SMED30009565

Overview
NameSMED30009565
Smed IDSMED30009565
Length (bp)1816
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30009565 (SMED30009565) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30009565 (SMED30009565) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30009565 (SMED30009565) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30009565 (SMED30009565) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30009565

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30009565SMESG000055070.1 dd_Smed_v4_2869_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30009565SMESG000055070.1 dd_Smed_v4_2869_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30009565SMESG000055070.1 dd_Smed_v4_2869_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30009565SMESG000055070.1 dd_Smed_v4_2869_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009565SMESG000028957.1 SMESG000055070.1 Contig45224newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009565SMESG000028957.1 SMESG000055070.1 Contig45224uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
pharynx musculatureSMED30009565SMESG000055070.1 dd_Smed_v6_2869_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
musculature systemSMED30009565SMESG000055070.1 dd_Smed_v6_2869_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30009565 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.001097:3794..12800 +8805
Homology
BLAST of SMED30009565 vs. TrEMBL
Match: G7YN43 (Basement membrane-specific heparan sulfate proteoglycan core protein OS=Clonorchis sinensis OX=79923 GN=CLF_102536 PE=4 SV=1)

HSP 1 Score: 149.058 bits (375), Expect = 1.678e-33
Identity = 131/485 (27.01%), Postives = 213/485 (43.92%), Query Frame = 3
Query:  360 EPLS--VNVNSTINKINPNPGRADLLSTLVRSNRKLQLDCYA----------TGEPNVKIQWYIFTEKYVPDVPIPARKIPLNPNEKSQNVIERITNKHYRLTRDYYS-QDTVDSFQCEATLKNKTV--RRNIKIQEIQDIFKVNYETDQGNSLRQQVFADKPFQAWCKM-ENDKKEPVAIKKVEWIFK--ESNGELI-------PLLKLAKVVDRRD--NKLYLANITLSFGAYIRSQCVAYYNDSYDVISAEVSLHLQESPKIYTIYFKQNFP-EKILHMAAPYNLMYSALKKTQIECIANTSTNAKSKITWLKCKDKNCQNTSEASPTS-LLSFPANSTKYFDVGQYRCQVKL-IMDFKEVLNQTVTLYVDRSAPPKEVAKQLLRLSKTNNLNLPCSSDFSSPEGNVTWSFIPLGKAKEEN---IPKNATINSSERYYNLVIKRPLKLEYSGLYICRITNEYGSGGYKFDVTISEGPNRWLR 1715
            EP+   + V+S  N I    G  D  + L R  R  +L+C A          TGE   ++ WY    +   DVPIP++  P+ P      VI    N    +  D YS +D V  F C A +++  V  ++ + +Q++ + F V    D+ +  R   F  +     C + E    E V  +  +W     ++NGE +       P L ++    ++   + L L        A    +C+ ++N ++D  S    ++L+  P I +I   +  P E +L         Y A +  Q+ C       A++  TW KC D  C    +  PT   L F ANST+Y D G +RC V L + ++   L ++  + + R +PP       +  + ++ ++L C+ + SSPE  V W+F P GK  EE    I    T      Y   + +  L  E+SG Y C  TN +GS     DVT++E  +R +R
Sbjct: 6321 EPIGFLLKVDSPANPIYDIGG--DNHTILARVQRPFELNCRAVFTSGGDRASTGEQLPRLVWYYRQPEIPGDVPIPSQVFPVMPPRMETLVITAQENHKISIHSDAYSFRDDVAEFHCNAYMESGDVVAQKIVFVQKVAEKFNVRI-FDEESRGRVYAFVGESKTLTCYVDEISTGERVEPESYQWEVSTGDANGEWVRGDHPRQPALAISGWTSKQLVLDSLVLPKTATPTEASFEFRCIVHHNATFDTASRPFVMNLRNKPVIESIQIDREKPTEAVLAAVGVPKDEYDAAEDYQLNCKPKV-IGAEASATWQKCADSQCDEAEDLHPTGDKLFFFANSTRYIDEGFFRCLVGLQLKEYNFRLTESRIVQIKRKSPPAIYNGDAITYTTSDEMSLQCTDESSSPESTVKWTFEPSGKVPEERKDPILLGKTYEYGRIYIFAIARGQLMTEHSGKYTCTATNPFGSSSGTIDVTVTEDLHRSVR 6801          
BLAST of SMED30009565 vs. TrEMBL
Match: A0A3R7EXM7 (Uncharacterized protein (Fragment) OS=Clonorchis sinensis OX=79923 GN=CSKR_561s PE=4 SV=1)

HSP 1 Score: 148.288 bits (373), Expect = 1.890e-33
Identity = 131/485 (27.01%), Postives = 213/485 (43.92%), Query Frame = 3
Query:  360 EPLS--VNVNSTINKINPNPGRADLLSTLVRSNRKLQLDCYA----------TGEPNVKIQWYIFTEKYVPDVPIPARKIPLNPNEKSQNVIERITNKHYRLTRDYYS-QDTVDSFQCEATLKNKTV--RRNIKIQEIQDIFKVNYETDQGNSLRQQVFADKPFQAWCKM-ENDKKEPVAIKKVEWIFK--ESNGELI-------PLLKLAKVVDRRD--NKLYLANITLSFGAYIRSQCVAYYNDSYDVISAEVSLHLQESPKIYTIYFKQNFP-EKILHMAAPYNLMYSALKKTQIECIANTSTNAKSKITWLKCKDKNCQNTSEASPTS-LLSFPANSTKYFDVGQYRCQVKL-IMDFKEVLNQTVTLYVDRSAPPKEVAKQLLRLSKTNNLNLPCSSDFSSPEGNVTWSFIPLGKAKEEN---IPKNATINSSERYYNLVIKRPLKLEYSGLYICRITNEYGSGGYKFDVTISEGPNRWLR 1715
            EP+   + V+S  N I    G  D  + L R  R  +L+C A          TGE   ++ WY    +   DVPIP++  P+ P      VI    N    +  D YS +D V  F C A +++  V  ++ + +Q++ + F V    D+ +  R   F  +     C + E    E V  +  +W     ++NGE +       P L ++    ++   + L L        A    +C+ ++N ++D  S    ++L+  P I +I   +  P E +L         Y A +  Q+ C       A++  TW KC D  C    +  PT   L F ANST+Y D G +RC V L + ++   L ++  + + R +PP       +  + ++ ++L C+ + SSPE  V W+F P GK  EE    I    T      Y   + +  L  E+SG Y C  TN +GS     DVT++E  +R +R
Sbjct: 1261 EPIGFLLKVDSPANPIYDIGG--DNHTILARVQRPFELNCRAVFTSGGDRASTGEQLPRLVWYYRQPEIPGDVPIPSQVFPVMPPRMETLVITAQENHKISIHSDAYSFRDDVAEFHCNAYMESGDVVAQKIVFVQKVAEKFNVRI-FDEESRGRVYAFVGESKTLTCYVDEISTGERVEPESYQWEVSTGDANGEWVRGDHPRQPALAISGWTSKQLVLDSLVLPKTATPTEASFEFRCIVHHNATFDTASRPFVMNLRNKPVIESIQIDREKPTEAVLAAVGVPKDEYDAAEDYQLNCKPKV-IGAEASATWQKCADSQCDEAEDLHPTGDKLFFFANSTRYIDEGFFRCLVGLQLKEYNFRLTESRIVQIKRKSPPAIYNGDAITYTTSDEMSLQCTDESSSPESTVKWTFEPSGKVPEERKDPILLGKTYEYGRIYIFAIARGQLMTEHSGKYTCTATNPFGSSSGTIDVTVTEDLHRSVR 1741          
BLAST of SMED30009565 vs. TrEMBL
Match: A0A4S2KYA6 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_010460 PE=4 SV=1)

