methionine synthase reductase

Overview
Namemethionine synthase reductase
Smed IDSMED30009557
Length (bp)2263
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of methionine synthase reductase (SMED30009557) t-SNE clustered cells

Violin plots show distribution of expression levels for methionine synthase reductase (SMED30009557) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of methionine synthase reductase (SMED30009557) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for methionine synthase reductase (SMED30009557) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30009557

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
posterior sideSMED30009557h1SMcG0017174 dd_Smed_v4_3947_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior muscle cellSMED30009557h1SMcG0017174 dd_Smed_v4_3947_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of methionine synthase reductase vs. Ensembl Human
Match: MTRR (5-methyltetrahydrofolate-homocysteine methyltransferase reductase [Source:HGNC Symbol;Acc:HGNC:7473])

HSP 1 Score: 334.724 bits (857), Expect = 1.107e-103
Identity = 240/724 (33.15%), Postives = 381/724 (52.62%), Query Frame = 2
Query:   62 LKMTCILYGSQTGQAKSIAENL--YAKLKDYIKHIN-IFELDDVEKSFEIHKLNFAIIICSTTGDGDAPDNASKFLRLIK--IYQPKYLSNFKYTVLGLGDTNYSNFCNCSKTIDQILESKGARRFYRSDMADDAVGLEIVVEPWLDGLYEIAK----------DMCSEIPIDGFQNLSXXXXXXXXXXXXXXNYKELLGDHLAKDMDGKNLTVPALPSPFLNIIYNN-EDSISNFHEPLI-TSMPMPSSDSELVMGEVQD------------------------ITKITNKYAIKSVHRATINVPNAKWKWKPGDSVGILPFNAESEVDSILSRLSVPETEKNCVVXXXXXXXXXXXXAKVPEHLIVRENGKMSLKSILLWLCDLRQPLSKVGLRIMSEYCPMKSAEQRRLLELCSREGQSFYTKCLRETSMPVLDLLNWFPSCQIPIVRLLEVLPRLKPRAYSLCDLESV------SFAFSKVDI---APIQTFRKRPLTGVCTSWMEKMAK------FHNEQ-------IWKIPIYLRKNMNGFTVCENPSIPHILIGPGTGVAPFIGFLQYFEKLKNE--NQNIGPIWLFFGCRNEERDFIFKKQLEHFANSGILTHLCVCFSRDNPTNSGDEQKNFCQPPNCKYVQHCLLHHSKILSDLLVNQNARVFVCGDSSGMSKDVLETWSNVLLGNHEKIQTKRDADSFITGMRVQKLYLEDVW 2038
            ++   +LY +Q GQAK+IAE +   A +  +   ++ I E D  +   E   L   +++ STTG GD PD A KF++ I+       + ++ +Y +LGLGD+ Y+ FCN  K ID+ L+  GAR FY +  ADD VGLE+VVEPW+ GL+   +          ++   +P+      S    + K E+  IE+  ELL    +   D + L   A+ S   N++  + E S++    PL   S+ +P    E +   +Q+                          ++T   AIK+     +++ N  + ++PGD+  ++  N++SEV S+L RL + +  ++CV+     +  +   A +P+H+        SL+ I  W  ++R    K  LR + +Y    SAE+RRL ELCS++G + Y++ +R+    +LDLL  FPSCQ P+  LLE LP+L+PR YS C   S+       F F+ V+    A  +  RK    GVCT W+  +         H            KI I  R   N F + ++PSIP I++GPGTG+APFIGFLQ+ EKL+ +  + N G +WLFFGCR+++RD++F+K+L HF   GILTHL V FSRD P   G+E+         KYVQ  +  H + ++ +L+ +N  ++VCGD+  M+KDV +    ++  + E    K +A   +  ++ +K YL+D+W
Sbjct:    1 MRRFLLLYATQQGQAKAIAEEICEQAVVHGFSADLHCISESDKYDLKTETAPL---VVVVSTTGTGDPPDTARKFVKEIQNQTLPVDFFAHLRYGLLGLGDSEYTYFCNGGKIIDKRLQELGARHFYDTGHADDCVGLELVVEPWIAGLWPALRKHFRSSRGQEEISGALPVAS--PASSRTDLVKSELLHIESQVELLRFDDSGRKDSEVLKQNAVNSNQSNVVIEDFESSLTRSVPPLSQASLNIPGLPPEYLQVHLQESLGQEESQVSVTSADPVFQVPISKAVQLTTNDAIKTTLLVELDISNTDFSYQPGDAFSVICPNSDSEVQSLLQRLQLEDKREHCVLLKIKADTKKKG-ATLPQHI----PAGCSLQFIFTWCLEIRAIPKKAFLRALVDYT-SDSAEKRRLQELCSKQGAADYSRFVRDACACLLDLLLAFPSCQPPLSLLLEHLPKLQPRPYS-CASSSLFHPGKLHFVFNIVEFLSTATTEVLRK----GVCTGWLALLVASVLQPNIHASHEDSGKALAPKISISPR-TTNSFHLPDDPSIPIIMVGPGTGIAPFIGFLQHREKLQEQHPDGNFGAMWLFFGCRHKDRDYLFRKELRHFLKHGILTHLKVSFSRDAPV--GEEEA------PAKYVQDNIQLHGQQVARILLQENGHIYVCGDAKNMAKDVHDALVQII--SKEVGVEKLEAMKTLATLKEEKRYLQDIW 697          
BLAST of methionine synthase reductase vs. Ensembl Human
Match: MTRR (5-methyltetrahydrofolate-homocysteine methyltransferase reductase [Source:HGNC Symbol;Acc:HGNC:7473])

HSP 1 Score: 335.495 bits (859), Expect = 1.223e-103
Identity = 245/736 (33.29%), Postives = 385/736 (52.31%), Query Frame = 2
Query:   50 LCDFLKMTCI--------LYGSQTGQAKSIAENL--YAKLKDYIKHIN-IFELDDVEKSFEIHKLNFAIIICSTTGDGDAPDNASKFLRLIK--IYQPKYLSNFKYTVLGLGDTNYSNFCNCSKTIDQILESKGARRFYRSDMADDAVGLEIVVEPWLDGLYEIAK----------DMCSEIPIDGFQNLSXXXXXXXXXXXXXXNYKELLGDHLAKDMDGKNLTVPALPSPFLNIIYNN-EDSISNFHEPLI-TSMPMPSSDSELVMGEVQD------------------------ITKITNKYAIKSVHRATINVPNAKWKWKPGDSVGILPFNAESEVDSILSRLSVPETEKNCVVXXXXXXXXXXXXAKVPEHLIVRENGKMSLKSILLWLCDLRQPLSKVGLRIMSEYCPMKSAEQRRLLELCSREGQSFYTKCLRETSMPVLDLLNWFPSCQIPIVRLLEVLPRLKPRAYSLCDLESV------SFAFSKVDI---APIQTFRKRPLTGVCTSWMEKMAK------FHNEQ-------IWKIPIYLRKNMNGFTVCENPSIPHILIGPGTGVAPFIGFLQYFEKLKNE--NQNIGPIWLFFGCRNEERDFIFKKQLEHFANSGILTHLCVCFSRDNPTNSGDEQKNFCQPPNCKYVQHCLLHHSKILSDLLVNQNARVFVCGDSSGMSKDVLETWSNVLLGNHEKIQTKRDADSFITGMRVQKLYLEDVW 2038
            LC F  +TC+        LY +Q GQAK+IAE +   A +  +   ++ I E D  +   E   L   +++ STTG GD PD A KF++ I+       + ++ +Y +LGLGD+ Y+ FCN  K ID+ L+  GAR FY +  ADD VGLE+VVEPW+ GL+   +          ++   +P+      S    + K E+  IE+  ELL    +   D + L   A+ S   N++  + E S++    PL   S+ +P    E +   +Q+                          ++T   AIK+     +++ N  + ++PGD+  ++  N++SEV S+L RL + +  ++CV+     +  +   A +P+H+        SL+ I  W  ++R    K  LR + +Y    SAE+RRL ELCS++G + Y++ +R+    +LDLL  FPSCQ P+  LLE LP+L+PR YS C   S+       F F+ V+    A  +  RK    GVCT W+  +         H            KI I  R   N F + ++PSIP I++GPGTG+APFIGFLQ+ EKL+ +  + N G +WLFFGCR+++RD++F+K+L HF   GILTHL V FSRD P   G+E+         KYVQ  +  H + ++ +L+ +N  ++VCGD+  M+KDV +    ++  + E    K +A   +  ++ +K YL+D+W
Sbjct:   17 LCSF-TVTCLEVMRRFLLLYATQQGQAKAIAEEICEQAVVHGFSADLHCISESDKYDLKTETAPL---VVVVSTTGTGDPPDTARKFVKEIQNQTLPVDFFAHLRYGLLGLGDSEYTYFCNGGKIIDKRLQELGARHFYDTGHADDCVGLELVVEPWIAGLWPALRKHFRSSRGQEEISGALPVAS--PASSRTDLVKSELLHIESQVELLRFDDSGRKDSEVLKQNAVNSNQSNVVIEDFESSLTRSVPPLSQASLNIPGLPPEYLQVHLQESLGQEESQVSVTSADPVFQVPISKAVQLTTNDAIKTTLLVELDISNTDFSYQPGDAFSVICPNSDSEVQSLLQRLQLEDKREHCVLLKIKADTKKKG-ATLPQHI----PAGCSLQFIFTWCLEIRAIPKKAFLRALVDYTS-DSAEKRRLQELCSKQGAADYSRFVRDACACLLDLLLAFPSCQPPLSLLLEHLPKLQPRPYS-CASSSLFHPGKLHFVFNIVEFLSTATTEVLRK----GVCTGWLALLVASVLQPNIHASHEDSGKALAPKISISPR-TTNSFHLPDDPSIPIIMVGPGTGIAPFIGFLQHREKLQEQHPDGNFGAMWLFFGCRHKDRDYLFRKELRHFLKHGILTHLKVSFSRDAPV--GEEEA------PAKYVQDNIQLHGQQVARILLQENGHIYVCGDAKNMAKDVHDALVQII--SKEVGVEKLEAMKTLATLKEEKRYLQDIW 724          
BLAST of methionine synthase reductase vs. Ensembl Human
Match: POR (cytochrome p450 oxidoreductase [Source:HGNC Symbol;Acc:HGNC:9208])

HSP 1 Score: 182.185 bits (461), Expect = 5.841e-48
Identity = 171/668 (25.60%), Postives = 291/668 (43.56%), Query Frame = 2
Query:   77 ILYGSQTGQAKSIAENLYAKLKDY-IKHINI----FELDDVEKSFEIHKLNFAIIIC-STTGDGDAPDNASKFLRLIKIYQPKYLSNFKYTVLGLGDTNYSNFCNCSKTIDQILESKGARRFYRSDMADDAVGLEIVVEPWLDGLYEIAKDMCSEIPIDGFQNLSXXXXXXXXXXXXXXNYKELLGDHLAKDMDGKNLTVP-ALPSPFLNIIYNNEDSISNFHEPLITSMPMPSSDSELVMGEVQDITKITNKYAIKSVHRATINVPNAKWKWKPGDSVGILPFNAESEVDSILSRLSVPETEKNCVVXXXXXXXXXXXXAKVPEHLIVRENGKMSLKSILLWLCDLRQPLSKVGLRIMSEYCPMKSAEQR-RLLELCSREGQSFYTKCLRETSMPVLDLLNWFPSCQIPIVRLLEVLPRLKPRAYSLCDLESV---SFAFSKVDIAPIQTFRKRPLTGVCTSWME-KMAKFHNEQIWKIPIYLRKNMNGFTVCENPSIPHILIGPGTGVAPFIGFLQYFEKLKNENQNIGPIWLFFGCRNEERDFIFKKQLEHFANSGILTHLCVCFSRDNPTNSGDEQKNFCQPPNCKYVQHCLLHHSKILSDLLVNQNARVFVCGDSSGMSKDVLETWSNVL--LGNHEKIQTKRDADSFITGMRVQKLYLEDVW 2038
            + YGSQTG A+  A  L      Y ++ ++     ++L D+    EI   N  ++ C +T G+GD  DNA  F   ++      LS  K+ V GLG+  Y +F    K +D+ LE  GA+R +   + DD   LE     W +  +     +C    ++     S   +   +    I+  K  +G+ + +    +N   P    +PFL  +  N                                 +  N+   + +    +++ ++K +++ GD V + P N  + V+ +   L     + + V+ L  L+   N++   P           S ++ L +  D+  P     L  +++Y    S ++  R +   S EG+  Y   + E    +L +L   PS + PI  L E+LPRL+ R YS+     V   S     V +   +T   R   GV T+W+  K     N     +P+++RK+   F +    + P I++GPGTGVAPFIGF+Q    L+ + + +G   L++GCR  + D++++++L  F   G LT L V FSR+                   YVQH L    + L   L+   A ++VCGD+  M++DV  T+ +++  LG  E  Q    A  +I  +  +  Y  DVW
Sbjct:   85 VFYGSQTGTAEEFANRLSKDAHRYGMRGMSADPEEYDLADLSSLPEID--NALVVFCMATYGEGDPTDNAQDFYDWLQETDVD-LSGVKFAVFGLGNKTYEHFNAMGKYVDKRLEQLGAQRIFELGLGDDDGNLEEDFITWREQFWPA---VCEHFGVEATGEESSIRQYELVVHTDIDAAKVYMGE-MGRLKSYENQKPPFDAKNPFLAAVTTN---------------------------------RKLNQGTERHLMHLELDISDSKIRYESGDHVAVYPANDSALVNQLGKILGA---DLDVVMSLNNLDEESNKKHPFP--------CPTSYRTALTYYLDITNPPRTNVLYELAQYASEPSEQELLRKMASSSGEGKELYLSWVVEARRHILAILQDCPSLRPPIDHLCELLPRLQARYYSIASSSKVHPNSVHICAV-VVEYETKAGRINKGVATNWLRAKEPAGENGGRALVPMFVRKSQ--FRLPFKATTPVIMVGPGTGVAPFIGFIQERAWLRQQGKEVGETLLYYGCRRSDEDYLYREELAQFHRDGALTQLNVAFSREQSHKV--------------YVQHLLKQDREHLWK-LIEGGAHIYVCGDARNMARDVQNTFYDIVAELGAMEHAQ----AVDYIKKLMTKGRYSLDVW 679          
BLAST of methionine synthase reductase vs. Ensembl Human
Match: POR (cytochrome p450 oxidoreductase [Source:HGNC Symbol;Acc:HGNC:9208])

HSP 1 Score: 164.466 bits (415), Expect = 4.385e-42
Identity = 156/618 (25.24%), Postives = 266/618 (43.04%), Query Frame = 2
Query:   77 ILYGSQTGQAKSIAENLYAKLKDY-IKHINI----FELDDVEKSFEIHKLNFAIIIC-STTGDGDAPDNASKFLRLIKIYQPKYLSNFKYTVLGLGDTNYSNFCNCSKTIDQILESKGARRFYRSDMADDAVGLEIVVEPWLDGLYEIAKDMCSEIPIDGFQNLSXXXXXXXXXXXXXXNYKELLGDHLAKDMDGKNLTVP-ALPSPFLNIIYNNEDSISNFHEPLITSMPMPSSDSELVMGEVQDITKITNKYAIKSVHRATINVPNAKWKWKPGDSVGILPFNAESEVDSILSRLSVPETEKNCVVXXXXXXXXXXXXAKVPEHLIVRENGKMSLKSILLWLCDLRQPLSKVGLRIMSEYCPMKSAEQR-RLLELCSREGQSFYTKCLRETSMPVLDLLNWFPSCQIPIVRLLEVLPRLKPRAYSLCDLESV---SFAFSKVDIAPIQTFRKRPLTGVCTSWME-KMAKFHNEQIWKIPIYLRKNMNGFTVCENPSIPHILIGPGTGVAPFIGFLQYFEKLKNENQNIGPIWLFFGCRNEERDFIFKKQLEHFANSGILTHLCVCFSRDNPTNSGDEQKNFCQPPNCKYVQHCLLHHSKILSDLLVNQNARVFVCG 1894
            + YGSQTG A+  A  L      Y ++ ++     ++L D+    EI   N  ++ C +T G+GD  DNA  F   ++      LS  K+ V GLG+  Y +F    K +D+ LE  GA+R +   + DD   LE     W +  +     +C    ++     S   +   +    I+  K  +G+ + +    +N   P    +PFL  +  N                                 +  N+   + +    +++ ++K +++ GD V + P N  + V+ +   L     + + V+ L  L+   N++   P           S ++ L +  D+  P     L  +++Y    S ++  R +   S EG+  Y   + E    +L +L   PS + PI  L E+LPRL+ R YS+     V   S     V +   +T   R   GV T+W+  K     N     +P+++RK+   F +    + P I++GPGTGVAPFIGF+Q    L+ + + +G   L++GCR  + D++++++L  F   G LT L V FSR+                   YVQH L    + L   L+   A ++VCG
Sbjct:   85 VFYGSQTGTAEEFANRLSKDAHRYGMRGMSADPEEYDLADLSSLPEID--NALVVFCMATYGEGDPTDNAQDFYDWLQETDVD-LSGVKFAVFGLGNKTYEHFNAMGKYVDKRLEQLGAQRIFELGLGDDDGNLEEDFITWREQFWPA---VCEHFGVEATGEESSIRQYELVVHTDIDAAKVYMGE-MGRLKSYENQKPPFDAKNPFLAAVTTN---------------------------------RKLNQGTERHLMHLELDISDSKIRYESGDHVAVYPANDSALVNQLGKILGA---DLDVVMSLNNLDEESNKKHPFP--------CPTSYRTALTYYLDITNPPRTNVLYELAQYASEPSEQELLRKMASSSGEGKELYLSWVVEARRHILAILQDCPSLRPPIDHLCELLPRLQARYYSIASSSKVHPNSVHICAV-VVEYETKAGRINKGVATNWLRAKEPAGENGGRALVPMFVRKSQ--FRLPFKATTPVIMVGPGTGVAPFIGFIQERAWLRQQGKEVGETLLYYGCRRSDEDYLYREELAQFHRDGALTQLNVAFSREQSHKV--------------YVQHLLKQDREHLWK-LIEGGAHIYVCG 633          
BLAST of methionine synthase reductase vs. Ensembl Human
Match: NDOR1 (NADPH dependent diflavin oxidoreductase 1 [Source:HGNC Symbol;Acc:HGNC:29838])

HSP 1 Score: 154.066 bits (388), Expect = 1.049e-38
Identity = 162/670 (24.18%), Postives = 286/670 (42.69%), Query Frame = 2
Query:   77 ILYGSQTGQAKSIAENLYAKLKDYIKHINIFELDDVEKSFEIHKLNFAIIICSTTGDGDAPDNASKFLRLI--KIYQPKYLSNFKYTVLGLGDTNYSNFCNCSKTIDQILESKGARRFYRSDMADDA--VGLEIVVEPWLDGLYEIAKDMCSEIPIDGFQNLSXXXXXXXXXXXXXXNYKELLGDHLAKDMDGKNLTVPALPSPFLNIIYNNEDSISNFHEPLITSMP---MPSSDSELVMGEVQDITKITNKYAIKSVHRATINVPNAKWKWKPGDSVGILPFNAESEVDSILSRLSVPETEKNCVVXXXXXXXXXXXXAKVPEHLIVRENGKMSLKSILLWLCDLRQPLSKVGLRIMSEYCPMKSAEQRRLLELCSREGQS-FYTKCLRETSMPVLDLLNWFP--SCQIPIVRLLEVLPRLKPRAYSLCD--LESVSFAFSKVDIAPIQTFRKRPLTGVCTSWMEKMAKFHNEQIWKIPIYLRKNMNGFTVCENPSIPHILIGPGTGVAPFIGFLQYFEKL-KNENQNIGPIWLFFGCRNEERDFIFKKQLEHFANSGILTHLCVCFSRDNPT---NSGDEQKNFCQPPNCKYVQHCLLHHSKILSDLLVNQNARVFVCGDSSGMSKDVLETWSNVLLGNHEKIQTKRDADSFITGMRVQKLYLEDVW 2038
            +L+GSQTG A+ ++E L  + +       +  LD       I++    I +C+TTG GD PDN   F R I  K      L    + VLGLGD++Y+ F   +K + + L   G        + DD   +G +  V+PWL  L++                                    +LG  L     G     P +P P    +   +++ S   E    + P    P S+S+  +  +    ++T     + V     ++  +   +  GD V I P N+ + V      L +   + + +  L+  E   +   ++P+          S++ ++    D+     +    +++    +   E+ +LLE  S +GQ   +  C R     +L++L  FP  +  IP   LL+++P ++PRA+S+    L   S     V +   QT  K P  G+C+SW+  +     +   ++P+++R     F   E P  P I++GPGTGVAPF   +Q  E++ + +  N    +LFFGCR  ++DF ++ + +       LT L   FSR+ P    ++  EQK         YVQH L     ++ +LL  Q A  ++ G++  M  DV E   ++     E      DA +++  ++  + +  + W
Sbjct:    8 VLFGSQTGTAQDVSERLGREARRRRLGCRVQALDSYPVVNLINE-PLVIFVCATTGQGDPPDNMKNFWRFIFRKNLPSTALCQMDFAVLGLGDSSYAKFNFVAKKLHRRLLQLGGSALLPVCLGDDQHELGPDAAVDPWLRDLWD-----------------------------------RVLG--LYPPPPGLTEIPPGVPLPSKFTLLFLQEAPSTGSEGQRVAHPGSQEPPSESKPFLAPMISNQRVTGPSHFQDVRLIEFDILGSGISFAAGDVVLIQPSNSAAHVQRFCQVLGL---DPDQLFMLQPREPDVSSPTRLPQ--------PCSMRHLVSHYLDIASVPRRSFFELLACLS-LHELEREKLLEFSSAQGQEELFEYCNRPRRT-ILEVLCDFPHTAAAIPPDYLLDLIPVIRPRAFSIASSLLTHPSRLQILVAVVQFQTRLKEPRRGLCSSWLASLDP--GQGPVRVPLWVRPGSLAFP--ETPDTPVIMVGPGTGVAPFRAAIQ--ERVAQGQTGN----FLFFGCRWRDQDFYWEAEWQELEKRDCLT-LIPAFSREQPPALFSALQEQK--------VYVQHRLRELGSLVWELLDRQGAYFYLAGNAKSMPADVSEALMSIF--QEEGGLCSPDAAAYLARLQQTRRFQTETW 605          
BLAST of methionine synthase reductase vs. Ensembl Celegans
Match: mtrr-1 (Methionine synthase reductase [Source:UniProtKB/Swiss-Prot;Acc:Q17574])

HSP 1 Score: 268.855 bits (686), Expect = 1.736e-79
Identity = 212/720 (29.44%), Postives = 352/720 (48.89%), Query Frame = 2
Query:   50 LCDFLKMTCILYGSQTGQAKSIAENLYAKLKDYIKHINIFELDDVEKSFEIHKLNFAIIICSTTGDGDAPDNASKFLRLIK--IYQPKYLSNFKYTVLGLGDTNYSNFCNCSKTIDQILESKGARRFYRSDMADDAVGLEIVVEPWLDGLYEIAKDMCSEIPIDGFQNLSXXXXXXXXXXXXXXNYKELL--------------GDHLAKDM---------------------DGKNLTVPALPSPFLNIIYNNEDSISNFHEPLITSM------PMPSSDSELVMGEVQDITKITNKYA--IKSVHRATINVPN--AKWKWKPGDSVGILPFNAESEVDSILSRLSVPE-TEKNCVVXXXXXXXXXXXXAKVPEHLIVRENGKMSLKSILLWLCDLRQPLSKVGLRIMSEYCPMKSAEQRRLLELCSREGQSFYTKCLRETSMPVLDLLNWFPSCQIPIVRLLEVLPRLKPRAYSLCDLES--VSFAFSKVDIAPIQTFRKRPLTGVCTSWMEKMAKFHNEQIW-KIPIYLRKNMNGFTVCENPSIPHILIGPGTGVAPFIGFLQYFEKLKNENQN---IGPIWLFFGCRNEERDFIFKKQLEHFANSGILTHLCVCFSRDNPTNSGDEQKNFCQPPNCKYVQHCLLHH-SKILSDLLVNQNARVFVCGDSSGMSKDVLETWSNVLLGNH--EKIQTKRDADSFITGMRVQKLYLEDVW 2038
            + DFL    I +GSQTGQA++IA++L  K +       +  LD+ EK F +++     I+ S+TGDGDAPDN ++F+R I     + +YL N  Y +LGLGD+NYS++    + ID+ L + GA R +    ADD VGLE+ VEPW++  +        +I  D    ++ +  +   ++K  E  K LL              G  +  DM                     + +NL VP  P PF+        S+SN   P  T +       MP   ++     V     +T+ ++  IK+    T++  +  A+ +++PGD++     N   EV+ IL R  V +  ++ C + +       N  A++P H+    +   +L+ +     D+R+   +  +R+++E       E+RRLLELCS +G   +T  +R   + + D+L  FP+ + P+ RL+E+LPRL PR YS+   E+      +S+++  P    R+    G+ T W+  +      Q+  K P   R    G T      +P +++GPGTGV+ F+ FL +  KLK ++ +     P  LFFGCR+   D I+  +LE F + GILT L +C S         EQK        + VQ  L  +  K+L  L  +  +++F+CGD+ GMSKDV + +S+++  +     ++ K+     +  ++    Y+EDVW
Sbjct:    1 MTDFL----IAFGSQTGQAETIAKSLKEKAELIGLTPRLHALDENEKKFNLNEEKLCAIVVSSTGDGDAPDNCARFVRRINRNSLENEYLKNLDYVLLGLGDSNYSSYQTIPRKIDKQLTALGANRLFDRAEADDQVGLELEVEPWIEKFFATLASRF-DISADKMNAITESSNLKLNQVKTEEEKKALLQKRIEDEESDDEGRGRVIGIDMLIPEHYDYPEISLLKGSQTLSNDENLRVPIAPQPFIV------SSVSNRKLPEDTKLEWQNLCKMPGVVTKPFEVLVVSAEFVTDPFSKKIKTKRMITVDFGDHAAELQYEPGDAIYFCVPNPALEVNFILKRCGVLDIADQQCELSINPKTEKIN--AQIPGHV----HKITTLRHMFTTCLDIRRAPGRPLIRVLAESTS-DPNEKRRLLELCSAQGMKDFTDFVRTPGLSLADMLFAFPNVKPPVDRLIELLPRLIPRPYSMSSYENRKARLIYSEMEF-PATDGRRHSRKGLATDWLNSLRIGDKVQVLGKEPARFRLPPLGMTKNSAGKLPLLMVGPGTGVSVFLSFLHFLRKLKQDSPSDFVDVPRVLFFGCRDSSVDAIYMSELEMFVSEGILTDLIICES---------EQKG-------ERVQDGLRKYLDKVLPFLTASTESKIFICGDAKGMSKDVWQCFSDIVASDQGIPDLEAKKK----LMDLKKSDQYIEDVW 681          
BLAST of methionine synthase reductase vs. Ensembl Celegans
Match: mtrr-1 (Methionine synthase reductase [Source:UniProtKB/Swiss-Prot;Acc:Q17574])

