SMED30009566

Overview
NameSMED30009566
Smed IDSMED30009566
Length (bp)1990
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30009566 (SMED30009566) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30009566 (SMED30009566) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30009566

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30009566SMESG000015985.1 SmedASXL_000863SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30009566SMESG000015985.1 SmedASXL_000863SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
pharynxSMED30009566SMESG000015985.1 dd_Smed_v4_4240_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30009566SMESG000015985.1 dd_Smed_v4_4240_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30009566SMESG000015985.1 dd_Smed_v4_4240_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30009566SMESG000015985.1 dd_Smed_v4_4240_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30009566SMESG000015985.1 dd_Smed_v4_4240_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30009566SMESG000015985.1 dd_Smed_v4_4240_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30009566SMESG000015985.1 dd_Smed_v4_4240_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30009566SMESG000015985.1 dd_Smed_v4_4240_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30009566 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.000194:143392..146040 +9825
Homology
BLAST of SMED30009566 vs. Ensembl Human
Match: TSFM (Ts translation elongation factor, mitochondrial [Source:HGNC Symbol;Acc:HGNC:12367])

HSP 1 Score: 77.411 bits (189), Expect = 9.157e-26
Identity = 41/109 (37.61%), Postives = 56/109 (51.38%), Query Frame = -2
Query: 1435 LSKLRKISGFPISKCKEALVKCNSNVDESHEWLKSEAAKHGWLKMGKLAEKPMSNGLIGMQLNANQNFSCGVMLELNCETDFVARNQNFHKCLNTATSAFMEHICELPD 1761
            L KLR+ +G+    CK+AL  C  ++ ++  WL  EA K GW K  KL  +    GLIG+    N      V++E+NCETDFV+RN  F   +       M H   L D
Sbjct:   50 LMKLRRKTGYSFVNCKKALETCGGDLKQAEIWLHKEAQKEGWSKAAKLQGRKTKEGLIGLLQEGNTT----VLVEVNCETDFVSRNLKFQLLVQQVALGTMMHCQTLKD 154          

HSP 2 Score: 60.8474 bits (146), Expect = 9.157e-26
Identity = 43/153 (28.10%), Postives = 75/153 (49.02%), Query Frame = -3
Query:  915 KKETLDHLLAINVGSLGENMHFRRAVALKASKDSHLSIYSH--LSWPDINKKWKETTFGKYGVMLKYKRQIDIDTQLDEDCWRKNATKAANAICQHIVGLDPVKIGNSQADEPNESIDEENILIYQRFLHDENLKVSDVLHENCMEIEDFTRF 1367
            ++ +L   LA+ +G LGENM  +RA  +K     ++  Y H  +  P ++K       GKYG ++  +   +  T L ED  R+        + QH+VG+ P+ +G S  DEP    + E  ++ Q +L D ++ +   +    + + DF RF
Sbjct:  178 REGSLKDQLALAIGKLGENMILKRAAWVKVPSGFYVGSYVHGAMQSPSLHK----LVLGKYGALVICETS-EQKTNL-EDVGRR--------LGQHVVGMAPLSVG-SLDDEPGG--EAETKMLSQPYLLDPSITLGQYVQPQGVSVVDFVRF 313          
BLAST of SMED30009566 vs. Ensembl Human
Match: TSFM (Ts translation elongation factor, mitochondrial [Source:HGNC Symbol;Acc:HGNC:12367])

HSP 1 Score: 76.6406 bits (187), Expect = 9.712e-17
Identity = 40/107 (37.38%), Postives = 55/107 (51.40%), Query Frame = -2
Query: 1435 KLRKISGFPISKCKEALVKCNSNVDESHEWLKSEAAKHGWLKMGKLAEKPMSNGLIGMQLNANQNFSCGVMLELNCETDFVARNQNFHKCLNTATSAFMEHICELPD 1755
            KLR+ +G+    CK+AL  C  ++ ++  WL  EA K GW K  KL  +    GLIG+    N      V++E+NCETDFV+RN  F   +       M H   L D
Sbjct:    2 KLRRKTGYSFVNCKKALETCGGDLKQAEIWLHKEAQKEGWSKAAKLQGRKTKEGLIGLLQEGNTT----VLVEVNCETDFVSRNLKFQLLVQQVALGTMMHCQTLKD 104          

HSP 2 Score: 31.187 bits (69), Expect = 9.712e-17
Identity = 14/41 (34.15%), Postives = 23/41 (56.10%), Query Frame = -3
Query: 1245 KKETLDHLLAINVGSLGENMHFRRAVALKASKDSHLSIYSH 1367
            ++ +L   LA+ +G LGENM  +RA  +K     ++  Y H
Sbjct:  128 REGSLKDQLALAIGKLGENMILKRAAWVKVPSGFYVGSYVH 168          
BLAST of SMED30009566 vs. Ensembl Human
Match: TSFM (Ts translation elongation factor, mitochondrial [Source:HGNC Symbol;Acc:HGNC:12367])

HSP 1 Score: 77.0258 bits (188), Expect = 7.536e-16
Identity = 41/109 (37.61%), Postives = 56/109 (51.38%), Query Frame = -2
Query: 1435 LSKLRKISGFPISKCKEALVKCNSNVDESHEWLKSEAAKHGWLKMGKLAEKPMSNGLIGMQLNANQNFSCGVMLELNCETDFVARNQNFHKCLNTATSAFMEHICELPD 1761
            L KLR+ +G+    CK+AL  C  ++ ++  WL  EA K GW K  KL  +    GLIG+    N      V++E+NCETDFV+RN  F   +       M H   L D
Sbjct:   50 LMKLRRKTGYSFVNCKKALETCGGDLKQAEIWLHKEAQKEGWSKAAKLQGRKTKEGLIGLLQEGNTT----VLVEVNCETDFVSRNLKFQLLVQQVALGTMMHCQTLKD 154          
BLAST of SMED30009566 vs. Ensembl Human
Match: TSFM (Ts translation elongation factor, mitochondrial [Source:HGNC Symbol;Acc:HGNC:12367])

HSP 1 Score: 76.2554 bits (186), Expect = 8.210e-16
Identity = 40/107 (37.38%), Postives = 55/107 (51.40%), Query Frame = -2
Query: 1435 KLRKISGFPISKCKEALVKCNSNVDESHEWLKSEAAKHGWLKMGKLAEKPMSNGLIGMQLNANQNFSCGVMLELNCETDFVARNQNFHKCLNTATSAFMEHICELPD 1755
            KLR+ +G+    CK+AL  C  ++ ++  WL  EA K GW K  KL  +    GLIG+    N      V++E+NCETDFV+RN  F   +       M H   L D
Sbjct:    2 KLRRKTGYSFVNCKKALETCGGDLKQAEIWLHKEAQKEGWSKAAKLQGRKTKEGLIGLLQEGNTT----VLVEVNCETDFVSRNLKFQLLVQQVALGTMMHCQTLKD 104          
BLAST of SMED30009566 vs. Ensembl Human
Match: TSFM (Ts translation elongation factor, mitochondrial [Source:HGNC Symbol;Acc:HGNC:12367])

HSP 1 Score: 77.0258 bits (188), Expect = 1.893e-15
Identity = 41/109 (37.61%), Postives = 56/109 (51.38%), Query Frame = -2
Query: 1435 LSKLRKISGFPISKCKEALVKCNSNVDESHEWLKSEAAKHGWLKMGKLAEKPMSNGLIGMQLNANQNFSCGVMLELNCETDFVARNQNFHKCLNTATSAFMEHICELPD 1761
            L KLR+ +G+    CK+AL  C  ++ ++  WL  EA K GW K  KL  +    GLIG+    N      V++E+NCETDFV+RN  F   +       M H   L D
Sbjct:   50 LMKLRRKTGYSFVNCKKALETCGGDLKQAEIWLHKEAQKEGWSKAAKLQGRKTKEGLIGLLQEGNTT----VLVEVNCETDFVSRNLKFQLLVQQVALGTMMHCQTLKD 154          
BLAST of SMED30009566 vs. Ensembl Celegans
Match: tsfm-1 (Elongation factor Ts, mitochondrial [Source:UniProtKB/Swiss-Prot;Acc:Q20819])