HSP 1 Score: 142.895 bits (359), Expect = 1.527e-31
Identity = 122/463 (26.35%), Postives = 199/463 (42.98%), Query Frame = 3
Query:  420 ADLLSTLVRSNRKLQLDCYA----------TGEPNVKIQWYIFTEKYVPDVPIPARKIPLNPNEKSQNVIERITNKHYRLTRDYYS-QDTVDSFQCEATLKNKTV--RRNIKIQEIQDIFKVNYETDQGNSLRQQVFADKPFQAWCKM-ENDKKEPVAIKKVEWIFK--ESNGELI-------PLLKLAKVVDRRD--NKLYLANITLSFGAYIRSQCVAYYNDSYDVISAEVSLHLQESPKIYTIYFKQNFP-EKILHMAAPYNLMYSALKKTQIECIANTSTNAKSKITWLKCKDKNCQNTSEASPTS-LLSFPANSTKYFDVGQYRCQVKL-IMDFKEVLNQTVTLYVDRSAPPKEVAKQLLRLSKTNNLNLPCSSDFSSPEGNVTWSFIPLGKAKEEN---IPKNATINSSERYYNLVIKRPLKLEYSGLYICRITNEYGSGGYKFDVTISEGPNRWLR 1715
             D  + L R  R  +L+C A          TGE   ++ WY    +   DVPIP++  P+ P      VI    N    +  D YS +D V  F C A +++  V  ++ + +Q++ + F V    D+ +  R   F  +     C + E    E V  +  +W     ++NGE I       P L +     ++   + L L        A    +C+ ++N ++D  S    ++L+  P I +I   +  P E +L         Y A +  Q+ C       A++  TW KC D  C    +  P    L F ANST+Y D G +RC V L + ++   L ++  + + R +PP       +  + ++ ++L C+ + SSPE  + W+F P GK   E    I    T      Y   + +  L  E+SG Y C  TN +GS     DVT++E  +R  R
Sbjct: 6338 GDNHTILARVQRPFELNCRAVFISGGDRASTGEQLPRLVWYYRQPEIPGDVPIPSQVFPVMPPRMETLVITAQENHKISIYSDAYSFRDDVAEFHCNAYMESGDVVAQKIVFVQKVAEKFNVRI-FDEESRGRVYAFVGESKTLTCYVDEISTGERVEPESYQWEVSTGDANGEWIRGDHPRQPALAIKGWTSKQLVLDSLVLPKTATPTEASFEFRCIVHHNATFDTASRPFVMNLRNKPVIESIQIDREKPTEAVLAAVGVPKDEYDAAEDYQLSCKPKV-IGAEASATWQKCADSQCDEAEDLHPIGDKLFFFANSTRYLDEGFFRCLVGLQLKEYNFRLTESRIVQIKRKSPPAIYNGDAITYTTSDEMSLQCTDESSSPESTIKWTFEPSGKVPAERKDPILLGKTYEYGRIYIFAIARGQLMTEHSGKYTCTATNPFGSSSGTIDVTVTEDLHRSAR 6798          
BLAST of SMED30009565 vs. TrEMBL
Match: A0A075A363 (Uncharacterized protein OS=Opisthorchis viverrini OX=6198 GN=T265_00466 PE=4 SV=1)

HSP 1 Score: 140.969 bits (354), Expect = 7.659e-31
Identity = 129/482 (26.76%), Postives = 209/482 (43.36%), Query Frame = 3
Query:  360 EPLS--VNVNSTINKINPNPGRADLLSTLVRSNRKLQLDCYA----------TGEPNVKIQWYIFTEKYVPDVPIPARKIPLNPNEKSQNVIERITNKHYRLTRDYYS-QDTVDSFQCEATLKNKTV--RRNIKIQEIQDIFKVNYETDQGNSLRQQVFADKPFQAWCKM-ENDKKEPVAIKKVEWIFK--ESNGELI----PLLKLAKVVDRRDNKLYLANITLS-----FGAYIRSQCVAYYNDSYDVISAEVSLHLQESPKIYTIYFKQNFP-EKILHMAAPYNLMYSALKKTQIECIANTSTNAKSKITWLKCKDKNCQNTSEASPTS-LLSFPANSTKYFDVGQYRCQVKL-IMDFKEVLNQTVTLYVDRSAPPKEVAKQLLRLSKTNNLNLPCSSDFSSPEGNVTWSFIPLGKAKEEN---IPKNATINSSERYYNLVIKRPLKLEYSGLYICRITNEYGSGGYKFDVTISEGPNR 1706
            EP+   + V+S+ N I    G  D  + L R  R  +L+C A          TGE   ++ WY    +   DVPIP++  P+ P      VI    N    +  D YS +D V  F C A +++  V  ++ + +Q++ + F V    D+ +  R   F  +     C + E    E V  +  +W     ++N E I    P    + +   +  +L L ++ L        A    +C+  +N ++D  S    ++L+  P I +I   +  P E +L         Y A +  Q+ C       A++  TW KC D  C    +  P    L F ANST+Y D G +RC V L + ++   L ++  + + R +PP       +  +  + ++L C+ + SSPE  V W+F P GK  EE    I    T      Y   + +  L  E+SG Y C  TN +GS     DVT++E  +R
Sbjct: 6270 EPIGFLLKVDSSANPIYDIGG--DNHTILARVQRPFELNCRAVFTSGGDRTSTGEQLPRLVWYYRQPEIPGDVPIPSQVFPVMPPRMETLVITAQENHKISIHSDAYSFRDDVAEFHCNAYMESGDVVAQKIVFVQKVAEKFNVRI-FDEESRGRVYAFVGESKTLTCYVDEISTGERVEPESYQWEVSTGDANNEWIRGDHPRQPASAISGWKSKQLVLDSLVLPKTATPTEASFEFRCIVNHNATFDTASRPFVMNLRNKPVIESIQIDREKPTEAVLAAVGVPMDEYDAAEDYQLSCKPKV-IGAEASATWQKCADSQCDEAEDLHPIGDKLFFFANSTRYIDEGFFRCLVGLQLKEYNFRLTESRIVQIKRKSPPAIYNGDAITYTTNDEMSLQCTDESSSPESTVKWTFEPSGKVPEERKDPILLGKTYEYGRIYIFAIARGQLMTEHSGKYTCTATNPFGSSSGTIDVTVTEDLHR 6747          
BLAST of SMED30009565 vs. TrEMBL
Match: A0A1S8WHH9 (Immunoglobulin domain protein (Fragment) OS=Opisthorchis viverrini OX=6198 GN=X801_10342 PE=4 SV=1)

HSP 1 Score: 139.813 bits (351), Expect = 1.683e-30
Identity = 129/482 (26.76%), Postives = 209/482 (43.36%), Query Frame = 3
Query:  360 EPLS--VNVNSTINKINPNPGRADLLSTLVRSNRKLQLDCYA----------TGEPNVKIQWYIFTEKYVPDVPIPARKIPLNPNEKSQNVIERITNKHYRLTRDYYS-QDTVDSFQCEATLKNKTV--RRNIKIQEIQDIFKVNYETDQGNSLRQQVFADKPFQAWCKM-ENDKKEPVAIKKVEWIFK--ESNGELI----PLLKLAKVVDRRDNKLYLANITLS-----FGAYIRSQCVAYYNDSYDVISAEVSLHLQESPKIYTIYFKQNFP-EKILHMAAPYNLMYSALKKTQIECIANTSTNAKSKITWLKCKDKNCQNTSEASPTS-LLSFPANSTKYFDVGQYRCQVKL-IMDFKEVLNQTVTLYVDRSAPPKEVAKQLLRLSKTNNLNLPCSSDFSSPEGNVTWSFIPLGKAKEEN---IPKNATINSSERYYNLVIKRPLKLEYSGLYICRITNEYGSGGYKFDVTISEGPNR 1706
            EP+   + V+S+ N I    G  D  + L R  R  +L+C A          TGE   ++ WY    +   DVPIP++  P+ P      VI    N    +  D YS +D V  F C A +++  V  ++ + +Q++ + F V    D+ +  R   F  +     C + E    E V  +  +W     ++N E I    P    + +   +  +L L ++ L        A    +C+  +N ++D  S    ++L+  P I +I   +  P E +L         Y A +  Q+ C       A++  TW KC D  C    +  P    L F ANST+Y D G +RC V L + ++   L ++  + + R +PP       +  +  + ++L C+ + SSPE  V W+F P GK  EE    I    T      Y   + +  L  E+SG Y C  TN +GS     DVT++E  +R
Sbjct: 4626 EPIGFLLKVDSSANPIYDIGG--DNHTILARVQRPFELNCRAVFTSGGDRTSTGEQLPRLVWYYRQPEIPGDVPIPSQVFPVMPPRMETLVITAQENHKISIHSDAYSFRDDVAEFHCNAYMESGDVVAQKIVFVQKVAEKFNVRI-FDEESRGRVYAFVGESKTLTCYVDEISTGERVEPESYQWEVSTGDANNEWIRGDHPRQPASAISGWKSKQLVLDSLVLPKTATPTEASFEFRCIVNHNATFDTASRPFVMNLRNKPVIESIQIDREKPTEAVLAAVGVPMDEYDAAEDYQLSCKPKV-IGAEASATWQKCADSQCDEAEDLHPIGDKLFFFANSTRYIDEGFFRCLVGLQLKEYNFRLTESRIVQIKRKSPPAIYNGDAITYTTNDEMSLQCTDESSSPESTVKWTFEPSGKVPEERKDPILLGKTYEYGRIYIFAIARGQLMTEHSGKYTCTATNPFGSSSGTIDVTVTEDLHR 5103          
BLAST of SMED30009565 vs. Planmine SMEST
Match: SMESG000055070.1 (SMESG000055070.1)