HSP 1 Score: 268.855 bits (686), Expect = 1.736e-79
Identity = 212/720 (29.44%), Postives = 352/720 (48.89%), Query Frame = 2
Query:   50 LCDFLKMTCILYGSQTGQAKSIAENLYAKLKDYIKHINIFELDDVEKSFEIHKLNFAIIICSTTGDGDAPDNASKFLRLIK--IYQPKYLSNFKYTVLGLGDTNYSNFCNCSKTIDQILESKGARRFYRSDMADDAVGLEIVVEPWLDGLYEIAKDMCSEIPIDGFQNLSXXXXXXXXXXXXXXNYKELL--------------GDHLAKDM---------------------DGKNLTVPALPSPFLNIIYNNEDSISNFHEPLITSM------PMPSSDSELVMGEVQDITKITNKYA--IKSVHRATINVPN--AKWKWKPGDSVGILPFNAESEVDSILSRLSVPE-TEKNCVVXXXXXXXXXXXXAKVPEHLIVRENGKMSLKSILLWLCDLRQPLSKVGLRIMSEYCPMKSAEQRRLLELCSREGQSFYTKCLRETSMPVLDLLNWFPSCQIPIVRLLEVLPRLKPRAYSLCDLES--VSFAFSKVDIAPIQTFRKRPLTGVCTSWMEKMAKFHNEQIW-KIPIYLRKNMNGFTVCENPSIPHILIGPGTGVAPFIGFLQYFEKLKNENQN---IGPIWLFFGCRNEERDFIFKKQLEHFANSGILTHLCVCFSRDNPTNSGDEQKNFCQPPNCKYVQHCLLHH-SKILSDLLVNQNARVFVCGDSSGMSKDVLETWSNVLLGNH--EKIQTKRDADSFITGMRVQKLYLEDVW 2038
            + DFL    I +GSQTGQA++IA++L  K +       +  LD+ EK F +++     I+ S+TGDGDAPDN ++F+R I     + +YL N  Y +LGLGD+NYS++    + ID+ L + GA R +    ADD VGLE+ VEPW++  +        +I  D    ++ +  +   ++K  E  K LL              G  +  DM                     + +NL VP  P PF+        S+SN   P  T +       MP   ++     V     +T+ ++  IK+    T++  +  A+ +++PGD++     N   EV+ IL R  V +  ++ C + +       N  A++P H+    +   +L+ +     D+R+   +  +R+++E       E+RRLLELCS +G   +T  +R   + + D+L  FP+ + P+ RL+E+LPRL PR YS+   E+      +S+++  P    R+    G+ T W+  +      Q+  K P   R    G T      +P +++GPGTGV+ F+ FL +  KLK ++ +     P  LFFGCR+   D I+  +LE F + GILT L +C S         EQK        + VQ  L  +  K+L  L  +  +++F+CGD+ GMSKDV + +S+++  +     ++ K+     +  ++    Y+EDVW
Sbjct:    1 MTDFL----IAFGSQTGQAETIAKSLKEKAELIGLTPRLHALDENEKKFNLNEEKLCAIVVSSTGDGDAPDNCARFVRRINRNSLENEYLKNLDYVLLGLGDSNYSSYQTIPRKIDKQLTALGANRLFDRAEADDQVGLELEVEPWIEKFFATLASRF-DISADKMNAITESSNLKLNQVKTEEEKKALLQKRIEDEESDDEGRGRVIGIDMLIPEHYDYPEISLLKGSQTLSNDENLRVPIAPQPFIV------SSVSNRKLPEDTKLEWQNLCKMPGVVTKPFEVLVVSAEFVTDPFSKKIKTKRMITVDFGDHAAELQYEPGDAIYFCVPNPALEVNFILKRCGVLDIADQQCELSINPKTEKIN--AQIPGHV----HKITTLRHMFTTCLDIRRAPGRPLIRVLAESTS-DPNEKRRLLELCSAQGMKDFTDFVRTPGLSLADMLFAFPNVKPPVDRLIELLPRLIPRPYSMSSYENRKARLIYSEMEF-PATDGRRHSRKGLATDWLNSLRIGDKVQVLGKEPARFRLPPLGMTKNSAGKLPLLMVGPGTGVSVFLSFLHFLRKLKQDSPSDFVDVPRVLFFGCRDSSVDAIYMSELEMFVSEGILTDLIICES---------EQKG-------ERVQDGLRKYLDKVLPFLTASTESKIFICGDAKGMSKDVWQCFSDIVASDQGIPDLEAKKK----LMDLKKSDQYIEDVW 681          
BLAST of methionine synthase reductase vs. Ensembl Celegans
Match: emb-8 (NADPH--cytochrome P450 reductase [Source:UniProtKB/TrEMBL;Acc:Q09590])

HSP 1 Score: 142.895 bits (359), Expect = 3.343e-35
Identity = 115/430 (26.74%), Postives = 190/430 (44.19%), Query Frame = 2
Query:  800 KITNKYAIKSVHRATINVPNAKWKWKPGDSVGILPFNAESEVDSILSRLSVPETEKNCVVXXXXXXXXXXXXAKVPEHLI----VRENGK--------MSLKSILLWLCDLRQPLSKVGLRIMSEYCPMKSAEQRRL--LELCSREGQSFYTKCLRETSMPVLDLLNWFPSCQIPIVRLLEVLPRLKPRAYSLCDLESVSFAFSKVDIAPIQT---FRKRPLTGVCTSWMEKMAKFHNEQIWKIPIYLRKNMNGFTVCENPSIPHILIGPGTGVAPFIGFLQYFEKLKNENQNIGPIWLFFGCRNEERDFIFKKQLEHFANSGILTHLCVCFSRDNPTNSGDEQKNFCQPPNCKYVQHCLLHHSKILSDLLVNQNARVFVCGDSSGMSKDVLETWSNVLLGNHEKIQTKRDADSFITGMRVQKLYLEDVW 2038
            ++  +++ +S      +V  ++ +++ GD + + P N    VD +++ L                          P+H      V E+           + ++ L    D+  P+    L+ +SEYC     E+  L  L   + EG   Y + + +    ++D+L    +C+ PI  LLE+LPRL+ R YS+    S      K+ I  + T      R + GVCT ++        +   K P+++RK+     +    +   I+IGPGTG APF GFLQ  +  KN  + IG + L++GCR+ + D+I+K +L  F    +LTHL   FSR        E K         YVQ  L      + D  +N  A V++CGD+  M++DV  T   +      K +T  +A ++   M   K Y  DVW
Sbjct:  282 ELHTEHSDRSCRHIEFSVEGSRIRYEAGDHLAVFPTNDPVLVDRLINMLQFD-----------------------PDHAFRLVNVDEDASKRHPFPCPTTFRTALSHYVDICAPVKSHVLKAISEYC-TDDTEKEFLNKLSTANEEGLKEYARYIVKERRSIVDVLTDQKTCKPPIEYLLELLPRLQARYYSIA--SSPRLNEEKIAICAVVTKYSIGDRDINGVCTRYLTT-----KDAGSKSPVFVRKST--MRLPHRTTTQVIMIGPGTGFAPFRGFLQDRQFHKNAGKEIGAMHLYYGCRHPDHDYIYKDELAKFQEDEVLTHLVCAFSR------AQEHK--------IYVQDRLWETRDRIWD-AINVGAHVYICGDARNMARDVQATLQKIFREIGGKSET--EAVAYFKDMEKTKRYQADVW 661          

HSP 2 Score: 66.2402 bits (160), Expect = 6.544e-11
Identity = 41/138 (29.71%), Postives = 71/138 (51.45%), Query Frame = 2
Query:   65 KMTCILYGSQTGQAKSIAENLYAKLKDYIKHINIFELDDVEKSFEIHKL----NFAIIIC-STTGDGDAPDNASKFLRLIKIYQPKYLSNFKYTVLGLGDTNYSNFCNCSKTIDQILESKGARRFYRSDMADDAVGLE 463
            +   I+YGSQTG A+ ++  L   L  Y K   + + +D+E   ++++L    +  +++C +T G+GD  DNA   +  +       LS  ++ V GLG+  Y +F      +D+ LE  GA+R +   + DD   LE
Sbjct:   71 RQVLIMYGSQTGTAEEMSGRLAKDLTRYTKKAVVVDPEDIECE-DLNRLSEVEDALLVLCIATYGEGDPTDNAVTLVEYLNAGDCD-LSGVRFAVFGLGNKTYEHFNEIGIQMDKQLEKLGAKRIFHLGLGDDDANLE 206          
BLAST of methionine synthase reductase vs. Ensembl Celegans
Match: emb-8 (NADPH--cytochrome P450 reductase [Source:UniProtKB/TrEMBL;Acc:Q09590])

HSP 1 Score: 142.895 bits (359), Expect = 3.343e-35
Identity = 115/430 (26.74%), Postives = 190/430 (44.19%), Query Frame = 2
Query:  800 KITNKYAIKSVHRATINVPNAKWKWKPGDSVGILPFNAESEVDSILSRLSVPETEKNCVVXXXXXXXXXXXXAKVPEHLI----VRENGK--------MSLKSILLWLCDLRQPLSKVGLRIMSEYCPMKSAEQRRL--LELCSREGQSFYTKCLRETSMPVLDLLNWFPSCQIPIVRLLEVLPRLKPRAYSLCDLESVSFAFSKVDIAPIQT---FRKRPLTGVCTSWMEKMAKFHNEQIWKIPIYLRKNMNGFTVCENPSIPHILIGPGTGVAPFIGFLQYFEKLKNENQNIGPIWLFFGCRNEERDFIFKKQLEHFANSGILTHLCVCFSRDNPTNSGDEQKNFCQPPNCKYVQHCLLHHSKILSDLLVNQNARVFVCGDSSGMSKDVLETWSNVLLGNHEKIQTKRDADSFITGMRVQKLYLEDVW 2038
            ++  +++ +S      +V  ++ +++ GD + + P N    VD +++ L                          P+H      V E+           + ++ L    D+  P+    L+ +SEYC     E+  L  L   + EG   Y + + +    ++D+L    +C+ PI  LLE+LPRL+ R YS+    S      K+ I  + T      R + GVCT ++        +   K P+++RK+     +    +   I+IGPGTG APF GFLQ  +  KN  + IG + L++GCR+ + D+I+K +L  F    +LTHL   FSR        E K         YVQ  L      + D  +N  A V++CGD+  M++DV  T   +      K +T  +A ++   M   K Y  DVW
Sbjct:  282 ELHTEHSDRSCRHIEFSVEGSRIRYEAGDHLAVFPTNDPVLVDRLINMLQFD-----------------------PDHAFRLVNVDEDASKRHPFPCPTTFRTALSHYVDICAPVKSHVLKAISEYC-TDDTEKEFLNKLSTANEEGLKEYARYIVKERRSIVDVLTDQKTCKPPIEYLLELLPRLQARYYSIA--SSPRLNEEKIAICAVVTKYSIGDRDINGVCTRYLTT-----KDAGSKSPVFVRKST--MRLPHRTTTQVIMIGPGTGFAPFRGFLQDRQFHKNAGKEIGAMHLYYGCRHPDHDYIYKDELAKFQEDEVLTHLVCAFSR------AQEHK--------IYVQDRLWETRDRIWD-AINVGAHVYICGDARNMARDVQATLQKIFREIGGKSET--EAVAYFKDMEKTKRYQADVW 661          

HSP 2 Score: 66.2402 bits (160), Expect = 6.544e-11
Identity = 41/138 (29.71%), Postives = 71/138 (51.45%), Query Frame = 2
Query:   65 KMTCILYGSQTGQAKSIAENLYAKLKDYIKHINIFELDDVEKSFEIHKL----NFAIIIC-STTGDGDAPDNASKFLRLIKIYQPKYLSNFKYTVLGLGDTNYSNFCNCSKTIDQILESKGARRFYRSDMADDAVGLE 463
            +   I+YGSQTG A+ ++  L   L  Y K   + + +D+E   ++++L    +  +++C +T G+GD  DNA   +  +       LS  ++ V GLG+  Y +F      +D+ LE  GA+R +   + DD   LE
Sbjct:   71 RQVLIMYGSQTGTAEEMSGRLAKDLTRYTKKAVVVDPEDIECE-DLNRLSEVEDALLVLCIATYGEGDPTDNAVTLVEYLNAGDCD-LSGVRFAVFGLGNKTYEHFNEIGIQMDKQLEKLGAKRIFHLGLGDDDANLE 206          
BLAST of methionine synthase reductase vs. Ensembl Celegans
Match: fre-1 (NADPH-dependent diflavin oxidoreductase 1 [Source:UniProtKB/TrEMBL;Acc:M1ZMI3])

HSP 1 Score: 129.798 bits (325), Expect = 3.709e-31
Identity = 158/629 (25.12%), Postives = 260/629 (41.34%), Query Frame = 2
Query:   74 CILYGSQTGQAKSIAENLYAKLKDYIKHINIFELDDVEKSFEIHKLNFAIIICSTTGDGDAPDNASKFLRLI--KIYQPKYLSNFKYTVLGLGDTNYSNFCNCSKTIDQILESKGARRFYRSDMADDA--VGLEIVVEPWLDGLYEIAKDMCSEIPIDGFQNLSXXXXXXXXXXXXXXNYKELLGDHLAKDMDGKNLTVPAL--PSPFLNIIYNNEDSISNFHEPLITSMPMPSSDSELVMGEVQDITKITNKYAIKSVHRATINVPNAKWKWKPGDSVGILPFNAESEVDSILSRLSVPETEKNCVVXXXXXXXXXXXXAKVPEHLIVRENGKMSLKSILLWLCDLRQPLSKVGLRIMSEYCPMKSAEQRRLLELCSREGQSFY----TKCLRETSMPVLDLLNWFPSCQIPIVRLLEVLPRLKPRAYSLCDLES---VSFAFSKVDIAPIQTFRKRPLTGVCTSWMEKMAKFHNEQIWKIPIYLRKNMNGFTVCENPSIPHILIGPGTGVAPFIGFLQYFEKLKNENQNIGPIWLFFGCRNEERDFIFKKQLEHFANSGILTHLCVCFSRDNPTNSGDEQKNFCQPPNCKYVQHCLLHHSKILSDLLVNQNARVFVCGDSSGMSKDV 1921
             ILYGS+TG A+ IAE+L  + +       + ELD+ + S ++      + + STTG G+ P N  K  +L+  K     +L N    VLGLGD++Y  +    K + + L   GA+      +ADD   +G++    PW    ++  K++   + I  ++ ++     S         + EL G+    D D      P +  P  F   +  N    S  H            D+ LV  E+ D  +                   +K  ++PGD + + P+N E  V   +  L + E +   + +   +   +      P  L+   + K +L + L    DL+Q + K     M  Y      E+ RL EL S EG   Y     +  R T+  + D +    S  +    L E+L  ++PRA+S+    S   +    +KV+       ++R   G+C++++ ++ K  +E   KI         G     +P  P I IGPGTGVAPF     +          I    LFFGCR+E  D+ F  +    +   ++      FSRD      D +K         YVQH +  ++  +  +L +  A+VF+ G S  M K V
Sbjct:    4 AILYGSETGTAQDIAESLRREAQQRHLQARVHELDEYDVS-QLPMEKVVLFVVSTTGQGEMPPNMRKTWKLLLRKSLGADFLKNVNIGVLGLGDSSYQKYNFAGKKLYRRLVQLGAKMMCGVHLADDQHEIGIDGAFIPWKTECWKKIKEIAENLSI--YREMTAEIDTSVQITTKY-RFLELGGESGNDDDDSDEDLEPQIEIPDYFPLKVLKNRRLTSAEH----------FQDTRLVDFEISDRNR-------------------SKMGFQPGDVLMVRPYNPEETVKIAIEALGLTEEQ---LKKPLKIVKNDRFSKNPPNFLVGNFSAKTTLLTCLQRYFDLQQ-VPKRSFFEMLGYYSTNPPEKERLQELASPEGLDDYLDYANRSRRTTAEALRDFVA--TSKNLKPDYLFEILTTIRPRAFSIASAPSPFHLELLVAKVEYKSRMADKRR---GLCSTFISRL-KPGDEVFCKI-------RPGTFKFPSPEAPVICIGPGTGVAPFRSLFGHRSLFSAHFPGI----LFFGCRSEHHDYYFSDEWPELSGVAVIP----AFSRDT-----DGRK--------VYVQHKMGENAGKIKRML-DLGAQVFIAGSSGDMPKAV 560          
BLAST of methionine synthase reductase vs. Ensembl Fly
Match: Cpr (gene:FBgn0015623 transcript:FBtr0331224)

HSP 1 Score: 182.57 bits (462), Expect = 2.000e-48
Identity = 163/664 (24.55%), Postives = 288/664 (43.37%), Query Frame = 2
Query:   77 ILYGSQTGQAKSIA-----ENLYAKLKDYIKHINIFELDDVEKSFEIHKLNFAIIICSTTGDGDAPDNASKFLRLIKIYQPKYLSNFKYTVLGLGDTNYSNFCNCSKTIDQILESKGARRFYRSDMADDAVGLEIVVEPWLDGLYEIAKDMCSEIPIDGFQNLSXXXXXXXXXXXXXXNYKELLGDHLAKDMDGKNLTVPALPSPFLNIIYNNEDSISNFHEPLITSMPMPSSDSELVMGEVQDITKITNKYAIKSVHRATINVPNAKWKWKPGDSVGILPFNAESEVDSILSRLSVPETEKNCVVXXXXXXXXXXXXAKVPEHLIVRENGKMSLKSILLWLCDLRQPLSKVGLRIMSEYCP-MKSAEQRRLLELCSREGQSFYTKCLRETSMPVLDLLNWFPSCQIPIVRLLEVLPRLKPRAYSLCDLESVSFAFSKVDIAPIQTFRKRPL----TGVCTSWMEKMAKFHNEQIWKIPIYLRKNMNGFTVCENPSIPHILIGPGTGVAPFIGFLQYFEKLKNENQNIGPIWLFFGCRNEERDFIFKKQLEHFANSGILTHLCVCFSRDNPTNSGDEQKNFCQPPNCKYVQHCLLHHSKILSDLLVNQNARVFVCGDSSGMSKDVLETWSNVLLGNHEKIQTKRDADSFITGMRVQKLYLEDVW 2038
            + YGSQTG  +  A     E +  +LK  +      +++++ +  +I   + A+   +T G+GD  DNA +F   I       LS   Y V GLG+  Y ++   +  +D+ LE  GA R +   + DD   +E     W D  +     +C    I+G             E   I  Y+ L    +  D                  IY  E  I+  H   I +   P       +  ++ + +  +K   +S     +++  +K ++  GD V + P N +S V+  L +L   + +    +     ++ +      P          + + +I         P + + L+ ++EYC   K  E  R +   S EG+  Y   +++    ++ +L    SC+ PI  + E+LPRL+PR YS+    S     + V +  +    K P      GV T++++      +E++ K+P+++RK+   F +   P  P I++GPGTG+APF GF+Q  + L++E + +G   L+FGCR    D+I++ +LE +   G L +L   FSRD                   YVQH L   + ++ +++       ++CGD+  M+ DV      +L  + +   ++ DA  +I  M  QK Y  DVW
Sbjct:   86 VFYGSQTGTGEEFAGRLAKEGIRYRLKGMVADPEECDMEELLQLKDIDN-SLAVFCLATYGEGDPTDNAMEFYEWITSGDVD-LSGLNYAVFGLGNKTYEHYNKVAIYVDKRLEELGANRVFELGLGDDDANIEDDFITWKDRFWPA---VCDHFGIEG-----------GGEEVLIRQYRLLEQPDVQPDR-----------------IYTGE--IARLHS--IQNQRPPFDAKNPFLAPIK-VNRELHKGGGRSCMHIELSIEGSKMRYDAGDHVAMFPVNDKSLVEK-LGQLCNADLDTVFSLINTDTDSSKKHPFPCPTTYRTALTHYLEITAI---------PRTHI-LKELAEYCTDEKEKELLRSMASISPEGKEKYQSWIQDACRNIVHILEDIKSCRPPIDHVCELLPRLQPRYYSISS--SAKLHPTDVHVTAVLVEYKTPTGRINKGVATTYLKNKQPQGSEEV-KVPVFIRKSQ--FRLPTKPETPIIMVGPGTGLAPFRGFIQERQFLRDEGKTVGESILYFGCRKRSEDYIYESELEEWVKKGTL-NLKAAFSRDQGKKV--------------YVQHLLEQDADLIWNVIGENKGHFYICGDAKNMAVDVRNILVKIL--STKGNMSEADAVQYIKKMEAQKRYSADVW 678          
BLAST of methionine synthase reductase vs. Ensembl Fly
Match: Cpr (gene:FBgn0015623 transcript:FBtr0331223)

HSP 1 Score: 182.57 bits (462), Expect = 2.000e-48
Identity = 163/664 (24.55%), Postives = 288/664 (43.37%), Query Frame = 2
Query:   77 ILYGSQTGQAKSIA-----ENLYAKLKDYIKHINIFELDDVEKSFEIHKLNFAIIICSTTGDGDAPDNASKFLRLIKIYQPKYLSNFKYTVLGLGDTNYSNFCNCSKTIDQILESKGARRFYRSDMADDAVGLEIVVEPWLDGLYEIAKDMCSEIPIDGFQNLSXXXXXXXXXXXXXXNYKELLGDHLAKDMDGKNLTVPALPSPFLNIIYNNEDSISNFHEPLITSMPMPSSDSELVMGEVQDITKITNKYAIKSVHRATINVPNAKWKWKPGDSVGILPFNAESEVDSILSRLSVPETEKNCVVXXXXXXXXXXXXAKVPEHLIVRENGKMSLKSILLWLCDLRQPLSKVGLRIMSEYCP-MKSAEQRRLLELCSREGQSFYTKCLRETSMPVLDLLNWFPSCQIPIVRLLEVLPRLKPRAYSLCDLESVSFAFSKVDIAPIQTFRKRPL----TGVCTSWMEKMAKFHNEQIWKIPIYLRKNMNGFTVCENPSIPHILIGPGTGVAPFIGFLQYFEKLKNENQNIGPIWLFFGCRNEERDFIFKKQLEHFANSGILTHLCVCFSRDNPTNSGDEQKNFCQPPNCKYVQHCLLHHSKILSDLLVNQNARVFVCGDSSGMSKDVLETWSNVLLGNHEKIQTKRDADSFITGMRVQKLYLEDVW 2038
            + YGSQTG  +  A     E +  +LK  +      +++++ +  +I   + A+   +T G+GD  DNA +F   I       LS   Y V GLG+  Y ++   +  +D+ LE  GA R +   + DD   +E     W D  +     +C    I+G             E   I  Y+ L    +  D                  IY  E  I+  H   I +   P       +  ++ + +  +K   +S     +++  +K ++  GD V + P N +S V+  L +L   + +    +     ++ +      P          + + +I         P + + L+ ++EYC   K  E  R +   S EG+  Y   +++    ++ +L    SC+ PI  + E+LPRL+PR YS+    S     + V +  +    K P      GV T++++      +E++ K+P+++RK+   F +   P  P I++GPGTG+APF GF+Q  + L++E + +G   L+FGCR    D+I++ +LE +   G L +L   FSRD                   YVQH L   + ++ +++       ++CGD+  M+ DV      +L  + +   ++ DA  +I  M  QK Y  DVW
Sbjct:   86 VFYGSQTGTGEEFAGRLAKEGIRYRLKGMVADPEECDMEELLQLKDIDN-SLAVFCLATYGEGDPTDNAMEFYEWITSGDVD-LSGLNYAVFGLGNKTYEHYNKVAIYVDKRLEELGANRVFELGLGDDDANIEDDFITWKDRFWPA---VCDHFGIEG-----------GGEEVLIRQYRLLEQPDVQPDR-----------------IYTGE--IARLHS--IQNQRPPFDAKNPFLAPIK-VNRELHKGGGRSCMHIELSIEGSKMRYDAGDHVAMFPVNDKSLVEK-LGQLCNADLDTVFSLINTDTDSSKKHPFPCPTTYRTALTHYLEITAI---------PRTHI-LKELAEYCTDEKEKELLRSMASISPEGKEKYQSWIQDACRNIVHILEDIKSCRPPIDHVCELLPRLQPRYYSISS--SAKLHPTDVHVTAVLVEYKTPTGRINKGVATTYLKNKQPQGSEEV-KVPVFIRKSQ--FRLPTKPETPIIMVGPGTGLAPFRGFIQERQFLRDEGKTVGESILYFGCRKRSEDYIYESELEEWVKKGTL-NLKAAFSRDQGKKV--------------YVQHLLEQDADLIWNVIGENKGHFYICGDAKNMAVDVRNILVKIL--STKGNMSEADAVQYIKKMEAQKRYSADVW 678          
BLAST of methionine synthase reductase vs. Ensembl Fly
Match: Cpr (gene:FBgn0015623 transcript:FBtr0079250)

HSP 1 Score: 182.57 bits (462), Expect = 2.000e-48
Identity = 163/664 (24.55%), Postives = 288/664 (43.37%), Query Frame = 2
Query:   77 ILYGSQTGQAKSIA-----ENLYAKLKDYIKHINIFELDDVEKSFEIHKLNFAIIICSTTGDGDAPDNASKFLRLIKIYQPKYLSNFKYTVLGLGDTNYSNFCNCSKTIDQILESKGARRFYRSDMADDAVGLEIVVEPWLDGLYEIAKDMCSEIPIDGFQNLSXXXXXXXXXXXXXXNYKELLGDHLAKDMDGKNLTVPALPSPFLNIIYNNEDSISNFHEPLITSMPMPSSDSELVMGEVQDITKITNKYAIKSVHRATINVPNAKWKWKPGDSVGILPFNAESEVDSILSRLSVPETEKNCVVXXXXXXXXXXXXAKVPEHLIVRENGKMSLKSILLWLCDLRQPLSKVGLRIMSEYCP-MKSAEQRRLLELCSREGQSFYTKCLRETSMPVLDLLNWFPSCQIPIVRLLEVLPRLKPRAYSLCDLESVSFAFSKVDIAPIQTFRKRPL----TGVCTSWMEKMAKFHNEQIWKIPIYLRKNMNGFTVCENPSIPHILIGPGTGVAPFIGFLQYFEKLKNENQNIGPIWLFFGCRNEERDFIFKKQLEHFANSGILTHLCVCFSRDNPTNSGDEQKNFCQPPNCKYVQHCLLHHSKILSDLLVNQNARVFVCGDSSGMSKDVLETWSNVLLGNHEKIQTKRDADSFITGMRVQKLYLEDVW 2038
            + YGSQTG  +  A     E +  +LK  +      +++++ +  +I   + A+   +T G+GD  DNA +F   I       LS   Y V GLG+  Y ++   +  +D+ LE  GA R +   + DD   +E     W D  +     +C    I+G             E   I  Y+ L    +  D                  IY  E  I+  H   I +   P       +  ++ + +  +K   +S     +++  +K ++  GD V + P N +S V+  L +L   + +    +     ++ +      P          + + +I         P + + L+ ++EYC   K  E  R +   S EG+  Y   +++    ++ +L    SC+ PI  + E+LPRL+PR YS+    S     + V +  +    K P      GV T++++      +E++ K+P+++RK+   F +   P  P I++GPGTG+APF GF+Q  + L++E + +G   L+FGCR    D+I++ +LE +   G L +L   FSRD                   YVQH L   + ++ +++       ++CGD+  M+ DV      +L  + +   ++ DA  +I  M  QK Y  DVW
Sbjct:   86 VFYGSQTGTGEEFAGRLAKEGIRYRLKGMVADPEECDMEELLQLKDIDN-SLAVFCLATYGEGDPTDNAMEFYEWITSGDVD-LSGLNYAVFGLGNKTYEHYNKVAIYVDKRLEELGANRVFELGLGDDDANIEDDFITWKDRFWPA---VCDHFGIEG-----------GGEEVLIRQYRLLEQPDVQPDR-----------------IYTGE--IARLHS--IQNQRPPFDAKNPFLAPIK-VNRELHKGGGRSCMHIELSIEGSKMRYDAGDHVAMFPVNDKSLVEK-LGQLCNADLDTVFSLINTDTDSSKKHPFPCPTTYRTALTHYLEITAI---------PRTHI-LKELAEYCTDEKEKELLRSMASISPEGKEKYQSWIQDACRNIVHILEDIKSCRPPIDHVCELLPRLQPRYYSISS--SAKLHPTDVHVTAVLVEYKTPTGRINKGVATTYLKNKQPQGSEEV-KVPVFIRKSQ--FRLPTKPETPIIMVGPGTGLAPFRGFIQERQFLRDEGKTVGESILYFGCRKRSEDYIYESELEEWVKKGTL-NLKAAFSRDQGKKV--------------YVQHLLEQDADLIWNVIGENKGHFYICGDAKNMAVDVRNILVKIL--STKGNMSEADAVQYIKKMEAQKRYSADVW 678          
BLAST of methionine synthase reductase vs. Ensembl Fly
Match: CG13667 (gene:FBgn0035890 transcript:FBtr0076611)