HSP 1 Score: 71.633 bits (174), Expect = 2.426e-13
Identity = 39/105 (37.14%), Postives = 61/105 (58.10%), Query Frame = -2
Query: 1459 KTDLSKLRKISGFPISKCKEALVKCNSN-VDESHEWLKSEAAKHGWLKMGKLAEKPMSNGLIGMQLNANQNFSCGVMLELNCETDFVARNQNFHKCLNTATSAFM 1770
            K  L  LRK +G+    C++AL++   N +D + +WLK  AAK GW K  KL  +  SNGL+ +  +     S   ++EL+CETDFVAR+  F   L+  +++ +
Sbjct:   27 KEALMALRKKTGYSYVNCRKALIQFGENDMDSAVKWLKEAAAKEGWAKAAKLGTRVTSNGLVSVVTDN----STAAVVELSCETDFVARSGAFKDLLSNISNSVL 127          
BLAST of SMED30009566 vs. Ensembl Fly
Match: mEFTs (gene:FBgn0032646 transcript:FBtr0080994)

HSP 1 Score: 98.2117 bits (243), Expect = 1.459e-39
Identity = 56/152 (36.84%), Postives = 83/152 (54.61%), Query Frame = -3
Query:  903 TLDHLLAINVGSLGENMHFRRAVALKASKDSHLSIYSHLSWPDINKKWKETTFGKYGVMLKYKRQIDIDTQLDEDCWRKNATKAANAICQHIVGLDPVKIGNSQADEPNESIDEENILIYQRFLHDENLKVSDVLHENCMEIEDFTRFNCGE 1358
            TL   LA+ +G++GEN   RRA+  KA+ D  L  Y+H +  ++      T  GKYG ++ Y+    +   LD +  +        +ICQ IVG+ P KIG    D+P E+ D+E  LI+Q +L D +  V + L E+  EI D+ RF CGE
Sbjct:  160 TLGDHLALLIGAIGENATIRRALCFKANNDLKLVGYAHPAPTNVGTTEGITQVGKYGAIVAYRSTHPL---LDFEFHK--------SICQQIVGMKPTKIGEYDKDKPAENKDDETCLIHQEYLLDADKTVGEALQEHNCEIVDYHRFECGE 300          

HSP 2 Score: 85.5001 bits (210), Expect = 1.459e-39
Identity = 43/108 (39.81%), Postives = 67/108 (62.04%), Query Frame = -2
Query: 1447 KTDLSKLRKISGFPISKCKEALVKCNSNVDESHEWLKSEAAKHGWLKMGKLAEKPMSNGLIGMQLNANQNFSCGVMLELNCETDFVARNQNFHKCLNTATSAFMEHIC 1770
            K+ L+ LRK +G+  + CK+AL K N++V  + +WL  +A   GW K  K+A++  ++GLIG+ +  N+    G M+ELNCETDFVARN  F +        F++H+ 
Sbjct:   29 KSALAALRKKTGYTFANCKKALEKHNNDVGLAEKWLHEQAQTLGWSKATKVADRATAHGLIGVLIRGNR----GAMVELNCETDFVARNDTFKR--------FVDHVA 124          
BLAST of SMED30009566 vs. Ensembl Zebrafish
Match: tsfm (Ts translation elongation factor, mitochondrial [Source:NCBI gene;Acc:567785])

HSP 1 Score: 88.5817 bits (218), Expect = 6.493e-31
Identity = 43/106 (40.57%), Postives = 63/106 (59.43%), Query Frame = -2
Query: 1453 KTDLSKLRKISGFPISKCKEALVKCNSNVDESHEWLKSEAAKHGWLKMGKLAEKPMSNGLIGMQLNANQNFSCGVMLELNCETDFVARNQNFHKCLNTATSAFMEH 1770
            K  L +LRK +G+    CK+AL KCN+++ ++  WL  +A K GW K  KL  +    GLIG+ ++ N      VM+E+NCETDFVARN+ F + +     + M H
Sbjct:   35 KALLLQLRKSTGYTFVNCKKALEKCNNDITQAESWLHGQAKKEGWSKATKLEGRKAKEGLIGLMMHDN----AAVMVEVNCETDFVARNEKFQQLVKDVALSVMAH 136          

HSP 2 Score: 66.2402 bits (160), Expect = 6.493e-31
Identity = 49/168 (29.17%), Postives = 71/168 (42.26%), Query Frame = -3
Query:  903 LNEYSISMLILTKKETLDHLLAINVGSLGENMHFRRAVALKASKDSHLSIYSHLSWPDINKKWKETTFGKYGV-MLKYKRQIDIDTQLDEDCWRKNATKAANAICQHIVGLDPVKIGNSQADEPNESIDEENILIYQRFLHDENLKVSDVLHENCMEIEDFTRFNCGE 1403
            L+   +S L      +L   LA+ +G LGEN+  RRAV+L    D H+  Y H            T  G+ G+ M +Y   +    +  E  +          + QH++G  PV +GN    +     D E  L+ Q FL D    V+  L      + DF RF CGE
Sbjct:  150 LSSEDMSKLNAPDGPSLADQLALTIGRLGENIAMRRAVSLSVPSDWHIGSYIH-----------GTVAGQVGIEMGRYGSLVVFQGEPKEGTY-----ALGRKLAQHVMGEAPVSLGNM---DDLSCGDSETRLLPQTFLPDPKYTVAQYLTLQDARVLDFIRFQCGE 298          
BLAST of SMED30009566 vs. Ensembl Zebrafish
Match: tsfm (Ts translation elongation factor, mitochondrial [Source:NCBI gene;Acc:567785])

HSP 1 Score: 88.5817 bits (218), Expect = 6.935e-31
Identity = 43/106 (40.57%), Postives = 63/106 (59.43%), Query Frame = -2
Query: 1453 KTDLSKLRKISGFPISKCKEALVKCNSNVDESHEWLKSEAAKHGWLKMGKLAEKPMSNGLIGMQLNANQNFSCGVMLELNCETDFVARNQNFHKCLNTATSAFMEH 1770
            K  L +LRK +G+    CK+AL KCN+++ ++  WL  +A K GW K  KL  +    GLIG+ ++ N      VM+E+NCETDFVARN+ F + +     + M H
Sbjct:   37 KALLLQLRKSTGYTFVNCKKALEKCNNDITQAESWLHEQAKKEGWSKATKLEGRKAKEGLIGLMMHDN----AAVMVEVNCETDFVARNEKFQQLVKDVALSVMAH 138          

HSP 2 Score: 66.2402 bits (160), Expect = 6.935e-31
Identity = 49/168 (29.17%), Postives = 71/168 (42.26%), Query Frame = -3
Query:  903 LNEYSISMLILTKKETLDHLLAINVGSLGENMHFRRAVALKASKDSHLSIYSHLSWPDINKKWKETTFGKYGV-MLKYKRQIDIDTQLDEDCWRKNATKAANAICQHIVGLDPVKIGNSQADEPNESIDEENILIYQRFLHDENLKVSDVLHENCMEIEDFTRFNCGE 1403
            L+   +S L      +L   LA+ +G LGEN+  RRAV+L    D H+  Y H            T  G+ G+ M +Y   +    +  E  +          + QH++G  PV +GN    +     D E  L+ Q FL D    V+  L      + DF RF CGE
Sbjct:  152 LSSEDMSKLNAPDGPSLADQLALTIGRLGENIAMRRAVSLSVPSDWHIGSYIH-----------GTVAGQVGIEMGRYGSLVVFQGEPKEGTY-----ALGRKLAQHVMGEAPVSLGNM---DDLSCGDSETRLLPQTFLPDPKYTVAQYLTLQDARVLDFIRFQCGE 300          
BLAST of SMED30009566 vs. Ensembl Xenopus
Match: cebpz (CCAAT enhancer binding protein zeta [Source:Xenbase;Acc:XB-GENE-853892])

HSP 1 Score: 79.337 bits (194), Expect = 1.108e-31
Identity = 54/191 (28.27%), Postives = 88/191 (46.07%), Query Frame = -3
Query:  897 VNFRILMQFNSAQKNLNEYSISML-------ILTKKETLDHLLAINVGSLGENMHFRRAVALKASKDSHLSIYSHLSWPDINKKWKETTFGKYGVMLKYKRQIDIDTQLDEDCWRKNATKAANAICQHIVGLDPVKIGNSQADEPNESIDEENILIYQRFLHDENLKVSDVLHENCMEIEDFTRFNCGELA 1448
            V    L    S Q+N++ Y    L       +  ++  L   LA+ +G LGENM  +RA  +K   D  +  Y H             TFGKYG ++  K   D D+       + N ++    + QH+VG++P+ +G+ + +   E+   E  ++ Q FL + +L V   L    + + DF RF CGE+A
Sbjct:  153 VAVSTLRHCQSHQENMSSYVKGFLSGEELLQMKAEESLLKDQLALAIGKLGENMTMKRAAWVKTPSDIFIGSYMHGILVADVPSLSNITFGKYGALVICK---DSDSNP-----KSNISEVGRRLGQHVVGMNPLSVGSLEDESSGET---ETKMLAQSFLLEPSLTVGQYLQPRGINVLDFIRFECGEVA 332          