HSP 1 Score: 1017.3 bits (2629), Expect = 0.000e+0
Identity = 494/506 (97.63%), Postives = 497/506 (98.22%), Query Frame = 3
Query:  198 GNQFQRNGFKKNENSVTIMFPVEQSFISEYLGTYYCFAKNKYGTDNTTLEIKGFEPLSVNVNSTINKINPNPGRADLLSTLVRSNRKLQLDCYATGEPNVKIQWYIFTEKYVPDVPIPARKIPLNPNEKSQNVIERITNKHYRLTRDYYSQDTVDSFQCEATLKNKTVRRNIKIQEIQDIFKVNYETDQGNSLRQQVFADKPFQAWCKMENDKKEPVAIKKVEWIFKESNGELIPLLKLAKVVDRRDNKLYLANITLSFGAYIRSQCVAYYNDSYDVISAEVSLHLQESPKIYTIYFKQNFPEKILHMAAPYNLMYSALKKTQIECIANTSTNAKSKITWLKCKDKNCQNTSEASPTSLLSFPANSTKYFDVGQYRCQVKLIMDFKEVLNQTVTLYVDRSAPPKEVAKQLLRLSKTNNLNLPCSSDFSSPEGNVTWSFIPLGKAKEENIPKNATINSSERYYNLVIKRPLKLEYSGLYICRITNEYGSGGYKFDVTISEGPNRWLR 1715
            G    +   +KNENSVTIMFPVEQS ISEYLGTYYCFAKNKYGTDNTTLEIKGFEPLSVNVNSTINKINPNPGRADLLSTLVRSNRKLQLDCYATGEPNVKIQWYIFTEKYVPDVPIPARKIPLNPNEKSQNVIERITNKHYRLTRDYYSQDTVDSFQCEATLKNKTVRRNIKIQEIQDIFKVNYETDQGNSLRQQVFADKPFQAWCKMENDKKEPVAIKKVEWIFKESNGELIPLLKLAKVVDRRDNKLYLANITLSFGAYIRSQCVAYYNDSYDVISAEVSLHLQESPKIYTIYFKQNFPEKILHMAAPYNLMY+ALKKTQIECIANTSTNAKSKITWLKCKDKNCQNTSEASPTSLLSFPANSTKYFDVGQYRCQVKLIMDFKEVLNQTVTLYVDRSAPPKEVAKQLLRLSKTNNLNL CSSDFSSPEGNVTWSFIPLGKAKEENIPKNATINSSERYYNLVIKRPLKLEYSGLYICRITNEYGSGGYKFDVTISEGPNRWLR
Sbjct: 5310 GKPIPKEWIQKNENSVTIMFPVEQSSISEYLGTYYCFAKNKYGTDNTTLEIKGFEPLSVNVNSTINKINPNPGRADLLSTLVRSNRKLQLDCYATGEPNVKIQWYIFTEKYVPDVPIPARKIPLNPNEKSQNVIERITNKHYRLTRDYYSQDTVDSFQCEATLKNKTVRRNIKIQEIQDIFKVNYETDQGNSLRQQVFADKPFQAWCKMENDKKEPVAIKKVEWIFKESNGELIPLLKLAKVVDRRDNKLYLANITLSFGAYIRSQCVAYYNDSYDVISAEVSLHLQESPKIYTIYFKQNFPEKILHMAAPYNLMYNALKKTQIECIANTSTNAKSKITWLKCKDKNCQNTSEASPTSLLSFPANSTKYFDVGQYRCQVKLIMDFKEVLNQTVTLYVDRSAPPKEVAKQLLRLSKTNNLNLLCSSDFSSPEGNVTWSFIPLGKAKEENIPKNATINSSERYYNLVIKRPLKLEYSGLYICRITNEYGSGGYKFDVTISEGPNRWLR 5815          

HSP 2 Score: 159.073 bits (401), Expect = 2.022e-40
Identity = 74/76 (97.37%), Postives = 75/76 (98.68%), Query Frame = 2
Query:    2 AQCFATNGAHNYTSTRISVTVVEDVDNRPKLHFSKTIGKLSDFPEKLLCLNERPETTEIYIGNINGKPIPKEWIQK 229
            AQCFAT GAHNYTSTRISVTVVEDVDNRPKLHFSKTIGKLSDFPEKLLCLNERPETT+IYIGNINGKPIPKEWIQK
Sbjct: 5245 AQCFATKGAHNYTSTRISVTVVEDVDNRPKLHFSKTIGKLSDFPEKLLCLNERPETTQIYIGNINGKPIPKEWIQK 5320          

HSP 3 Score: 53.5286 bits (127), Expect = 3.767e-9
Identity = 35/130 (26.92%), Postives = 69/130 (53.08%), Query Frame = 3
Query:  228 KNENSVTIMFPVEQSFISEYLGTYYCFAKNKYGTDNTTLEIK---GFEPLSVNVNSTINKINPNPGRADLLSTLVRSNRKLQLDC-YATGEPNVKIQWYIFTEKYVPDVPIPARKIPLNPNEKSQNVIER 605
            KN+NSV ++ P+      +++G+Y C A+NK+GTD+  +++K    + P+S+N+ +    I+   G   + S++   N   ++DC Y+ G+P +   W++     +       RK+P   + K   V E+
Sbjct: 2933 KNKNSVELILPINSENPLKFIGSYECKAENKFGTDHRIVDVKYVQRYPPISINIITKSGPISKESGMKYIKSSIGLLN---EIDCLYSGGKPPLVADWFLEKNSEM-------RKLPRGDSVKKYKVFEK 3052          

HSP 4 Score: 26.9498 bits (58), Expect = 3.767e-9
Identity = 16/66 (24.24%), Postives = 29/66 (43.94%), Query Frame = 2
Query:    2 AQCFATNGAHNYTSTRISVTVVEDVDNRPKLHFSKTIGKLSDFPEKLLCLNERPETTEIYIGNING 199
             +C        Y S    V   ED   +PKL  + ++ + +   + L CL++  E T I +  ++G
Sbjct: 2859 GRCIVIVQGKKYFSKYFEVFTNEDALRKPKLIANYSVDEKTGIIKALECLDQSGEMTNIQVTFLSG 2924          

HSP 5 Score: 42.3578 bits (98), Expect = 1.099e-7
Identity = 63/267 (23.60%), Postives = 109/267 (40.82%), Query Frame = 3
Query:  171 LKYILEILMGNQFQRNGFKKNENSVTIMFPVEQSFISEYLGTYYCFAKNKYGTDNTTLEIK---GFEPLSVNVNSTINKINPNPGRADLLSTLVRSNRKLQLDC-YATGEPNVKIQWYIFTEKYVPDVPIPARKIPLNPNEKSQNVIE-RITN--KHYRLTRDYYSQDTVDSFQCEATLKNKTVRRNIKIQEIQDIFKVNYETDQGNSLR-QQVFADKPFQAWCKMENDKKEPVAIKKVEWIFKESNGELIPLLKLAKVVDRRDNKL 947
            L YI   L G         K  N +  +F  +     +Y G Y C A +KYG+++ TL+ K    F+PL V+V S          R    + ++   R +++DC +  G+P   + WY   +    ++     K   N  +K  N++  +I N  K+  +T +   +D          + +  V      Q    +  V    D  +S   +Q   D+  QA        K+       +W F +SN E  P+ KLA+ VD++  ++
Sbjct: 3242 LDYINRTLAGGVLN-----KKRNHIEYVFTTDSKSTLKYDGIYRCNATSKYGSNSITLDTKIKPVFKPLIVSVYSKDVNFTVKDKRN---TAILPEYRVIEIDCLHFGGQPPTDVTWYQIKDSQEVELLKSEIKDNFNVYQKQPNILTVKILNMKKNSNMTLNCVVKDA------NGVMISSPV---FLTQSPSGVRFVVAGLDGDSSFNPKQGSMDRKLQASIIDAKTGKDLSGGFTFKWYFLQSNKEEYPIDKLAEKVDQKGGEI 3491          