HSP 1 Score: 152.14 bits (383), Expect = 1.504e-38
Identity = 156/665 (23.46%), Postives = 285/665 (42.86%), Query Frame = 2
Query:   77 ILYGSQTGQAKSIAENLYAKLKDYIKHINIFELDDVEKSFEIHKLNFAIIICSTTGDGDAPDN---ASKFLRLIKIYQPKYLSNFKYTVLGLGDTNYSNFCNCSKTIDQILESKGARRFYRSDMADDA--VGLEIVVEPWLDGLYEIAKDMCSEIPIDGFQNLSXXXXXXXXXXXXXXNYKELLGDHLAKDMDGKNLTVPALPSPFLNIIYNNEDSISNFHEPLITSMPMPSSDSELVMGEVQDITKITNKYAIKSVHRATINVPNAKWKWKPGDSVGILPFNAESEVDSILSRLSVPETEKNCVVXXXXXXXXXXXXAKVPEHLIVRENGKMSLKSILLWLCDLRQPLSKVGLRIMSEYCPMKSAEQRRLLELCSREGQSFYTKCLRETSMPVLDLLNWF--PSCQIPIVRLLEVLPRLKPRAYSLC-DLESVSFAFSKVDIAPIQTFRKRPLTGVCTSWMEKMAKFHNEQIWKIPIYLRKNMNGFTVC--ENPSIPHILIGPGTGVAPFIGFLQYFEKLKNENQNIGPIWLFFGCRNEERDFIFKKQLEHFANSG-ILTHLCVCFSRDNPTNSGDEQKNFCQPPNCKYVQHCLLHHSKILSDLLVNQNARVFVCGDSSGMSKDVLETWSNVLLGNHEKIQTKRDADSFITGMRVQKLYLEDVW 2038
            +LYGSQTG A+ +AE ++ +         +   D+ + +  I +    + + +TTGDG  PDN   A +FL L +    + L   ++  LGLGD++Y  F   +K + + L++ GA       + DD    G   V   W   L+   K         G   L  ++  +  +     + KEL  D     MD              N++++ + +  +F                    ++ D  + T     + V    +        W+PGD + + P N++  V +    +     E +       +  + +    +P  L +  +  +SL     ++ DL     +  L ++++ C     E+ +LLE  S EG       +      +L++L  F   +  + + +L E++P ++PR++S+  D+ ++S     V +   +T    P  G+C++W++ +         K    L   +   T+   ++ SIP I++GPGTG+APF   +Q     +++   IGP+ +FFGCRN+  DF F      + ++  +  H    FSRD       +QK         YVQH +  +   L+ L+ + NA ++V G+S+ M K V E +  +L G         DAD ++  M  Q+ Y E+ W
Sbjct:    5 VLYGSQTGTAQDVAEQIWRESHQLGFQGPVLPFDEYDMTKLIEE-RLVVFVVATTGDGVEPDNMKLAWRFL-LKRSLPAQSLQGMQFACLGLGDSSYPKFNYAAKKLSKRLQNLGANSVCPVGLCDDQHDYGHLGVSLSWTKDLWTALK---------GISGLDESKLSNSHQTTVKWSVKELPKDSQIAPMD--------------NLLWSQKQTAHSF--------------------KILDNQRTTAVDHFQDVRFLRLQCQTEDLSWEPGDVLDVQPQNSDEAVQTFFDLIR----EHSLNFDESTIVEVSSAHQDMP--LPIAYSNPLSLLQAAKFVWDLSAKPRQRFLEVLAQNC-CDEMEKEKLLEFSSAEGIDDLVAYVNRPRRNLLEVLEDFRHATSSLTLQQLFEMMPLIQPRSFSIASDVSALSLDL-LVAVVEYKTIMHTPRLGLCSNWLKTL---------KSGTELSGVVKRGTMVWPKDLSIPLIMVGPGTGIAPFRSIIQNRLYAQSKGATIGPLVVFFGCRNKAADFHFGNDFSTWTDAKQVEAH--TAFSRDQ------DQK--------VYVQHLIAKNGAHLARLIKDLNAYIYVAGNSNNMPKSVKEAFIEILDG---------DAD-YVELMIKQRRYQEETW 581          
BLAST of methionine synthase reductase vs. Ensembl Fly
Match: CG13667 (gene:FBgn0035890 transcript:FBtr0076610)

HSP 1 Score: 152.14 bits (383), Expect = 1.504e-38
Identity = 156/665 (23.46%), Postives = 285/665 (42.86%), Query Frame = 2
Query:   77 ILYGSQTGQAKSIAENLYAKLKDYIKHINIFELDDVEKSFEIHKLNFAIIICSTTGDGDAPDN---ASKFLRLIKIYQPKYLSNFKYTVLGLGDTNYSNFCNCSKTIDQILESKGARRFYRSDMADDA--VGLEIVVEPWLDGLYEIAKDMCSEIPIDGFQNLSXXXXXXXXXXXXXXNYKELLGDHLAKDMDGKNLTVPALPSPFLNIIYNNEDSISNFHEPLITSMPMPSSDSELVMGEVQDITKITNKYAIKSVHRATINVPNAKWKWKPGDSVGILPFNAESEVDSILSRLSVPETEKNCVVXXXXXXXXXXXXAKVPEHLIVRENGKMSLKSILLWLCDLRQPLSKVGLRIMSEYCPMKSAEQRRLLELCSREGQSFYTKCLRETSMPVLDLLNWF--PSCQIPIVRLLEVLPRLKPRAYSLC-DLESVSFAFSKVDIAPIQTFRKRPLTGVCTSWMEKMAKFHNEQIWKIPIYLRKNMNGFTVC--ENPSIPHILIGPGTGVAPFIGFLQYFEKLKNENQNIGPIWLFFGCRNEERDFIFKKQLEHFANSG-ILTHLCVCFSRDNPTNSGDEQKNFCQPPNCKYVQHCLLHHSKILSDLLVNQNARVFVCGDSSGMSKDVLETWSNVLLGNHEKIQTKRDADSFITGMRVQKLYLEDVW 2038
            +LYGSQTG A+ +AE ++ +         +   D+ + +  I +    + + +TTGDG  PDN   A +FL L +    + L   ++  LGLGD++Y  F   +K + + L++ GA       + DD    G   V   W   L+   K         G   L  ++  +  +     + KEL  D     MD              N++++ + +  +F                    ++ D  + T     + V    +        W+PGD + + P N++  V +    +     E +       +  + +    +P  L +  +  +SL     ++ DL     +  L ++++ C     E+ +LLE  S EG       +      +L++L  F   +  + + +L E++P ++PR++S+  D+ ++S     V +   +T    P  G+C++W++ +         K    L   +   T+   ++ SIP I++GPGTG+APF   +Q     +++   IGP+ +FFGCRN+  DF F      + ++  +  H    FSRD       +QK         YVQH +  +   L+ L+ + NA ++V G+S+ M K V E +  +L G         DAD ++  M  Q+ Y E+ W
Sbjct:    5 VLYGSQTGTAQDVAEQIWRESHQLGFQGPVLPFDEYDMTKLIEE-RLVVFVVATTGDGVEPDNMKLAWRFL-LKRSLPAQSLQGMQFACLGLGDSSYPKFNYAAKKLSKRLQNLGANSVCPVGLCDDQHDYGHLGVSLSWTKDLWTALK---------GISGLDESKLSNSHQTTVKWSVKELPKDSQIAPMD--------------NLLWSQKQTAHSF--------------------KILDNQRTTAVDHFQDVRFLRLQCQTEDLSWEPGDVLDVQPQNSDEAVQTFFDLIR----EHSLNFDESTIVEVSSAHQDMP--LPIAYSNPLSLLQAAKFVWDLSAKPRQRFLEVLAQNC-CDEMEKEKLLEFSSAEGIDDLVAYVNRPRRNLLEVLEDFRHATSSLTLQQLFEMMPLIQPRSFSIASDVSALSLDL-LVAVVEYKTIMHTPRLGLCSNWLKTL---------KSGTELSGVVKRGTMVWPKDLSIPLIMVGPGTGIAPFRSIIQNRLYAQSKGATIGPLVVFFGCRNKAADFHFGNDFSTWTDAKQVEAH--TAFSRDQ------DQK--------VYVQHLIAKNGAHLARLIKDLNAYIYVAGNSNNMPKSVKEAFIEILDG---------DAD-YVELMIKQRRYQEETW 581          
BLAST of methionine synthase reductase vs. Ensembl Zebrafish
Match: mtrr (5-methyltetrahydrofolate-homocysteine methyltransferase reductase [Source:ZFIN;Acc:ZDB-GENE-101115-3])

HSP 1 Score: 370.933 bits (951), Expect = 1.153e-117
Identity = 248/723 (34.30%), Postives = 387/723 (53.53%), Query Frame = 2
Query:   53 CDFLKMTCILYGSQTGQAKSIAENLYAKLKDYIKHINIFELDDVEKSFEIHKLNFAIIICSTTGDGDAPDNASKFLRLIK--IYQPKYLSNFKYTVLGLGDTNYSNFCNCSKTIDQILESKGARRFYRSDMADDAVGLEIVVEPWLDGLYEIAKDMCSEIPI-------------------DGFQNLSXXXXXXXXXXXXXXNYKELLGDHLAKDMDGKN----------------LTVPALPSPFLNIIYNNEDSISNFHEPLITSMPMPSSDSELVMGEVQDITKITNKYAIKSVHRATINVPNAKWK-WKPGDSVGILPFNAESEVDSILSRLSVPETEKNCVVXXXXXXXXXXXXAKVPEHLIVRENGKMSLKSILLWLCDLRQPLSKVGLRIMSEYCPMKSAEQRRLLELCSREGQSFYTKCLRETSMPVLDLLNWFPSCQIPIVRLLEVLPRLKPRAYSLCDLE-----SVSFAFSKVDIA--PIQTFRKRPLTGVCTSWM----EKMAKFHNEQIW----------KIPIYLRKNMNGFTVCENPSIPHILIGPGTGVAPFIGFLQYFEKLKNENQ--NIGPIWLFFGCRNEERDFIFKKQLEHFANSGILTHLCVCFSRDNPTNSGDEQKNFCQPPNCKYVQHCLLHHSKILSDLLVNQNARVFVCGDSSGMSKDVLETWSNVLLGNHEKIQTKRDADSFITGMRVQKLYLEDVW 2038
            C+      ILYGSQ GQA+SIAE +  +  ++    +I  L   +K     +    + + STTGDGD PD A KF+R IK       +LS+ +Y +LGLGDTNY+NFCN  KTID  L+  GA+ FY +  ADD  GLE+VV+PW++GL++  K   S +                     D  +NL +  ++ K+        K +  D +A ++   +                L VPALP  +L I+    +++            +P  D    +  +    ++T   A+K+     +++   + + ++PGD+  IL  N +SEV+ +L +L + + +KNC V++ LL+N   + AKVP H  + +NG  SL+ IL W  ++R    K  LR + ++    ++E+RRLLELCS++G + Y   +R++S+ VLDLL  FPSC  P+  L E LP+L+PRAYS           V   F+ V+    P    RK    G+CT W+      + + H   +           K+ +  R + + F +  +P +P +++GPGTGVAPFIGFLQ  EK +  NQ    G +WLFFGCR++++DF+F+++LE F ++G L+HL VCFSRD P    D  +   +P    YVQH L+ H+K L+ +L+     ++VCGD+  M+KDV +T   + +GN  ++  K DA   + G+R  K YL+D+W
Sbjct:    3 CEAAAHFLILYGSQRGQAQSIAEEICQQAAEHGFTADISCLSKHDKYNLDSESRPVVFVVSTTGDGDPPDTALKFVRKIKNKSLPHDHLSHLRYALLGLGDTNYANFCNGGKTIDSYLQKLGAKHFYATGHADDGTGLEVVVDPWIEGLWDALKKAFSTMSTSDQQTLSDCTQDSNHQNASDQKKNLEVDLQLLKLSEVDSPKGKTVTSDSIATEIGSTSSVASLKESVPPLSESVLNVPALPPSYLEILLVGTENVEE--------TVLPDKDGYFEV-PISKAVQLTQDDAVKTAILLELDISQQQEQVYQPGDAFDILCPNRDSEVEELLLKLDL-QMQKNCTVQVNLLKNTSKKAAKVPLH--IPQNG--SLQFILTWCLEIRSTPKKAFLRALVDFT-QNASEKRRLLELCSKQGSADYNSFVRDSSVCVLDLLRAFPSCCPPLSLLFEHLPKLQPRAYSAASSSLQHPGKVHLVFNVVEFPARPEHPARK----GLCTGWLVDHVSSILEPHGTALASERPGTSALPKVHVRARPS-STFHLPSDPCVPVVMVGPGTGVAPFIGFLQQREKEREANQEATFGEMWLFFGCRHKDKDFLFREELEKFVHNGTLSHLIVCFSRDEP----DAAETVNRP---TYVQHNLILHAKNLAKILLEDKGCLYVCGDAKNMAKDVNDTLLEI-IGNELQLD-KLDAMKIVAGLREDKRYLQDIW 696          
BLAST of methionine synthase reductase vs. Ensembl Zebrafish
Match: mtrr (5-methyltetrahydrofolate-homocysteine methyltransferase reductase [Source:ZFIN;Acc:ZDB-GENE-101115-3])

HSP 1 Score: 371.318 bits (952), Expect = 1.429e-117
Identity = 249/731 (34.06%), Postives = 390/731 (53.35%), Query Frame = 2
Query:   29 FVYIMHLLCDFLKMTCILYGSQTGQAKSIAENLYAKLKDYIKHINIFELDDVEKSFEIHKLNFAIIICSTTGDGDAPDNASKFLRLIK--IYQPKYLSNFKYTVLGLGDTNYSNFCNCSKTIDQILESKGARRFYRSDMADDAVGLEIVVEPWLDGLYEIAKDMCSEIPI-------------------DGFQNLSXXXXXXXXXXXXXXNYKELLGDHLAKDMDGKN----------------LTVPALPSPFLNIIYNNEDSISNFHEPLITSMPMPSSDSELVMGEVQDITKITNKYAIKSVHRATINVPNAKWK-WKPGDSVGILPFNAESEVDSILSRLSVPETEKNCVVXXXXXXXXXXXXAKVPEHLIVRENGKMSLKSILLWLCDLRQPLSKVGLRIMSEYCPMKSAEQRRLLELCSREGQSFYTKCLRETSMPVLDLLNWFPSCQIPIVRLLEVLPRLKPRAYSLCDLE-----SVSFAFSKVDIA--PIQTFRKRPLTGVCTSWM----EKMAKFHNEQIW----------KIPIYLRKNMNGFTVCENPSIPHILIGPGTGVAPFIGFLQYFEKLKNENQ--NIGPIWLFFGCRNEERDFIFKKQLEHFANSGILTHLCVCFSRDNPTNSGDEQKNFCQPPNCKYVQHCLLHHSKILSDLLVNQNARVFVCGDSSGMSKDVLETWSNVLLGNHEKIQTKRDADSFITGMRVQKLYLEDVW 2038
            F    ++ C+      ILYGSQ GQA+SIAE +  +  ++    +I  L   +K     +    + + STTGDGD PD A KF+R IK       +LS+ +Y +LGLGDTNY+NFCN  KTID  L+  GA+ FY +  ADD  GLE+VV+PW++GL++  K   S +                     D  +NL +  ++ K+        K +  D +A ++   +                L VPALP  +L I+    +++            +P  D    +  +    ++T   A+K+     +++   + + ++PGD+  IL  N +SEV+ +L +L + + +KNC V++ LL+N   + AKVP H  + +NG  SL+ IL W  ++R    K  LR + ++    ++E+RRLLELCS++G + Y   +R++S+ VLDLL  FPSC  P+  L E LP+L+PRAYS           V   F+ V+    P    RK    G+CT W+      + + H   +           K+ +  R + + F +  +P +P +++GPGTGVAPFIGFLQ  EK +  NQ    G +WLFFGCR++++DF+F+++LE F ++G L+HL VCFSRD P    D  +   +P    YVQH L+ H+K L+ +L+     ++VCGD+  M+KDV +T   + +GN  ++  K DA   + G+R  K YL+D+W
Sbjct:    9 FSSFYNMPCEAAAHFLILYGSQRGQAQSIAEEICQQAAEHGFTADISCLSKHDKYNLDSESRPVVFVVSTTGDGDPPDTALKFVRKIKNKSLPHDHLSHLRYALLGLGDTNYANFCNGGKTIDSYLQKLGAKHFYATGHADDGTGLEVVVDPWIEGLWDALKKAFSTMSTSDQQTLSDCTQDSNHQNASDQKKNLEVDLQLLKLSEVDSPKGKTVTSDSIATEIGSTSSVASLKESVPPLSESVLNVPALPPSYLEILLVGTENVEE--------TVLPDKDGYFEV-PISKAVQLTQDDAVKTAILLELDISQQQEQVYQPGDAFDILCPNRDSEVEELLLKLDL-QMQKNCTVQVNLLKNTSKKAAKVPLH--IPQNG--SLQFILTWCLEIRSTPKKAFLRALVDFT-QNASEKRRLLELCSKQGSADYNSFVRDSSVCVLDLLRAFPSCCPPLSLLFEHLPKLQPRAYSAASSSLQHPGKVHLVFNVVEFPARPEHPARK----GLCTGWLVDHVSSILEPHGTALASERPGTSALPKVHVRARPS-STFHLPSDPCVPVVMVGPGTGVAPFIGFLQQREKEREANQEATFGEMWLFFGCRHKDKDFLFREELEKFVHNGTLSHLIVCFSRDEP----DAAETVNRP---TYVQHNLILHAKNLAKILLEDKGCLYVCGDAKNMAKDVNDTLLEI-IGNELQLD-KLDAMKIVAGLREDKRYLQDIW 710          
BLAST of methionine synthase reductase vs. Ensembl Zebrafish
Match: mtrr (5-methyltetrahydrofolate-homocysteine methyltransferase reductase [Source:ZFIN;Acc:ZDB-GENE-101115-3])

HSP 1 Score: 359.762 bits (922), Expect = 1.989e-113
Identity = 242/715 (33.85%), Postives = 383/715 (53.57%), Query Frame = 2
Query:   77 ILYGSQTGQAKSIAENLYAKLKDYIKHINIFELDDVEKSFEIHKLNFAIIICSTTGDGDAPDNASKFLRLIK--IYQPKYLSNFKYTVLGLGDTNYSNFCNCSKTIDQILESKGARRFYRSDMADDAVGLEIVVEPWLDGLYEIAKDMCSEIPI-------------------DGFQNLSXXXXXXXXXXXXXXNYKELLGDHLAKDMDGKN----------------LTVPALPSPFLNIIYNNEDSISNFHEPLITSMPMPSSDSELVMGEVQDITKITNKYAIKSVHRATINVPNAKWK-WKPGDSVGILPFNAESEVDSILSRLSVPETEKNCVVXXXXXXXXXXXXAKVPEHLIVRENGKMSLKSILLWLCDLRQPLSKVGLRIMSEYCPMKSAEQRRLLELCSREGQSFYTKCLRETSMPVLDLLNWFPSCQIPIVRLLEVLPRLKPRAYSLCDLE-----SVSFAFSKVDIA--PIQTFRKRPLTGVCTSWM----EKMAKFHNEQIW----------KIPIYLRKNMNGFTVCENPSIPHILIGPGTGVAPFIGFLQYFEKLKNENQ--NIGPIWLFFGCRNEERDFIFKKQLEHFANSGILTHLCVCFSRDNPTNSGDEQKNFCQPPNCKYVQHCLLHHSKILSDLLVNQNARVFVCGDSSGMSKDVLETWSNVLLGNHEKIQTKRDADSFITGMRVQKLYLEDVW 2038
            ++  S+ GQA+SIAE +  +  ++    +I  L   +K     +    + + STTGDGD PD A KF+R IK       +LS+ +Y +LGLGDTNY+NFCN  KTID  L+  GA+ FY +  ADD  GLE+VV+PW++GL++  K   S +                     D  +NL +  ++ K+        K +  D +A ++   +                L VPALP  +L I+    +++            +P  D    +  +    ++T   A+K+     +++   + + ++PGD+  IL  N +SEV+ +L +L + + +KNC V++ LL+N   + AKVP H  + +NG  SL+ IL W  ++R    K  LR + ++    ++E+RRLLELCS++G + Y   +R++S+ VLDLL  FPSC  P+  L E LP+L+PRAYS           V   F+ V+    P    RK    G+CT W+      + + H   +           K+ +  R + + F +  +P +P +++GPGTGVAPFIGFLQ  EK +  NQ    G +WLFFGCR++++DF+F+++LE F ++G L+HL VCFSRD P    D  +   +P    YVQH L+ H+K L+ +L+     ++VCGD+  M+KDV +T   + +GN  ++  K DA   + G+R  K YL+D+W
Sbjct:    9 VICKSKRGQAQSIAEEICQQAAEHGFTADISCLSKHDKYNLDSESRPVVFVVSTTGDGDPPDTALKFVRKIKNKSLPHDHLSHLRYALLGLGDTNYANFCNGGKTIDSYLQKLGAKHFYATGHADDGTGLEVVVDPWIEGLWDALKKAFSTMSTSDQQTLSDCTQDSNHQNASDQKKNLEVDLQLLKLSEVDSPKGKTVTSDSIATEIGSTSSVASLKESVPPLSESVLNVPALPPSYLEILLVGTENVEE--------TVLPDKDGYFEV-PISKAVQLTQDDAVKTAILLELDISQQQEQVYQPGDAFDILCPNRDSEVEELLLKLDL-QMQKNCTVQVNLLKNTSKKAAKVPLH--IPQNG--SLQFILTWCLEIRSTPKKAFLRALVDFT-QNASEKRRLLELCSKQGSADYNSFVRDSSVCVLDLLRAFPSCCPPLSLLFEHLPKLQPRAYSAASSSLQHPGKVHLVFNVVEFPARPEHPARK----GLCTGWLVDHVSSILEPHGTALASERPGTSALPKVHVRARPS-STFHLPSDPCVPVVMVGPGTGVAPFIGFLQQREKEREANQEATFGEMWLFFGCRHKDKDFLFREELEKFVHNGTLSHLIVCFSRDEP----DAAETVNRP---TYVQHNLILHAKNLAKILLEDKGCLYVCGDAKNMAKDVNDTLLEI-IGNELQLD-KLDAMKIVAGLREDKRYLQDIW 694          
BLAST of methionine synthase reductase vs. Ensembl Zebrafish
Match: mtrr (5-methyltetrahydrofolate-homocysteine methyltransferase reductase [Source:ZFIN;Acc:ZDB-GENE-101115-3])

HSP 1 Score: 206.068 bits (523), Expect = 2.020e-58
Identity = 148/453 (32.67%), Postives = 235/453 (51.88%), Query Frame = 2
Query:   53 CDFLKMTCILYGSQTGQAKSIAENLYAKLKDYIKHINIFELDDVEKSFEIHKLNFAIIICSTTGDGDAPDNASKFLRLIK--IYQPKYLSNFKYTVLGLGDTNYSNFCNCSKTIDQILESKGARRFYRSDMADDAVGLEIVVEPWLDGLYEIAKDMCSEIPI-------------------DGFQNLSXXXXXXXXXXXXXXNYKELLGDHLAKDMDGKN----------------LTVPALPSPFLNIIYNNEDSISNFHEPLITSMPMPSSDSELVMGEVQDITKITNKYAIKSVHRATINVPNAKWK-WKPGDSVGILPFNAESEVDSILSRLSVPETEKNCVVXXXXXXXXXXXXAKVPEHLIVRENGKMSLKSILLWLCDLRQPLSKVGLRIMSEYCPMKSAEQRRLLELCSREGQSFYTKCLRETSMPVLDLLNWFPSCQIPIVRLL 1297
            C+      ILYGSQ GQA+SIAE +  +  ++    +I  L   +K     +    + + STTGDGD PD A KF+R IK       +LS+ +Y +LGLGDTNY+NFCN  KTID  L+  GA+ FY +  ADD  GLE+VV+PW++GL++  K   S +                     D  +NL +  ++ K+        K +  D +A ++   +                L VPALP  +L I+    +++            +P  D    +  +    ++T   A+K+     +++   + + ++PGD+  IL  N +SEV+ +L +L + + +KNC V++ LL+N   + AKVP H  + +NG  SL+ IL W  ++R    K  LR + ++    ++E+RRLLELCS++G + Y   +R++S+ VLDLL  FPSC  P+  L 
Sbjct:    3 CEAAAHFLILYGSQRGQAQSIAEEICQQAAEHGFTADISCLSKHDKYNLDSESRPVVFVVSTTGDGDPPDTALKFVRKIKNKSLPHDHLSHLRYALLGLGDTNYANFCNGGKTIDSYLQKLGAKHFYATGHADDGTGLEVVVDPWIEGLWDALKKAFSTMSTSDQQTLSDCTQDSNHQNASDQKKNLEVDLQLLKLSEVDSPKGKTVTSDSIATEIGSTSSVASLKESVPPLSESVLNVPALPPSYLEILLVGTENVEE--------TVLPDKDGYFEV-PISKAVQLTQDDAVKTAILLELDISQQQEQVYQPGDAFDILCPNRDSEVEELLLKLDL-QMQKNCTVQVNLLKNTSKKAAKVPLH--IPQNG--SLQFILTWCLEIRSTPKKAFLRALVDFT-QNASEKRRLLELCSKQGSADYNSFVRDSSVCVLDLLRAFPSCCPPLSLLF 440          
BLAST of methionine synthase reductase vs. Ensembl Zebrafish
Match: porb (P450 (cytochrome) oxidoreductase b [Source:ZFIN;Acc:ZDB-GENE-030131-5767])

HSP 1 Score: 200.675 bits (509), Expect = 1.295e-54
Identity = 173/668 (25.90%), Postives = 291/668 (43.56%), Query Frame = 2
Query:   65 KMTCILYGSQTGQAKSIAENLYAKLKDY-IKHINI----FELDDVEKSFEIHKLNFAIIICSTTGDGDAPDNASKFLRLIKIYQPKYLSNFKYTVLGLGDTNYSNFCNCSKTIDQILESKGARRFYRSDMADDAVGLEIVVEPWLDGLYEIAKDMCSEIPIDGFQNLSXXXXXXXXXXXXXXNYKELLGDHLAKDMDGKNLTVPALPSPFLNIIYNNEDSISNFHEPLITSMPMPSSDSELVMGEVQDITKITNKYAIKSVHRATINVPNAKWKWKPGDSVGILPFNAESEVDSILSRLSVPETEKNCVVXXXXXXXXXXXXAKVPEHLIVRENGKMSLKSILLWLCDLRQPLSKVGLRIMSEYCPMKSAEQRRLLELCSREGQSFYTKCLRETSMPVLDLLNWFPSCQIPIVRLLEVLPRLKPRAYSLCDLESV---SFAFSKVDIAPIQTFRKRPLTGVCTSWMEKMAKFHNEQIWKIPIYLRKNMNGFTVCENPSIPHILIGPGTGVAPFIGFLQYFEKLKNENQNIGPIWLFFGCRNEERDFIFKKQLEHFANSGILTHLCVCFSRDNPTNSGDEQKNFCQPPNCKYVQHCLLHHSKILSDLLVNQNARVFVCGDSSGMSKDVLETWSNVL--LGNHEKIQTKRDADSFITGMRVQKLYLEDVW 2038
            K   + YGSQTG A+  +  L      Y +K +      ++L ++ +  EI   + AI   +T G+GD  DNA  F   ++     + S  KYTV  LG+  Y ++    K +D+ LE  GA+R +   M DD   LE     W +  +     +C    ++     S   +        +   K   G+       G+  +      PF        DS + F  P+                    + +  NK   + +    +++  +K +++ GD V + P N  + V+ I   L+V   + + V+ L  L+   N++   P     R        ++  +L     P + V   +       K  E  R +   S EG++ Y   + ++   ++ +L   PS + PI  L E+LPRL+ R YS+     V   S     V +   QT   R   GV T+W++      N     +P+Y+RK+   F +    + P I+IGPGTG+APFIGF+Q    LK + + +G   L+FGCR++  DF+++++L  F  +G+LT L V FSRD                   YVQH L ++ + +  L+   NA +++CGD+  M++DV   +  +   LG   + Q    A  +I  +  +  Y +DVW
Sbjct:   72 KNIVVFYGSQTGTAEEFSNRLAKDAHRYGMKGMAADPEEYDLSELSRMGEIDN-SLAIFCLATYGEGDPTDNAQDFYDWLQEADADF-SGLKYTVFALGNKTYEHYNAMGKYVDKRLEELGAQRIFDLGMGDDDGNLEEDFVSWREQFWPA---VCEHFGVEATGEESSIRQYELKVHTDLNMNKVYTGEL------GRLKSFENQKPPF--------DSKNPFLAPVT-------------------VNRKLNKGGERHLMHLELDITGSKIRYESGDHVAVYPINDTAMVNKIGELLAV---DLDTVISLNNLDEESNKKHPFPCPTTYR-------TALTHYLDITNSPRTNVLYELAQYASDPKDQENMRKMASSSAEGKAQYQSWVLDSCRNIVAILEDLPSLRPPIDHLCELLPRLQARYYSISSSSKVHPNSIHICAV-VVEYQTKTGRVNKGVATNWLKNKMPTDNGHKATVPMYIRKSQ--FRLPFKSTNPIIMIGPGTGIAPFIGFIQERGWLKEQGKEVGETVLYFGCRHKNEDFLYQEELAQFEKTGVLTTLNVAFSRDQAEKV--------------YVQHHLKNNKEAVWKLVHTDNAHIYICGDARNMARDVQTAFYEIAEELGGMSRPQ----AVDYIKKLMTKGRYSQDVW 670          
BLAST of methionine synthase reductase vs. Ensembl Xenopus
Match: MTRR (5-methyltetrahydrofolate-homocysteine methyltransferase reductase [Source:NCBI gene;Acc:733716])

