Ornithorhynchus anatinu... [more]
A0A2Y9ME372.286e-1541.28tigger transposable element-derived protein 1-like... [more]
A0A341B4F22.308e-1541.28tigger transposable element-derived protein 1-like... [more]
back to top
BLAST of SMED30009573 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30009573 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000000018.11.583e-1640.86pep scaffold:Pmarinus_7.0:GL482463:8529:10142:1 ge... [more]
ENSPMAT00000003106.18.640e-1539.13pep scaffold:Pmarinus_7.0:GL476998:37517:41189:1 g... [more]
ENSPMAT00000006798.11.062e-1341.86pep scaffold:Pmarinus_7.0:GL478691:31611:33359:1 g... [more]
ENSPMAT00000003825.13.193e-1240.45pep scaffold:Pmarinus_7.0:GL476420:1061824:1069341... [more]
ENSPMAT00000003826.13.293e-1240.45pep scaffold:Pmarinus_7.0:GL476420:1061824:1069341... [more]
back to top
BLAST of SMED30009573 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30009573 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30009573 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30009573 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000071434.12.410e-839.18SMESG000071434.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30009573 ID=SMED30009573|Name=SMED30009573|organism=Schmidtea mediterranea sexual|type=transcript|length=435bp
AGGCTAAGAGCCTATCCCTGACAAAACCATCCTCTACTAGCAACGAAAGT
TTCACTTATGTTCCTTGCCTCAGCCTGAATGTAATTAAAATAGATTGGAT
TGATGGCATATTGCGTTCAATTTCGTCGTCAATCCATATAGACAGTCGTT
TTTCCATTTCCTCTATAATGCTATTTCTAGAATGGGTAATTTTAGTTGCA
GAGCTCTACGTAGTTGCAGTTGCCGATGACAGTATTTTTTCTTTATTCTT
AAGAATTGTCCTTATTGTTGAAGTTGGCAAATTCAATGCAGCACTAATTT
GAGATTGACGCTCACCAGAATCTAATCTTCTAATCACTTGCATTTTAGTT
TCCAGTGAAATGCTTTTTCTGGTTGCTTTATTTTCTTGTTTTTCATTATC
ACCCATGATAAAAACTAAAGATCGTAATATTTGTC
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000074oocyte
PLANA:0000231vitelline gland
Vocabulary: INTERPRO
TermDefinition
IPR007889HTH_Psq
IPR009057Homeobox-like_sf
Vocabulary: molecular function
TermDefinition
GO:0003677DNA binding