HSP 2 Score: 78.5666 bits (192), Expect = 1.108e-31
Identity = 38/103 (36.89%), Postives = 60/103 (58.25%), Query Frame = -2
Query: 1453 LSKLRKISGFPISKCKEALVKCNSNVDESHEWLKSEAAKHGWLKMGKLAEKPMSNGLIGMQLNANQNFSCGVMLELNCETDFVARNQNFHKCLNTATSAFMEH 1761
            L KLRK +G+    CK+AL + +++  ++  WL  +A K GW K  KL  +  + GL+G+  + N +    VM+E+NCETDFVARN  F + +     + + H
Sbjct:   62 LVKLRKRTGYSFINCKKALEQFSNDFKQAETWLHQQAQKEGWDKASKLQGRKTTEGLVGLLQDGNTS----VMVEVNCETDFVARNSKFQQLVQQVAVSTLRH 160          
BLAST of SMED30009566 vs. Ensembl Mouse
Match: Tsfm (Ts translation elongation factor, mitochondrial [Source:MGI Symbol;Acc:MGI:1913649])

HSP 1 Score: 79.337 bits (194), Expect = 1.116e-27
Identity = 40/109 (36.70%), Postives = 58/109 (53.21%), Query Frame = -2
Query: 1435 LSKLRKISGFPISKCKEALVKCNSNVDESHEWLKSEAAKHGWLKMGKLAEKPMSNGLIGMQLNANQNFSCGVMLELNCETDFVARNQNFHKCLNTATSAFMEHICELPD 1761
            L KLR+ +G+    CK+AL  C  ++ ++ +WL  +A K GW K  KL  +    GLIG+    N      V++E+NCETDFV+RN  F + +       M H   L D
Sbjct:   49 LMKLRRKTGYSFVNCKKALETCGGDLKQAEDWLHKQAQKEGWSKAAKLHGRKTKEGLIGLLQEGN----TAVLVEVNCETDFVSRNLKFQQLVQQVALGTMAHCQNLTD 153          

HSP 2 Score: 64.6994 bits (156), Expect = 1.116e-27
Identity = 41/155 (26.45%), Postives = 71/155 (45.81%), Query Frame = -3
Query:  903 KKETLDHLLAINVGSLGENMHFRRAVALKASKDSHLSIYSHLSWPDINKKWKETTFGKYGVMLKYKRQIDIDTQLDEDCWRKNATKAANAICQHIVGLDPVKIGNSQADEPNESIDEENILIYQRFLHDENLKVSDVLHENCMEIEDFTRFNCGE 1367
            ++ +L   LA+ +G LGENM  +RA  +K     ++  Y H      +   +    GKYG ++  +    I           N  +    + QH+VG+ P+ +G S  DEP    + E  ++ Q +L D ++ +   +    + + DF RF CGE
Sbjct:  177 REGSLKDQLALAIGKLGENMILKRAAWVKVPSGFYVGSYVH--GVTQSPSLQNLVLGKYGALVICETPEQI----------ANLEEVGRRLGQHVVGMAPLSVG-SLDDEPGG--ETETRMLPQPYLLDPSITLGQYVQPQGVTVVDFVRFECGE 316          
BLAST of SMED30009566 vs. Ensembl Mouse
Match: Tsfm (Ts translation elongation factor, mitochondrial [Source:MGI Symbol;Acc:MGI:1913649])

HSP 1 Score: 79.7221 bits (195), Expect = 1.376e-16
Identity = 40/109 (36.70%), Postives = 58/109 (53.21%), Query Frame = -2
Query: 1435 LSKLRKISGFPISKCKEALVKCNSNVDESHEWLKSEAAKHGWLKMGKLAEKPMSNGLIGMQLNANQNFSCGVMLELNCETDFVARNQNFHKCLNTATSAFMEHICELPD 1761
            L KLR+ +G+    CK+AL  C  ++ ++ +WL  +A K GW K  KL  +    GLIG+    N      V++E+NCETDFV+RN  F + +       M H   L D
Sbjct:   49 LMKLRRKTGYSFVNCKKALETCGGDLKQAEDWLHKQAQKEGWSKAAKLHGRKTKEGLIGLLQEGN----TAVLVEVNCETDFVSRNLKFQQLVQQVALGTMAHCQNLTD 153          
BLAST of SMED30009566 vs. Ensembl Mouse
Match: Tsfm (Ts translation elongation factor, mitochondrial [Source:MGI Symbol;Acc:MGI:1913649])

HSP 1 Score: 53.1434 bits (126), Expect = 2.155e-7
Identity = 30/96 (31.25%), Postives = 48/96 (50.00%), Query Frame = -2
Query: 1492 LSKLRKISGFPISKCKEALVKCNSNVDESHEWLKSEAAKHGWLKMGKLAEKPMSNGLIGMQLNANQNFSCGVMLELNCETDFV------ARNQNFH 1761
            L KLR+ +G+    CK+AL  C  ++ ++ +WL  +A K GW K  KL  +    GLIG+    N      V+L L+ +   V      +R ++ H
Sbjct:   49 LMKLRRKTGYSFVNCKKALETCGGDLKQAEDWLHKQAQKEGWSKAAKLHGRKTKEGLIGLLQEGNTAVLVEVVLCLSPQQKDVVGVERGSRGRDLH 144          
BLAST of SMED30009566 vs. UniProt/SwissProt
Match: sp|Q9VJC7|EFTS_DROME (Elongation factor Ts, mitochondrial OS=Drosophila melanogaster OX=7227 GN=mEFTs PE=2 SV=1)

HSP 1 Score: 98.2117 bits (243), Expect = 1.115e-38
Identity = 56/152 (36.84%), Postives = 83/152 (54.61%), Query Frame = -3
Query:  903 TLDHLLAINVGSLGENMHFRRAVALKASKDSHLSIYSHLSWPDINKKWKETTFGKYGVMLKYKRQIDIDTQLDEDCWRKNATKAANAICQHIVGLDPVKIGNSQADEPNESIDEENILIYQRFLHDENLKVSDVLHENCMEIEDFTRFNCGE 1358
            TL   LA+ +G++GEN   RRA+  KA+ D  L  Y+H +  ++      T  GKYG ++ Y+    +   LD +  +        +ICQ IVG+ P KIG    D+P E+ D+E  LI+Q +L D +  V + L E+  EI D+ RF CGE
Sbjct:  160 TLGDHLALLIGAIGENATIRRALCFKANNDLKLVGYAHPAPTNVGTTEGITQVGKYGAIVAYRSTHPL---LDFEFHK--------SICQQIVGMKPTKIGEYDKDKPAENKDDETCLIHQEYLLDADKTVGEALQEHNCEIVDYHRFECGE 300          

HSP 2 Score: 85.5001 bits (210), Expect = 1.115e-38
Identity = 43/108 (39.81%), Postives = 67/108 (62.04%), Query Frame = -2
Query: 1447 KTDLSKLRKISGFPISKCKEALVKCNSNVDESHEWLKSEAAKHGWLKMGKLAEKPMSNGLIGMQLNANQNFSCGVMLELNCETDFVARNQNFHKCLNTATSAFMEHIC 1770
            K+ L+ LRK +G+  + CK+AL K N++V  + +WL  +A   GW K  K+A++  ++GLIG+ +  N+    G M+ELNCETDFVARN  F +        F++H+ 
Sbjct:   29 KSALAALRKKTGYTFANCKKALEKHNNDVGLAEKWLHEQAQTLGWSKATKVADRATAHGLIGVLIRGNR----GAMVELNCETDFVARNDTFKR--------FVDHVA 124          
BLAST of SMED30009566 vs. UniProt/SwissProt
Match: sp|C3YEM5|EFTS_BRAFL (Elongation factor Ts, mitochondrial OS=Branchiostoma floridae OX=7739 GN=BRAFLDRAFT_84221 PE=3 SV=1)

HSP 1 Score: 88.9669 bits (219), Expect = 1.735e-33
Identity = 49/136 (36.03%), Postives = 77/136 (56.62%), Query Frame = -2
Query: 1378 KTDLSKLRKISGFPISKCKEALVKCNSNVDESHEWLKSEAAKHGWLKMGKLAEKPMSNGLIGMQLNANQNFSCGVMLELNCETDFVARNQNFHKCLNTATSAFMEHICELPD-----INAIQLGSEELKRILYLDV 1770
            K +LSKLRK +GF    C++AL K  ++++++ +WLK +A K GW K  KL ++  + GL+G+     Q  +   M+E+NCETDFVARN  F + +     A +  +   P      + A+  G EELK++   D 
Sbjct:   32 KANLSKLRKKTGFTFVNCRKALEKFENDLEQAEKWLKEQAQKEGWAKATKLQDRQTAQGLVGV----AQEGTMATMVEVNCETDFVARNPKFRQLVTQVAMATLGDVKAHPQWTLGWLKALHTG-EELKQLQIGDT 162          