HSP 1 Score: 368.237 bits (944), Expect = 1.368e-116
Identity = 241/706 (34.14%), Postives = 384/706 (54.39%), Query Frame = 2
Query:   68 MTCILYGSQTGQAKSIAENLYAKLKDYIKHINIFELDDVEKSFEIHKLNFAIIICSTTGDGDAPDNASKFLRLI--KIYQPKYLSNFKYTVLGLGDTNYSNFCNCSKTIDQILESKGARRFYRSDMADDAVGLEIVVEPWLDGLY----------------EIAKDMCSEIPI--DGFQNLSXXXXXXXXXXXXXXNYKELLGDHLAKDMD---------------GKNLTVPALPSPFLNIIYNNEDSISNFHEPLITSMPMPSSDSELVMGEVQDITKITNKYAIKSVHRATINVPNAKWKWKPGDSVGILPFNAESEVDSILSRLSVPETEKNCVVXXXXXXXXXXXXAKVPEHLIVRENGKMSLKSILLWLCDLRQPLSKVGLRIMSEYCPMKSAEQRRLLELCSREGQSFYTKCLRETSMPVLDLLNWFPSCQIPIVRLLEVLPRLKPRAYS-----LCDLESVSFAFSKVDIAPIQTFRKRPLTGVCTSWMEKM-------AKFHNEQIWKIPIYLRKNMNGFTVCENPSIPHILIGPGTGVAPFIGFLQYFEKLKNENQN--IGPIWLFFGCRNEERDFIFKKQLEHFANSGILTHLCVCFSRDNPTNSGDEQKNFCQPPNCKYVQHCLLHHSKILSDLLVNQNARVFVCGDSSGMSKDVLETWSNVLLGNHEKIQTKRDADSFITGMRVQKLYLEDVW 2038
            M  +LYG+Q GQ+K+I+E +  + + +    +I+ L D +K     + +  +I+ STTG GD PD A +FL+ I  K +   Y +N KY VL LGD+ Y+ FCN  K ID  L+  GA+ FY +  ADD VGLE+VV+PW++GL+                +  K+M +E P   +  +NL +  +   +E   +  Y   L ++   + +                 NL VP LPSP+L++     +  S       T + +   + ++    +    ++T+  A+K+V    +++ N   +++PGDS  I+  N   EV+ +L +L++ E +++C V L +    + + A VP ++        SL+ I  W  ++R    K  +R + E+    +AE+RRL ELCS++G S Y   +R+ S+ +LDLLN FPSC  P+  L+E LP+L+ R YS     L     V   F+ V++ P    R  P  GVCT W+ ++       A+   +   KI I+ R + + F +  +PS+P +++GPGTG+APFIGFLQ+ EKLK +N+    G  WLFFGCR+ E +++F+++L HF +SG+LTHL VCFSRD P N+G        P   KYVQ  L   S  ++ +L  +N  ++VCGD+  M+KDV +  +N+L    E    K +A + +  +R QK YL+DVW
Sbjct:    1 MFLLLYGTQQGQSKAISEEIGQQAEHHGFTADIYSLKDFKKFNLETERDPVVIVISTTGTGDPPDAAIRFLKEIQNKEHPVDYFANLKYAVLALGDSEYTYFCNGGKIIDWRLQELGAKHFYETGYADDCVGLELVVDPWIEGLWTALHSEFIPRTEKKNTDHMKNMSTEKPATDEVPENLELRIQAINLEHSVLPKYS--LAENTGSESNRVIKPSLLHSGSLLSQSNLNVPVLPSPYLDVCVLESEGQS-------TDLSLLYPEEKIFNISIIQAKELTSADAVKTVLMLELDISNTSAEFQPGDSFSIICPNPHEEVEMLLEKLTLAE-KRDCQVHLGVKLGTKKKGASVPGYI----PEGCSLQFIFTWCLEIRAVPKKAMIRALVEHT-SNAAEKRRLQELCSKQGGSDYNHFIRDNSISILDLLNVFPSCSPPLNLLIEHLPKLQARPYSAASSPLYHPGKVHIVFTVVEL-PTCPDRPAPRKGVCTGWLAELVSHMYDTAELKKDFPPKISIFARPSTS-FHLPRDPSVPILMVGPGTGIAPFIGFLQHREKLKEQNKERIFGDTWLFFGCRSHENEYLFRQELRHFTDSGVLTHLKVCFSRDPPINAG-----VVSP---KYVQDFLKICSSDIAKVLTKENGSIYVCGDAKNMAKDVNDALANILC--MELNMDKLEAINTLAVLRDQKCYLQDVW 679          
BLAST of methionine synthase reductase vs. Ensembl Xenopus
Match: MTRR (5-methyltetrahydrofolate-homocysteine methyltransferase reductase [Source:NCBI gene;Acc:733716])

HSP 1 Score: 367.466 bits (942), Expect = 3.292e-116
Identity = 240/703 (34.14%), Postives = 383/703 (54.48%), Query Frame = 2
Query:   77 ILYGSQTGQAKSIAENLYAKLKDYIKHINIFELDDVEKSFEIHKLNFAIIICSTTGDGDAPDNASKFLRLI--KIYQPKYLSNFKYTVLGLGDTNYSNFCNCSKTIDQILESKGARRFYRSDMADDAVGLEIVVEPWLDGLY----------------EIAKDMCSEIPI--DGFQNLSXXXXXXXXXXXXXXNYKELLGDHLAKDMD---------------GKNLTVPALPSPFLNIIYNNEDSISNFHEPLITSMPMPSSDSELVMGEVQDITKITNKYAIKSVHRATINVPNAKWKWKPGDSVGILPFNAESEVDSILSRLSVPETEKNCVVXXXXXXXXXXXXAKVPEHLIVRENGKMSLKSILLWLCDLRQPLSKVGLRIMSEYCPMKSAEQRRLLELCSREGQSFYTKCLRETSMPVLDLLNWFPSCQIPIVRLLEVLPRLKPRAYS-----LCDLESVSFAFSKVDIAPIQTFRKRPLTGVCTSWMEKM-------AKFHNEQIWKIPIYLRKNMNGFTVCENPSIPHILIGPGTGVAPFIGFLQYFEKLKNENQN--IGPIWLFFGCRNEERDFIFKKQLEHFANSGILTHLCVCFSRDNPTNSGDEQKNFCQPPNCKYVQHCLLHHSKILSDLLVNQNARVFVCGDSSGMSKDVLETWSNVLLGNHEKIQTKRDADSFITGMRVQKLYLEDVW 2038
            +LYG+Q GQ+K+I+E +  + + +    +I+ L D +K     + +  +I+ STTG GD PD A +FL+ I  K +   Y +N KY VL LGD+ Y+ FCN  K ID  L+  GA+ FY +  ADD VGLE+VV+PW++GL+                +  K+M +E P   +  +NL +  +   +E   +  Y   L ++   + +                 NL VP LPSP+L++     +  S       T + +   + ++    +    ++T+  A+K+V    +++ N   +++PGDS  I+  N   EV+ +L +L++ E +++C V L +    + + A VP ++        SL+ I  W  ++R    K  +R + E+    +AE+RRL ELCS++G S Y   +R+ S+ +LDLLN FPSC  P+  L+E LP+L+ R YS     L     V   F+ V++ P    R  P  GVCT W+ ++       A+   +   KI I+ R + + F +  +PS+P +++GPGTG+APFIGFLQ+ EKLK +N+    G  WLFFGCR+ E +++F+++L HF +SG+LTHL VCFSRD P N+G        P   KYVQ  L   S  ++ +L  +N  ++VCGD+  M+KDV +  +N+L    E    K +A + +  +R QK YL+DVW
Sbjct:   11 LLYGTQQGQSKAISEEIGQQAEHHGFTADIYSLKDFKKFNLETERDPVVIVISTTGTGDPPDAAIRFLKEIQNKEHPVDYFANLKYAVLALGDSEYTYFCNGGKIIDWRLQELGAKHFYETGYADDCVGLELVVDPWIEGLWTALHSEFIPRTEKKNTDHMKNMSTEKPATDEVPENLELRIQAINLEHSVLPKYS--LAENTGSESNRVIKPSLLHSGSLLSQSNLNVPVLPSPYLDVCVLESEGQS-------TDLSLLYPEEKIFNISIIQAKELTSADAVKTVLMLELDISNTSAEFQPGDSFSIICPNPHEEVEMLLEKLTLAE-KRDCQVHLGVKLGTKKKGASVPGYI----PEGCSLQFIFTWCLEIRAVPKKAMIRALVEHT-SNAAEKRRLQELCSKQGGSDYNHFIRDNSISILDLLNVFPSCSPPLNLLIEHLPKLQARPYSAASSPLYHPGKVHIVFTVVEL-PTCPDRPAPRKGVCTGWLAELVSHMYDTAELKKDFPPKISIFARPSTS-FHLPRDPSVPILMVGPGTGIAPFIGFLQHREKLKEQNKERIFGDTWLFFGCRSHENEYLFRQELRHFTDSGVLTHLKVCFSRDPPINAG-----VVSP---KYVQDFLKICSSDIAKVLTKENGSIYVCGDAKNMAKDVNDALANILC--MELNMDKLEAINTLAVLRDQKCYLQDVW 686          
BLAST of methionine synthase reductase vs. Ensembl Xenopus
Match: MTRR (5-methyltetrahydrofolate-homocysteine methyltransferase reductase [Source:NCBI gene;Acc:733716])

HSP 1 Score: 349.747 bits (896), Expect = 7.758e-110
Identity = 239/708 (33.76%), Postives = 371/708 (52.40%), Query Frame = 2
Query:   65 KMTCILYGSQTGQAKSIAENLYAKLKDYIKHINIFELDDVEKSFEIHKLNFAIIICSTTGDGDAPDNASKFLRLI--KIYQPKYLSNFKYTVLGLGDTNYSNFCNCSKTIDQILESKGARRFYRSDMADDAVGLEIVVEPWLDGLY----------------EIAKDMCSEIPI--DGFQNLSXXXXXXXXXXXXXXNYKELLGDHLAKDMD---------------GKNLTVPALPSPFLNI-IYNNEDSISNFHEPLITSMPMPSSDSELVMGEVQDITKITNKYAIKSVHRATINVPNAKWKWKPGDSVGILPFNAESEVDSILSRLSVPETEKNCVVXXXXXXXXXXXXAKVPEHLIVRENGKMSLKSILLWLCDLRQPLSKVGLRIMSEYCPMKSAEQRRLLELCSREGQSFYTKCLRETSMPVLDLLNWFPSCQIPIVRLLEVLPRLKPRAYS-----LCDLESVSFAFSKVDIAPIQTFRKRPLTGVCTSWMEKM-------AKFHNEQIWKIPIYLRKNMNGFTVCENPSIPHILIGPGTGVAPFIGFLQYFEKLKNENQN--IGPIWLFFGCRNEERDFIFKKQLEHFANSGILTHLCVCFSRDNPTNSGDEQKNFCQPPNCKYVQHCLLHHSKILSDLLVNQNARVFVCGDSSGMSKDVLETWSNVLLGNHEKIQTKRDADSFITGMRVQKLYLEDVW 2038
            K   +LYG+Q GQ+K+I+E +  + + +    +I+ L D +K     + +  +I+ STTG GD PD A +FL+ I  K +   Y +N KY VL LGD+ Y+ FCN  K ID  L+  GA+ FY +  ADD VGLE+VV+PW++GL+                +  K+M +E P   +  +NL +  +   +E   +  Y   L ++   + +                 NL VP LPSP+L++ +  +E  I+                                     S H+      N   +++PGDS  I+  N   EV+ +L +L++ E +++C V L +    + + A VP ++        SL+ I  W  ++R    K  +R + E+    +AE+RRL ELCS++G S Y   +R+ S+ +LDLLN FPSC  P+  L+E LP+L+ R YS     L     V   F+ V++ P    R  P  GVCT W+ ++       A+   +   KI I+ R + + F +  +PS+P +++GPGTG+APFIGFLQ+ EKLK +N+    G  WLFFGCR+ E +++F+++L HF +SG+LTHL VCFSRD P N+G        P   KYVQ  L   S  ++ +L  +N  ++VCGD+  M+KDV +  +N+L    E    K +A + +  +R QK YL+DVW
Sbjct:    7 KRFLLLYGTQQGQSKAISEEIGQQAEHHGFTADIYSLKDFKKFNLETERDPVVIVISTTGTGDPPDAAIRFLKEIQNKEHPVDYFANLKYAVLALGDSEYTYFCNGGKIIDWRLQELGAKHFYETGYADDCVGLELVVDPWIEGLWTALHSEFIPRTEKKNTDHMKNMSTEKPATDEVPENLELRIQAINLEHSVLPKYS--LAENTGSESNRVIKPSLLHSGSLLSQSNLNVPVLPSPYLDVCVLESEGQIT---------------------------------LVFFSFHK------NTSAEFQPGDSFSIICPNPHEEVEMLLEKLTLAE-KRDCQVHLGVKLGTKKKGASVPGYI----PEGCSLQFIFTWCLEIRAVPKKAMIRALVEHT-SNAAEKRRLQELCSKQGGSDYNHFIRDNSISILDLLNVFPSCSPPLNLLIEHLPKLQARPYSAASSPLYHPGKVHIVFTVVEL-PTCPDRPAPRKGVCTGWLAELVSHMYDTAELKKDFPPKISIFARPSTS-FHLPRDPSVPILMVGPGTGIAPFIGFLQHREKLKEQNKERIFGDTWLFFGCRSHENEYLFRQELRHFTDSGVLTHLKVCFSRDPPINAG-----VVSP---KYVQDFLKICSSDIAKVLTKENGSIYVCGDAKNMAKDVNDALANILC--MELNMDKLEAINTLAVLRDQKCYLQDVW 655          
BLAST of methionine synthase reductase vs. Ensembl Xenopus
Match: MTRR (5-methyltetrahydrofolate-homocysteine methyltransferase reductase [Source:NCBI gene;Acc:733716])

HSP 1 Score: 339.732 bits (870), Expect = 1.057e-105
Identity = 233/702 (33.19%), Postives = 378/702 (53.85%), Query Frame = 2
Query:   77 ILYGSQTGQAKSIAENLYAKLKDYIKHINIFELDDVEKSFEIHKLNFAIIICSTTGDGDAPDNASKFLRLI--KIYQPKYLSNFKYTVLGLGDTNYSNFCNCSKTIDQILESKGARRFYRSDMADDAVGLEIVVEPWLDGLY----------------EIAKDMCSEIPI--DGFQNLSXXXXXXXXXXXXXXNYKELLGDHLAKDMD---------------GKNLTVPALPSPFLNI-IYNNEDSISNFHEPLITSMPMPSSDSELVMGEVQDITKITNKYAIKSVHRATINVPNAKWKWKPGDSVGILPFNAESEVDSILSRLSVPETEKNCVVXXXXXXXXXXXXAKVPEHLIVRENGKMSLKSILLWLCDLRQPLSKVGLRIMSEYCPMKSAEQRRLLELCSREGQSFYTKCLRETSMPVLDLLNWFPSCQIPIVRLL--EVLPRLKPRAYS-LCDLESVSFAFSKVDIAPIQTFRKRPLTGVCTSWMEKM-------AKFHNEQIWKIPIYLRKNMNGFTVCENPSIPHILIGPGTGVAPFIGFLQYFEKLKNENQN--IGPIWLFFGCRNEERDFIFKKQLEHFANSGILTHLCVCFSRDNPTNSGDEQKNFCQPPNCKYVQHCLLHHSKILSDLLVNQNARVFVCGDSSGMSKDVLETWSNVLLGNHEKIQTKRDADSFITGMRVQKLYLEDVW 2038
            +LYG+Q GQ+K+I+E +  + + +    +I+ L D +K     + +  +I+ STTG GD PD A +FL+ I  K +   Y +N KY VL LGD+ Y+ FCN  K ID  L+  GA+ FY +  ADD VGLE+VV+PW++GL+                +  K+M +E P   +  +NL +  +   +E   +  Y   L ++   + +                 NL VP LPSP+L++ +  +E  +          + +   + ++    +    ++T+  A+K+V    +++  +  +++PGDS  I+  N   EV+ +L +L++ E +++C V L +    + + A VP ++        SL+ I  W  ++R    K  +R + E+    +AE+RRL ELCS++G S Y   +R+ S+ +LDLLN FPSC  P+  L+    L       +S L     V   F+ V++ P    R  P  GVCT W+ ++       A+   +   KI I+ R + + F +  +PS+P +++GPGTG+APFIGFLQ+ EKLK +N+    G  WLFFGCR+ E +++F+++L HF +SG+LTHL VCFSRD P N+G        P   KYVQ  L   S  ++ +L  +N  ++VCGD+  M+KDV +  +N+L    E    K +A + +  +R QK YL+DVW
Sbjct:   11 LLYGTQQGQSKAISEEIGQQAEHHGFTADIYSLKDFKKFNLETERDPVVIVISTTGTGDPPDAAIRFLKEIQNKEHPVDYFANLKYAVLALGDSEYTYFCNGGKIIDWRLQELGAKHFYETGYADDCVGLELVVDPWIEGLWTALHSEFIPRTEKKNTDHMKNMSTEKPATDEVPENLELRIQAINLEHSVLPKYS--LAENTGSESNRVIKPSLLHSGSLLSQSNLNVPVLPSPYLDVCVLESEGQVD---------LSLLYPEEKIFNISIIQAKELTSADAVKTVLMLELDI--SVTEFQPGDSFSIICPNPHEEVEMLLEKLTLAE-KRDCQVHLGVKLGTKKKGASVPGYI----PEGCSLQFIFTWCLEIRAVPKKAMIRALVEHTS-NAAEKRRLQELCSKQGGSDYNHFIRDNSISILDLLNVFPSCSPPLNLLIGKHALNAAMFVCFSPLYHPGKVHIVFTVVEL-PTCPDRPAPRKGVCTGWLAELVSHMYDTAELKKDFPPKISIFARPSTS-FHLPRDPSVPILMVGPGTGIAPFIGFLQHREKLKEQNKERIFGDTWLFFGCRSHENEYLFRQELRHFTDSGVLTHLKVCFSRDPPINAG-----VVSP---KYVQDFLKICSSDIAKVLTKENGSIYVCGDAKNMAKDVNDALANILC--MELNMDKLEAINTLAVLRDQKCYLQDVW 681          
BLAST of methionine synthase reductase vs. Ensembl Xenopus
Match: MTRR (5-methyltetrahydrofolate-homocysteine methyltransferase reductase [Source:NCBI gene;Acc:733716])

HSP 1 Score: 271.937 bits (694), Expect = 8.050e-82
Identity = 170/478 (35.56%), Postives = 269/478 (56.28%), Query Frame = 2
Query:  647 NLTVPALPSPFLNIIYNNEDSISNFHEPLITSMPMPSSDSELVMGEVQDITKITNKYAIKSVHRATINVPNAKWKWKPGDSVGILPFNAESEVDSILSRLSVPETEKNCVVXXXXXXXXXXXXAKVPEHLIVRENGKMSLKSILLWLCDLRQPLSKVGLRIMSEYCPMKSAEQRRLLELCSREGQSFYTKCLRETSMPVLDLLNWFPSCQIPIVRLLEVLPRLKPRAYS-----LCDLESVSFAFSKVDIAPIQTFRKRPLTGVCTSWMEKM-------AKFHNEQIWKIPIYLRKNMNGFTVCENPSIPHILIGPGTGVAPFIGFLQYFEKLKNENQN--IGPIWLFFGCRNEERDFIFKKQLEHFANSGILTHLCVCFSRDNPTNSGDEQKNFCQPPNCKYVQHCLLHHSKILSDLLVNQNARVFVCGDSSGMSKDVLETWSNVLLGNHEKIQTKRDADSFITGMRVQKLYLEDVW 2038
            NL VP LPSP+L++     +  S       T + +   + ++    +    ++T+  A+K+V    +++ N   +++PGDS  I+  N   EV+ +L +L++ E +++C V L +    + + A VP ++        SL+ I  W  ++R    K  +R + E+    +AE+RRL ELCS++G S Y   +R+ S+ +LDLLN FPSC  P+  L+E LP+L+ R YS     L     V   F+ V++ P    R  P  GVCT W+ ++       A+   +   KI I+ R +   F +  +PS+P +++GPGTG+APFIGFLQ+ EKLK +N+    G  WLFFGCR+ E +++F+++L HF +SG+LTHL VCFSRD P N+G        P   KYVQ  L   S  ++ +L  +N  ++VCGD+  M+KDV +  +N+L    E    K +A + +  +R QK YL+DVW
Sbjct:   75 NLNVPVLPSPYLDVCVLESEGQS-------TDLSLLYPEEKIFNISIIQAKELTSADAVKTVLMLELDISNTSAEFQPGDSFSIICPNPHEEVEMLLEKLTLAE-KRDCQVHLGVKLGTKKKGASVPGYI----PEGCSLQFIFTWCLEIRAVPKKAMIRALVEHT-SNAAEKRRLQELCSKQGGSDYNHFIRDNSISILDLLNVFPSCSPPLNLLIEHLPKLQARPYSAASSPLYHPGKVHIVFTVVEL-PTCPDRPAPRKGVCTGWLAELVSHMYDTAELKKDFPPKISIFARPS-TSFHLPRDPSVPILMVGPGTGIAPFIGFLQHREKLKEQNKERIFGDTWLFFGCRSHENEYLFRQELRHFTDSGVLTHLKVCFSRDPPINAG-----VVSP---KYVQDFLKICSSDIAKVLTKENGSIYVCGDAKNMAKDVNDALANILC--MELNMDKLEAINTLAVLRDQKCYLQDVW 527          
BLAST of methionine synthase reductase vs. Ensembl Mouse
Match: Mtrr (5-methyltetrahydrofolate-homocysteine methyltransferase reductase [Source:MGI Symbol;Acc:MGI:1891037])

HSP 1 Score: 345.895 bits (886), Expect = 4.527e-108
Identity = 235/726 (32.37%), Postives = 379/726 (52.20%), Query Frame = 2
Query:   62 LKMTCILYGSQTGQAKSIAENLYAKLKDYIKHINIFELDDVEKSFEIHKLNFAIIICSTTGDGDAPDNASKFLRLI--KIYQPKYLSNFKYTVLGLGDTNYSNFCNCSKTIDQILESKGARRFYRSDMADDAVGLEIVVEPWLDGLYE-IAKDMCSEIPIDGFQNLSXXXXXXXXXXXXXXNYKELL--------------GD---------------------------HLAKDMDGKNLTVPALPSPFLNIIYNNEDSISNFHEPLITSMPMPSSDSELVMGEVQDITKITNKYAIKSVHRATINVPNAKWKWKPGDSVGILPFNAESEVDSILSRLSVPETEKNCVVXXXXXXXXXXXXAKVPEHLIVRENGKMSLKSILLWLCDLRQPLSKVGLRIMSEYCPMKSAEQRRLLELCSREGQSFYTKCLRETSMPVLDLLNWFPSCQIPIVRLLEVLPRLKPRAY-----SLCDLESVSFAFSKVDIAPIQT---FRKRPLTGVCTSWMEKM-AKF------------HNEQIWKIPIYLRKNMNGFTVCENPSIPHILIGPGTGVAPFIGFLQYFEKLKNENQN--IGPIWLFFGCRNEERDFIFKKQLEHFANSGILTHLCVCFSRDNPTNSGDEQKNFCQPPNCKYVQHCLLHHSKILSDLLVNQNARVFVCGDSSGMSKDVLETWSNVLLGNHEKIQTKRDADSFITGMRVQKLYLEDVW 2038
            ++   +LY +Q GQAK+IAE +  +   +    ++  + + EK     +    +++ STTG GD PD A KF++ I  K     Y ++ +Y +LGLGD+ Y+ FCN  K ID+ L+  GA+RFY +  ADD VGLE+VVEPW+DGL+  + K   S   + G +N+S T   +           ELL              G+                           H    +   +L++PA+P  +L +  + ++S+            +PS D    +  +    ++T   A+KS     +++   ++  +PGDS  +   N++ EV+ +L RL + +   + V+     +  +   A +P H+     G+ SL+ IL W  ++R    K  LR ++E+    + E+RRL ELCS++G + Y + +R+ S+ +LDLL  FPSCQ P+  LLE LP+L+PR Y     SL   + + F F+ V+  P  T    RK    GVCT W+  + A F             +    +I I  R   N F + E+PS P I++GPGTGVAPF+GFLQ+ EKL+ ++ +   G +WLFFGCR+++RD++F+++L HF  +G+LTHL V FSRD   + G+E          KYVQ  L  HS+ ++  L+ +N  V+VCGD+  M+KDV +T   ++  ++E    K +A   +  ++ +K YL+D+W
Sbjct:    1 MRRFLLLYATQRGQAKAIAEEISEQAVSHGFSADLHCISESEKYDLKTETGPLVMVVSTTGTGDPPDTARKFVKEIHNKTLPTDYFAHLQYGLLGLGDSEYTYFCNGGKVIDKRLQELGAQRFYDTGHADDCVGLELVVEPWIDGLWAALTKHFKS---LGGQENMSDTLSRASDAPLSTAMKPELLHIQSQVELLRLEDMGERDSELREQNETNRGQQGRIEDFDSSLVHSVPPLSQSSLSIPAVPPEYLEV--HLQESLGQEE----NQASVPSGDPSFQV-PISKAIRLTTNDAVKSTLLLELDISKIEFSHQPGDSFNVTCPNSDREVEELLQRLQLADKRAHRVILKIKTDTKKKGAA-LPAHV---PEGR-SLQFILTWCLEIRAVPKKAFLRALAEHT-SSATEKRRLQELCSKQGAADYNRFIRDASVCLLDLLLTFPSCQPPLSLLLEHLPKLQPRPYSCASSSLRHPDKLHFVFNIVEFPPSTTAASLRK----GVCTGWLATLVAPFLQPNTDVSNVDSGDALAPEIRISPRAT-NAFHLPEDPSAPIIMVGPGTGVAPFVGFLQHREKLQEQHPDGKFGAMWLFFGCRHKDRDYLFREELRHFLKTGVLTHLKVSFSRDAAPD-GEEAP-------AKYVQDNLQRHSQQVARTLLQENGYVYVCGDAKNMAKDVNDTLIGII--SNEAGVDKLEAMKTLATLKQEKRYLQDIW 695          
BLAST of methionine synthase reductase vs. Ensembl Mouse
Match: Mtrr (5-methyltetrahydrofolate-homocysteine methyltransferase reductase [Source:MGI Symbol;Acc:MGI:1891037])