HSP 6 Score: 33.113 bits (74), Expect = 1.099e-7
Identity = 21/65 (32.31%), Postives = 31/65 (47.69%), Query Frame = 2
Query:    2 AQCFATNGAHNYTSTRISVTVVEDVDNRPKLHFSKTIGKLSDFPEKLLCLNERPETTEIYIGNIN 196
            AQC   NG+ N  S    + V ED   RPKL    T     +  ++L C++    T+E+ +  IN
Sbjct: 3182 AQCRVNNGSVNDVSKPFFIHVDEDELKRPKLFLKPTFEGELNAVKRLDCIDRSEATSEMTLDYIN 3246          
BLAST of SMED30009565 vs. Planmine SMEST
Match: SMESG000055070.1 (SMESG000055070.1)

HSP 1 Score: 1017.3 bits (2629), Expect = 0.000e+0
Identity = 494/506 (97.63%), Postives = 497/506 (98.22%), Query Frame = 3
Query:  198 GNQFQRNGFKKNENSVTIMFPVEQSFISEYLGTYYCFAKNKYGTDNTTLEIKGFEPLSVNVNSTINKINPNPGRADLLSTLVRSNRKLQLDCYATGEPNVKIQWYIFTEKYVPDVPIPARKIPLNPNEKSQNVIERITNKHYRLTRDYYSQDTVDSFQCEATLKNKTVRRNIKIQEIQDIFKVNYETDQGNSLRQQVFADKPFQAWCKMENDKKEPVAIKKVEWIFKESNGELIPLLKLAKVVDRRDNKLYLANITLSFGAYIRSQCVAYYNDSYDVISAEVSLHLQESPKIYTIYFKQNFPEKILHMAAPYNLMYSALKKTQIECIANTSTNAKSKITWLKCKDKNCQNTSEASPTSLLSFPANSTKYFDVGQYRCQVKLIMDFKEVLNQTVTLYVDRSAPPKEVAKQLLRLSKTNNLNLPCSSDFSSPEGNVTWSFIPLGKAKEENIPKNATINSSERYYNLVIKRPLKLEYSGLYICRITNEYGSGGYKFDVTISEGPNRWLR 1715
            G    +   +KNENSVTIMFPVEQS ISEYLGTYYCFAKNKYGTDNTTLEIKGFEPLSVNVNSTINKINPNPGRADLLSTLVRSNRKLQLDCYATGEPNVKIQWYIFTEKYVPDVPIPARKIPLNPNEKSQNVIERITNKHYRLTRDYYSQDTVDSFQCEATLKNKTVRRNIKIQEIQDIFKVNYETDQGNSLRQQVFADKPFQAWCKMENDKKEPVAIKKVEWIFKESNGELIPLLKLAKVVDRRDNKLYLANITLSFGAYIRSQCVAYYNDSYDVISAEVSLHLQESPKIYTIYFKQNFPEKILHMAAPYNLMY+ALKKTQIECIANTSTNAKSKITWLKCKDKNCQNTSEASPTSLLSFPANSTKYFDVGQYRCQVKLIMDFKEVLNQTVTLYVDRSAPPKEVAKQLLRLSKTNNLNL CSSDFSSPEGNVTWSFIPLGKAKEENIPKNATINSSERYYNLVIKRPLKLEYSGLYICRITNEYGSGGYKFDVTISEGPNRWLR
Sbjct: 5008 GKPIPKEWIQKNENSVTIMFPVEQSSISEYLGTYYCFAKNKYGTDNTTLEIKGFEPLSVNVNSTINKINPNPGRADLLSTLVRSNRKLQLDCYATGEPNVKIQWYIFTEKYVPDVPIPARKIPLNPNEKSQNVIERITNKHYRLTRDYYSQDTVDSFQCEATLKNKTVRRNIKIQEIQDIFKVNYETDQGNSLRQQVFADKPFQAWCKMENDKKEPVAIKKVEWIFKESNGELIPLLKLAKVVDRRDNKLYLANITLSFGAYIRSQCVAYYNDSYDVISAEVSLHLQESPKIYTIYFKQNFPEKILHMAAPYNLMYNALKKTQIECIANTSTNAKSKITWLKCKDKNCQNTSEASPTSLLSFPANSTKYFDVGQYRCQVKLIMDFKEVLNQTVTLYVDRSAPPKEVAKQLLRLSKTNNLNLLCSSDFSSPEGNVTWSFIPLGKAKEENIPKNATINSSERYYNLVIKRPLKLEYSGLYICRITNEYGSGGYKFDVTISEGPNRWLR 5513          

HSP 2 Score: 159.073 bits (401), Expect = 2.030e-40
Identity = 74/76 (97.37%), Postives = 75/76 (98.68%), Query Frame = 2
Query:    2 AQCFATNGAHNYTSTRISVTVVEDVDNRPKLHFSKTIGKLSDFPEKLLCLNERPETTEIYIGNINGKPIPKEWIQK 229
            AQCFAT GAHNYTSTRISVTVVEDVDNRPKLHFSKTIGKLSDFPEKLLCLNERPETT+IYIGNINGKPIPKEWIQK
Sbjct: 4943 AQCFATKGAHNYTSTRISVTVVEDVDNRPKLHFSKTIGKLSDFPEKLLCLNERPETTQIYIGNINGKPIPKEWIQK 5018          

HSP 3 Score: 53.5286 bits (127), Expect = 3.595e-9
Identity = 35/130 (26.92%), Postives = 69/130 (53.08%), Query Frame = 3
Query:  228 KNENSVTIMFPVEQSFISEYLGTYYCFAKNKYGTDNTTLEIK---GFEPLSVNVNSTINKINPNPGRADLLSTLVRSNRKLQLDC-YATGEPNVKIQWYIFTEKYVPDVPIPARKIPLNPNEKSQNVIER 605
            KN+NSV ++ P+      +++G+Y C A+NK+GTD+  +++K    + P+S+N+ +    I+   G   + S++   N   ++DC Y+ G+P +   W++     +       RK+P   + K   V E+
Sbjct: 2933 KNKNSVELILPINSENPLKFIGSYECKAENKFGTDHRIVDVKYVQRYPPISINIITKSGPISKESGMKYIKSSIGLLN---EIDCLYSGGKPPLVADWFLEKNSEM-------RKLPRGDSVKKYKVFEK 3052          

HSP 4 Score: 26.9498 bits (58), Expect = 3.595e-9
Identity = 16/66 (24.24%), Postives = 29/66 (43.94%), Query Frame = 2
Query:    2 AQCFATNGAHNYTSTRISVTVVEDVDNRPKLHFSKTIGKLSDFPEKLLCLNERPETTEIYIGNING 199
             +C        Y S    V   ED   +PKL  + ++ + +   + L CL++  E T I +  ++G
Sbjct: 2859 GRCIVIVQGKKYFSKYFEVFTNEDALRKPKLIANYSVDEKTGIIKALECLDQSGEMTNIQVTFLSG 2924          

HSP 5 Score: 42.3578 bits (98), Expect = 1.058e-7
Identity = 63/267 (23.60%), Postives = 109/267 (40.82%), Query Frame = 3
Query:  171 LKYILEILMGNQFQRNGFKKNENSVTIMFPVEQSFISEYLGTYYCFAKNKYGTDNTTLEIK---GFEPLSVNVNSTINKINPNPGRADLLSTLVRSNRKLQLDC-YATGEPNVKIQWYIFTEKYVPDVPIPARKIPLNPNEKSQNVIE-RITN--KHYRLTRDYYSQDTVDSFQCEATLKNKTVRRNIKIQEIQDIFKVNYETDQGNSLR-QQVFADKPFQAWCKMENDKKEPVAIKKVEWIFKESNGELIPLLKLAKVVDRRDNKL 947
            L YI   L G         K  N +  +F  +     +Y G Y C A +KYG+++ TL+ K    F+PL V+V S          R    + ++   R +++DC +  G+P   + WY   +    ++     K   N  +K  N++  +I N  K+  +T +   +D          + +  V      Q    +  V    D  +S   +Q   D+  QA        K+       +W F +SN E  P+ KLA+ VD++  ++
Sbjct: 3242 LDYINRTLAGGVLN-----KKRNHIEYVFTTDSKSTLKYDGIYRCNATSKYGSNSITLDTKIKPVFKPLIVSVYSKDVNFTVKDKRN---TAILPEYRVIEIDCLHFGGQPPTDVTWYQIKDSQEVELLKSEIKDNFNVYQKQPNILTVKILNMKKNSNMTLNCVVKDA------NGVMISSPV---FLTQSPSGVRFVVAGLDGDSSFNPKQGSMDRKLQASIIDAKTGKDLSGGFTFKWYFLQSNKEEYPIDKLAEKVDQKGGEI 3491          