HSP 2 Score: 77.411 bits (189), Expect = 1.735e-33
Identity = 46/173 (26.59%), Postives = 80/173 (46.24%), Query Frame = -3
Query:  900 TLDHLLAINVGSLGENMHFRRAV--ALKASKDSHLSIYSHLSWPDI-NKKWKETTFGKYGVMLKYKRQIDIDTQLDEDCWRKNATKAANAICQHIVGLDPVKIG--------------NSQADEPNESID---EENILIYQRFLHDENLKVSDVLHENCMEIEDFTRFNCGEL 1358
            TL  L A+ +G+LGEN+  RRA+  ++      H+ +Y H         +      GKYG ++ ++R+       + +    NA +    + QH+VG+ P+ +G                + DE   S D   +E  ++ Q FL D  + V ++  +  +E+ DF RF CGE+
Sbjct:  163 TLGDLTALTIGTLGENIQIRRAMYYSVPPIPTKHVGVYVHAPVAGTTGGQSGSCALGKYGALVAFRRK-------NTEFQNFNAAELGRRLGQHVVGMSPLTVGEMPEVREEEGEKKDGDKQDEEERSTDSDEDETQMLRQTFLLDPTMTVGEMTRQQGIELLDFVRFECGEV 328          
BLAST of SMED30009566 vs. UniProt/SwissProt
Match: sp|A1L2P7|EFTS_XENLA (Elongation factor Ts, mitochondrial OS=Xenopus laevis OX=8355 GN=tsfm PE=2 SV=1)

HSP 1 Score: 82.0333 bits (201), Expect = 8.406e-32
Identity = 43/123 (34.96%), Postives = 65/123 (52.85%), Query Frame = -2
Query: 1435 FYYXXXXXXXSKTDLSKLRKISGFPISKCKEALVKCNSNVDESHEWLKSEAAKHGWLKMGKLAEKPMSNGLIGMQLNANQNFSCGVMLELNCETDFVARNQNFHKCLNTATSAFMEHICELPD 1803
            F+      +  K  L KLRK +G+    CK+AL +C ++  ++  WL  +A K GW K  KL  +    GL+G+     Q+ S  VM+E+NCETDFVARN  F + +     + + H    P+
Sbjct:   21 FHTGVRLLAADKDLLVKLRKKTGYSFMNCKKALEQCANDFKQAETWLHQQAQKEGWDKASKLQGRKTKEGLVGLL----QDGSTSVMVEVNCETDFVARNSKFQQLVQQVAVSTLRHCQSHPE 139          

HSP 2 Score: 78.5666 bits (192), Expect = 8.406e-32
Identity = 51/162 (31.48%), Postives = 79/162 (48.77%), Query Frame = -3
Query:  897 MLILTKKETLDHLLAINVGSLGENMHFRRAVALKASKDSHLSIYSHLSWPDINKKWKETTFGKYGVMLKYKRQIDIDTQLDEDCWRKNATKAANAICQHIVGLDPVKIGNSQADEPNESIDEENILIYQRFLHDENLKVSDVLHENCMEIEDFTRFNCGELA 1382
            +L L   E+L   LA+ +G LGENM  +RA  +K   D  +  Y H             TFGKYG ++  K   D D  L     + N ++    + QH+VG++P+ +G+ + +   E+   E  ++ Q FL + +L V   L    + + DF RF CGE A
Sbjct:  154 LLQLKADESLKDQLALAIGKLGENMIMKRAAWVKTPSDIFVGSYMHGILMADLPSLTNMTFGKYGALVICK---DSDGNL-----KSNISEIGRRLGQHVVGMNPLLVGSLEDESGGET---ETKMLAQPFLLEPSLTVGQYLQPRGINVLDFIRFECGEEA 304          
BLAST of SMED30009566 vs. UniProt/SwissProt
Match: sp|B5X5B4|EFTS_SALSA (Elongation factor Ts, mitochondrial OS=Salmo salar OX=8030 GN=tsfm PE=2 SV=1)

HSP 1 Score: 84.3445 bits (207), Expect = 5.427e-31
Identity = 43/106 (40.57%), Postives = 61/106 (57.55%), Query Frame = -2
Query: 1453 KTDLSKLRKISGFPISKCKEALVKCNSNVDESHEWLKSEAAKHGWLKMGKLAEKPMSNGLIGMQLNANQNFSCGVMLELNCETDFVARNQNFHKCLNTATSAFMEH 1770
            K  L KLRK +G+    CK+AL KC++++ ++  WL  +A K GW K  KL  +    GLIG+ +         VM+E+NCETDFVARN+ F + +     A M H
Sbjct:   37 KALLMKLRKSTGYTFINCKKALEKCDNDITKAESWLHEQAQKEGWSKASKLEGRRAKEGLIGLFVGDK----AAVMVEVNCETDFVARNEKFQQLVKDVAFATMAH 138          

HSP 2 Score: 73.559 bits (179), Expect = 5.427e-31
Identity = 54/165 (32.73%), Postives = 75/165 (45.45%), Query Frame = -3
Query:  894 ISMLILTKKETLDHLLAINVGSLGENMHFRRAVALKASKDSHLSIYSHLSWPDINKKWKETTFGKYGVMLKYKRQIDIDTQLDEDCWRKNATKAANAICQHIVGLDPVKIGNSQADEPNESIDEENILIYQRFLHDENLKVSDVLHENCMEIEDFTRFNCGELAT 1388
            +S L L +  +L   LA+ +G LGEN+  RRAV +      H+  Y H           +   G+YG ++ +  Q   D  LD    RK        + QH+VG  PV +GN   D P    D E  L+ Q FL D +  V+  L E    + DF RF CGE  +
Sbjct:  159 LSKLNLGEDASLADQLALTIGRLGENISVRRAVTVGVPAGWHIGSYIHGGVAG----QSDMAMGRYGALVVF--QGGKDGALDT-LGRK--------LGQHVVGEAPVSLGNMD-DLP--CGDAETRLLPQSFLPDPSRTVAQYLTEQGARVLDFVRFQCGEAGS 305          
BLAST of SMED30009566 vs. UniProt/SwissProt
Match: sp|A1A5Z3|EFTS_DANRE (Elongation factor Ts, mitochondrial OS=Danio rerio OX=7955 GN=tsfm PE=2 SV=1)

HSP 1 Score: 88.5817 bits (218), Expect = 4.560e-30
Identity = 43/106 (40.57%), Postives = 63/106 (59.43%), Query Frame = -2
Query: 1453 KTDLSKLRKISGFPISKCKEALVKCNSNVDESHEWLKSEAAKHGWLKMGKLAEKPMSNGLIGMQLNANQNFSCGVMLELNCETDFVARNQNFHKCLNTATSAFMEH 1770
            K  L +LRK +G+    CK+AL KCN+++ ++  WL  +A K GW K  KL  +    GLIG+ ++ N      VM+E+NCETDFVARN+ F + +     + M H
Sbjct:   37 KALLLQLRKSTGYTFVNCKKALEKCNNDITQAESWLHEQAKKEGWSKATKLEGRKAKEGLIGLMMHDN----AAVMVEVNCETDFVARNEKFQQLVKDVALSVMAH 138          

HSP 2 Score: 66.2402 bits (160), Expect = 4.560e-30
Identity = 49/168 (29.17%), Postives = 71/168 (42.26%), Query Frame = -3
Query:  903 LNEYSISMLILTKKETLDHLLAINVGSLGENMHFRRAVALKASKDSHLSIYSHLSWPDINKKWKETTFGKYGV-MLKYKRQIDIDTQLDEDCWRKNATKAANAICQHIVGLDPVKIGNSQADEPNESIDEENILIYQRFLHDENLKVSDVLHENCMEIEDFTRFNCGE 1403
            L+   +S L      +L   LA+ +G LGEN+  RRAV+L    D H+  Y H            T  G+ G+ M +Y   +    +  E  +          + QH++G  PV +GN    +     D E  L+ Q FL D    V+  L      + DF RF CGE
Sbjct:  152 LSSEDMSKLNAPDGPSLADQLALTIGRLGENIAMRRAVSLSVPSDWHIGSYIH-----------GTVAGQVGIEMGRYGSLVVFQGEPKEGTY-----ALGRKLAQHVMGEAPVSLGNM---DDLSCGDSETRLLPQTFLPDPKYTVAQYLTLQDARVLDFIRFQCGE 300          
BLAST of SMED30009566 vs. TrEMBL
Match: A0A183AQ99 (Elongation factor Ts, mitochondrial OS=Echinostoma caproni OX=27848 GN=ECPE_LOCUS9134 PE=3 SV=1)