HSP 1 Score: 345.895 bits (886), Expect = 4.527e-108
Identity = 235/726 (32.37%), Postives = 379/726 (52.20%), Query Frame = 2
Query:   62 LKMTCILYGSQTGQAKSIAENLYAKLKDYIKHINIFELDDVEKSFEIHKLNFAIIICSTTGDGDAPDNASKFLRLI--KIYQPKYLSNFKYTVLGLGDTNYSNFCNCSKTIDQILESKGARRFYRSDMADDAVGLEIVVEPWLDGLYE-IAKDMCSEIPIDGFQNLSXXXXXXXXXXXXXXNYKELL--------------GD---------------------------HLAKDMDGKNLTVPALPSPFLNIIYNNEDSISNFHEPLITSMPMPSSDSELVMGEVQDITKITNKYAIKSVHRATINVPNAKWKWKPGDSVGILPFNAESEVDSILSRLSVPETEKNCVVXXXXXXXXXXXXAKVPEHLIVRENGKMSLKSILLWLCDLRQPLSKVGLRIMSEYCPMKSAEQRRLLELCSREGQSFYTKCLRETSMPVLDLLNWFPSCQIPIVRLLEVLPRLKPRAY-----SLCDLESVSFAFSKVDIAPIQT---FRKRPLTGVCTSWMEKM-AKF------------HNEQIWKIPIYLRKNMNGFTVCENPSIPHILIGPGTGVAPFIGFLQYFEKLKNENQN--IGPIWLFFGCRNEERDFIFKKQLEHFANSGILTHLCVCFSRDNPTNSGDEQKNFCQPPNCKYVQHCLLHHSKILSDLLVNQNARVFVCGDSSGMSKDVLETWSNVLLGNHEKIQTKRDADSFITGMRVQKLYLEDVW 2038
            ++   +LY +Q GQAK+IAE +  +   +    ++  + + EK     +    +++ STTG GD PD A KF++ I  K     Y ++ +Y +LGLGD+ Y+ FCN  K ID+ L+  GA+RFY +  ADD VGLE+VVEPW+DGL+  + K   S   + G +N+S T   +           ELL              G+                           H    +   +L++PA+P  +L +  + ++S+            +PS D    +  +    ++T   A+KS     +++   ++  +PGDS  +   N++ EV+ +L RL + +   + V+     +  +   A +P H+     G+ SL+ IL W  ++R    K  LR ++E+    + E+RRL ELCS++G + Y + +R+ S+ +LDLL  FPSCQ P+  LLE LP+L+PR Y     SL   + + F F+ V+  P  T    RK    GVCT W+  + A F             +    +I I  R   N F + E+PS P I++GPGTGVAPF+GFLQ+ EKL+ ++ +   G +WLFFGCR+++RD++F+++L HF  +G+LTHL V FSRD   + G+E          KYVQ  L  HS+ ++  L+ +N  V+VCGD+  M+KDV +T   ++  ++E    K +A   +  ++ +K YL+D+W
Sbjct:    1 MRRFLLLYATQRGQAKAIAEEISEQAVSHGFSADLHCISESEKYDLKTETGPLVMVVSTTGTGDPPDTARKFVKEIHNKTLPTDYFAHLQYGLLGLGDSEYTYFCNGGKVIDKRLQELGAQRFYDTGHADDCVGLELVVEPWIDGLWAALTKHFKS---LGGQENMSDTLSRASDAPLSTAMKPELLHIQSQVELLRLEDMGERDSELREQNETNRGQQGRIEDFDSSLVHSVPPLSQSSLSIPAVPPEYLEV--HLQESLGQEE----NQASVPSGDPSFQV-PISKAIRLTTNDAVKSTLLLELDISKIEFSHQPGDSFNVTCPNSDREVEELLQRLQLADKRAHRVILKIKTDTKKKGAA-LPAHV---PEGR-SLQFILTWCLEIRAVPKKAFLRALAEHT-SSATEKRRLQELCSKQGAADYNRFIRDASVCLLDLLLTFPSCQPPLSLLLEHLPKLQPRPYSCASSSLRHPDKLHFVFNIVEFPPSTTAASLRK----GVCTGWLATLVAPFLQPNTDVSNVDSGDALAPEIRISPRAT-NAFHLPEDPSAPIIMVGPGTGVAPFVGFLQHREKLQEQHPDGKFGAMWLFFGCRHKDRDYLFREELRHFLKTGVLTHLKVSFSRDAAPD-GEEAP-------AKYVQDNLQRHSQQVARTLLQENGYVYVCGDAKNMAKDVNDTLIGII--SNEAGVDKLEAMKTLATLKQEKRYLQDIW 695          
BLAST of methionine synthase reductase vs. Ensembl Mouse
Match: Por (P450 (cytochrome) oxidoreductase [Source:MGI Symbol;Acc:MGI:97744])

HSP 1 Score: 189.889 bits (481), Expect = 9.154e-51
Identity = 169/666 (25.38%), Postives = 297/666 (44.59%), Query Frame = 2
Query:   77 ILYGSQTGQAKSIAENLYAKLKDY-IKHINI----FELDDVEKSFEIHKLNFAIIICSTTGDGDAPDNASKFLRLIKIYQPKYLSNFKYTVLGLGDTNYSNFCNCSKTIDQILESKGARRFYRSDMADDAVGLEIVVEPWLDGLYEIAKDMCSEIPIDGFQNLSXXXXXXXXXXXXXXNYKELLGDHLAKDMDGKNLTVPALPSPFLNIIYNNEDSISNFHEPLITSMPMPSSDSELVMGEVQDITKITNKYAIKSVHRATINVPNAKWKWKPGDSVGILPFNAESEVDSILSRLSVPETEKNCVVXXXXXXXXXXXXAKVPEHLIVRENGKMSLKSILLWLCDLRQPLSKVGLRIMSEYCPMKSAEQRRLLELCSR--EGQSFYTKCLRETSMPVLDLLNWFPSCQIPIVRLLEVLPRLKPRAYSLCDLESVSFAFSKVDIAPIQTFRK--RPLTGVCTSWME-KMAKFHNEQIWKIPIYLRKNMNGFTVCENPSIPHILIGPGTGVAPFIGFLQYFEKLKNENQNIGPIWLFFGCRNEERDFIFKKQLEHFANSGILTHLCVCFSRDNPTNSGDEQKNFCQPPNCKYVQHCLLHHSKILSDLLVNQNARVFVCGDSSGMSKDVLETWSNVL--LGNHEKIQTKRDADSFITGMRVQKLYLEDVW 2038
            + YGSQTG A+  A  L      Y ++ ++     ++L D+    EI K +  +   +T G+GD  DNA  F   ++      L+  K+ V GLG+  Y +F    K +DQ LE  GA+R +   + DD   LE     W +  +     +C    ++     S   +             EL+   + +DMD   +    +        Y N+    +   P + ++   +++ +L  G  + +  +             +++ ++K +++ GD V + P N  + V+ I   L     + + ++ L  L+   N++   P           + ++ L +  D+  P     L  +++Y    S EQ  L ++ S   EG+  Y   + E    +L +L  +PS + PI  L E+LPRL+ R YS+     V      +    ++   K  R   GV TSW+  K     N +   +P+++RK+   F +   P+ P I++GPGTGVAPF+GF+Q    L+ + + +G   L++GCR  + D++++++L  F   G LT L V FSR+                +  YVQH L    + L  L+    A ++VCGD+  M+KDV  T+ +++   G  E  Q    A  ++  +  +  Y  DVW
Sbjct:   82 VFYGSQTGTAEEFANRLSKDAHRYGMRGMSADPEEYDLADLSSLPEIDK-SLVVFCMATYGEGDPTDNAQDFYDWLQETDVD-LTGVKFAVFGLGNKTYEHFNAMGKYVDQRLEQLGAQRIFELGLGDDDGNLEEDFITWREQFWPA---VCEFFGVEATGEESSIRQY------------ELV---VHEDMDTAKVYTGEMGRL---KSYENQKPPFDAKNPFLAAV---TTNRKLNQGTERHLMHLE------------LDISDSKIRYESGDHVAVYPANDSTLVNQIGEILGA---DLDVIMSLNNLDEESNKKHPFP--------CPTTYRTALTYYLDITNPPRTNVLYELAQYASEPS-EQEHLHKMASSSGEGKELYLSWVVEARRHILAILQDYPSLRPPIDHLCELLPRLQARYYSIASSSKVHPNSVHICAVAVEYEAKSGRVNKGVATSWLRTKEPAGENGRRALVPMFVRKSQ--FRLPFKPTTPVIMVGPGTGVAPFMGFIQERAWLREQGKEVGETLLYYGCRRSDEDYLYREELARFHKDGALTQLNVAFSREQ--------------AHKVYVQHLLKRDKEHLWKLIHEGGAHIYVCGDARNMAKDVQNTFYDIVAEFGPMEHTQ----AVDYVKKLMTKGRYSLDVW 677          
BLAST of methionine synthase reductase vs. Ensembl Mouse
Match: Por (P450 (cytochrome) oxidoreductase [Source:MGI Symbol;Acc:MGI:97744])

HSP 1 Score: 162.54 bits (410), Expect = 1.359e-41
Identity = 144/570 (25.26%), Postives = 257/570 (45.09%), Query Frame = 2
Query:   77 ILYGSQTGQAKSIAENLYAKLKDY-IKHINI----FELDDVEKSFEIHKLNFAIIICSTTGDGDAPDNASKFLRLIKIYQPKYLSNFKYTVLGLGDTNYSNFCNCSKTIDQILESKGARRFYRSDMADDAVGLEIVVEPWLDGLYEIAKDMCSEIPIDGFQNLSXXXXXXXXXXXXXXNYKELLGDHLAKDMDGKNLTVPALPSPFLNIIYNNEDSISNFHEPLITSMPMPSSDSELVMGEVQDITKITNKYAIKSVHRATINVPNAKWKWKPGDSVGILPFNAESEVDSILSRLSVPETEKNCVVXXXXXXXXXXXXAKVPEHLIVRENGKMSLKSILLWLCDLRQPLSKVGLRIMSEYCPMKSAEQRRLLELCSR--EGQSFYTKCLRETSMPVLDLLNWFPSCQIPIVRLLEVLPRLKPRAYSLCDLESVSFAFSKVDIAPIQTFRK--RPLTGVCTSWME-KMAKFHNEQIWKIPIYLRKNMNGFTVCENPSIPHILIGPGTGVAPFIGFLQYFEKLKNENQNIGPIWLFFGCRNEERDFIFKKQLEHFANSGILTHLCVCFSRDN 1756
            + YGSQTG A+  A  L      Y ++ ++     ++L D+    EI K +  +   +T G+GD  DNA  F   ++      L+  K+ V GLG+  Y +F    K +DQ LE  GA+R +   + DD   LE     W +  +     +C    ++     S   +             EL+   + +DMD   +    +        Y N+    +   P + ++   +++ +L  G  + +  +             +++ ++K +++ GD V + P N  + V+ I   L     + + ++ L  L+   N++   P           + ++ L +  D+  P     L  +++Y    S EQ  L ++ S   EG+  Y   + E    +L +L  +PS + PI  L E+LPRL+ R YS+     V      +    ++   K  R   GV TSW+  K     N +   +P+++RK+   F +   P+ P I++GPGTGVAPF+GF+Q    L+ + + +G   L++GCR  + D++++++L  F   G LT L V FSR+ 
Sbjct:   82 VFYGSQTGTAEEFANRLSKDAHRYGMRGMSADPEEYDLADLSSLPEIDK-SLVVFCMATYGEGDPTDNAQDFYDWLQETDVD-LTGVKFAVFGLGNKTYEHFNAMGKYVDQRLEQLGAQRIFELGLGDDDGNLEEDFITWREQFWPA---VCEFFGVEATGEESSIRQY------------ELV---VHEDMDTAKVYTGEMGRL---KSYENQKPPFDAKNPFLAAV---TTNRKLNQGTERHLMHLE------------LDISDSKIRYESGDHVAVYPANDSTLVNQIGEILGA---DLDVIMSLNNLDEESNKKHPFP--------CPTTYRTALTYYLDITNPPRTNVLYELAQYASEPS-EQEHLHKMASSSGEGKELYLSWVVEARRHILAILQDYPSLRPPIDHLCELLPRLQARYYSIASSSKVHPNSVHICAVAVEYEAKSGRVNKGVATSWLRTKEPAGENGRRALVPMFVRKSQ--FRLPFKPTTPVIMVGPGTGVAPFMGFIQERAWLREQGKEVGETLLYYGCRRSDEDYLYREELARFHKDGALTQLNVAFSREQ 599          
BLAST of methionine synthase reductase vs. Ensembl Mouse
Match: Ndor1 (NADPH dependent diflavin oxidoreductase 1 [Source:MGI Symbol;Acc:MGI:1926047])

HSP 1 Score: 155.221 bits (391), Expect = 2.484e-39
Identity = 170/667 (25.49%), Postives = 286/667 (42.88%), Query Frame = 2
Query:   77 ILYGSQTGQAKSIAENLYAKLKDYIKHINIFELDDVEKSFEIHKLNFAIIICSTTGDGDAPDNASKFLRLI--KIYQPKYLSNFKYTVLGLGDTNYSNFCNCSKTIDQILESKGARRFYRSDMADDA--VGLEIVVEPWLDGLYEIAKDMCSEIPIDGFQNLSXXXXXXXXXXXXXXNYKELLGDHLAKDMDGKNLTVPALPSPFLNIIYNNEDSISNFHEPLITSMPM-PSSDSELVMGEVQDITKITNKYAIKSVHRATINVPNAKWKWKPGDSVGILPFNAESEVDSILSRLSVPETEKNCVVXXXXXXXXXXXXAKVPEHLIVRENGKMSLKSILLWLCDLRQPLSKVGLRIMSEYCPMKSAEQRRLLELCSREGQS-FYTKCLRETSMPVLDLLNWFP--SCQIPIVRLLEVLPRLKPRAYSLCDLESVSFAFSK-----VDIAPIQTFRKRPLTGVCTSWMEKMAKFHNEQIWKIPIYLRKNMNGFTVCENPSIPHILIGPGTGVAPFIGFLQYFEKLKNENQNIGPIWLFFGCRNEERDFIFKKQLEHFANSGILTHLCVCFSRDNPTNSGDEQKNFCQPPNCKYVQHCLLHHSKILSDLLVNQNARVFVCGDSSGMSKDVLETWSNVLLGNHEKIQTKRDADSFITGMRVQKLYLEDVW 2038
            +L+GSQTG A+  AE L  + +       +  LD    +  I +    I +C+TTG GD PDN   F R I  K      L    + VLGLGD++Y+ F   +K + + L   G        + DD   +G +  ++PW+  L+E    M   +P+D                             + +   G    VP LPS F+        SI      + +S P  P S+ +  +  V    ++T     + V     ++ ++   +  GD V ILP N+E+        L +   + N    L+  E        +P+   V      +L S  L +  + +      L  +S++    + E+ +LLEL S  GQ   +  C R     +L++L  FP  +  IP   LL+++PR++PRA+S+    S   A  +     V +   QT  K P  G+C+SW+  +       + ++P+++R     F   + P  P I++G GTGVAPF   +Q  E++ +        +LFFGCR  ++DF ++ + +     G LT L   FSR+       EQK         YVQH L     ++ +LL  Q A  ++ G++  +  DV E   ++     E   +  DA +++  ++    +  + W
Sbjct:    8 VLFGSQTGTAQDEAERLGREARRRRLGCRVQALDSYSVANLIRE-PLVIFVCATTGQGDPPDNMKNFWRFIFRKSLPSSSLCQMDFAVLGLGDSSYAKFNFVAKKLHRRLLQLGGSALLPPCLGDDQHELGPDAAIDPWVGDLWEKIMVMYP-VPLD-----------------------------IPEIPHG----VP-LPSKFIFQFLQEVPSIGAEELNIASSAPQTPPSELQPFLAPVITNQRVTGPQHFQDVRLIEFDITDSNISFAAGDVVFILPSNSEAHTQQFCQVLCL---DPNQFFTLKPREPGVPDPPGLPQPCTV-----WNLVSQYLDIASVPRRSFFELLACLSQH----ALEREKLLELSSARGQEELWEYCSRPRRT-ILEVLCDFPHTAGAIPPDYLLDLIPRIRPRAFSIA---SSLLAHPRRLQILVAVVKYQTRLKEPRHGLCSSWLASLNPGQAGPV-RVPLWVRPGSLVFP--KTPDTPIIMVGAGTGVAPFRAAIQ--ERVAHGQTG---NFLFFGCRQRDQDFYWQTEWQKLEQKGWLT-LVTAFSREQ------EQK--------VYVQHRLRELGPLVWELLDGQGAYFYLAGNAKYLPTDVSEALMSIF--QEEGRLSTADASAYLARLQQTLRFQTETW 597          
BLAST of methionine synthase reductase vs. UniProt/SwissProt
Match: sp|Q8C1A3|MTRR_MOUSE (Methionine synthase reductase OS=Mus musculus OX=10090 GN=Mtrr PE=1 SV=2)

HSP 1 Score: 350.132 bits (897), Expect = 8.224e-109
Identity = 232/723 (32.09%), Postives = 377/723 (52.14%), Query Frame = 2
Query:   62 LKMTCILYGSQTGQAKSIAENLYAKLKDYIKHINIFELDDVEKSFEIHKLNFAIIICSTTGDGDAPDNASKFLRLI--KIYQPKYLSNFKYTVLGLGDTNYSNFCNCSKTIDQILESKGARRFYRSDMADDAVGLEIVVEPWLDGLYE-IAKDMCSEIPIDGFQNLSXXXXXXXXXXXXXXNYKELL--------------GD---------------------------HLAKDMDGKNLTVPALPSPFLNIIYNNEDSISNFHEPLITSMPMPSSDSELVMGEVQDITKITNKYAIKSVHRATINVPNAKWKWKPGDSVGILPFNAESEVDSILSRLSVPETEKNCVVXXXXXXXXXXXXAKVPEHLIVRENGKMSLKSILLWLCDLRQPLSKVGLRIMSEYCPMKSAEQRRLLELCSREGQSFYTKCLRETSMPVLDLLNWFPSCQIPIVRLLEVLPRLKPRAY-----SLCDLESVSFAFSKVDIAPIQTFRKRPLTGVCTSWMEKM-------------AKFHNEQIWKIPIYLRKNMNGFTVCENPSIPHILIGPGTGVAPFIGFLQYFEKLKNENQN--IGPIWLFFGCRNEERDFIFKKQLEHFANSGILTHLCVCFSRDNPTNSGDEQKNFCQPPNCKYVQHCLLHHSKILSDLLVNQNARVFVCGDSSGMSKDVLETWSNVLLGNHEKIQTKRDADSFITGMRVQKLYLEDVW 2038
            ++   +LY +Q GQAK+IAE +  +   +    ++  + + EK     +    +++ STTG GD PD A KF++ I  K     Y ++ +Y +LGLGD+ Y+ FCN  K ID+ L+  GA+RFY +  ADD VGLE+VVEPW+DGL+  + K   S   + G +N+S T   +           ELL              G+                           H    +   +L++PA+P  +L +  + ++S+            +PS D    +  +    ++T   A+KS     +++   ++  +PGDS  +   N++ EV+ +L RL + +   + V+     +  +   A +P H+     G+ SL+ IL W  ++R    K  LR ++E+    + E+RRL ELCS++G + Y + +R+ S+ +LDLL  FPSCQ P+  LLE LP+L+PR Y     SL   + + F F+ V+  P  T    P  GVCT W+  +             A   +    +I I  R   N F + E+PS P I++GPGTGVAPF+GFLQ+ EKL+ ++ +   G +WLFFGCR+++RD++F+++L HF  +G+LTHL V FSRD   + G+E          KYVQ  L  HS+ ++  L+ +N  ++VCGD+  M+KDV +T   ++  ++E    K +A   +  ++ +K YL+D+W
Sbjct:    1 MRRFLLLYATQRGQAKAIAEEISEQAVSHGFSADLHCISESEKYDLKTETGPLVMVVSTTGTGDPPDTARKFVKEIHNKTLPTDYFAHLRYGLLGLGDSEYTYFCNGGKVIDKRLQELGAQRFYDTGHADDCVGLELVVEPWIDGLWAALTKHFKS---LGGQENMSDTLSRASDAPLSTAMKPELLHIQSQVELLRLEDVGERDSELREQNETNRGQQGRIEDFDSSLVHSVPPLSQSSLSIPAVPPEYLEV--HLQESLGQEE----NQASVPSGDPSFQV-PISKAIRLTTNDAVKSTLLLELDISKIEFSHQPGDSFNVTCPNSDREVEELLQRLQLADKRAHRVILKIKTDTKKKGAA-LPAHV---PEGR-SLQFILTWCLEIRAVPKKAFLRALAEHT-SSATEKRRLQELCSKQGAADYNRFIRDASVCLLDLLLTFPSCQPPLSLLLEHLPKLQPRPYSCASSSLRHPDKLHFVFNIVEFPP-STTAASPRKGVCTGWLATLVAPFLQPNTDVSNADSGDTLAPEIRISPRAT-NAFHLPEDPSAPIIMVGPGTGVAPFVGFLQHREKLQEQHPDGKFGAMWLFFGCRHKDRDYLFREELRHFLKTGVLTHLKVSFSRDAAPD-GEEAP-------AKYVQDNLQRHSQQVARTLLQENGYIYVCGDAKNMAKDVNDTLIGII--SNEAGVDKLEAMKTLATLKQEKRYLQDIW 695          
BLAST of methionine synthase reductase vs. UniProt/SwissProt
Match: sp|Q4JIJ2|MTRR_BOVIN (Methionine synthase reductase OS=Bos taurus OX=9913 GN=MTRR PE=2 SV=1)

HSP 1 Score: 338.191 bits (866), Expect = 3.166e-104
Identity = 237/717 (33.05%), Postives = 372/717 (51.88%), Query Frame = 2
Query:   77 ILYGSQTGQAKSIAENLYAKLKDYIKHINIFELDDVEKSFEIHKLNFAIIICSTTGDGDAPDNASKFLRLIK--IYQPKYLSNFKYTVLGLGDTNYSNFCNCSKTIDQILESKGARRFYRSDMADDAVGLEIVVEPWLDGLYEIAKD--MCSEIPIDGFQNLSXXXXXXXXXXXXXXNYKE-LLGDHLAKDMDGKNLTVPALPSPFLNIIYNNEDS--ISNFHEPLITSMPMPSSDS---------------ELVMGE-----------------VQDITKITNKYAIKSVHRATINVPNAKWKWKPGDSVGILPFNAESEVDSILSRLSVPETEKNCVVXXXXXXXXXXXXAKVPEHLIVRENGKMSLKSILLWLCDLRQPLSKVGLRIMSEYCPMKSAEQRRLLELCSREGQSFYTKCLRETSMPVLDLLNWFPSCQIPIVRLLEVLPRLKPRAYSLCDLES------VSFAFSKVDIAPIQT---FRKRPLTGVCTSWMEKMAKF-------------HNEQIWKIPIYLRKNMNGFTVCENPSIPHILIGPGTGVAPFIGFLQYFEKLKNEN--QNIGPIWLFFGCRNEERDFIFKKQLEHFANSGILTHLCVCFSRDNPTNSGDEQKNFCQPPNCKYVQHCLLHHSKILSDLLVNQNARVFVCGDSSGMSKDVLETWSNVLLGNHEKIQTKRDADSFITGMRVQKLYLEDVW 2038
            +LY +Q GQAK+IAE +  K   Y    ++  + + +K     +    +++ STTG+GD PD A KF++ IK     P +L++ +Y +LGLGD+ Y+ FCN  K ID+ L+  GA+RFY +  ADD VGLE+VVEPW++GL+   +   + +    D  + L++    S+  + P   + E  +G     D  GK   V        N + +N+ S  I +F   L  S+P  S  S               E  +G+                 V    ++T   AIK+     +++    + ++PGD+  ++  N++SEV  +L RL + +  ++ V      +  +   A +P+H+  R     SL+ +L W  ++R    K  LR ++++    SAE+RRL ELCSR+G + YT+ +RE    + DLL  FPSCQ P+  LLE LP+L+PR YS C   S      + F F+ V+     T    R+    GVCT W+  + +                    KI I  R   N F + ++PS+P I++GPG GVAPFIGFLQ+ EKL+ ++   + G  WLFFGCR++ERD++F+ +L HF   G+LTHL V FSRD     G+E+         KYVQ  L  HSK ++ +L+  +  V+VCGD+  M+KDV +    ++  + E    K +A   +  ++ +K YL+D+W
Sbjct:    6 LLYATQRGQAKAIAEEISEKAVTYGFSADLHCISESDKYDLKTETAPLVMVVSTTGNGDPPDTARKFVKAIKDKTLPPDFLAHLRYGLLGLGDSEYTYFCNGGKVIDKRLQELGAQRFYDTGHADDCVGLELVVEPWINGLWAALEKHFLSNRGREDTSETLTMASHASRDAVTPELLHVESQVGLLKLDDSGGKAAKVLE-----QNAVNSNQSSTLIVDFEASLTHSVPPLSQASLNIPSLPPEYLEVHLEEALGQEESHASVSLVDPVFHVPVSKAVQLTTNDAIKTTLLIELDISKTDFSYQPGDAFNVICPNSDSEVQFLLQRLQLADRREHHVAVTIKADTRKKGAA-LPQHVPER----CSLQFLLTWCLEIRAVPKKAFLRALADHT-GDSAERRRLQELCSRQGAADYTRFVREAGACLSDLLRAFPSCQPPLGLLLEHLPKLQPRPYS-CASSSLFHPGKLHFIFNIVEFLSNTTEVILRR----GVCTGWLATLVESILQPYMCANHVDGKKALAPKISISPR-TTNSFHLPDDPSVPIIMVGPGAGVAPFIGFLQHREKLQEQHPGGHFGATWLFFGCRHKERDYLFRDELRHFLKCGVLTHLEVSFSRD--VAVGEEEG------PAKYVQDSLQRHSKQVAGVLLQDSGYVYVCGDAKNMAKDVHDALVEII--SRETGVEKLEAMKTLATLKEEKRYLQDIW 695          
BLAST of methionine synthase reductase vs. UniProt/SwissProt
Match: sp|Q9UBK8|MTRR_HUMAN (Methionine synthase reductase OS=Homo sapiens OX=9606 GN=MTRR PE=1 SV=4)

HSP 1 Score: 334.724 bits (857), Expect = 5.318e-103
Identity = 240/724 (33.15%), Postives = 381/724 (52.62%), Query Frame = 2
Query:   62 LKMTCILYGSQTGQAKSIAENL--YAKLKDYIKHIN-IFELDDVEKSFEIHKLNFAIIICSTTGDGDAPDNASKFLRLIK--IYQPKYLSNFKYTVLGLGDTNYSNFCNCSKTIDQILESKGARRFYRSDMADDAVGLEIVVEPWLDGLYEIAK----------DMCSEIPIDGFQNLSXXXXXXXXXXXXXXNYKELLGDHLAKDMDGKNLTVPALPSPFLNIIYNN-EDSISNFHEPLI-TSMPMPSSDSELVMGEVQD------------------------ITKITNKYAIKSVHRATINVPNAKWKWKPGDSVGILPFNAESEVDSILSRLSVPETEKNCVVXXXXXXXXXXXXAKVPEHLIVRENGKMSLKSILLWLCDLRQPLSKVGLRIMSEYCPMKSAEQRRLLELCSREGQSFYTKCLRETSMPVLDLLNWFPSCQIPIVRLLEVLPRLKPRAYSLCDLESV------SFAFSKVDI---APIQTFRKRPLTGVCTSWMEKMAK------FHNEQ-------IWKIPIYLRKNMNGFTVCENPSIPHILIGPGTGVAPFIGFLQYFEKLKNE--NQNIGPIWLFFGCRNEERDFIFKKQLEHFANSGILTHLCVCFSRDNPTNSGDEQKNFCQPPNCKYVQHCLLHHSKILSDLLVNQNARVFVCGDSSGMSKDVLETWSNVLLGNHEKIQTKRDADSFITGMRVQKLYLEDVW 2038
            ++   +LY +Q GQAK+IAE +   A +  +   ++ I E D  +   E   L   +++ STTG GD PD A KF++ I+       + ++ +Y +LGLGD+ Y+ FCN  K ID+ L+  GAR FY +  ADD VGLE+VVEPW+ GL+   +          ++   +P+      S    + K E+  IE+  ELL    +   D + L   A+ S   N++  + E S++    PL   S+ +P    E +   +Q+                          ++T   AIK+     +++ N  + ++PGD+  ++  N++SEV S+L RL + +  ++CV+     +  +   A +P+H+        SL+ I  W  ++R    K  LR + +Y    SAE+RRL ELCS++G + Y++ +R+    +LDLL  FPSCQ P+  LLE LP+L+PR YS C   S+       F F+ V+    A  +  RK    GVCT W+  +         H            KI I  R   N F + ++PSIP I++GPGTG+APFIGFLQ+ EKL+ +  + N G +WLFFGCR+++RD++F+K+L HF   GILTHL V FSRD P   G+E+         KYVQ  +  H + ++ +L+ +N  ++VCGD+  M+KDV +    ++  + E    K +A   +  ++ +K YL+D+W
Sbjct:    1 MRRFLLLYATQQGQAKAIAEEICEQAVVHGFSADLHCISESDKYDLKTETAPL---VVVVSTTGTGDPPDTARKFVKEIQNQTLPVDFFAHLRYGLLGLGDSEYTYFCNGGKIIDKRLQELGARHFYDTGHADDCVGLELVVEPWIAGLWPALRKHFRSSRGQEEISGALPVAS--PASSRTDLVKSELLHIESQVELLRFDDSGRKDSEVLKQNAVNSNQSNVVIEDFESSLTRSVPPLSQASLNIPGLPPEYLQVHLQESLGQEESQVSVTSADPVFQVPISKAVQLTTNDAIKTTLLVELDISNTDFSYQPGDAFSVICPNSDSEVQSLLQRLQLEDKREHCVLLKIKADTKKKG-ATLPQHI----PAGCSLQFIFTWCLEIRAIPKKAFLRALVDYT-SDSAEKRRLQELCSKQGAADYSRFVRDACACLLDLLLAFPSCQPPLSLLLEHLPKLQPRPYS-CASSSLFHPGKLHFVFNIVEFLSTATTEVLRK----GVCTGWLALLVASVLQPNIHASHEDSGKALAPKISISPR-TTNSFHLPDDPSIPIIMVGPGTGIAPFIGFLQHREKLQEQHPDGNFGAMWLFFGCRHKDRDYLFRKELRHFLKHGILTHLKVSFSRDAPV--GEEEA------PAKYVQDNIQLHGQQVARILLQENGHIYVCGDAKNMAKDVHDALVQII--SKEVGVEKLEAMKTLATLKEEKRYLQDIW 697          
BLAST of methionine synthase reductase vs. UniProt/SwissProt
Match: sp|Q17574|MTRR_CAEEL (Methionine synthase reductase OS=Caenorhabditis elegans OX=6239 GN=mtrr-1 PE=3 SV=1)