HSP 6 Score: 33.113 bits (74), Expect = 1.058e-7
Identity = 21/65 (32.31%), Postives = 31/65 (47.69%), Query Frame = 2
Query:    2 AQCFATNGAHNYTSTRISVTVVEDVDNRPKLHFSKTIGKLSDFPEKLLCLNERPETTEIYIGNIN 196
            AQC   NG+ N  S    + V ED   RPKL    T     +  ++L C++    T+E+ +  IN
Sbjct: 3182 AQCRVNNGSVNDVSKPFFIHVDEDELKRPKLFLKPTFEGELNAVKRLDCIDRSEATSEMTLDYIN 3246          
BLAST of SMED30009565 vs. Planmine SMEST
Match: SMESG000055070.1 (SMESG000055070.1)

HSP 1 Score: 1017.3 bits (2629), Expect = 0.000e+0
Identity = 494/506 (97.63%), Postives = 497/506 (98.22%), Query Frame = 3
Query:  198 GNQFQRNGFKKNENSVTIMFPVEQSFISEYLGTYYCFAKNKYGTDNTTLEIKGFEPLSVNVNSTINKINPNPGRADLLSTLVRSNRKLQLDCYATGEPNVKIQWYIFTEKYVPDVPIPARKIPLNPNEKSQNVIERITNKHYRLTRDYYSQDTVDSFQCEATLKNKTVRRNIKIQEIQDIFKVNYETDQGNSLRQQVFADKPFQAWCKMENDKKEPVAIKKVEWIFKESNGELIPLLKLAKVVDRRDNKLYLANITLSFGAYIRSQCVAYYNDSYDVISAEVSLHLQESPKIYTIYFKQNFPEKILHMAAPYNLMYSALKKTQIECIANTSTNAKSKITWLKCKDKNCQNTSEASPTSLLSFPANSTKYFDVGQYRCQVKLIMDFKEVLNQTVTLYVDRSAPPKEVAKQLLRLSKTNNLNLPCSSDFSSPEGNVTWSFIPLGKAKEENIPKNATINSSERYYNLVIKRPLKLEYSGLYICRITNEYGSGGYKFDVTISEGPNRWLR 1715
            G    +   +KNENSVTIMFPVEQS ISEYLGTYYCFAKNKYGTDNTTLEIKGFEPLSVNVNSTINKINPNPGRADLLSTLVRSNRKLQLDCYATGEPNVKIQWYIFTEKYVPDVPIPARKIPLNPNEKSQNVIERITNKHYRLTRDYYSQDTVDSFQCEATLKNKTVRRNIKIQEIQDIFKVNYETDQGNSLRQQVFADKPFQAWCKMENDKKEPVAIKKVEWIFKESNGELIPLLKLAKVVDRRDNKLYLANITLSFGAYIRSQCVAYYNDSYDVISAEVSLHLQESPKIYTIYFKQNFPEKILHMAAPYNLMY+ALKKTQIECIANTSTNAKSKITWLKCKDKNCQNTSEASPTSLLSFPANSTKYFDVGQYRCQVKLIMDFKEVLNQTVTLYVDRSAPPKEVAKQLLRLSKTNNLNL CSSDFSSPEGNVTWSFIPLGKAKEENIPKNATINSSERYYNLVIKRPLKLEYSGLYICRITNEYGSGGYKFDVTISEGPNRWLR
Sbjct: 5310 GKPIPKEWIQKNENSVTIMFPVEQSSISEYLGTYYCFAKNKYGTDNTTLEIKGFEPLSVNVNSTINKINPNPGRADLLSTLVRSNRKLQLDCYATGEPNVKIQWYIFTEKYVPDVPIPARKIPLNPNEKSQNVIERITNKHYRLTRDYYSQDTVDSFQCEATLKNKTVRRNIKIQEIQDIFKVNYETDQGNSLRQQVFADKPFQAWCKMENDKKEPVAIKKVEWIFKESNGELIPLLKLAKVVDRRDNKLYLANITLSFGAYIRSQCVAYYNDSYDVISAEVSLHLQESPKIYTIYFKQNFPEKILHMAAPYNLMYNALKKTQIECIANTSTNAKSKITWLKCKDKNCQNTSEASPTSLLSFPANSTKYFDVGQYRCQVKLIMDFKEVLNQTVTLYVDRSAPPKEVAKQLLRLSKTNNLNLLCSSDFSSPEGNVTWSFIPLGKAKEENIPKNATINSSERYYNLVIKRPLKLEYSGLYICRITNEYGSGGYKFDVTISEGPNRWLR 5815          

HSP 2 Score: 159.073 bits (401), Expect = 2.022e-40
Identity = 74/76 (97.37%), Postives = 75/76 (98.68%), Query Frame = 2
Query:    2 AQCFATNGAHNYTSTRISVTVVEDVDNRPKLHFSKTIGKLSDFPEKLLCLNERPETTEIYIGNINGKPIPKEWIQK 229
            AQCFAT GAHNYTSTRISVTVVEDVDNRPKLHFSKTIGKLSDFPEKLLCLNERPETT+IYIGNINGKPIPKEWIQK
Sbjct: 5245 AQCFATKGAHNYTSTRISVTVVEDVDNRPKLHFSKTIGKLSDFPEKLLCLNERPETTQIYIGNINGKPIPKEWIQK 5320          

HSP 3 Score: 53.5286 bits (127), Expect = 3.767e-9
Identity = 35/130 (26.92%), Postives = 69/130 (53.08%), Query Frame = 3
Query:  228 KNENSVTIMFPVEQSFISEYLGTYYCFAKNKYGTDNTTLEIK---GFEPLSVNVNSTINKINPNPGRADLLSTLVRSNRKLQLDC-YATGEPNVKIQWYIFTEKYVPDVPIPARKIPLNPNEKSQNVIER 605
            KN+NSV ++ P+      +++G+Y C A+NK+GTD+  +++K    + P+S+N+ +    I+   G   + S++   N   ++DC Y+ G+P +   W++     +       RK+P   + K   V E+
Sbjct: 2933 KNKNSVELILPINSENPLKFIGSYECKAENKFGTDHRIVDVKYVQRYPPISINIITKSGPISKESGMKYIKSSIGLLN---EIDCLYSGGKPPLVADWFLEKNSEM-------RKLPRGDSVKKYKVFEK 3052          

HSP 4 Score: 26.9498 bits (58), Expect = 3.767e-9
Identity = 16/66 (24.24%), Postives = 29/66 (43.94%), Query Frame = 2
Query:    2 AQCFATNGAHNYTSTRISVTVVEDVDNRPKLHFSKTIGKLSDFPEKLLCLNERPETTEIYIGNING 199
             +C        Y S    V   ED   +PKL  + ++ + +   + L CL++  E T I +  ++G
Sbjct: 2859 GRCIVIVQGKKYFSKYFEVFTNEDALRKPKLIANYSVDEKTGIIKALECLDQSGEMTNIQVTFLSG 2924          

HSP 5 Score: 42.3578 bits (98), Expect = 1.099e-7
Identity = 63/267 (23.60%), Postives = 109/267 (40.82%), Query Frame = 3
Query:  171 LKYILEILMGNQFQRNGFKKNENSVTIMFPVEQSFISEYLGTYYCFAKNKYGTDNTTLEIK---GFEPLSVNVNSTINKINPNPGRADLLSTLVRSNRKLQLDC-YATGEPNVKIQWYIFTEKYVPDVPIPARKIPLNPNEKSQNVIE-RITN--KHYRLTRDYYSQDTVDSFQCEATLKNKTVRRNIKIQEIQDIFKVNYETDQGNSLR-QQVFADKPFQAWCKMENDKKEPVAIKKVEWIFKESNGELIPLLKLAKVVDRRDNKL 947
            L YI   L G         K  N +  +F  +     +Y G Y C A +KYG+++ TL+ K    F+PL V+V S          R    + ++   R +++DC +  G+P   + WY   +    ++     K   N  +K  N++  +I N  K+  +T +   +D          + +  V      Q    +  V    D  +S   +Q   D+  QA        K+       +W F +SN E  P+ KLA+ VD++  ++
Sbjct: 3242 LDYINRTLAGGVLN-----KKRNHIEYVFTTDSKSTLKYDGIYRCNATSKYGSNSITLDTKIKPVFKPLIVSVYSKDVNFTVKDKRN---TAILPEYRVIEIDCLHFGGQPPTDVTWYQIKDSQEVELLKSEIKDNFNVYQKQPNILTVKILNMKKNSNMTLNCVVKDA------NGVMISSPV---FLTQSPSGVRFVVAGLDGDSSFNPKQGSMDRKLQASIIDAKTGKDLSGGFTFKWYFLQSNKEEYPIDKLAEKVDQKGGEI 3491          