HSP 1 Score: 108.612 bits (270), Expect = 6.391e-46
Identity = 53/114 (46.49%), Postives = 74/114 (64.91%), Query Frame = -2
Query: 1429 KTDLSKLRKISGFPISKCKEALVKCNSNVDESHEWLKSEAAKHGWLKMGKLAEKPMSNGLIGMQLNANQNFSCGVMLELNCETDFVARNQNFHKCLNTATSAFMEHICELPDIN 1770
            K+ LSKLR+ +G+  S CKEAL+K N+  D++ +WL  EA + GW K GKL+ +P+S GL+G+     Q  +  V+LE+NCETDFVARN+ F   +  AT A ME     P I+
Sbjct:   36 KSQLSKLRRSTGYTFSACKEALLKHNNEYDKALQWLNDEAVRRGWEKAGKLSTRPLSQGLLGVL----QTRTHAVVLEVNCETDFVARNEQFQNFVANATEAVMERFTVNPSIS 145          

HSP 2 Score: 107.071 bits (266), Expect = 6.391e-46
Identity = 60/177 (33.90%), Postives = 100/177 (56.50%), Query Frame = -3
Query:  903 NSAQKNLNEYSISMLILTKKETLDHLLAINVGSLGENMHFRRAVALKASKD-SHLSIYSHLSWPDINKKWKETTFGKYGVMLKYKRQIDIDTQLDEDCWRKNATKAANAICQHIVGLDPVKIG---NSQADEPNESIDEENILIYQRFLHDENLKVSDVLHENCMEIEDFTRFNCGE 1421
            N +  +L+  +I+ LIL K   L   +AI VG++GEN+  RRA+ L    D S L+ Y+H+S   +    ++  FGKY  +++Y+    +  Q+    W + A++    +CQHIVG++P + G    S AD+P    DEE  L+ Q F  D+ ++V + L+ N + +E+F R  CG+
Sbjct:  141 NPSISHLDAENINNLILEKSTKLSDAVAIVVGAVGENIAVRRAIGLHNPGDPSRLASYAHISTDGVKSGIRDVKFGKYAAIIRYR---PVGDQVASAAWHERASRLGKQLCQHIVGMNP-RPGLDLTSPADDP----DEEKCLLLQPFFLDDTVRVGEHLNRNEIVLEEFIRAECGQ 309          
BLAST of SMED30009566 vs. TrEMBL
Match: A0A074Z3T0 (Elongation factor Ts, mitochondrial OS=Opisthorchis viverrini OX=6198 GN=T265_11234 PE=3 SV=1)

HSP 1 Score: 108.227 bits (269), Expect = 6.826e-42
Identity = 56/166 (33.73%), Postives = 89/166 (53.61%), Query Frame = -3
Query:  903 ISMLILTKKETLDHLLAINVGSLGENMHFRRAVALKASK----DSHLSIYSHLSWPDINKKWKETTFGKYGVMLKYKRQIDIDTQLDEDCWRKNATKAANAICQHIVGLDPVKIGNSQADEPNESIDEENILIYQRFLHDENLKVSDVLHENCMEIEDFTRFNCGE 1388
            +++ I     T+   +A+ +G++GENM  RRAV L+ S      S L+ Y H+S   I    ++  FGKY  +++Y+       Q     W++ A++    +CQHIVG++P      +  EP E  +EE  L+ Q F  DEN++V + L  N M +EDF R  CG+
Sbjct:  414 MALTIPNSAGTVSDNMAVAIGAIGENMAIRRAVGLRTSDIPDCASRLASYIHISTAGIRPSIRDVKFGKYAAVVRYR---PAGNQPASPAWQERASRLGEQLCQHIVGMNPRP--GLEITEPAEDPEEEQCLLLQPFFLDENIRVGEHLTRNDMILEDFIRVECGQ 574          

HSP 2 Score: 93.9745 bits (232), Expect = 6.826e-42
Identity = 44/105 (41.90%), Postives = 69/105 (65.71%), Query Frame = -2
Query: 1456 KTDLSKLRKISGFPISKCKEALVKCNSNVDESHEWLKSEAAKHGWLKMGKLAEKPMSNGLIGMQLNANQNFSCGVMLELNCETDFVARNQNFHKCLNTATSAFME 1770
            KT L+KLR+ +G+  + CKEAL+K +++++++  WL  EA + GW K GKL+ + +S GL+G+Q +        V++E+NCETDFVARN+ F   +  AT   M 
Sbjct:  297 KTLLAKLRRQTGYTFAACKEALLKHDNDLNKASAWLTEEAVRRGWDKAGKLSGRTLSQGLLGLQFSRTH----AVVVEVNCETDFVARNEQFQNFVAVATEMVMR 397          

HSP 3 Score: 95.1301 bits (235), Expect = 1.371e-16
Identity = 47/116 (40.52%), Postives = 72/116 (62.07%), Query Frame = -2
Query: 1432 KTDLSKLRKISGFPISKCKEALVKCNSNVDESHEWLKSEAAKHGWLKMGKLAEKPMSNGLIGMQLNANQNFSCGVMLELNCETDFVARNQNFHKCLNTATSAFMEHICEL---PDI 1770
            KT L+KLR+ +G+  + CKEAL+K +++++++  WL  EA + GW K GKL+ + +S GL+G+Q +        V++E+NCETDFVARN+ F   +  AT   M         PDI
Sbjct:  109 KTLLAKLRRQTGYTFAACKEALLKHDNDLNKASAWLTEEAVRRGWDKAGKLSGRTLSQGLLGLQFSRTH----AVVVEVNCETDFVARNEQFQNFVAVATEMVMREFVSRFISPDI 220          
BLAST of SMED30009566 vs. TrEMBL
Match: A0A504YKM2 (Elongation factor Ts, mitochondrial OS=Fasciola gigantica OX=46835 GN=FGIG_01136 PE=3 SV=1)

HSP 1 Score: 103.605 bits (257), Expect = 7.117e-42
Identity = 56/163 (34.36%), Postives = 91/163 (55.83%), Query Frame = -3
Query:  903 LILTKKETLDHLLAINVGSLGENMHFRRAVALKASKD-SHLSIYSHLSWPDINKKWKETTFGKYGVMLKYKRQIDIDTQLDEDCWRKNATKAANAICQHIVGLDPVKIG---NSQADEPNESIDEENILIYQRFLHDENLKVSDVLHENCMEIEDFTRFNCGE 1379
            ++L K   L   +AI VG++GEN+  RRAV L    D S L+ Y+H+S   + +  +E  FGKY  +++Y+       Q+    W + A++    +CQHIVG++P + G    + AD+P    DEE  L+ Q F  D+ ++V + L  N + +E+F R  CG+
Sbjct:  154 MVLDKSTKLSDAVAIVVGAVGENIAVRRAVGLHNIDDTSRLASYAHISTDGVKQGIREVRFGKYAAVIRYR---PTGEQIASAAWHERASRLGKQLCQHIVGMNP-RPGLELTTPADDP----DEEKCLLLQPFFLDDTVRVGEHLARNEIVLEEFVRLECGQ 308          

HSP 2 Score: 98.5969 bits (244), Expect = 7.117e-42
Identity = 48/114 (42.11%), Postives = 71/114 (62.28%), Query Frame = -2
Query: 1429 KTDLSKLRKISGFPISKCKEALVKCNSNVDESHEWLKSEAAKHGWLKMGKLAEKPMSNGLIGMQLNANQNFSCGVMLELNCETDFVARNQNFHKCLNTATSAFMEHICELPDIN 1770
            K+ LS+LR+ +G+    C+EAL+K N++ D + +WL  EA + GW K  KL+ + +S GL+G+     Q  +  V++E+NCETDFVARN+ F   +  AT A ME     P IN
Sbjct:   35 KSHLSQLRRSTGYTFGACREALLKHNNDFDRALQWLNEEAIRRGWDKAEKLSTRHLSQGLLGVL----QTRTHAVVIEVNCETDFVARNEQFQNLVAGATEAIMERFVINPSIN 144          
BLAST of SMED30009566 vs. TrEMBL
Match: A0A4S2LRI2 (Elongation factor Ts, mitochondrial OS=Opisthorchis felineus OX=147828 GN=CRM22_006811 PE=3 SV=1)