HSP 1 Score: 268.855 bits (686), Expect = 2.209e-78
Identity = 212/720 (29.44%), Postives = 352/720 (48.89%), Query Frame = 2
Query:   50 LCDFLKMTCILYGSQTGQAKSIAENLYAKLKDYIKHINIFELDDVEKSFEIHKLNFAIIICSTTGDGDAPDNASKFLRLIK--IYQPKYLSNFKYTVLGLGDTNYSNFCNCSKTIDQILESKGARRFYRSDMADDAVGLEIVVEPWLDGLYEIAKDMCSEIPIDGFQNLSXXXXXXXXXXXXXXNYKELL--------------GDHLAKDM---------------------DGKNLTVPALPSPFLNIIYNNEDSISNFHEPLITSM------PMPSSDSELVMGEVQDITKITNKYA--IKSVHRATINVPN--AKWKWKPGDSVGILPFNAESEVDSILSRLSVPE-TEKNCVVXXXXXXXXXXXXAKVPEHLIVRENGKMSLKSILLWLCDLRQPLSKVGLRIMSEYCPMKSAEQRRLLELCSREGQSFYTKCLRETSMPVLDLLNWFPSCQIPIVRLLEVLPRLKPRAYSLCDLES--VSFAFSKVDIAPIQTFRKRPLTGVCTSWMEKMAKFHNEQIW-KIPIYLRKNMNGFTVCENPSIPHILIGPGTGVAPFIGFLQYFEKLKNENQN---IGPIWLFFGCRNEERDFIFKKQLEHFANSGILTHLCVCFSRDNPTNSGDEQKNFCQPPNCKYVQHCLLHH-SKILSDLLVNQNARVFVCGDSSGMSKDVLETWSNVLLGNH--EKIQTKRDADSFITGMRVQKLYLEDVW 2038
            + DFL    I +GSQTGQA++IA++L  K +       +  LD+ EK F +++     I+ S+TGDGDAPDN ++F+R I     + +YL N  Y +LGLGD+NYS++    + ID+ L + GA R +    ADD VGLE+ VEPW++  +        +I  D    ++ +  +   ++K  E  K LL              G  +  DM                     + +NL VP  P PF+        S+SN   P  T +       MP   ++     V     +T+ ++  IK+    T++  +  A+ +++PGD++     N   EV+ IL R  V +  ++ C + +       N  A++P H+    +   +L+ +     D+R+   +  +R+++E       E+RRLLELCS +G   +T  +R   + + D+L  FP+ + P+ RL+E+LPRL PR YS+   E+      +S+++  P    R+    G+ T W+  +      Q+  K P   R    G T      +P +++GPGTGV+ F+ FL +  KLK ++ +     P  LFFGCR+   D I+  +LE F + GILT L +C S         EQK        + VQ  L  +  K+L  L  +  +++F+CGD+ GMSKDV + +S+++  +     ++ K+     +  ++    Y+EDVW
Sbjct:    1 MTDFL----IAFGSQTGQAETIAKSLKEKAELIGLTPRLHALDENEKKFNLNEEKLCAIVVSSTGDGDAPDNCARFVRRINRNSLENEYLKNLDYVLLGLGDSNYSSYQTIPRKIDKQLTALGANRLFDRAEADDQVGLELEVEPWIEKFFATLASRF-DISADKMNAITESSNLKLNQVKTEEEKKALLQKRIEDEESDDEGRGRVIGIDMLIPEHYDYPEISLLKGSQTLSNDENLRVPIAPQPFIV------SSVSNRKLPEDTKLEWQNLCKMPGVVTKPFEVLVVSAEFVTDPFSKKIKTKRMITVDFGDHAAELQYEPGDAIYFCVPNPALEVNFILKRCGVLDIADQQCELSINPKTEKIN--AQIPGHV----HKITTLRHMFTTCLDIRRAPGRPLIRVLAESTS-DPNEKRRLLELCSAQGMKDFTDFVRTPGLSLADMLFAFPNVKPPVDRLIELLPRLIPRPYSMSSYENRKARLIYSEMEF-PATDGRRHSRKGLATDWLNSLRIGDKVQVLGKEPARFRLPPLGMTKNSAGKLPLLMVGPGTGVSVFLSFLHFLRKLKQDSPSDFVDVPRVLFFGCRDSSVDAIYMSELEMFVSEGILTDLIICES---------EQKG-------ERVQDGLRKYLDKVLPFLTASTESKIFICGDAKGMSKDVWQCFSDIVASDQGIPDLEAKKK----LMDLKKSDQYIEDVW 681          
BLAST of methionine synthase reductase vs. UniProt/SwissProt
Match: sp|Q498R1|MTRR_RAT (Methionine synthase reductase OS=Rattus norvegicus OX=10116 GN=Mtrr PE=2 SV=2)

HSP 1 Score: 249.595 bits (636), Expect = 3.622e-71
Identity = 160/483 (33.13%), Postives = 268/483 (55.49%), Query Frame = 2
Query:  647 NLTVPALPSPFLNIIYNNEDSISNFHEPLITSMPMPSSDSELVMGEVQDITKITNKYAIKSVHRATINVPNAKWKWKPGDSVGILPFNAESEVDSILSRLSVPETEKNCVVXXXXXXXXXXXXAKVPEHLIVRENGKMSLKSILLWLCDLRQPLSKVGLRIMSEYCPMKSAEQRRLLELCSREGQSFYTKCLRETSMPVLDLLNWFPSCQIPIVRLLEVLPRLKPRAY-----SLCDLESVSFAFSKVDIAPIQTFRKRPLTGVCTSWM------------EKMAKFHNEQIWKIPIYLRKNMNGFTVCENPSIPHILIGPGTGVAPFIGFLQYFEKLKNE--NQNIGPIWLFFGCRNEERDFIFKKQLEHFANSGILTHLCVCFSRDNPTNSGDEQKNFCQPPNCKYVQHCLLHHSKILSDLLVNQNARVFVCGDSSGMSKDVLETWSNVLLGNHEKIQTKRDADSFITGMRVQKLYLEDVW 2038
            +L++PA+   +L + Y  E    + ++    S+P PS D  +    +    ++T   AIK+     +++   ++  +PGDS  ++  N+ SEV+ +L RL + + + + V+    ++  +   A +P+H  V E    SL+ I  W  ++R    K  LR +S+Y    + E+RRL ELCS++G + Y + +R+ S+ +LDLL  FPSCQ P+  LLE LP+L+PR Y     SL   + + F F+ V++ P  T       GVCT W+            E +   H++ +    +   +  N F + ++ S P I++GPGTGVAPF+GFLQ+ EKL+ +  + N G +WLFFGCR+++RD++F+++L HF  +G+LTHL V FSRD      +E          KYVQ  L HHS+ ++  L+ +N  ++VCGD+  M+KDV +    ++  + E    K +A   +  ++ +K YL+D+W
Sbjct:  239 SLSIPAVSPEYLEV-YLQESLGQDENQ---ASVP-PSVDP-IFQVPISKAVELTTNDAIKTTLLLELDISKVEFSHQPGDSFNVICPNSGSEVEDLLQRLQLADKQAHRVILKIKMDTKKKG-ASLPQH--VPEGS--SLQFIFTWCLEIRAVPKKAFLRALSDYTS-DATEKRRLQELCSKQGAADYNRFIRDASVCLLDLLLTFPSCQPPLNLLLEHLPKLQPRPYSCASSSLLHPDKLHFVFNIVEL-PSNTTAASLRKGVCTGWLATLVAPFLQPNTEVLTADHSDALAPEILISPRATNSFHLPDDLSAPIIMVGPGTGVAPFVGFLQHREKLQEQHPDGNFGAMWLFFGCRHKDRDYLFREELRHFLKTGVLTHLKVSFSRDAAPEEEEEAPA-------KYVQDNLQHHSQQVARTLLQENGYIYVCGDAKNMAKDVHDALVEII--SKEAGVDKLEAMKTLATLKQEKRYLQDIW 699          

HSP 2 Score: 113.62 bits (283), Expect = 1.037e-24
Identity = 58/147 (39.46%), Postives = 89/147 (60.54%), Query Frame = 2
Query:   62 LKMTCILYGSQTGQAKSIAENLYAKLKDYIKHINIFELDDVEKSFEIHKLNFAIIICSTTGDGDAPDNASKFLRLI--KIYQPKYLSNFKYTVLGLGDTNYSNFCNCSKTIDQILESKGARRFYRSDMADDAVGLEIVVEPWLDGLY 496
            ++   +LY +Q GQAK+IAE +  +   +    ++  + + EK     +    +++ STTG GD PD A KF++ I  K     + ++  Y +LGLGD+ Y+ FCN  K ID+ L+  GA+ FY +  ADD VGLE+VVEPW+DGL+
Sbjct:    1 MRRFLLLYATQRGQAKAIAEEISEQALSHGFSADLHCVSESEKYDLKTETGPLVMVVSTTGTGDPPDTARKFVKEIHNKTLPTDFFAHLWYGLLGLGDSEYTYFCNGGKVIDKRLQELGAQHFYDTGHADDCVGLELVVEPWIDGLW 147          
BLAST of methionine synthase reductase vs. TrEMBL
Match: C3XSJ5 (Uncharacterized protein OS=Branchiostoma floridae OX=7739 GN=BRAFLDRAFT_282133 PE=4 SV=1)

HSP 1 Score: 408.683 bits (1049), Expect = 9.910e-129
Identity = 241/705 (34.18%), Postives = 394/705 (55.89%), Query Frame = 2
Query:   77 ILYGSQTGQAKSIAENLYAKLKDYIKHINIFELDDVEKSFEIHKLNFAIIICSTTGDGDAPDNASKFLRLIK--IYQPKYLSNFKYTVLGLGDTNYSNFCNCSKTIDQILESKGARRFYRSDMADDAVGLEIVVEPWLDGLY-EIAKDMCSEIPIDGFQNLSXXXXXXXXXXXXXXNYKEL-------LGDHLAKD--------MDG------------------KNLTVPALPSPFLNIIYNNEDSISNFHEPLITSMPMPSSDSELVMGEVQDITKITNKYAIKSVHRATINVPNAKWKWKPGDSVGILPFNAESEVDSILSRLSVPETEKNCVVXXXXXXXXXXXXAKVPEHLIVRENGKMSLKSILLWLCDLRQPLSKVGLRIMSEYCPMKSAEQRRLLELCSREGQSFYTKCLRETSMPVLDLLNWFPSCQIPIVRLLEVLPRLKPRAY-----SLCDLESVSFAFSKVDIAPIQTFRKRPLTGVCTSWMEKMAKFHNEQIW-------KIPIYLRK-NMNGFTVCENPSIPHILIGPGTGVAPFIGFLQYFEKLKNENQNI--GPIWLFFGCRNEERDFIFKKQLEHFANSGILTHLCVCFSRDNPTNSGDEQKNFCQPPNCKYVQHCLLHHSKILSDLLVNQNARVFVCGDSSGMSKDVLETWSNVLLGNHEKIQTKRDADSFITGMRVQKLYLEDVW 2038
            +LYGSQTGQAK+IAE ++   + +    ++F L+  EK F++ K +  + +CSTTGDGD PDNA+KF R +K       +L++  + VLGLGD+NY+NFCNC KT+D+ L+  GA+ FY +  ADDAVGLEIVV+PW++GL+  + K + +EI       +S ++          ++  +        L D   KD         DG                    LT+PA   P+L + ++ E+S+     PL +  P PS+ +++VM  V   T++T   A+K+     +++ +  +K++PGDS G++  N E+EV  ++ RL + +   +     ++++  + R A VP HL  R     +++  LL   ++R    K  LR++ E+    + ++RRL ELCS++G + Y   +RE ++ +LD+L  FPSC  P  RLLE+LPRL+PR Y      L   + + F F+ V I P  + R  P TGVCT W++++       ++       K+   + +   N F +  + S+P I++GPGTGVAPF+GFLQ+ EK +  + +   GP WLF+GCR+ +RD++++++LE  A +G+L HL VCFSR+ P     +       P  +YVQ  L HH   +  +L+++ A ++VCGD+  M+KDV E  + ++     K+   R+    +  +R  + Y+ED+W
Sbjct:   13 LLYGSQTGQAKAIAEEIHENAEKHGLRTDLFGLELTEKKFDVTKESCVVFVCSTTGDGDPPDNATKFFRRLKKKTLPSDHLAHLNFAVLGLGDSNYTNFCNCPKTLDKRLQELGAKPFYPTGYADDAVGLEIVVDPWIEGLWTAVRKQLGTEINGQRDDKVSESQSEIVAVKSCEDSTNDRTSTAYTDLADVADKDTHSIVPENQDGVIQQAGPSLRVSAPPLCDSGLTLPAKSVPYLEVEFHPEESLL----PLQSGCPFPSAAADVVMATVTMATRLTRHDAVKTALDIELDILDTSFKYEPGDSFGVVCPNDETEVQDLIDRLGLTD-HADTTFSAKVIKGTKKRAAAVPAHLPAR----CTIRYALLTCLEIRAVPKKAFLRMLVEHT-SDAVQKRRLQELCSKQGTADYAAFIREPNLRLLDVLTAFPSCCPPFERLLEMLPRLQPRPYSVSSSPLVSPDRLHFVFNIVHI-PSGSGRAAPCTGVCTGWLDRLTGHMQTGVYVGMAEEDKVAEKIGQITNNHFRLPSDLSVPIIMVGPGTGVAPFVGFLQHREKQREISHDAVCGPSWLFYGCRHRDRDYLYREELERLAAAGVLDHLVVCFSREEPVTMETDGA-----PPARYVQDNLHHHGDDVGRMLLDEGAVLYVCGDAKNMAKDVNEVITQIVQKYKGKLSEARNT---VFQLRQDRHYIEDIW 698          
BLAST of methionine synthase reductase vs. TrEMBL
Match: A0A2D0PRR0 (methionine synthase reductase OS=Ictalurus punctatus OX=7998 GN=mtrr PE=4 SV=1)

HSP 1 Score: 371.703 bits (953), Expect = 1.661e-114
Identity = 240/715 (33.57%), Postives = 386/715 (53.99%), Query Frame = 2
Query:   77 ILYGSQTGQAKSIAENLYAKLKDYIKHINIFELDDVEKSFEIHKLNFAIIICSTTGDGDAPDNASKFLRLIKIYQ-PK-YLSNFKYTVLGLGDTNYSNFCNCSKTIDQILESKGARRFYRSDMADDAVGLEIVVEPWLDGLYEIAKDMCSEIPI----------DGFQ------NLSXXXXXXXXXXXXXXNYKELLGDHLAKDMDGK-----------------NLTVPALPSPFLNIIYNNEDSISNFHEPLITSMPMPSSDSELVMGEVQDI-----TKITNKYAIKSVHRATINVPNAKWKWKPGDSVGILPFNAESEVDSILSRLSVPETEKNCVVXXXXXXXXXXXXAKVPEHLIVRENGKMSLKSILLWLCDLRQPLSKVGLRIMSEYCPMKSAEQRRLLELCSREGQSFYTKCLRETSMPVLDLLNWFPSCQIPIVRLLEVLPRLKPRAYSLCDLE-----SVSFAFSKVDIAPIQTFRKRPLTGVCTSWME------------KMAKFHNEQIWKIP-IYLRKNMNG-FTVCENPSIPHILIGPGTGVAPFIGFLQYFEKLKNENQN--IGPIWLFFGCRNEERDFIFKKQLEHFANSGILTHLCVCFSRDNPTNSGDEQKNFCQPPNCKYVQHCLLHHSKILSDLLVNQNARVFVCGDSSGMSKDVLETWSNVLLGNHEKIQTKRDADSFITGMRVQKLYLEDVW 2038
            ILYGSQ GQA+SIAE L  +  ++    ++  L   +K     + N  + + STTGDG+ PD A KF+R IK    P+ + S+  Y +L LGDTNY++FCNC KTID+ L+  GA  FY + +ADD  GLE+V++PW+DGL++  K + +++P           DG Q       L  T +  K+      +  +   +   + +D +                 +L++PALP  +L + + +              +P    ++ +V      +      ++T   A+K      +++ N    ++PGD+  +L  N E+EV+ +L RLS+ + +KN  V L+LL+  + + A+VP ++      K +L+ +L W  ++R    K  LR + + C  ++ E+RRL ELCSREG + Y + +R+ S+ +LDLL  FPSC  P+  L+E LP+L+PRAYS           V   FS V         +R  TG+CT W+             K A   +     +P +++   +N  F +  +P++P +++GPG+GVAPF+GFLQ  EK +  NQ+   G  WLFFGCR+++RDFIF+++LE FA    L+ L VCFSR  P  SG E     +P   KYVQH LL H++ ++ +L+ +N R++VCGD+  M+KDV +T   + +G   ++  K ++   +  +R +K YL+D+W
Sbjct:   12 ILYGSQKGQAQSIAEQLADQAAEHGFEADVSCLSQADKYNLEKEHNPVVFVVSTTGDGEPPDTALKFVRSIKKKSLPRDHFSHLHYGLLALGDTNYTDFCNCGKTIDRRLQELGANHFYETGLADDGTGLEVVLDPWIDGLWDALKKIFAKMPASDLIRSISLSDGHQLVAAQEKLESTARSLKLLDISDVDAGKFKPESETESLDAETPLEASLNRSIAPLSQSSLSIPALPPSYLEVCFGD--------------VPTGEEEAHVVARGFHAVPISRAVRLTRDDAVKPAILLELDIKNENVSYQPGDAFDLLCPNRETEVEDLLHRLSLRD-KKNHSVHLQLLKTTKKKGARVPPYI----TEKCTLQYLLTWCLEIRSIPKKAFLRSLVD-CTQQAQEKRRLQELCSREGAADYDRFVRKPSVCILDLLRAFPSCTPPLSLLIEHLPKLQPRAYSAASSSLRHPGKVHIVFSVVRFPACAEHPER--TGLCTGWLADRVSTIIEPYGTKQASRESVDYAALPKVHISPRLNNTFRLPSDPTVPMVMVGPGSGVAPFVGFLQQREKERERNQDGAFGETWLFFGCRHKDRDFIFREELERFAEDKTLSRLKVCFSRAEPDRSGSE----AEP---KYVQHNLLLHAEHVARVLLKENGRLYVCGDAKNMAKDVNDTLMEI-IGAGLQVD-KLESMKTVAKLREEKRYLQDIW 695          
BLAST of methionine synthase reductase vs. TrEMBL
Match: F1RE28 (5-methyltetrahydrofolate-homocysteine methyltransferase reductase OS=Danio rerio OX=7955 GN=mtrr PE=4 SV=2)

HSP 1 Score: 370.933 bits (951), Expect = 2.580e-114
Identity = 248/723 (34.30%), Postives = 387/723 (53.53%), Query Frame = 2
Query:   53 CDFLKMTCILYGSQTGQAKSIAENLYAKLKDYIKHINIFELDDVEKSFEIHKLNFAIIICSTTGDGDAPDNASKFLRLIK--IYQPKYLSNFKYTVLGLGDTNYSNFCNCSKTIDQILESKGARRFYRSDMADDAVGLEIVVEPWLDGLYEIAKDMCSEIPI-------------------DGFQNLSXXXXXXXXXXXXXXNYKELLGDHLAKDMDGKN----------------LTVPALPSPFLNIIYNNEDSISNFHEPLITSMPMPSSDSELVMGEVQDITKITNKYAIKSVHRATINVPNAKWK-WKPGDSVGILPFNAESEVDSILSRLSVPETEKNCVVXXXXXXXXXXXXAKVPEHLIVRENGKMSLKSILLWLCDLRQPLSKVGLRIMSEYCPMKSAEQRRLLELCSREGQSFYTKCLRETSMPVLDLLNWFPSCQIPIVRLLEVLPRLKPRAYSLCDLE-----SVSFAFSKVDIA--PIQTFRKRPLTGVCTSWM----EKMAKFHNEQIW----------KIPIYLRKNMNGFTVCENPSIPHILIGPGTGVAPFIGFLQYFEKLKNENQ--NIGPIWLFFGCRNEERDFIFKKQLEHFANSGILTHLCVCFSRDNPTNSGDEQKNFCQPPNCKYVQHCLLHHSKILSDLLVNQNARVFVCGDSSGMSKDVLETWSNVLLGNHEKIQTKRDADSFITGMRVQKLYLEDVW 2038
            C+      ILYGSQ GQA+SIAE +  +  ++    +I  L   +K     +    + + STTGDGD PD A KF+R IK       +LS+ +Y +LGLGDTNY+NFCN  KTID  L+  GA+ FY +  ADD  GLE+VV+PW++GL++  K   S +                     D  +NL +  ++ K+        K +  D +A ++   +                L VPALP  +L I+    +++            +P  D    +  +    ++T   A+K+     +++   + + ++PGD+  IL  N +SEV+ +L +L + + +KNC V++ LL+N   + AKVP H  + +NG  SL+ IL W  ++R    K  LR + ++    ++E+RRLLELCS++G + Y   +R++S+ VLDLL  FPSC  P+  L E LP+L+PRAYS           V   F+ V+    P    RK    G+CT W+      + + H   +           K+ +  R + + F +  +P +P +++GPGTGVAPFIGFLQ  EK +  NQ    G +WLFFGCR++++DF+F+++LE F ++G L+HL VCFSRD P    D  +   +P    YVQH L+ H+K L+ +L+     ++VCGD+  M+KDV +T   + +GN  ++  K DA   + G+R  K YL+D+W
Sbjct:    3 CEAAAHFLILYGSQRGQAQSIAEEICQQAAEHGFTADISCLSKHDKYNLDSESRPVVFVVSTTGDGDPPDTALKFVRKIKNKSLPHDHLSHLRYALLGLGDTNYANFCNGGKTIDSYLQKLGAKHFYATGHADDGTGLEVVVDPWIEGLWDALKKAFSTMSTSDQQTLSDCTQDSNHQNASDQKKNLEVDLQLLKLSEVDSPKGKTVTSDSIATEIGSTSSVASLKESVPPLSESVLNVPALPPSYLEILLVGTENVEE--------TVLPDKDGYFEV-PISKAVQLTQDDAVKTAILLELDISQQQEQVYQPGDAFDILCPNRDSEVEELLLKLDL-QMQKNCTVQVNLLKNTSKKAAKVPLH--IPQNG--SLQFILTWCLEIRSTPKKAFLRALVDFT-QNASEKRRLLELCSKQGSADYNSFVRDSSVCVLDLLRAFPSCCPPLSLLFEHLPKLQPRAYSAASSSLQHPGKVHLVFNVVEFPARPEHPARK----GLCTGWLVDHVSSILEPHGTALASERPGTSALPKVHVRARPS-STFHLPSDPCVPVVMVGPGTGVAPFIGFLQQREKEREANQEATFGEMWLFFGCRHKDKDFLFREELEKFVHNGTLSHLIVCFSRDEP----DAAETVNRP---TYVQHNLILHAKNLAKILLEDKGCLYVCGDAKNMAKDVNDTLLEI-IGNELQLD-KLDAMKIVAGLREDKRYLQDIW 696          
BLAST of methionine synthase reductase vs. TrEMBL
Match: A0A2R8QQ95 (5-methyltetrahydrofolate-homocysteine methyltransferase reductase OS=Danio rerio OX=7955 GN=mtrr PE=4 SV=1)

HSP 1 Score: 371.318 bits (952), Expect = 3.197e-114
Identity = 249/731 (34.06%), Postives = 390/731 (53.35%), Query Frame = 2
Query:   29 FVYIMHLLCDFLKMTCILYGSQTGQAKSIAENLYAKLKDYIKHINIFELDDVEKSFEIHKLNFAIIICSTTGDGDAPDNASKFLRLIK--IYQPKYLSNFKYTVLGLGDTNYSNFCNCSKTIDQILESKGARRFYRSDMADDAVGLEIVVEPWLDGLYEIAKDMCSEIPI-------------------DGFQNLSXXXXXXXXXXXXXXNYKELLGDHLAKDMDGKN----------------LTVPALPSPFLNIIYNNEDSISNFHEPLITSMPMPSSDSELVMGEVQDITKITNKYAIKSVHRATINVPNAKWK-WKPGDSVGILPFNAESEVDSILSRLSVPETEKNCVVXXXXXXXXXXXXAKVPEHLIVRENGKMSLKSILLWLCDLRQPLSKVGLRIMSEYCPMKSAEQRRLLELCSREGQSFYTKCLRETSMPVLDLLNWFPSCQIPIVRLLEVLPRLKPRAYSLCDLE-----SVSFAFSKVDIA--PIQTFRKRPLTGVCTSWM----EKMAKFHNEQIW----------KIPIYLRKNMNGFTVCENPSIPHILIGPGTGVAPFIGFLQYFEKLKNENQ--NIGPIWLFFGCRNEERDFIFKKQLEHFANSGILTHLCVCFSRDNPTNSGDEQKNFCQPPNCKYVQHCLLHHSKILSDLLVNQNARVFVCGDSSGMSKDVLETWSNVLLGNHEKIQTKRDADSFITGMRVQKLYLEDVW 2038
            F    ++ C+      ILYGSQ GQA+SIAE +  +  ++    +I  L   +K     +    + + STTGDGD PD A KF+R IK       +LS+ +Y +LGLGDTNY+NFCN  KTID  L+  GA+ FY +  ADD  GLE+VV+PW++GL++  K   S +                     D  +NL +  ++ K+        K +  D +A ++   +                L VPALP  +L I+    +++            +P  D    +  +    ++T   A+K+     +++   + + ++PGD+  IL  N +SEV+ +L +L + + +KNC V++ LL+N   + AKVP H  + +NG  SL+ IL W  ++R    K  LR + ++    ++E+RRLLELCS++G + Y   +R++S+ VLDLL  FPSC  P+  L E LP+L+PRAYS           V   F+ V+    P    RK    G+CT W+      + + H   +           K+ +  R + + F +  +P +P +++GPGTGVAPFIGFLQ  EK +  NQ    G +WLFFGCR++++DF+F+++LE F ++G L+HL VCFSRD P    D  +   +P    YVQH L+ H+K L+ +L+     ++VCGD+  M+KDV +T   + +GN  ++  K DA   + G+R  K YL+D+W
Sbjct:    9 FSSFYNMPCEAAAHFLILYGSQRGQAQSIAEEICQQAAEHGFTADISCLSKHDKYNLDSESRPVVFVVSTTGDGDPPDTALKFVRKIKNKSLPHDHLSHLRYALLGLGDTNYANFCNGGKTIDSYLQKLGAKHFYATGHADDGTGLEVVVDPWIEGLWDALKKAFSTMSTSDQQTLSDCTQDSNHQNASDQKKNLEVDLQLLKLSEVDSPKGKTVTSDSIATEIGSTSSVASLKESVPPLSESVLNVPALPPSYLEILLVGTENVEE--------TVLPDKDGYFEV-PISKAVQLTQDDAVKTAILLELDISQQQEQVYQPGDAFDILCPNRDSEVEELLLKLDL-QMQKNCTVQVNLLKNTSKKAAKVPLH--IPQNG--SLQFILTWCLEIRSTPKKAFLRALVDFT-QNASEKRRLLELCSKQGSADYNSFVRDSSVCVLDLLRAFPSCCPPLSLLFEHLPKLQPRAYSAASSSLQHPGKVHLVFNVVEFPARPEHPARK----GLCTGWLVDHVSSILEPHGTALASERPGTSALPKVHVRARPS-STFHLPSDPCVPVVMVGPGTGVAPFIGFLQQREKEREANQEATFGEMWLFFGCRHKDKDFLFREELEKFVHNGTLSHLIVCFSRDEP----DAAETVNRP---TYVQHNLILHAKNLAKILLEDKGCLYVCGDAKNMAKDVNDTLLEI-IGNELQLD-KLDAMKIVAGLREDKRYLQDIW 710          
BLAST of methionine synthase reductase vs. TrEMBL
Match: W5U6V5 (Methionine synthase reductase OS=Ictalurus punctatus OX=7998 GN=Mtrr PE=2 SV=1)