HSP 6 Score: 33.113 bits (74), Expect = 1.099e-7
Identity = 21/65 (32.31%), Postives = 31/65 (47.69%), Query Frame = 2
Query:    2 AQCFATNGAHNYTSTRISVTVVEDVDNRPKLHFSKTIGKLSDFPEKLLCLNERPETTEIYIGNIN 196
            AQC   NG+ N  S    + V ED   RPKL    T     +  ++L C++    T+E+ +  IN
Sbjct: 3182 AQCRVNNGSVNDVSKPFFIHVDEDELKRPKLFLKPTFEGELNAVKRLDCIDRSEATSEMTLDYIN 3246          
BLAST of SMED30009565 vs. Planmine SMEST
Match: SMESG000055070.1 (SMESG000055070.1)

HSP 1 Score: 1017.3 bits (2629), Expect = 0.000e+0
Identity = 494/506 (97.63%), Postives = 497/506 (98.22%), Query Frame = 3
Query:  198 GNQFQRNGFKKNENSVTIMFPVEQSFISEYLGTYYCFAKNKYGTDNTTLEIKGFEPLSVNVNSTINKINPNPGRADLLSTLVRSNRKLQLDCYATGEPNVKIQWYIFTEKYVPDVPIPARKIPLNPNEKSQNVIERITNKHYRLTRDYYSQDTVDSFQCEATLKNKTVRRNIKIQEIQDIFKVNYETDQGNSLRQQVFADKPFQAWCKMENDKKEPVAIKKVEWIFKESNGELIPLLKLAKVVDRRDNKLYLANITLSFGAYIRSQCVAYYNDSYDVISAEVSLHLQESPKIYTIYFKQNFPEKILHMAAPYNLMYSALKKTQIECIANTSTNAKSKITWLKCKDKNCQNTSEASPTSLLSFPANSTKYFDVGQYRCQVKLIMDFKEVLNQTVTLYVDRSAPPKEVAKQLLRLSKTNNLNLPCSSDFSSPEGNVTWSFIPLGKAKEENIPKNATINSSERYYNLVIKRPLKLEYSGLYICRITNEYGSGGYKFDVTISEGPNRWLR 1715
            G    +   +KNENSVTIMFPVEQS ISEYLGTYYCFAKNKYGTDNTTLEIKGFEPLSVNVNSTINKINPNPGRADLLSTLVRSNRKLQLDCYATGEPNVKIQWYIFTEKYVPDVPIPARKIPLNPNEKSQNVIERITNKHYRLTRDYYSQDTVDSFQCEATLKNKTVRRNIKIQEIQDIFKVNYETDQGNSLRQQVFADKPFQAWCKMENDKKEPVAIKKVEWIFKESNGELIPLLKLAKVVDRRDNKLYLANITLSFGAYIRSQCVAYYNDSYDVISAEVSLHLQESPKIYTIYFKQNFPEKILHMAAPYNLMY+ALKKTQIECIANTSTNAKSKITWLKCKDKNCQNTSEASPTSLLSFPANSTKYFDVGQYRCQVKLIMDFKEVLNQTVTLYVDRSAPPKEVAKQLLRLSKTNNLNL CSSDFSSPEGNVTWSFIPLGKAKEENIPKNATINSSERYYNLVIKRPLKLEYSGLYICRITNEYGSGGYKFDVTISEGPNRWLR
Sbjct: 5214 GKPIPKEWIQKNENSVTIMFPVEQSSISEYLGTYYCFAKNKYGTDNTTLEIKGFEPLSVNVNSTINKINPNPGRADLLSTLVRSNRKLQLDCYATGEPNVKIQWYIFTEKYVPDVPIPARKIPLNPNEKSQNVIERITNKHYRLTRDYYSQDTVDSFQCEATLKNKTVRRNIKIQEIQDIFKVNYETDQGNSLRQQVFADKPFQAWCKMENDKKEPVAIKKVEWIFKESNGELIPLLKLAKVVDRRDNKLYLANITLSFGAYIRSQCVAYYNDSYDVISAEVSLHLQESPKIYTIYFKQNFPEKILHMAAPYNLMYNALKKTQIECIANTSTNAKSKITWLKCKDKNCQNTSEASPTSLLSFPANSTKYFDVGQYRCQVKLIMDFKEVLNQTVTLYVDRSAPPKEVAKQLLRLSKTNNLNLLCSSDFSSPEGNVTWSFIPLGKAKEENIPKNATINSSERYYNLVIKRPLKLEYSGLYICRITNEYGSGGYKFDVTISEGPNRWLR 5719          

HSP 2 Score: 159.073 bits (401), Expect = 2.113e-40
Identity = 74/76 (97.37%), Postives = 75/76 (98.68%), Query Frame = 2
Query:    2 AQCFATNGAHNYTSTRISVTVVEDVDNRPKLHFSKTIGKLSDFPEKLLCLNERPETTEIYIGNINGKPIPKEWIQK 229
            AQCFAT GAHNYTSTRISVTVVEDVDNRPKLHFSKTIGKLSDFPEKLLCLNERPETT+IYIGNINGKPIPKEWIQK
Sbjct: 5149 AQCFATKGAHNYTSTRISVTVVEDVDNRPKLHFSKTIGKLSDFPEKLLCLNERPETTQIYIGNINGKPIPKEWIQK 5224          

HSP 3 Score: 53.5286 bits (127), Expect = 3.620e-9
Identity = 35/130 (26.92%), Postives = 69/130 (53.08%), Query Frame = 3
Query:  228 KNENSVTIMFPVEQSFISEYLGTYYCFAKNKYGTDNTTLEIK---GFEPLSVNVNSTINKINPNPGRADLLSTLVRSNRKLQLDC-YATGEPNVKIQWYIFTEKYVPDVPIPARKIPLNPNEKSQNVIER 605
            KN+NSV ++ P+      +++G+Y C A+NK+GTD+  +++K    + P+S+N+ +    I+   G   + S++   N   ++DC Y+ G+P +   W++     +       RK+P   + K   V E+
Sbjct: 2933 KNKNSVELILPINSENPLKFIGSYECKAENKFGTDHRIVDVKYVQRYPPISINIITKSGPISKESGMKYIKSSIGLLN---EIDCLYSGGKPPLVADWFLEKNSEM-------RKLPRGDSVKKYKVFEK 3052          

HSP 4 Score: 26.9498 bits (58), Expect = 3.620e-9
Identity = 16/66 (24.24%), Postives = 29/66 (43.94%), Query Frame = 2
Query:    2 AQCFATNGAHNYTSTRISVTVVEDVDNRPKLHFSKTIGKLSDFPEKLLCLNERPETTEIYIGNING 199
             +C        Y S    V   ED   +PKL  + ++ + +   + L CL++  E T I +  ++G
Sbjct: 2859 GRCIVIVQGKKYFSKYFEVFTNEDALRKPKLIANYSVDEKTGIIKALECLDQSGEMTNIQVTFLSG 2924          

HSP 5 Score: 42.3578 bits (98), Expect = 1.048e-7
Identity = 63/267 (23.60%), Postives = 109/267 (40.82%), Query Frame = 3
Query:  171 LKYILEILMGNQFQRNGFKKNENSVTIMFPVEQSFISEYLGTYYCFAKNKYGTDNTTLEIK---GFEPLSVNVNSTINKINPNPGRADLLSTLVRSNRKLQLDC-YATGEPNVKIQWYIFTEKYVPDVPIPARKIPLNPNEKSQNVIE-RITN--KHYRLTRDYYSQDTVDSFQCEATLKNKTVRRNIKIQEIQDIFKVNYETDQGNSLR-QQVFADKPFQAWCKMENDKKEPVAIKKVEWIFKESNGELIPLLKLAKVVDRRDNKL 947
            L YI   L G         K  N +  +F  +     +Y G Y C A +KYG+++ TL+ K    F+PL V+V S          R    + ++   R +++DC +  G+P   + WY   +    ++     K   N  +K  N++  +I N  K+  +T +   +D          + +  V      Q    +  V    D  +S   +Q   D+  QA        K+       +W F +SN E  P+ KLA+ VD++  ++
Sbjct: 3242 LDYINRTLAGGVLN-----KKRNHIEYVFTTDSKSTLKYDGIYRCNATSKYGSNSITLDTKIKPVFKPLIVSVYSKDVNFTVKDKRN---TAILPEYRVIEIDCLHFGGQPPTDVTWYQIKDSQEVELLKSEIKDNFNVYQKQPNILTVKILNMKKNSNMTLNCVVKDA------NGVMISSPV---FLTQSPSGVRFVVAGLDGDSSFNPKQGSMDRKLQASIIDAKTGKDLSGGFTFKWYFLQSNKEEYPIDKLAEKVDQKGGEI 3491          