HSP 1 Score: 107.071 bits (266), Expect = 7.292e-42
Identity = 56/166 (33.73%), Postives = 89/166 (53.61%), Query Frame = -3
Query:  903 ISMLILTKKETLDHLLAINVGSLGENMHFRRAVALKASK----DSHLSIYSHLSWPDINKKWKETTFGKYGVMLKYKRQIDIDTQLDEDCWRKNATKAANAICQHIVGLDPVKIGNSQADEPNESIDEENILIYQRFLHDENLKVSDVLHENCMEIEDFTRFNCGE 1388
            +++ I     T+   +A+ +G++GENM  RRAV L+ S      S L+ Y H+S   I    ++  FGKY  +++Y+       Q     W++ A++    +CQHIVG++P      +  EP E  +EE  L+ Q F  DEN++V + L  N M +EDF R  CG+
Sbjct:  147 MALTIPNSGGTVSDNIAVAIGAVGENMAIRRAVGLRTSDIPDCTSRLASYIHISTAGIRPGIRDVKFGKYAAVVRYR---PAGNQPASPAWQERASRLGEQLCQHIVGMNPRP--GLEITEPAEDPEEEQCLLLQPFFLDENIRVGEHLTRNDMILEDFIRVECGQ 307          

HSP 2 Score: 95.1301 bits (235), Expect = 7.292e-42
Identity = 45/109 (41.28%), Postives = 70/109 (64.22%), Query Frame = -2
Query: 1444 KTDLSKLRKISGFPISKCKEALVKCNSNVDESHEWLKSEAAKHGWLKMGKLAEKPMSNGLIGMQLNANQNFSCGVMLELNCETDFVARNQNFHKCLNTATSAFMEHICE 1770
            KT L+KLR+ +G+  + CKEAL+K +++++++  WL  EA + GW K GKL+ + +S GL+G+Q +        V++E+NCETDFVARN+ F   +  AT   M    E
Sbjct:   30 KTLLAKLRRQTGYTFAACKEALLKHDNDLNKASAWLTEEAVRRGWDKAGKLSGRTLSQGLLGLQFSRTH----AVVVEVNCETDFVARNEQFQNFVAMATEMVMREFAE 134          
BLAST of SMED30009566 vs. TrEMBL
Match: A0A0R3SDW0 (Elongation factor Ts, mitochondrial OS=Hymenolepis diminuta OX=6216 GN=HDID_LOCUS2902 PE=3 SV=1)

HSP 1 Score: 107.842 bits (268), Expect = 8.465e-42
Identity = 58/167 (34.73%), Postives = 93/167 (55.69%), Query Frame = -3
Query:  906 SISMLILTKKETLDHLLAINVGSLGENMHFRRAVALKASKDS-----HLSIYSHLSWPDINKKWKETTFGKYGVMLKYKRQIDIDTQLDEDCWRKNATKAANAICQHIVGLDPVKIGNSQADEPNESIDEENILIYQRFLHDENLKVSDVLHENCMEIEDFTRFNCG 1391
            +I  ++ ++++T+  LLA  +GSLGENM   R V +  S D      +L+ Y H+S   I K  ++  FGKY  +L+Y+    +  Q     W + A++    +CQHIVG++P +  +  A    E+ DEE  L+ Q FL DE++ V  +L +N + +EDF R  CG
Sbjct:  150 AIPNVVGSQQQTIGELLANIIGSLGENMAIPRGVGMALSGDKANEFRYLTAYCHMSNTGIKKGVRDVVFGKYIAILRYRH---MSNQKGSAAWHEQASRFTQQLCQHIVGMNPHRDLSLDAIPQAENPDEEKCLLRQGFLFDESVPVGTLLEQNEIVVEDFVRVECG 313          

HSP 2 Score: 93.9745 bits (232), Expect = 8.465e-42
Identity = 48/123 (39.02%), Postives = 70/123 (56.91%), Query Frame = -2
Query: 1393 LSKLRKISGFPISKCKEALVKCNSNVDESHEWLKSEAAKHGWLKMGKLAEKPMSNGLIGMQLNANQNFSCGVMLELNCETDFVARNQNFHKCLNTATSAFMEHICELPDINAIQLGSEELKRI 1761
            L++LRK +G P   C+EAL  CN + D +  WL++EA K G  K  KL  +PMS GL+GM  +      C  ++E+NCETDFVARNQ+F   + ++T +  +   E           ++LK I
Sbjct:   33 LAQLRKATGHPFVFCREALAVCNGDYDRALAWLQNEATKRGMTKAEKLKLRPMSQGLLGMIASTR----CVAVVEVNCETDFVARNQDFQYLVASSTESLFKFFSEANQPGTHMFSGDDLKAI 151          
BLAST of SMED30009566 vs. Ensembl Cavefish
Match: tsfm (Ts translation elongation factor, mitochondrial [Source:NCBI gene;Acc:103022184])

HSP 1 Score: 87.4261 bits (215), Expect = 1.108e-29
Identity = 46/108 (42.59%), Postives = 63/108 (58.33%), Query Frame = -2
Query: 1447 KTDLSKLRKISGFPISKCKEALVKCNSNVDESHEWLKSEAAKHGWLKMGKLAEKPMSNGLIGMQLNANQNFSCGVMLELNCETDFVARNQNFHKCLNTATSAFMEHIC 1770
            K  L KLRK +G+    CK+AL K N+++ ++  WL  +A K GW K  KL  +    GLIG+     +N S  VM+E+NCETDFVARN+ F + +     A M H C
Sbjct:   32 KALLLKLRKATGYTFINCKKALEKFNNDIAQAESWLHEQAQKEGWSKASKLEGRRAKEGLIGVL----KNDSAAVMVEVNCETDFVARNEKFQQLVQDVALATMAHHC 135          

HSP 2 Score: 63.1586 bits (152), Expect = 1.108e-29
Identity = 45/169 (26.63%), Postives = 75/169 (44.38%), Query Frame = -3
Query:  903 LNEYSISMLILTKKETLDHLLAINVGSLGENMHFRRAVALKASKDSHLSIYSH--LSWPDINKKWKETTFGKYGVMLKYKRQIDIDTQLDEDCWRKNATKAANAICQHIVGLDPVKIGNSQADEPNESIDEENILIYQRFLHDENLKVSDVLHENCMEIEDFTRFNCGE 1403
            L+   ++ L + +  +L   LA+ +G LGEN+  RRAV++    D H+  Y H  ++ P           G+YG ++ ++   + + +                + QHIVG  P  +GN +     ES   E  L+ Q FL +    V   L  +   + DF R+ CGE
Sbjct:  147 LSAEDLAKLTMVEGPSLADQLALTIGRLGENISIRRAVSIGIPSDWHIGSYVHSPVTGPS------SLMMGRYGSLVVFQGGPEGEVEF-----------LGKKLGQHIVGEAPDTLGNMEDLPCGES---ETRLLPQTFLLEPKYTVGQFLTLHNARVLDFIRYKCGE 295          
BLAST of SMED30009566 vs. Ensembl Nematostella
Match: EDO34261 (Elongation factor Ts, mitochondrial [Source:UniProtKB/Swiss-Prot;Acc:A7SPW6])

HSP 1 Score: 96.6709 bits (239), Expect = 4.130e-22
Identity = 48/106 (45.28%), Postives = 68/106 (64.15%), Query Frame = -2
Query: 1453 KTDLSKLRKISGFPISKCKEALVKCNSNVDESHEWLKSEAAKHGWLKMGKLAEKPMSNGLIGMQLNANQNFSCGVMLELNCETDFVARNQNFHKCLNTATSAFMEH 1770
            K+ L KLRK +GF  SKC+EALV   ++   +  WL  +A K GW K  KL  +  + GLIG+ +N + + + G M+E+NCETDFVARN+NF   +NT TS  + +
Sbjct:    3 KSLLGKLRKETGFGFSKCREALVLARNDYAAAEAWLHEQAEKEGWQKANKLQGRSATEGLIGVIVN-HSDMNLGAMVEVNCETDFVARNENFVDLVNTVTSTTLAY 107          