HSP 1 Score: 370.548 bits (950), Expect = 3.490e-114
Identity = 240/715 (33.57%), Postives = 385/715 (53.85%), Query Frame = 2
Query:   77 ILYGSQTGQAKSIAENLYAKLKDYIKHINIFELDDVEKSFEIHKLNFAIIICSTTGDGDAPDNASKFLRLIKIYQ-PK-YLSNFKYTVLGLGDTNYSNFCNCSKTIDQILESKGARRFYRSDMADDAVGLEIVVEPWLDGLYEIAKDMCSEIPI----------DGFQ------NLSXXXXXXXXXXXXXXNYKELLGDHLAKDMDGK-----------------NLTVPALPSPFLNIIYNNEDSISNFHEPLITSMPMPSSDSELVMGEVQDI-----TKITNKYAIKSVHRATINVPNAKWKWKPGDSVGILPFNAESEVDSILSRLSVPETEKNCVVXXXXXXXXXXXXAKVPEHLIVRENGKMSLKSILLWLCDLRQPLSKVGLRIMSEYCPMKSAEQRRLLELCSREGQSFYTKCLRETSMPVLDLLNWFPSCQIPIVRLLEVLPRLKPRAYSLCDLE-----SVSFAFSKVDIAPIQTFRKRPLTGVCTSWME------------KMAKFHNEQIWKIP-IYLRKNMNG-FTVCENPSIPHILIGPGTGVAPFIGFLQYFEKLKNENQN--IGPIWLFFGCRNEERDFIFKKQLEHFANSGILTHLCVCFSRDNPTNSGDEQKNFCQPPNCKYVQHCLLHHSKILSDLLVNQNARVFVCGDSSGMSKDVLETWSNVLLGNHEKIQTKRDADSFITGMRVQKLYLEDVW 2038
            ILYGSQ GQA+SIAE L  +  ++    ++  L   +K     + N  + + STTGDG+ PD A KF+R IK    P+ + S+  Y +L LGDTNY++FCNC KTID+ L+  GA  FY + +ADD  GLE+V++PW+DGL++  K + +++P           DG Q       L  T +  K+      +  +   +   + +D +                 +L+ PALP  +L + + +              +P    ++ +V      +      ++T   A+K      +++ N    ++PGD+  +L  N E+EV+ +L RLS+ + +KN  V L+LL+  + + A+VP ++      K +L+ +L W  ++R    K  LR + + C  ++ E+RRL ELCSREG + Y + +R+ S+ +LDLL  FPSC  P+  L+E LP+L+PRAYS           V   FS V         +R  TG+CT W+             K A   +     +P +++   +N  F +  +P++P +++GPG+GVAPF+GFLQ  EK +  NQ+   G  WLFFGCR+++RDFIF+++LE FA    L+ L VCFSR  P  SG E     +P   KYVQH LL H++ ++ +L+ +N R++VCGD+  M+KDV +T   + +G   ++  K ++   +  +R +K YL+D+W
Sbjct:   12 ILYGSQKGQAQSIAEQLADQAAEHGFEADVSCLSQADKYNLEKEHNPVVFVVSTTGDGEPPDTALKFVRSIKKKSLPRDHFSHLHYGLLALGDTNYTDFCNCGKTIDRRLQELGANHFYETGLADDGTGLEVVLDPWIDGLWDALKKIFAKMPASDLIRSISLSDGHQLVAAQEKLESTARSLKLLDISDVDAGKFKPESETESLDAETPLEASLNRSIAPLSQSSLSTPALPPSYLEVCFGD--------------VPTGEEEAHVVARGFHAVPISRAVRLTRDDAVKPAILLELDIKNENVSYQPGDAFDLLCPNRETEVEDLLHRLSLRD-KKNHSVHLQLLKTTKKKGARVPPYI----TEKCTLQYLLTWCLEIRSIPKKAFLRSLVD-CTQQAQEKRRLQELCSREGAADYDRFVRKPSVCILDLLRAFPSCTPPLSLLIEHLPKLQPRAYSAASSSLRHPGKVHIVFSVVRFPACAEHPER--TGLCTGWLADRVSTIIEPYGTKQASRESVDYAALPKVHISPRLNNTFRLPSDPTVPMVMVGPGSGVAPFVGFLQQREKERERNQDGAFGETWLFFGCRHKDRDFIFREELERFAEDKTLSRLKVCFSRAEPDRSGSE----AEP---KYVQHNLLLHAEHVARILLKENGRLYVCGDAKNMAKDVNDTLMEI-IGAGLQVD-KLESMKTVAKLREEKRYLQDIW 695          
BLAST of methionine synthase reductase vs. Ensembl Cavefish
Match: mtrr (5-methyltetrahydrofolate-homocysteine methyltransferase reductase [Source:NCBI gene;Acc:103046907])

HSP 1 Score: 370.163 bits (949), Expect = 2.310e-117
Identity = 251/731 (34.34%), Postives = 371/731 (50.75%), Query Frame = 2
Query:   53 CDFLKMTCILYGSQTGQAKSIAENLYAKLKDYIKHINIFELDDVEKSFEIHKLNFAIIICSTTGDGDAPDNASKFLRLIK--IYQPKYLSNFKYTVLGLGDTNYSNFCNCSKTIDQILESKGARRFYRSDMADDAVGLEIVVEPWLDGLYEIAKDMCSEIPIDGFQNLSXXXXXXXXXXXXXXNYKELLGD-----HLAKDMDGKN-------------------------------------LTVPALPSPFLNIIYNN----EDSISNFHEPLITSMPMPSSDSELVMGEVQDITKITNKYAIKSVHRATINVPNAKWKWKPGDSVGILPFNAESEVDSILSRLSVPETEKNCVVXXXXXXXXXXXXAKVPEHLIVRENGKMSLKSILLWLCDLRQPLSKVGLRIMSEYCPMKSAEQRRLLELCSREGQSFYTKCLRETSMPVLDLLNWFPSCQIPIVRLLEVLPRLKPRAY-----SLCDLESVSFAFSKVDIAPIQTFRKRPLTGVCTSWMEK------------MAKFHNEQIWKIP-IYLRKNM-NGFTVCENPSIPHILIGPGTGVAPFIGFLQYFEKLKNENQN--IGPIWLFFGCRNEERDFIFKKQLEHFANSGILTHLCVCFSRDNPTNSGDEQKNFCQPPNCKYVQHCLLHHSKILSDLLVNQNARVFVCGDSSGMSKDVLETWSNVLLGNHEKIQTKRDADSFITGMRVQKLYLEDVW 2038
            C       ILYGSQ GQA+SIAE +  +  ++     I  L   +K     +    + + STTGDG+ PD A KF++ IK       + S+  Y +LGLGDTNY+NFCNC KTID+ L+  GA+ FY +  ADD  GLE+VV+PW++GL+E  K   S +  D  Q  +   + ++   +     +E L       HL K  D +                                      L VPALP  +L +   +    E+S+    E     +P            V     +T   A+KS     +++ +    ++PGD+  +L  N  SEV+ +LSRL V +    CV      +  +   A+VP ++      K +L+ +L W  ++R    K  +R + E+    S E+RRL ELCSREG + Y K +R+T++ +LDLL  F SC  P+  L+E LP+L+PRAY     SLC    V F FS V+        +R  TG+CT W+               A         +P +Y+R  + N F +  +PS+P +++GPGTGVAPFIGFLQ  EK + E QN   G  WLFFGCR+++RDFIF+++LE F  +  L+HL VCFSR       DEQ      P  +YVQH LL H+K +  +L+ +N  ++VCGD+  M+KDV +T    +LGN  ++  K ++   +  +R +K YL+D+W
Sbjct:    3 CGVAPRFLILYGSQRGQAQSIAEEISEQATEHGFLAKISCLSKGDKYNLDREHGPVVFVVSTTGDGEPPDTALKFVKKIKNKSLPGDHYSHLHYALLGLGDTNYANFCNCGKTIDKRLQELGAKHFYATGHADDGTGLEVVVDPWIEGLWEALKKAFSRMS-DSNQEGTAQGEATEKSTQQGAEIQEKLDSSAVSLHLLKLGDVETQKEKAETSASESETTEPSGAPLEPALIRSVPPLSQSALNVPALPPAYLEVRLEDVPVEEESVHVLKEDF-REVP------------VSRALHLTRDDAVKSAILVELDIADQDMPYQPGDAFDVLCPNRASEVEELLSRLGVGDQRNRCVYLQLRKDTKKKG-AQVPSYI----PQKCTLQYLLTWCLEIRSVPKKAFVRALVEWT-QDSREKRRLQELCSREGSADYNKFVRDTNVCLLDLLQTFSSCSPPLSLLIEHLPKLQPRAYSAASSSLCHPGKVHFVFSVVEFPACAEHPER--TGLCTGWLVHHVSPILQPCGTITAAKKTADCSALPKVYVRSRISNTFHLPSDPSVPVVMVGPGTGVAPFIGFLQQREKEREERQNGPFGETWLFFGCRHKDRDFIFREELERFVENETLSHLKVCFSR-------DEQDGNDPEPKPRYVQHQLLLHAKNIVHILLKENGYLYVCGDAKNMAKDVNDTLIE-MLGNELQLD-KLESMKMVAKLREEKRYLQDIW 702          
BLAST of methionine synthase reductase vs. Ensembl Cavefish
Match: mtrr (5-methyltetrahydrofolate-homocysteine methyltransferase reductase [Source:NCBI gene;Acc:103046907])

HSP 1 Score: 369.777 bits (948), Expect = 4.248e-117
Identity = 251/731 (34.34%), Postives = 371/731 (50.75%), Query Frame = 2
Query:   53 CDFLKMTCILYGSQTGQAKSIAENLYAKLKDYIKHINIFELDDVEKSFEIHKLNFAIIICSTTGDGDAPDNASKFLRLIK--IYQPKYLSNFKYTVLGLGDTNYSNFCNCSKTIDQILESKGARRFYRSDMADDAVGLEIVVEPWLDGLYEIAKDMCSEIPIDGFQNLSXXXXXXXXXXXXXXNYKELLGD-----HLAKDMDGKN-------------------------------------LTVPALPSPFLNIIYNN----EDSISNFHEPLITSMPMPSSDSELVMGEVQDITKITNKYAIKSVHRATINVPNAKWKWKPGDSVGILPFNAESEVDSILSRLSVPETEKNCVVXXXXXXXXXXXXAKVPEHLIVRENGKMSLKSILLWLCDLRQPLSKVGLRIMSEYCPMKSAEQRRLLELCSREGQSFYTKCLRETSMPVLDLLNWFPSCQIPIVRLLEVLPRLKPRAY-----SLCDLESVSFAFSKVDIAPIQTFRKRPLTGVCTSWMEK------------MAKFHNEQIWKIP-IYLRKNM-NGFTVCENPSIPHILIGPGTGVAPFIGFLQYFEKLKNENQN--IGPIWLFFGCRNEERDFIFKKQLEHFANSGILTHLCVCFSRDNPTNSGDEQKNFCQPPNCKYVQHCLLHHSKILSDLLVNQNARVFVCGDSSGMSKDVLETWSNVLLGNHEKIQTKRDADSFITGMRVQKLYLEDVW 2038
            C       ILYGSQ GQA+SIAE +  +  ++     I  L   +K     +    + + STTGDG+ PD A KF++ IK       + S+  Y +LGLGDTNY+NFCNC KTID+ L+  GA+ FY +  ADD  GLE+VV+PW++GL+E  K   S +  D  Q  +   + ++   +     +E L       HL K  D +                                      L VPALP  +L +   +    E+S+    E     +P            V     +T   A+KS     +++ +    ++PGD+  +L  N  SEV+ +LSRL V +    CV      +  +   A+VP ++      K +L+ +L W  ++R    K  +R + E+    S E+RRL ELCSREG + Y K +R+T++ +LDLL  F SC  P+  L+E LP+L+PRAY     SLC    V F FS V+        +R  TG+CT W+               A         +P +Y+R  + N F +  +PS+P +++GPGTGVAPFIGFLQ  EK + E QN   G  WLFFGCR+++RDFIF+++LE F  +  L+HL VCFSR       DEQ      P  +YVQH LL H+K +  +L+ +N  ++VCGD+  M+KDV +T    +LGN  ++  K ++   +  +R +K YL+D+W
Sbjct:   16 CGVAPRFLILYGSQRGQAQSIAEEISEQATEHGFLAKISCLSKGDKYNLDREHGPVVFVVSTTGDGEPPDTALKFVKKIKNKSLPGDHYSHLHYALLGLGDTNYANFCNCGKTIDKRLQELGAKHFYATGHADDGTGLEVVVDPWIEGLWEALKKAFSRMS-DSNQEGTAQGEATEKSTQQGAEIQEKLDSSAVSLHLLKLGDVETQKEKAETSASESETTEPSGAPLEPALIRSVPPLSQSALNVPALPPAYLEVRLEDVPVEEESVHVLKEDF-REVP------------VSRALHLTRDDAVKSAILVELDIADQDMPYQPGDAFDVLCPNRASEVEELLSRLGVGDQRNRCVYLQLRKDTKKKG-AQVPSYI----PQKCTLQYLLTWCLEIRSVPKKAFVRALVEWT-QDSREKRRLQELCSREGSADYNKFVRDTNVCLLDLLQTFSSCSPPLSLLIEHLPKLQPRAYSAASSSLCHPGKVHFVFSVVEFPACAEHPER--TGLCTGWLVHHVSPILQPCGTITAAKKTADCSALPKVYVRSRISNTFHLPSDPSVPVVMVGPGTGVAPFIGFLQQREKEREERQNGPFGETWLFFGCRHKDRDFIFREELERFVENETLSHLKVCFSR-------DEQDGNDPEPKPRYVQHQLLLHAKNIVHILLKENGYLYVCGDAKNMAKDVNDTLIE-MLGNELQLD-KLESMKMVAKLREEKRYLQDIW 715          
BLAST of methionine synthase reductase vs. Ensembl Cavefish
Match: pora (NADPH--cytochrome P450 reductase [Source:NCBI gene;Acc:103023494])

HSP 1 Score: 191.045 bits (484), Expect = 1.491e-51
Identity = 172/666 (25.83%), Postives = 296/666 (44.44%), Query Frame = 2
Query:   77 ILYGSQTGQAKSIAENLYAKLKDY-----IKHINIFELDDVEKSFEIHKLNFAIIICSTTGDGDAPDNASKFLRLIKIYQPKYLSNFKYTVLGLGDTNYSNFCNCSKTIDQILESKGARRFYRSDMADDAVGLEIVVEPWLDGLYEIAKDMCSEIPIDGFQNLSXXXXXXXXXXXXXXNYKELLGDHLAKDMDGKNLTVPALPSPFLNIIYNNE-DSISNFHEPLITSMPMPSSDSELVMGEVQDITKITNKYAIKSVHRATINVPNAKWKWKPGDSVGILPFNAESEVDSILSRLSVPETEKNCVVXXXXXXXXXXXXAKVPEHLIVRENGKMSLKSILLWLCDLRQPLSKVGLRIMSEYCPMKSAEQRRLLELCSR--EGQSFYTKCLRETSMPVLDLLNWFPSCQIPIVRLLEVLPRLKPRAYSLCDLESVSFAFSKVDIAPI----QTFRKRPLTGVCTSWMEKMAKFHNEQIWKIPIYLRKNMNGFTVCENPSIPHILIGPGTGVAPFIGFLQYFEKLKNENQNIGPIWLFFGCRNEERDFIFKKQLEHFANSGILTHLCVCFSRDNPTNSGDEQKNFCQPPNCKYVQHCLLHHSKILSDLLVNQNARVFVCGDSSGMSKDVLETWSNVLLGNHEKIQTKRDADSFITGMRVQKLYLEDVW 2038
            + YGSQTG A+  A  L    + Y     +     +++ ++ +  E+   + A+   +T G+G+  DNA  F   +++     L    ++V GLG+  Y ++    K  D+ L   GA + +   + DD   LE   E ++    +    +C+   +   Q      +             EL+   +  D+D             LN +Y  E   + +F    +   P  + +  L   EV  + +  N+   + +    +++  +K ++  GD V + P N  S V+ +  RL +   + + V+ L+ L+   +++   P           + ++ L    D+  PL    L  +S+Y    S E+ R+  + S   EG++ Y   + E+   +L +L   PS   P+  L E+LPRL+ R YS+    S     + + I  +     T   R   GV T+W++   K        +PIY+RK+   F +    S P I+IGPGTG+APF+GFLQ     K +    G   L+FGCR++  DFI++++LE F  +G+LT L V FSRD       E K         YVQH L  + + L  L+ + NA ++VCGD+  M++DV E +  +         T   A  +   +  +  Y +DVW
Sbjct:   39 VFYGSQTGTAEEFATRLVKDAQRYGIKGMVADPEEYDMSELPRLTEVVN-SLAVFCMATYGEGEPTDNAQGFYDWMQVTDVS-LEGVHFSVFGLGNKTYDHYNAMGKYTDRRLAELGATQIFDLGLGDDDGNLE---EDFISWKAQFWPAVCAFFGVQPTQEECSVRQF------------ELV---VHNDID-------------LNEVYTGEVGCLKSFQ---VQKPPFDAKNPYL--AEVT-VNRKLNQGGSRHLMHLQLDISGSKIRYDAGDHVAVYPVNDVSLVNRLGERLGI---DLDTVITLKNLDEEASKKHPFP--------CPTTYRTALTHYLDITNPLHTNVLFELSQYAS-DSEERERMCRMSSSSSEGKALYHSWVVESERNILAVLEDLPSLNPPVDYLCELLPRLQARYYSIAS--SAKVHPTSIHICAVVLDYTTKTGRVFKGVATNWLKNKVKTEGGPWPTVPIYVRKSQ--FRLPFKASNPVIMIGPGTGIAPFMGFLQERAWQKQQGNETGETVLYFGCRHKNEDFIYQEELEEFKKAGVLTQLHVAFSRDQ------EHK--------VYVQHLLKQNKEHLWKLIHSNNAHIYVCGDARNMARDVHEAFHEI--AEEAGGLTHTQAVDYFQRLMTKGRYSQDVW 633          
BLAST of methionine synthase reductase vs. Ensembl Cavefish
Match: porb (NADPH--cytochrome P450 reductase-like [Source:NCBI gene;Acc:103023972])

HSP 1 Score: 182.185 bits (461), Expect = 3.033e-48
Identity = 171/673 (25.41%), Postives = 291/673 (43.24%), Query Frame = 2
Query:   65 KMTCILYGSQTGQAKSIAENLYAKLKDY-IKHINI----FELDDVEKSFEIHKLNFAIIICSTTGDGDAPDNASKFLRLIKIYQPKYLSNFKYTVLGLGDTNYSNFCNCSKTIDQILESKGARRFYRSDMADDAVGLEIVVEPWLDGLYEIAKDMCSEIPIDGFQNLSXXXXXXXXXXXXXXNYKELLGDHLAKDMDGKNLTVPALPSPFLNIIYNNE----DSISNFHEPLITSMPMPSSDSELVMGEVQDITKITNKYAIKSVHRATINVPNAKWKWKPGDSVGILPFNAESEVDSILSRLSVPETEKNCVVXXXXXXXXXXXXAKVPEHLIVRENGKMSLKSILLWLCDLRQ-PLSKVGLRIMSEYCPMKSAEQRRLLELCSREGQSFYTKCLRETSMPVLDLLNWFPSCQIPIVRLLEVLPRLKPRAYSLCDLESV---SFAFSKVDIAPIQTFRKRPLTGVCTSWMEKMAKFHNEQIWKIPIYLRKNMNGFTVCENPSIPHILIGPGTGVAPFIGFLQYFEKLKNENQNIGPIWLFFGCRNEERDFIFKKQLEHFANSGILTHLCVCFSRDNPTNSGDEQKNFCQPPNCKYVQHCLLHHSKILSDLLVNQNARVFVCGDSSGMSKDVLETWSNVL--LGNHEKIQTKRDADSFITGMRVQKLYLEDVW 2038
            K   + YGSQTG  +  A  L    + Y +K +      +++ ++ +  EI   + AI   +T G+GD  DNA  F   ++      L    +TV  LG+  Y ++    K +D+ L   GA+R +   M DD   LE     W +  +     +C    ++     S   +                   + +D++             +N IY  E     S  N   P  +  P  S  +         + +  NK   + +    +++  +K +++ GD V + P N  + V+ +   L V   + + V+ L  L+   N++   P           + ++ L    D+   P + V   +       K  E  R +   S EG++ Y   + ++S  +L +L   PS + PI  L E+LPRL+ R YS+     V   S     V +   QT   R   GV T+W++      N     +P+Y+RK+   F +    S P I+IGPGTG+APF+GF+Q    LK + + +G   ++FGCR++  DF+++++LE F    +LT L V FSRD       E+K         YVQH L ++ + +   +   NA +++CGD+  M++DV   +  +   LG      T   A  +I  +  +  Y +DVW
Sbjct:   77 KNIVVFYGSQTGTGEEFANRLSKDAQRYGMKGMAADPEEYDMSELSRLKEIDN-SLAIFCMATYGEGDPTDNAQDFYDWLQESDAD-LDGVNFTVFALGNKTYEHYNAMGKYVDKRLSELGAKRIFDLGMGDDDGNLEEDFVSWREQFWPA---VCEHFGVEATGEESSIRQYELK---------------VHEDLN-------------MNKIYTGELGRLKSFENQKPPFDSKNPFLSPVT---------VNRKLNKGGDRHLMHLELDITGSKIRYESGDHVAVYPTNDSNIVNKLGEVLGV---DLDTVISLNNLDEESNKKHPFP--------CPTTYRTALTHYLDVTSCPRTNVLYELAQYASDPKDQENMRKMASSSPEGKALYQTWVLDSSRNILAILEDLPSLRPPIDHLCELLPRLQARYYSIASSSKVHPNSIHICAV-VVEYQTKTGRTNKGVATNWLKNKVPTDNGHKATVPMYIRKSQ--FRLPFKSSNPVIMIGPGTGIAPFMGFIQERAWLKQQGKEVGETVMYFGCRHKNEDFLYQEELEAFEKEEVLTQLNVAFSRDQ------EKK--------VYVQHLLKNNKEEVWRQIHKDNAHIYICGDARNMARDVQSVFYEIAEELGG----MTHTQAVDYIKKLMTKGRYSQDVW 675          
BLAST of methionine synthase reductase vs. Ensembl Cavefish
Match: NOS2 (nitric oxide synthase, inducible-like [Source:NCBI gene;Acc:103026958])

HSP 1 Score: 146.362 bits (368), Expect = 1.082e-35
Identity = 171/675 (25.33%), Postives = 292/675 (43.26%), Query Frame = 2
Query:   77 ILYGSQTGQAKSIAENLYAKLK----DYIKHINIFELDDVEKSFEIHKLNFAIIICSTTGDGDAPDNASKFLRLIKIYQPKYL-SNFKYTVLGLGDTNYSNFCNCSKTIDQILESKGARRFYRSDMADDAVGLEIVVEPWLDGLYEIAKDMCSEIPIDGFQNLSXXXXXXXXXXXXXXNYKELLG-DHLAKDMDGKNLTVPALPSPFLNIIYNNEDSISNFHEPLITSMPMPSSDSELVMGEVQDITKITNKYAIKSVHRATINVPNAK--WKWKPGDSVGILPFNAESEVDSILSRL-SVPETEKNCVVXXXXXXXXX--XXXAKVPEHLIVRENGKMSLKSILLWLCDLRQPLSKVGLRIMSEYCPMKSAEQRRLLELCSREGQSFYTKCLRETSMPVLDLLNWFPSCQIPIVRLLEVLPRLKPRAYSLC---DLESVSFAFSKVDIAPIQTFRKRPL-TGVCTSWMEKMAKFHNEQIWKIPIYLRKNMNGFTVCENPSIPHILIGPGTGVAPFIGFLQ--YFEKLKNENQNIGPIWLFFGCRNEERDFIFKKQLEHFANSGILTHLCVCFSRDNPTNSGDEQKNFCQPPNCK-YVQHCLLHHSKILSDLL---VNQNARVFVCGDSSGMSKDVLETWSNVLLGNHEKIQTKRDADSFITGMRVQKLYLEDVW 2038
            ILY ++TG++++ A+ L + L       +  +  +   D+EK          I++ ST G+G++P N   F +  K+   K L +N +Y V GLG   Y  FC  +  +D  L   GA+        D+  G +     W    +   K +C E  I+G                      +L G + L    D + + V    S  L+ I     ++S  H    T  PM          +++    + +  + +S     + V  AK    + PGD VG+ P N+   V  IL  + SVP T ++  +  +         +  ++P           SL   L +L D+  P S+  LR +S+    K  +++RLL L S        K  R+ +   L++L  FPS ++    +L  LP +KPR YSL    DL       +   +       K PL  GVC++W+  +   H      +P ++  + +GF +  +P+ P ILIG G+G+APF  F Q  Y +K K   +   P+ L FGCR+ + D ++K++      +G L  +   +SR              QP + K YVQ  L    K LS+ +   + +   V+VCG  + M+++V  T  +++ G  +      +A  ++  ++ +K Y ED++
Sbjct:  488 ILYATETGKSQTFAKKLKSMLSCAFNPRLLCMEDYRFGDLEKE------RLLIVVTSTFGNGESPGNGETFQK--KLMGKKQLKNNLRYCVFGLGSRMYPQFCAFAHAVDDKLAELGAKCVTPIGEGDELNGQDEAFSAWACTAF---KAVCKEFGIEG----------------------QLSGAERLTDSWDPQKIRVQP-DSSTLDCI----SALSALHSK--TVFPM----------KLKRRKNLQSSQSRRSTILVELEVHGAKDVLNYAPGDHVGVFPENSPELVTGILKHIPSVPPTNQSLHLEYQANSGGVGWQKDERLP---------ACSLTQALTYLLDITTPPSQGLLRKLSQVS-KKEDDRQRLLALASDFKSYSEWKEFRKPNF--LEVLEEFPSLEVSAAFVLSQLPLMKPRLYSLSSSPDLHPNELHLTVSVVNYRTQDGKGPLHHGVCSTWLNTLKDGHT-----VPCFIHGS-SGFHLPPDPTTPTILIGAGSGIAPFRSFWQQRYHDKEKKGLKE-SPMMLVFGCRDSDTDHLYKEETYEMRENGTLKSITPAYSR--------------QPGHPKVYVQDVL---KKQLSEEVWQALQKAGHVYVCGGMN-MAREVAHTIQDIVAG--QLGVPFSEAGGYLERLKAEKRYHEDIF 1073          
BLAST of methionine synthase reductase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004550.1 (pep scaffold:Pmarinus_7.0:GL501143:124546:139236:-1 gene:ENSPMAG00000004118.1 transcript:ENSPMAT00000004550.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 334.339 bits (856), Expect = 1.154e-104
Identity = 230/707 (32.53%), Postives = 357/707 (50.50%), Query Frame = 2
Query:   77 ILYGSQTGQAKSIAENLYAKLKDYIKHINIFELDDVE-----------KSFEIHKLNFAIIICSTTGDGDAPDNASKFLRLIKIYQPKYLSNFKYTVLGLGDTNYSNFCNCSKTIDQILESKGARRFYRSDMADDAVGLEIVVEPWLDGLYEIAKDMCSEIPIDGFQNLSXXXXXXXXXXXXXXNYKEL---LGDHLAKDMDG--------------------KNLTVPALPSPFLNIIYNNEDSISNFHEPLITSMPMPSSDSELVMGEVQDITKITNKYAIKSVHRATINVPNAKWKWKPGDSVGILPFNAESEVDSILSRLSVPETEKNCVVXXXXXXXXXXXXAKVPEHLIVRENGKMSLKSILLWLCDLRQPLSKVGLRIMSEYCPMKSAEQRRLLELCSREGQSFYTKCLRETSMPVLDLLNWFPSCQIPIVRLLEVLPRLKPRAYSLCDLESVSFAFSKV--DIAPIQTFRKRPLT--GVCTSWM-------EKMAKFHNEQIWKIPIYLRKNMN-------GFTVCENPSIPHILIGPGTGVAPFIGFLQYFE-KLKNENQNIGPIWLFFGCRNEERDFIFKKQLEHFANSGILTHLCVCFSRDNPTNSGDEQKNFCQPPNCKYVQHCLLHHSKILSDLLVNQNARVFVCGDSSGMSKDVLETWSNVLLGNHEKIQTKRDADSFITGMRVQKLYLEDVW 2038
            +LYG++ G AK+IA++L A+ + +    ++  L               ++ E H+LN                  S    +I +Y+   +S F     GLGDTNY+NFCNC +T+D+ L   GA+RFY++  ADDAVG E+V EPW++GL+E     C +    G   +           +  + + +    + +   K +D                       L VP+LP P+L + ++   S        +    +P++ SE+    V    ++T   A+K+     ++V +A +   PGD++G+L  N E+EVD++L RL + + + +C + L    N   R +KVP+ +        SL+SIL    ++R    K  +R ++E+     AE+RRLLEL SR+G + YT  LR+ S+ +  LL+ FPSC+ P   L+E LPRL+PRAYS+     V+   + V  ++        RP    GVCT W+       E         +   P+   K ++       GF + E+ S+P I+IGPGTGVAPF+GFLQ+ E K       +G  WLFFGCR+ +RDF++++QLE F   G LTHL V FSRD P  S          P  +YVQH L  H   +  LL+ + AR++VCGD+  M++DV ET  ++++   E    K +A   I G++ Q  YL+DVW
Sbjct:    6 LLYGTEIGTAKAIAQDLCAQAERFGLDADLHCLSKTHDESGSLTWIPSETKEKHRLN------------------SCLKSVIVVYRELTVSCFFSA--GLGDTNYTNFCNCGRTMDRRLAELGAQRFYQTGHADDAVGTELVAEPWVEGLWEALVSECKQ-EGGGTSRVGERVADVSPPRERDQEHGDAGKQISESTEKTLDQTQPEKPLVPSLTVSVPPLSEATLQVPSLPEPYLQLQFD--PSRPGVFVERMGHHFIPAA-SEVCEVAVSGWKQLTRADAVKTALELQLDVSDAPFALCPGDALGVLCPNGEAEVDALLRRLGL-DGQADCTLELRAKPNARGRASKVPDFI----PAGSSLRSILTHGLEIRALPKKAMVRALAEHT-EDEAERRRLLELSSRQGSADYTHLLRDASLGLAALLHAFPSCRPPASLLIEHLPRLQPRAYSIASSPLVTPGAAHVVFNVVEFAAGPGRPQAQRGVCTGWLAEVVVGPEAKGNSRPSNLSGAPLADPKLLSPKAAKSTGFRLPEDASVPIIMIGPGTGVAPFVGFLQHREHKAGGGTAALGESWLFFGCRHRDRDFLYREQLEGFVARGTLTHLRVAFSRDEPAGSEVASPGGVAHP--RYVQHSLGQHRADVMRLLLQEGARLYVCGDAKNMARDVQETLVDMVV--EEMGVAKLEAMRVIGGLKEQGRYLQDVW 678          
BLAST of methionine synthase reductase vs. Ensembl Sea Lamprey
Match: porb (P450 (cytochrome) oxidoreductase b [Source:ZFIN;Acc:ZDB-GENE-030131-5767])