HSP 6 Score: 33.113 bits (74), Expect = 1.048e-7
Identity = 21/65 (32.31%), Postives = 31/65 (47.69%), Query Frame = 2
Query:    2 AQCFATNGAHNYTSTRISVTVVEDVDNRPKLHFSKTIGKLSDFPEKLLCLNERPETTEIYIGNIN 196
            AQC   NG+ N  S    + V ED   RPKL    T     +  ++L C++    T+E+ +  IN
Sbjct: 3182 AQCRVNNGSVNDVSKPFFIHVDEDELKRPKLFLKPTFEGELNAVKRLDCIDRSEATSEMTLDYIN 3246          
BLAST of SMED30009565 vs. Planmine SMEST
Match: SMESG000055070.1 (SMESG000055070.1)

HSP 1 Score: 1017.3 bits (2629), Expect = 0.000e+0
Identity = 494/506 (97.63%), Postives = 497/506 (98.22%), Query Frame = 3
Query:  198 GNQFQRNGFKKNENSVTIMFPVEQSFISEYLGTYYCFAKNKYGTDNTTLEIKGFEPLSVNVNSTINKINPNPGRADLLSTLVRSNRKLQLDCYATGEPNVKIQWYIFTEKYVPDVPIPARKIPLNPNEKSQNVIERITNKHYRLTRDYYSQDTVDSFQCEATLKNKTVRRNIKIQEIQDIFKVNYETDQGNSLRQQVFADKPFQAWCKMENDKKEPVAIKKVEWIFKESNGELIPLLKLAKVVDRRDNKLYLANITLSFGAYIRSQCVAYYNDSYDVISAEVSLHLQESPKIYTIYFKQNFPEKILHMAAPYNLMYSALKKTQIECIANTSTNAKSKITWLKCKDKNCQNTSEASPTSLLSFPANSTKYFDVGQYRCQVKLIMDFKEVLNQTVTLYVDRSAPPKEVAKQLLRLSKTNNLNLPCSSDFSSPEGNVTWSFIPLGKAKEENIPKNATINSSERYYNLVIKRPLKLEYSGLYICRITNEYGSGGYKFDVTISEGPNRWLR 1715
            G    +   +KNENSVTIMFPVEQS ISEYLGTYYCFAKNKYGTDNTTLEIKGFEPLSVNVNSTINKINPNPGRADLLSTLVRSNRKLQLDCYATGEPNVKIQWYIFTEKYVPDVPIPARKIPLNPNEKSQNVIERITNKHYRLTRDYYSQDTVDSFQCEATLKNKTVRRNIKIQEIQDIFKVNYETDQGNSLRQQVFADKPFQAWCKMENDKKEPVAIKKVEWIFKESNGELIPLLKLAKVVDRRDNKLYLANITLSFGAYIRSQCVAYYNDSYDVISAEVSLHLQESPKIYTIYFKQNFPEKILHMAAPYNLMY+ALKKTQIECIANTSTNAKSKITWLKCKDKNCQNTSEASPTSLLSFPANSTKYFDVGQYRCQVKLIMDFKEVLNQTVTLYVDRSAPPKEVAKQLLRLSKTNNLNL CSSDFSSPEGNVTWSFIPLGKAKEENIPKNATINSSERYYNLVIKRPLKLEYSGLYICRITNEYGSGGYKFDVTISEGPNRWLR
Sbjct: 5208 GKPIPKEWIQKNENSVTIMFPVEQSSISEYLGTYYCFAKNKYGTDNTTLEIKGFEPLSVNVNSTINKINPNPGRADLLSTLVRSNRKLQLDCYATGEPNVKIQWYIFTEKYVPDVPIPARKIPLNPNEKSQNVIERITNKHYRLTRDYYSQDTVDSFQCEATLKNKTVRRNIKIQEIQDIFKVNYETDQGNSLRQQVFADKPFQAWCKMENDKKEPVAIKKVEWIFKESNGELIPLLKLAKVVDRRDNKLYLANITLSFGAYIRSQCVAYYNDSYDVISAEVSLHLQESPKIYTIYFKQNFPEKILHMAAPYNLMYNALKKTQIECIANTSTNAKSKITWLKCKDKNCQNTSEASPTSLLSFPANSTKYFDVGQYRCQVKLIMDFKEVLNQTVTLYVDRSAPPKEVAKQLLRLSKTNNLNLLCSSDFSSPEGNVTWSFIPLGKAKEENIPKNATINSSERYYNLVIKRPLKLEYSGLYICRITNEYGSGGYKFDVTISEGPNRWLR 5713          

HSP 2 Score: 159.073 bits (401), Expect = 2.113e-40
Identity = 74/76 (97.37%), Postives = 75/76 (98.68%), Query Frame = 2
Query:    2 AQCFATNGAHNYTSTRISVTVVEDVDNRPKLHFSKTIGKLSDFPEKLLCLNERPETTEIYIGNINGKPIPKEWIQK 229
            AQCFAT GAHNYTSTRISVTVVEDVDNRPKLHFSKTIGKLSDFPEKLLCLNERPETT+IYIGNINGKPIPKEWIQK
Sbjct: 5143 AQCFATKGAHNYTSTRISVTVVEDVDNRPKLHFSKTIGKLSDFPEKLLCLNERPETTQIYIGNINGKPIPKEWIQK 5218          

HSP 3 Score: 53.5286 bits (127), Expect = 3.649e-9
Identity = 35/130 (26.92%), Postives = 69/130 (53.08%), Query Frame = 3
Query:  228 KNENSVTIMFPVEQSFISEYLGTYYCFAKNKYGTDNTTLEIK---GFEPLSVNVNSTINKINPNPGRADLLSTLVRSNRKLQLDC-YATGEPNVKIQWYIFTEKYVPDVPIPARKIPLNPNEKSQNVIER 605
            KN+NSV ++ P+      +++G+Y C A+NK+GTD+  +++K    + P+S+N+ +    I+   G   + S++   N   ++DC Y+ G+P +   W++     +       RK+P   + K   V E+
Sbjct: 2933 KNKNSVELILPINSENPLKFIGSYECKAENKFGTDHRIVDVKYVQRYPPISINIITKSGPISKESGMKYIKSSIGLLN---EIDCLYSGGKPPLVADWFLEKNSEM-------RKLPRGDSVKKYKVFEK 3052          

HSP 4 Score: 26.9498 bits (58), Expect = 3.649e-9
Identity = 16/66 (24.24%), Postives = 29/66 (43.94%), Query Frame = 2
Query:    2 AQCFATNGAHNYTSTRISVTVVEDVDNRPKLHFSKTIGKLSDFPEKLLCLNERPETTEIYIGNING 199
             +C        Y S    V   ED   +PKL  + ++ + +   + L CL++  E T I +  ++G
Sbjct: 2859 GRCIVIVQGKKYFSKYFEVFTNEDALRKPKLIANYSVDEKTGIIKALECLDQSGEMTNIQVTFLSG 2924          

HSP 5 Score: 42.3578 bits (98), Expect = 1.023e-7
Identity = 63/267 (23.60%), Postives = 109/267 (40.82%), Query Frame = 3
Query:  171 LKYILEILMGNQFQRNGFKKNENSVTIMFPVEQSFISEYLGTYYCFAKNKYGTDNTTLEIK---GFEPLSVNVNSTINKINPNPGRADLLSTLVRSNRKLQLDC-YATGEPNVKIQWYIFTEKYVPDVPIPARKIPLNPNEKSQNVIE-RITN--KHYRLTRDYYSQDTVDSFQCEATLKNKTVRRNIKIQEIQDIFKVNYETDQGNSLR-QQVFADKPFQAWCKMENDKKEPVAIKKVEWIFKESNGELIPLLKLAKVVDRRDNKL 947
            L YI   L G         K  N +  +F  +     +Y G Y C A +KYG+++ TL+ K    F+PL V+V S          R    + ++   R +++DC +  G+P   + WY   +    ++     K   N  +K  N++  +I N  K+  +T +   +D          + +  V      Q    +  V    D  +S   +Q   D+  QA        K+       +W F +SN E  P+ KLA+ VD++  ++
Sbjct: 3242 LDYINRTLAGGVLN-----KKRNHIEYVFTTDSKSTLKYDGIYRCNATSKYGSNSITLDTKIKPVFKPLIVSVYSKDVNFTVKDKRN---TAILPEYRVIEIDCLHFGGQPPTDVTWYQIKDSQEVELLKSEIKDNFNVYQKQPNILTVKILNMKKNSNMTLNCVVKDA------NGVMISSPV---FLTQSPSGVRFVVAGLDGDSSFNPKQGSMDRKLQASIIDAKTGKDLSGGFTFKWYFLQSNKEEYPIDKLAEKVDQKGGEI 3491          