HSP 2 Score: 74.3294 bits (181), Expect = 1.385e-14
Identity = 46/151 (30.46%), Postives = 74/151 (49.01%), Query Frame = -3
Query:  906 LDHLLAINVGSLGENMHFRRAVALKASKDSHLSIYSHLSWPDINKKWKETTFGKYGVMLKYKR-QIDIDTQLDEDCWRKNATKAANAICQHIVGLDPVKIGNSQADEPNESIDEENILIYQRFLHDENLKVSDVLHENCMEIEDFTRFNCG 1355
            L  ++A  +G LGEN+   +A+ +    D+ +  Y H  +     K  + +FGKYG M+  K  +  IDT         +    AN + QH+VG++P  IG  Q  E +E   E   L+ Q +L D +L V     +  +++ DF R+ CG
Sbjct:  152 LSDMVAKVIGKLGENIKLGKAITITTDSDNVIGSYVHGPYV---TKVHQCSFGKYGAMVAVKPIKKGIDTS--------SLALLANKLAQHVVGMNPKVIG--QGGEADEKGGESEALLDQEYLLDGSLTVGQFTEKEGVQVVDFVRYECG 289          
BLAST of SMED30009566 vs. Ensembl Medaka
Match: tsfm (Ts translation elongation factor, mitochondrial [Source:NCBI gene;Acc:101160042])

HSP 1 Score: 77.411 bits (189), Expect = 1.438e-27
Identity = 41/106 (38.68%), Postives = 60/106 (56.60%), Query Frame = -2
Query: 1453 KTDLSKLRKISGFPISKCKEALVKCNSNVDESHEWLKSEAAKHGWLKMGKLAEKPMSNGLIGMQLNANQNFSCGVMLELNCETDFVARNQNFHKCLNTATSAFMEH 1770
            K  L KLRK +G+    CK+AL   +++  ++  WL  +A K GW K  KL  +    GLIG+ +      +  VM+E+NCETDFVARN  F + +   T A ++H
Sbjct:   38 KALLMKLRKSTGYTFINCKKALEMFDNDPAQAESWLHEQAQKEGWSKANKLEGRKAKEGLIGVFVGD----AAAVMVEVNCETDFVARNDKFQQLVKDVTFATLDH 139          

HSP 2 Score: 65.855 bits (159), Expect = 1.438e-27
Identity = 46/162 (28.40%), Postives = 77/162 (47.53%), Query Frame = -3
Query:  903 ISMLILTKKETLDHLLAINVGSLGENMHFRRAVALKASKDSHLSIYSHLSWPDINKKWKETTFGKYGVMLKYKRQIDIDTQLDEDCWRKNATKAANAICQHIVGLDPVKIGNSQADEPNESIDEENILIYQRFLHDENLKVSDVLHENCMEIEDFTRFNCGE 1388
            +S L + +   L   +A+ +G LGENM  +RAV +    +  +  Y H    ++  + +E   G+YG ++ ++   + +  +     RK        + QHIVG  P+ +GN       ES   E  L+ Q FL D +  V++ L     ++ DF RF CGE
Sbjct:  161 LSRLRMGEGAALADSVALTIGRLGENMSVKRAVMVGVPAEWRIGSYVH---GNVGSQ-QEVAMGRYGALVIFQGGKEGEQDM---LGRK--------LGQHIVGEAPLSLGNMDDLPCGES---ETRLLPQTFLADPSRTVAEFLRGQQAKVLDFVRFQCGE 304          
BLAST of SMED30009566 vs. Planmine SMEST
Match: SMESG000015985.1 (SMESG000015985.1)

HSP 1 Score: 339.347 bits (869), Expect = 3.997e-177
Identity = 160/160 (100.00%), Postives = 160/160 (100.00%), Query Frame = -3
Query:  888 KKETLDHLLAINVGSLGENMHFRRAVALKASKDSHLSIYSHLSWPDINKKWKETTFGKYGVMLKYKRQIDIDTQLDEDCWRKNATKAANAICQHIVGLDPVKIGNSQADEPNESIDEENILIYQRFLHDENLKVSDVLHENCMEIEDFTRFNCGELATFA 1367
            KKETLDHLLAINVGSLGENMHFRRAVALKASKDSHLSIYSHLSWPDINKKWKETTFGKYGVMLKYKRQIDIDTQLDEDCWRKNATKAANAICQHIVGLDPVKIGNSQADEPNESIDEENILIYQRFLHDENLKVSDVLHENCMEIEDFTRFNCGELATFA
Sbjct:  164 KKETLDHLLAINVGSLGENMHFRRAVALKASKDSHLSIYSHLSWPDINKKWKETTFGKYGVMLKYKRQIDIDTQLDEDCWRKNATKAANAICQHIVGLDPVKIGNSQADEPNESIDEENILIYQRFLHDENLKVSDVLHENCMEIEDFTRFNCGELATFA 323          