HSP 6 Score: 33.113 bits (74), Expect = 1.023e-7
Identity = 21/65 (32.31%), Postives = 31/65 (47.69%), Query Frame = 2
Query:    2 AQCFATNGAHNYTSTRISVTVVEDVDNRPKLHFSKTIGKLSDFPEKLLCLNERPETTEIYIGNIN 196
            AQC   NG+ N  S    + V ED   RPKL    T     +  ++L C++    T+E+ +  IN
Sbjct: 3182 AQCRVNNGSVNDVSKPFFIHVDEDELKRPKLFLKPTFEGELNAVKRLDCIDRSEATSEMTLDYIN 3246          
The following BLAST results are available for this feature:
BLAST of SMED30009565 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30009565 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30009565 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30009565 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30009565 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30009565 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30009565 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30009565 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
G7YN431.678e-3327.01Basement membrane-specific heparan sulfate proteog... [more]
A0A3R7EXM71.890e-3327.01Uncharacterized protein (Fragment) OS=Clonorchis s... [more]
A0A4S2KYA61.527e-3126.35Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A075A3637.659e-3126.76Uncharacterized protein OS=Opisthorchis viverrini ... [more]
A0A1S8WHH91.683e-3026.76Immunoglobulin domain protein (Fragment) OS=Opisth... [more]
back to top
BLAST of SMED30009565 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30009565 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30009565 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30009565 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30009565 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30009565 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000055070.12.022e-4097.63SMESG000055070.1[more]
SMESG000055070.12.030e-4097.63SMESG000055070.1[more]
SMESG000055070.12.022e-4097.63SMESG000055070.1[more]
SMESG000055070.12.113e-4097.63SMESG000055070.1[more]
SMESG000055070.12.113e-4097.63SMESG000055070.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30009565 ID=SMED30009565|Name=SMED30009565|organism=Schmidtea mediterranea sexual|type=transcript|length=1816bp
GGCTCAGTGCTTTGCGACAAATGGAGCTCATAACTATACATCCACTAGAA
TATCTGTAACAGTTGTAGAAGACGTTGACAATCGACCTAAATTACATTTC
TCTAAAACGATTGGAAAACTGTCAGATTTTCCAGAGAAATTACTTTGCTT
GAATGAACGACCAGAAACGACTGAAATATATATTGGAAATATTAATGGGA
AACCAATTCCAAAGGAATGGATTCAAAAAAAATGAAAATTCTGTTACCAT
TATGTTTCCAGTTGAACAAAGTTTCATTTCTGAATATCTGGGAACCTATT
ACTGTTTCGCAAAGAATAAATATGGAACAGATAACACAACACTGGAAATT
AAAGGTTTTGAACCTCTCAGTGTGAATGTTAACTCAACCATAAACAAAAT
TAATCCAAATCCAGGACGTGCTGATTTGCTTTCCACTTTAGTACGAAGTA
ATCGAAAATTACAACTCGATTGTTATGCAACAGGGGAGCCAAATGTAAAG
ATTCAGTGGTATATATTTACAGAGAAATACGTTCCAGATGTACCAATACC
AGCTAGAAAAATCCCATTAAATCCCAATGAGAAATCGCAAAACGTAATTG
AAAGAATAACAAACAAACATTATCGTCTGACGAGGGATTATTATTCACAA
GACACTGTTGATTCATTCCAATGCGAGGCTACGTTGAAGAACAAAACTGT
GAGGAGGAACATCAAAATTCAAGAAATTCAGGATATTTTTAAAGTGAACT
ACGAAACTGACCAAGGAAATTCATTGCGTCAACAAGTTTTTGCTGATAAA
CCATTTCAAGCCTGGTGCAAAATGGAGAATGACAAAAAAGAGCCTGTTGC
AATTAAGAAAGTTGAGTGGATATTTAAAGAATCTAATGGCGAGTTGATTC
CTCTTCTGAAATTGGCTAAGGTCGTAGATCGTAGAGATAATAAGCTTTAT
TTGGCAAATATCACTCTATCATTTGGAGCTTATATTCGTAGTCAATGTGT
TGCTTATTATAATGATTCGTATGACGTTATTAGCGCTGAGGTTTCTTTGC
ATTTGCAAGAATCACCAAAAATATATACAATTTATTTTAAACAAAACTTT
CCTGAGAAGATATTGCATATGGCAGCACCTTATAACTTAATGTACAGTGC
TTTGAAGAAAACTCAAATCGAGTGTATTGCTAATACTAGCACAAATGCAA
AATCGAAGATCACTTGGCTAAAGTGCAAGGATAAAAATTGCCAAAATACA
TCTGAGGCCAGTCCGACGTCATTACTGTCATTTCCAGCCAACTCAACGAA
ATATTTTGATGTTGGACAGTATAGATGTCAGGTAAAATTGATAATGGATT
TCAAAGAAGTCCTAAATCAGACAGTTACACTTTATGTCGACAGATCCGCA
CCTCCGAAAGAAGTTGCTAAGCAATTATTAAGACTTTCTAAAACAAATAA
TTTAAATCTTCCCTGCTCCTCTGATTTCAGCAGTCCAGAAGGCAATGTCA
CATGGTCATTCATTCCCCTCGGCAAGGCAAAAGAGGAAAATATTCCTAAA
AATGCTACTATAAATTCATCAGAGAGATACTATAATTTAGTAATCAAAAG
GCCTTTAAAATTGGAATACAGTGGACTTTATATATGCAGGATCACTAATG
AATATGGATCTGGAGGGTACAAATTTGATGTAACAATTTCTGAGGGACCC
AATAGATGGCTTCGGTTTTAAACTTTTATAATTCTGATTGAATAATTATT
TTTAGTAAATAGTTCTTTACATAGGTTGTACTATTGAATAAAGTTTTATT
AATAATTTCAAAAAAA
back to top

protein sequence of SMED30009565-orf-1

>SMED30009565-orf-1 ID=SMED30009565-orf-1|Name=SMED30009565-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=523bp
MNDQKRLKYILEILMGNQFQRNGFKKNENSVTIMFPVEQSFISEYLGTYY
CFAKNKYGTDNTTLEIKGFEPLSVNVNSTINKINPNPGRADLLSTLVRSN
RKLQLDCYATGEPNVKIQWYIFTEKYVPDVPIPARKIPLNPNEKSQNVIE
RITNKHYRLTRDYYSQDTVDSFQCEATLKNKTVRRNIKIQEIQDIFKVNY
ETDQGNSLRQQVFADKPFQAWCKMENDKKEPVAIKKVEWIFKESNGELIP
LLKLAKVVDRRDNKLYLANITLSFGAYIRSQCVAYYNDSYDVISAEVSLH
LQESPKIYTIYFKQNFPEKILHMAAPYNLMYSALKKTQIECIANTSTNAK
SKITWLKCKDKNCQNTSEASPTSLLSFPANSTKYFDVGQYRCQVKLIMDF
KEVLNQTVTLYVDRSAPPKEVAKQLLRLSKTNNLNLPCSSDFSSPEGNVT
WSFIPLGKAKEENIPKNATINSSERYYNLVIKRPLKLEYSGLYICRITNE
YGSGGYKFDVTISEGPNRWLRF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000101muscle cell
PLANA:0000428musculature system
PLANA:0000478pharynx musculature
Vocabulary: INTERPRO
TermDefinition
IPR013783Ig-like_fold
IPR013151Immunoglobulin
IPR007110Ig-like_dom
IPR003599Ig_sub
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0051287NAD binding
GO:0004471malate dehydrogenase (decarboxylating) (NAD+) activity
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
GO:0005783endoplasmic reticulum
Vocabulary: biological process
TermDefinition
GO:0055114oxidation-reduction process
GO:0006810transport