HSP 2 Score: 302.753 bits (774), Expect = 3.997e-177
Identity = 155/155 (100.00%), Postives = 155/155 (100.00%), Query Frame = -2
Query: 1363 TYKLIGNKFYYXXXXXXXSKTDLSKLRKISGFPISKCKEALVKCNSNVDESHEWLKSEAAKHGWLKMGKLAEKPMSNGLIGMQLNANQNFSCGVMLELNCETDFVARNQNFHKCLNTATSAFMEHICELPDINAIQLGSEELKRILYLDVDSNKK 1827
            TYKLIGNKFYYSSSSHSISKTDLSKLRKISGFPISKCKEALVKCNSNVDESHEWLKSEAAKHGWLKMGKLAEKPMSNGLIGMQLNANQNFSCGVMLELNCETDFVARNQNFHKCLNTATSAFMEHICELPDINAIQLGSEELKRILYLDVDSNKK
Sbjct:   11 TYKLIGNKFYYSSSSHSISKTDLSKLRKISGFPISKCKEALVKCNSNVDESHEWLKSEAAKHGWLKMGKLAEKPMSNGLIGMQLNANQNFSCGVMLELNCETDFVARNQNFHKCLNTATSAFMEHICELPDINAIQLGSEELKRILYLDVDSNKK 165          
The following BLAST results are available for this feature:
BLAST of SMED30009566 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TSFM9.157e-2637.61Ts translation elongation factor, mitochondrial [S... [more]
TSFM9.712e-1737.38Ts translation elongation factor, mitochondrial [S... [more]
TSFM7.536e-1637.61Ts translation elongation factor, mitochondrial [S... [more]
TSFM8.210e-1637.38Ts translation elongation factor, mitochondrial [S... [more]
TSFM1.893e-1537.61Ts translation elongation factor, mitochondrial [S... [more]
back to top
BLAST of SMED30009566 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
tsfm-12.426e-1337.14Elongation factor Ts, mitochondrial [Source:UniPr... [more]
back to top
BLAST of SMED30009566 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
mEFTs1.459e-3936.84gene:FBgn0032646 transcript:FBtr0080994[more]
back to top
BLAST of SMED30009566 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
tsfm6.493e-3140.57Ts translation elongation factor, mitochondrial [S... [more]
tsfm6.935e-3140.57Ts translation elongation factor, mitochondrial [S... [more]
back to top
BLAST of SMED30009566 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
cebpz1.108e-3128.27CCAAT enhancer binding protein zeta [Source:Xenbas... [more]
back to top
BLAST of SMED30009566 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Tsfm1.116e-2736.70Ts translation elongation factor, mitochondrial [S... [more]
Tsfm1.376e-1636.70Ts translation elongation factor, mitochondrial [S... [more]
Tsfm2.155e-731.25Ts translation elongation factor, mitochondrial [S... [more]
back to top
BLAST of SMED30009566 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9VJC7|EFTS_DROME1.115e-3836.84Elongation factor Ts, mitochondrial OS=Drosophila ... [more]
sp|C3YEM5|EFTS_BRAFL1.735e-3336.03Elongation factor Ts, mitochondrial OS=Branchiosto... [more]
sp|A1L2P7|EFTS_XENLA8.406e-3234.96Elongation factor Ts, mitochondrial OS=Xenopus lae... [more]
sp|B5X5B4|EFTS_SALSA5.427e-3140.57Elongation factor Ts, mitochondrial OS=Salmo salar... [more]
sp|A1A5Z3|EFTS_DANRE4.560e-3040.57Elongation factor Ts, mitochondrial OS=Danio rerio... [more]
back to top
BLAST of SMED30009566 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A183AQ996.391e-4646.49Elongation factor Ts, mitochondrial OS=Echinostoma... [more]
A0A074Z3T06.826e-4233.73Elongation factor Ts, mitochondrial OS=Opisthorchi... [more]
A0A504YKM27.117e-4234.36Elongation factor Ts, mitochondrial OS=Fasciola gi... [more]
A0A4S2LRI27.292e-4233.73Elongation factor Ts, mitochondrial OS=Opisthorchi... [more]
A0A0R3SDW08.465e-4234.73Elongation factor Ts, mitochondrial OS=Hymenolepis... [more]
back to top
BLAST of SMED30009566 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
tsfm1.108e-2942.59Ts translation elongation factor, mitochondrial [S... [more]
back to top
BLAST of SMED30009566 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30009566 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30009566 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO342614.130e-2245.28Elongation factor Ts, mitochondrial [Source:UniPr... [more]
back to top
BLAST of SMED30009566 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
tsfm1.438e-2738.68Ts translation elongation factor, mitochondrial [S... [more]
back to top
BLAST of SMED30009566 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000015985.13.997e-177100.00SMESG000015985.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30009566 ID=SMED30009566|Name=SMED30009566|organism=Schmidtea mediterranea sexual|type=transcript|length=1990bp
GTTTAAAGCGATAAAATGATCGGCAATCAATATGAAATTTCAAATTTGAA
AGGATATTTACTGTCGAAAGAGCATCGATATAATCATGAGCTTGTGCGCC
CGAGTGGTAGACATTTAGACAGCGGCTATACAAATCAGAAAGTTCATCAT
CAAGTAAATAAGATTGCCAAGAGGAAAGATTGCGATGCCACAGAAAAGCA
TTCAAAAACCAGTGGTAAGCTCGGTGAAAATAAACAGAACATCCAAGCCA
AATTTAAACGGCCTTTTCCCAGGGATTTCTGTGTAATTTTAAATGATAAA
AACGGCAATGCTCATGAGGAGAAATCGCTTAATTTGTCTTTTAATTTTGA
CTTTCATAAGTTCAAAAACAAACCTTTTAGCGAGATGGAAAGCGAATGCA
TCATTTTGGAATATCGAATTGCTCATGGGAAAAAGGAATTGGAAAAGATG
ATAGAATGCTTAGAATTGATGGTGAGAGTCAAGGAGACGATGTACGGAGC
TCGGAGTTGGCGGCAAGCATTGCATGAGGGTAACAAACCAGGATCTAGCC
TTGGATCCAGCACAACGACAATTGTCAGCTCTTGCTTCAATGGATTCTCG
CGCAACAACGAGACTGGCAACGACAGCTGCCAATCACTCAAGTCTAACAA
GTCCACGTCCTCAGATCTCAGCCTGAATCATGTTTCCCTCCACTTCAAGA
CCGAGAAACAGACTCTACTCAAGCGGCTGTGGCGGAGCGTCAAGTCAAAC
TTGTATCCGAAGAGATATGGCAAGAAATGCCCGCCAAAAGCGACCAATGA
CAGGCGAGGAAATGATTTATCAACTCAGAGTTATTACACAGCAACAGACA
ATGAAGAAATGCAGCAAATTTATTCAACAAAAAATTAGGCAAACGTTGCC
AATTCTCCGCAATTAAATCGAGTAAAATCTTCAATTTCCATGCAGTTCTC
GTGGAGGACATCGCTAACCTTCAGGTTTTCATCGTGGAGAAAGCGCTGAT
AGATTAATATGTTTTCCTCATCAATTGACTCGTTTGGCTCGTCCGCTTGT
GAGTTGCCGATTTTCACTGGATCCAGCCCGACTATGTGTTGGCAGATCGC
GTTGGCAGCCTTTGTAGCGTTCTTTCTCCAGCAGTCCTCGTCCAGCTGAG
TATCAATATCAATTTGCCGTTTGTATTTTAACATAACGCCGTACTTTCCA
AAAGTAGTTTCTTTCCATTTTTTATTGATATCTGGCCATGATAAATGCGA
ATATATCGATAAATGTGAATCTTTCGATGCTTTGAGTGCAACTGCACGCC
GGAAATGCATATTTTCTCCCAATGAGCCGACATTAATTGCCAGTAAATGA
TCTAGAGTTTCTTTTTTTGTTAGAATCAACATCGAGATAGAGTATTCGTT
TAAGTTCTTCTGAGCCGAGTTGAATTGCATTAATATCCGGAAGTTCACAA
ATATGTTCCATGAAAGCAGAAGTTGCTGTGTTAAGACATTTGTGAAAATT
TTGATTCCTTGCAACGAAATCTGTTTCACAATTAAGTTCTAACATAACTC
CACAACTGAAATTCTGATTAGCGTTTAACTGCATTCCGATCAATCCATTA
GACATTGGCTTTTCAGCTAATTTTCCCATTTTAAGCCAACCATGCTTTGC
TGCTTCAGATTTAAGCCACTCGTGGGATTCATCAACATTGCTATTGCATT
TAACTAGAGCCTCTTTGCATTTAGAAATCGGAAATCCCGAAATTTTTCGC
AATTTGCTCAGATCTGTTTTACTTATAGAATGACTGGAGGATGAATAGTA
AAATTTGTTGCCAATTAATTTATATGTATTTAAATTTCTTAAATTTAAGT
TAAACATCTATAATATTAAAATTTTATATCCTATGAAAACGTATTTAAAA
TAACATGAAATTTGAAATTTGAAAGGTTAACTTTAAAAATCAAATACAAA
CACAGAAAACTTATAAATTTTACGAATTACCTAAAAAAAA
back to top

protein sequence of SMED30009566-orf-1

>SMED30009566-orf-1 ID=SMED30009566-orf-1|Name=SMED30009566-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=182bp
MQFNSAQKNLNEYSISMLILTKKETLDHLLAINVGSLGENMHFRRAVALK
ASKDSHLSIYSHLSWPDINKKWKETTFGKYGVMLKYKRQIDIDTQLDEDC
WRKNATKAANAICQHIVGLDPVKIGNSQADEPNESIDEENILIYQRFLHD
ENLKVSDVLHENCMEIEDFTRFNCGELATFA*
back to top

protein sequence of SMED30009566-orf-2

>SMED30009566-orf-2 ID=SMED30009566-orf-2|Name=SMED30009566-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=175bp
MFNLNLRNLNTYKLIGNKFYYSSSSHSISKTDLSKLRKISGFPISKCKEA
LVKCNSNVDESHEWLKSEAAKHGWLKMGKLAEKPMSNGLIGMQLNANQNF
SCGVMLELNCETDFVARNQNFHKCLNTATSAFMEHICELPDINAIQLGSE
ELKRILYLDVDSNKKRNSRSFTGN*
back to top

protein sequence of SMED30009566-orf-3

>SMED30009566-orf-3 ID=SMED30009566-orf-3|Name=SMED30009566-orf-3|organism=Schmidtea mediterranea sexual|type=polypeptide|length=291bp
MIGNQYEISNLKGYLLSKEHRYNHELVRPSGRHLDSGYTNQKVHHQVNKI
AKRKDCDATEKHSKTSGKLGENKQNIQAKFKRPFPRDFCVILNDKNGNAH
EEKSLNLSFNFDFHKFKNKPFSEMESECIILEYRIAHGKKELEKMIECLE
LMVRVKETMYGARSWRQALHEGNKPGSSLGSSTTTIVSSCFNGFSRNNET
GNDSCQSLKSNKSTSSDLSLNHVSLHFKTEKQTLLKRLWRSVKSNLYPKR
YGKKCPPKATNDRRGNDLSTQSYYTATDNEEMQQIYSTKN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000429neoblast
PLANA:0002032epidermal cell
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR036402EF-Ts_dimer_sf
IPR001816Transl_elong_EFTs/EF1B
IPR014039Transl_elong_EFTs/EF1B_dimer
IPR018101Transl_elong_Ts_CS
IPR009060UBA-like_sf
Vocabulary: cellular component
TermDefinition
GO:0005622intracellular
Vocabulary: biological process
TermDefinition
GO:0006414translational elongation
Vocabulary: molecular function
TermDefinition
GO:0003746translation elongation factor activity
GO:0005515protein binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:1.10.8.10coord: 26..84
e-value: 1.3E-16
score: 62.5
NoneNo IPR availablePANTHERPTHR11741:SF0ELONGATION FACTOR TS, MITOCHONDRIALcoord: 25..153
NoneNo IPR availableCDDcd14275UBA_EF-Tscoord: 32..66
e-value: 5.35609E-9
score: 47.387
IPR036402Elongation factor Ts, dimerisation domain superfamilyGENE3DG3DSA:3.30.479.20coord: 86..173
e-value: 3.6E-13
score: 51.7
IPR036402Elongation factor Ts, dimerisation domain superfamilySUPERFAMILYSSF54713Elongation factor Ts (EF-Ts), dimerisation domaincoord: 86..126
IPR014039Translation elongation factor EFTs/EF1B, dimerisationPFAMPF00889EF_TScoord: 103..153
e-value: 9.3E-9
score: 35.2
IPR001816Translation elongation factor EFTs/EF1BPANTHERPTHR11741ELONGATION FACTOR TScoord: 25..153
IPR018101Translation elongation factor Ts, conserved sitePROSITEPS01127EF_TS_2coord: 107..117
IPR009060UBA-like superfamilySUPERFAMILYSSF46934UBA-likecoord: 28..79