HSP 1 Score: 159.844 bits (403), Expect = 2.722e-41
Identity = 120/402 (29.85%), Postives = 194/402 (48.26%), Query Frame = 2
Query:  845 INVPNAKWKWKPGDSVGILPFNAESEVDSILSRLSVPETEKNCVVXXXXXXXXXXXXAKVPEHLIVRENGKMSLKSILLWLCDLRQPLSKVGLRIMSEYCP-MKSAEQRRLLELCSREGQSFYTKCLRETSMPVLDLLNWFPSCQIPIVRLLEVLPRLKPRAYSLCDLESV---SFAFSKVDIAPIQTFRKRPLTGVCTSWMEKMAKFHNEQIWKIPIYLRKNMNGFTVCENPSIPHILIGPGTGVAPFIGFLQYFEKLKNENQNIGPIWLFFGCRNEERDFIFKKQLEHFANSGILTHLCVCFSRDNPTNSGDEQKNFCQPPNCKYVQHCLLHHSKILSDLLVNQNARVFVCGDSSGMSKDVLETWSNVLLGNHEKIQTKRDADSFITGMRVQKLYLEDVW 2038
            +++  +K +++ GD V + P N  + V+  L+RL   + +    +     E+ +      P           + ++ LL   D+  P     L  +++Y    K  E  R +   + E ++ Y   + +    +L +L   PS + PI  L E+LPRL+ R YS+     V   S     V +   +T   R   GV TSW++      N     +P Y+RK+   F +   PS P I+IGPGTG+APF+GF+Q  E  K + + +G   L+FGCRN   DFI++++LE F   G+LT L V FSRD       E+K         YVQH +  + + +  LL   NA ++VCGD+  M++DV    S V+  +     T++ A  F+  ++ +  Y  DVW
Sbjct:  311 LDISGSKMRYEAGDHVAVFPTNDSALVEE-LARLLGADLDTVFSLNNLDEESNKKHPFPCP----------TTYRTALLHYLDITNPPRTNVLYELAQYASDPKEQEFLRRMASSAVECKTQYQSWVLDERRHILAILQDLPSVKPPIDHLCELLPRLQARYYSIASSAKVFPDSIHICAV-LVEYKTRLGRTNRGVATSWLQGRCPSQNGHKPTVPAYVRKSQ--FRLPYKPSSPIIMIGPGTGLAPFLGFIQEREWQKQQGKEVGETVLYFGCRNRSTDFIYEEELEAFKERGVLTQLHVAFSRDQ------EEK--------VYVQHLITKNKENIWQLL-QSNAHIYVCGDAKNMARDVQAAISEVV--SECGGLTQQQALDFVKKLQTKGRYSSDVW 681          

HSP 2 Score: 55.4546 bits (132), Expect = 4.169e-8
Identity = 30/84 (35.71%), Postives = 44/84 (52.38%), Query Frame = 2
Query:  212 NFAIIICSTTGDGDAPDNASKFLRLIKIYQPKYLSNFKYTVLGLGDTNYSNFCNCSKTIDQILESKGARRFYRSDMADDAVGLE 463
            + A+   +T G+GD  DNA +F  L++    + L+  KY V GLG+  Y +F    K +D+ LE  GA R +     DD   LE
Sbjct:  137 SLAVFCMATYGEGDPTDNAQEFYDLLQEGSLE-LAGVKYAVFGLGNKTYEHFNAMGKYLDKRLEELGAERIFELGSGDDDATLE 219          
BLAST of methionine synthase reductase vs. Ensembl Yeast
Match: TAH18 (Conserved NAPDH-dependent diflavin reductase; component of an early step in the cytosolic Fe-S protein assembly (CIA) machinery; transfers electrons from NADPH to the Fe-S cluster of Dre2p; plays a pro-death role under oxidative stress; Tah18p-dependent nitric oxide synthesis confers high-temperature stress tolerance; possible target for development of antifungal drugs [Source:SGD;Acc:S000006252])

HSP 1 Score: 137.887 bits (346), Expect = 1.980e-34
Identity = 175/702 (24.93%), Postives = 298/702 (42.45%), Query Frame = 2
Query:   65 KMTCILYGSQTGQAKSIAENLYAKLKDYIKHINIFELDDVEKSFEIHKLNFAIIICSTTGDGDAPDN--ASKFLRLIKIYQ--------PKYLSNFKYTVLGLGDTNYSNFCNCSKTIDQ-ILESKGARRFYRSDMADD----------AVGLEIVVEPWLDGLYEIAKDMCSEIPIDGFQNLSXXXXXXXXXXXXXXNYKELLGDHLAKDMDGKNLTVPAL-PSPFLNIIYNNEDSISNFHEPLITSMPMPSSDSELVMGEVQDITKITNKYAIKSVHRATI-NVPNAKWKWKPGDSVGILPFNAESEVDSILSR----LSVPETEKNCVVXXXXXXXXXXXXAKVPEHL----IVRENGKMSLKSILLWLCDLRQ-PLSKVGLRI---MSEYCPMKSAEQR------RLLELCS-REGQSFYTKCLRETSMPVLDLLNWFPSCQIPIVRLLEVLPRLKPRAYSLCDLESVSFAFSKVDIAPIQTFRKRPLTGVCTSWMEKMAKFHNEQIWKIPIYLRKNMNGFTVCENPSIPHILIGPGTGVAPFIGFLQYFEKLKNENQNIGPIWLFFGCRNEERDFIFKKQLEHFANSGILTHLCVCFSRDNPTNSGDEQKNFCQPPNCKYVQHCLLHHSKILSDLLVNQNARVFVCGDSSGMSKDVLETWSNVL--LGNHEKIQTKRDADSFITGMRVQKLYLEDVW 2038
            K   ILYGS+TG A   A  L  +L  +        + D +   +I K  +  IICSTTG G+ P N  A K  R +  +            L++ +  +LGLGD++Y  F    + + Q I+   GA   +    ADD           +G+E V        +E  K + S                             LL  +  + ++G+ +    L P  +L      + S  + +E   ++  +   D  L +G V    +IT++   + V +    NV   +  ++PGD+V I P N + +V   L+     L + +   N               + VP  L    +VR    M+L+++L + CD    P +   L+I    ++   M+  +++      +L +  + ++ Q  Y  C R     +L++L  F S ++P   +L+ LP +KPR YS+            V I   +T  ++   G+CT+++ ++ +   EQI     Y  +N N     E  + P IL+GPG G+AP +  ++  E  K+       I L FGCR +++D+I+K  LE +   G +  L   FSRD   +           P  KYVQ  L    + +++L+VN++A  F+CG S  M   V  T+  +L   GN    +T   A  ++  M     Y+++ W
Sbjct:    5 KKIVILYGSETGNAHDFATILSHRLHRWHFSHTFCSIGDYDPQ-DILKCRYLFIICSTTGQGELPRNVNALKGERPVTFWSFLKRKNLPSNLLNHIQTAMLGLGDSSYPKFNYGIRKLHQRIVTQLGANELFDRLEADDQAMAGSNKGTGLGIESVY-------FEYEKKVLSF----------------------------LLSKYPNRKVNGQIIKREELDPEVYLEPASYLQLSDEHANEKFTSTKVIFEGDESLKVGRVNINKRITSEGHFQDVRQFKFSNVDKIQENYEPGDTVTIYPCNTDEDVSRFLANQSHWLEIADKPLNFT-------------SGVPNDLKDGGLVRP---MTLRNLLKYHCDFMSIPRTSFFLKIWTFATDVTKMERGQEQLNDQREKLRQFATDQDMQDLYDYCNR-PRRSILEVLEDFISVKLPWKYVLDYLPIIKPRYYSISSGPGDPNIELTVAIVKYKTILRKIRRGICTNYIARLQE--GEQIR----YKLQN-NHIIKKEFLNKPMILVGPGVGLAPLLSVVKA-EISKD-------IKLLFGCRYKDKDYIYKDMLEDWFRKGKIA-LHSSFSRDEENS-----------PGVKYVQDYLWRLGEEITNLVVNKDAVFFLCGSSGKMPIQVRLTFIEMLKKWGNFSDEET---AKKYLKEMEKSDRYIQETW 623          
BLAST of methionine synthase reductase vs. Ensembl Yeast
Match: NCP1 (NADP-cytochrome P450 reductase; involved in ergosterol biosynthesis; associated and coordinately regulated with Erg11p [Source:SGD;Acc:S000001084])

HSP 1 Score: 132.88 bits (333), Expect = 1.161e-32
Identity = 175/721 (24.27%), Postives = 299/721 (41.47%), Query Frame = 2
Query:   38 IMHLLCDFLKMTCILYGSQTGQAKSIAENLYAKLKDYIKHINIFEL-DDVEKSFEIHKLN----FAIIICSTTGDGDAPDNASKFLRLIKIYQPKYLSNFKYTVLGLGDTNYSNFCNCSKTIDQILESKGARRFYRSDMADDAVGL-EIVVEPWLDGLYEIAKDMCSEIPIDGFQNLSXXXXXXXXXXXXXXNYKELLGDHLAKDMDGKNLTVPALPSPFLNIIYNNEDSIS----NFHEPLITSMPMPSSDSELVMGEVQDITKITNKYAIKSVHRATINVPNAKWKWKPGDSVGILPFNAESEVDSILSRLSV-PETEKNCVVXXXXXXXXXXXXAKVPEHLIVRENGKMSLKSILLWLCDLRQPLSKVGLRIMSEYCPMKSAEQRRLLELCSREGQSFYTKCLRETSMPVLDLLNWFPSCQ----IPIVRLLEVLPRLKPRAYSLCDLESVSFAFSKVDIAPIQTF------RKRPLTGVCTSWMEKMAKFHNE---------------------QIWKIPIYLRKNMNGFTVCENPSIPHILIGPGTGVAPFIGFLQ----YFEKLKNENQNI--GPIWLFFGCRNEERDFIFKKQLEHFAN--SGILTHLCVCFSRDNPTNSGDEQKNFCQPPNCK--YVQHCLLHHSKILSDLLVNQNARVFVCGDSSGMSKDVLETWSNVLLG--NHEKIQTKRDADSFITGMRVQKLYLEDVW 2038
            I  ++ +  K   +LY SQTG A+  A+      K+ +   N+  +  DVE +++   LN       I  ST G+GD PD A  F   I   +   LSN +Y + GLG++ Y  F   +K  ++ L + GA R  +   ADD  G  +     W D + E+ KD   E+ +D            + E K    ++  + + +   M     +   LPS  LN    N D I     +  +P I   P+  S         +++    ++  I S      ++  +  K+  GD + + P N   +V+  LS  ++ PET               +   KVP           ++ + +    ++  P+S+     + ++ P  +A+ +  L L S++   F  + +      + D L +         +P+  L+E +P++ PR YS+            V  + ++ F         P+ GV T+ +  +    N                        +K+P+++R++   F +  NPS P I+IGPGTGVAPF GF++    + E  K    N+  G   LF+G RN + DF+++ +   +A    G    + V  SR                PN K  YVQ  L  +   + + ++N  A ++VCGD+ GM+K V    S  L+G  +  K  T  +A   I  ++    Y EDVW
Sbjct:   50 IAQVVTENNKNYLVLYASQTGTAEDYAKKFS---KELVAKFNLNVMCADVE-NYDFESLNDVPVIVSIFISTYGEGDFPDGAVNFEDFICNAEAGALSNLRYNMFGLGNSTYEFFNGAAKKAEKHLSAAGAIRLGKLGEADDGAGTTDEDYMAWKDSILEVLKD---ELHLD------------EQEAKFTSQFQYTVLNEITDSMSLGEPSAHYLPSHQLN---RNADGIQLGPFDLSQPYIA--PIVKS---------RELFSSNDRNCIHS----EFDLSGSNIKYSTGDHLAVWPSNPLEKVEQFLSIFNLDPET--------IFDLKPLDPTVKVPFPT------PTTIGAAIKHYLEITGPVSRQLFSSLIQFAP--NADVKEKLTLLSKDKDQFAVE-ITSKYFNIADALKYLSDGAKWDTVPMQFLVESVPQMTPRYYSISSSSLSEKQTVHV-TSIVENFPNPELPDAPPVVGVTTNLLRNIQLAQNNVNIAETNLPVHYDLNGPRKLFANYKLPVHVRRS--NFRLPSNPSTPVIMIGPGTGVAPFRGFIRERVAFLESQKKGGNNVSLGKHILFYGSRNTD-DFLYQDEWPEYAKKLDGSF-EMVVAHSR---------------LPNTKKVYVQDKLKDYEDQVFE-MINNGAFIYVCGDAKGMAKGV----STALVGILSRGKSITTDEATELIKMLKTSGRYQEDVW 691          
BLAST of methionine synthase reductase vs. Ensembl Yeast
Match: MET10 (Subunit alpha of assimilatory sulfite reductase; complex converts sulfite into sulfide [Source:SGD;Acc:S000001926])

HSP 1 Score: 77.0258 bits (188), Expect = 6.266e-15
Identity = 65/297 (21.89%), Postives = 133/297 (44.78%), Query Frame = 2
Query: 1160 EQRRLLELCSREGQSFYTKCLRETSMPVLDLLNWFPSCQIPIVRLLEVLPRLKPRAYSLCDLESVSFAFSKVDIAPIQ--TFRKRPLTGVCTSWMEKMAKFHNEQIWKIPIYLRKNMNGFTVCENPSIPHILIGPGTGVAPFIGFLQYFEKL--KNENQNIGPIWLFFGCRNEERDFIFKKQLEHFANSGILTHLCVCFSRDNPTNSGDEQKNFCQPPNCKYVQHCLLHHSKILSDLLVNQNARVFVCGDSSGMSKDVLETWSNVLLGNHEKIQTKRDADSFITGMRVQKLYLEDVW 2038
            E+++L +L +  G     +          D+   FPS +  +  L+ ++  LK R YS+   + V      + I  +     + R   G  + ++  +A      +   P  ++       +  +P  P I+ G GTG+APF   ++  EKL  K +   IG ++L+ G R++  ++++ +  E + ++GI+TH+   FSRD P      QK         Y+Q  +  +   L   +++     ++CG +  +  D+ +   ++L  + E+   K D D+ I  ++    Y+ +V+
Sbjct:  763 EKKKLEDLVTPAGAVDLKRFQDVEYYTYADIFELFPSVRPSLEELVTIIEPLKRREYSIASSQKVHPNEVHLLIVVVDWVDNKGRKRYGQASKYISDLAVGSELVVSVKPSVMK-------LPPSPKQPVIMSGLGTGLAPFKAIVE--EKLWQKQQGYEIGEVFLYLGSRHKREEYLYGELWEAYKDAGIITHIGAAFSRDQP------QK--------IYIQDRIKENLDELKTAMIDNKGSFYLCGPTWPV-PDITQALQDILAKDAEERGIKVDLDAAIEELKEASRYILEVY 1035          
BLAST of methionine synthase reductase vs. Ensembl Nematostella
Match: EDO40246 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S7T0])

HSP 1 Score: 214.927 bits (546), Expect = 1.169e-60
Identity = 158/497 (31.79%), Postives = 243/497 (48.89%), Query Frame = 2
Query:  656 VPALPSPFLNIIYNNEDSISNFHEPLITSMPMPSSDSELVMGEVQDITKITNKYAIKSVHRATINVPNAKWKWKPGDSVGILPFNAESEVDSILSRL---SVPETEKNCVVXXXXXXXXXXXXAKVPEHLIVRENGKMSLKSILLWLCDLRQPLSKVGLRIMSEYCPMKSAEQRRLLELCSREGQSFYTKCLRETSMPVLDLLNWFPSCQIPIVRLLEVLPRLKPRAYSLCD--LE---SVSFAFSKVDIAPIQTFRKRPLTGVCTSWMEKMA---------------KFHNEQIW-----KIPIYLRKNMNGFTVCENPSIPHILIGPGTGVAPFIGFLQYFEK---LKNENQNIGPIWLFFGCRNEERDFIFKKQLEHFANSGILTHLCVCFSRDNPTNSGDEQKNFCQPPNCKYVQHCLLHHSKILSDLLVNQNARVFVCGDSSGMSKDVLETWSNVL-----LGNHEKIQTKRDADSFITGMRVQKLYLEDVW 2038
            +  L  P  +I+    D  +  H+        P + S + M  +    ++T   A+K     T+++  + W+++ G+S  I   N E EVD+I+ RL   S+ +   +  V     +   +    +P+   ++E+        LL   D+R    K  LR + E+    + EQRRL ELCS++G   Y + +RE S+ +L+LL  FPSC  P  RLLE LPRL PR YS+    LE    ++F F+ V     +  RK    GVCTSW+E +                K     I      ++P+  R N + F +  +  IP I+IGPGTGVAPFIGFL +  K   L  +    G +WLFFGCR+ E+DF+++K+LE F  +G L+ L   FSRD        Q         +YVQ  L      ++DL++N  A V+VCGD+  M+ +V E +  ++     +G  E I+        +T +R ++ Y EDVW
Sbjct:  146 IDGLWGPLKDILGKTPDFSTVPHQ---AGASFPGAASPITMATIVGARRLTADDAMKKALEITLDISQSGWEYEAGNSFNIYCPNDEGEVDAIIERLGLTSMAQVPYDIQVMSGTKKKTASIPNYIPQPYTIKES--------LLTCLDIRMVPRKAFLRTLVEFT-HDNNEQRRLQELCSKQGADEYCRFVREPSLSLLELLTAFPSCFPPFERLLEHLPRLSPRPYSISSSPLEKPGQLNFVFNVVKFGEFEDIRKS-RKGVCTSWLEGLTGSMITEEGNKANGILKISELSILSSPYVQVPVSARSNSD-FKLPPDSRIPVIMIGPGTGVAPFIGFLHHRRKQMELAEDLTGFGEMWLFFGCRHREKDFLYQKELESFVETGTLSRLFTSFSRD--------QGFTVSLSTPRYVQDNLKLQGDKIADLVLNDGAVVYVCGDAKNMASNVFECFCEIIEKHLCVGKMEAIKE-------MTRLRKERKYREDVW 613          

HSP 2 Score: 134.42 bits (337), Expect = 6.967e-33
Identity = 68/153 (44.44%), Postives = 96/153 (62.75%), Query Frame = 2
Query:   77 ILYGSQTGQAKSIAENLYAKLKDYIKHINIFELDDVEKSFEIHKLNFAIIICSTTGDGDAPDNASKFLRLIK--IYQPKYLSNFKYTVLGLGDTNYSNFCNCSKTIDQILESKGARRFYRSDMADDAVGLEIVVEPWLDGLYEIAKDMCSEIP 529
            ILY SQTGQAK+IA+ ++ K      +  +F L   EK F + K +  + + STTG+GD PD   KF R +K       +L + +Y +L LGD+NY+NFC   K +D+ L   GA++FY +  ADDAVGLE+VVEPW+DGL+   KD+  + P
Sbjct:    9 ILYASQTGQAKAIADEIHEKSASNGLNSKLFCLSLTEKKFMLEKESAVVFVVSTTGEGDPPDTMLKFFRRLKKKTLPGNHLKDLQYGLLALGDSNYTNFCVNGKNLDRRLNELGAKKFYDTGHADDAVGLELVVEPWIDGLWGPLKDILGKTP 161          
BLAST of methionine synthase reductase vs. Ensembl Nematostella
Match: EDO30877 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SZI6])

HSP 1 Score: 176.792 bits (447), Expect = 2.628e-47
Identity = 163/668 (24.40%), Postives = 302/668 (45.21%), Query Frame = 2
Query:   65 KMTCILYGSQTGQAKSIAENLYAKLKDYIKHINIFELDDVEKSFEIHKLNFAIIICSTTGDGDAPDNASKFLRLI--KIYQPKYLSNFKYTVLGLGDTNYSNFCNCSKTIDQILESKGARRFYRSDMADDA--VGLEIVVEPWLDGLYEIAKDMCSEIPID-GFQNLSXXXXXXXXXXXXXXNYKELLGDHLAKDMDGKNLTVPALPSPFLNIIYNNEDSISNFHEPLITSMPMPSSDSELVMGEVQDITKITNKYAIKSVHRATINVPNAKWKWKPGDSVGILPFNAESEVDSILSRLSVPETEKNCVVXXXXXXXXXXXXAKVPEHLIVRENGKMSLKSILLWLCDLRQPLSKVGLRIMSEYCPMKSAEQRRLLELCSREGQS-FYTKCLRETSMPVLDLLNWFP--SCQIPIVRLLEVLPRLKPRAYSLCDLESVSFAFSKVDIAPI--QTFRKRPLTGVCTSWMEKMAKFHNEQIWKIPIYLRKNMNGFTVCENPSIPHILIGPGTGVAPFIGFLQYFEKLKNENQNIGPIWLFFGCRNEERDFIFKKQLEHFANSGILTHLCVCFSRDNPTNSGDEQKNFCQPPNCKYVQHCLLHHSKILSDLLVNQNARVFVCGDSSGMSKDVLETWSNVLLGNHEKIQTKRDADSFITGMRVQKLYLEDVW 2038
            K   +LYGSQTG A+ +AE +  + +       +  LDD   + ++ K +  + +C+TTG GD PDN  KF R I  +      L    ++VLGLGD++Y  F   +K +++ L   GA       +ADD   +G + VV+PWL  L+E    + +  PI  G + +S  E+           YK +  D  A++   +     +  +PF   + +N+                                ++T     + V    +++  +   + PGD V + P N     +  +S L + + +KN  ++    +        VP  L        S++ ++    D++    +    ++S + P +  E+ +L +  S EGQ   Y+ C R+     L++L  FP  S  +P   LL+++P ++PRA+S+   +       ++ +A +  QT   +P  G+C++W+  +         ++P+++++      +  + ++P ++IGPGTGVAPF  F++  E+L   ++    + LFFG RN+  DF F+ Q +  + +G L+ +   FSRD      D++          YVQH +   S ++ DL+ N  A  ++ G+S  M  DV E    V         ++ +A++    +   + Y  + W
Sbjct:    8 KRLTVLYGSQTGTAQEVAERIGREGRRRHISARVLALDDYNVA-DLIKEDLVVFVCATTGQGDEPDNMKKFWRFIMRRNLPAHSLQQLSFSVLGLGDSSYPKFNFIAKKLNKRLLQLGASVLQPVGLADDQHDLGPDAVVDPWLKELWE---KVFAVYPIPPGLEIISADERPPA-------RYKIIYTDSPAEESSLEFGLPASQQAPFFATLISND--------------------------------RVTASNHWQDVRLVKLDISGSGISYSPGDVVMVQPSNLSDTAEEFMSFLHL-DPDKNFTLQQTNPDI------PVPRRL----PRPCSIRFLVEHYLDIQGVPRRYFFELLSHFTPSE-LEKEKLQDFASAEGQEDLYSYCYRQKRS-TLEVLQDFPQASANLPFEYLLDLIPAIQPRAFSIASAQKAHPDEIEILMAVVKYQTKISKPRRGLCSTWLSSLPSRS-----RVPVWVKRGTISLPL--DHTVPLLMIGPGTGVAPFRSFIE--ERLVPVHEGSKCV-LFFGSRNKNADFFFENQWKELSETGCLS-VFTAFSRDQ-----DDK---------IYVQHRIREQSSLIWDLINNHRAICYLAGNSKRMPIDVKEALIEVFCKGE---MSESEAEALFAELERTRRYQAETW 591          
BLAST of methionine synthase reductase vs. Ensembl Nematostella
Match: EDO39434 (NADPH--cytochrome P450 reductase [Source:UniProtKB/TrEMBL;Acc:A7SA55])

HSP 1 Score: 141.739 bits (356), Expect = 4.243e-35
Identity = 94/332 (28.31%), Postives = 164/332 (49.40%), Query Frame = 2
Query: 1061 SLKSILLWLCDLRQPLSKVGLRIMSEYCPMKSAEQRRLLELCS---REGQSFYTKCLRETSMPVLDLLNWFPSCQIPIVRLLEVLPRLKPRAYSLCDLESVSFAFSKVDIAPIQ--TFRKRPLTGVCTSWME-KMAKFHNEQIWKIPIYLRKNMNGFTVCENPSIPHILIGPGTGVAPFIGFLQYFEKLKNENQNIGPIWLFFGCRNEERDFIFKKQLEHFANSGILTHLCVCFSRDNPTNSGDEQKNFCQPPNCKYVQHCLLHHSKILSDLLVNQNARVFVCGDSSGMSKDVLETWSNVLLGNHEKIQTKRDADSFITGMRVQKLYLEDVW 2038
            + ++ L+   D+   +    LR ++EY   +  E++  L   S    E +  Y + + +    ++ +L   PS + P+  +LE+LPRL+ R YS+        +   V    ++  T   R   GV T+W+  K+ K      W +PI++R+    F +   P  P I+IGPGTG+APF GF+Q    L  + + +G   LFFGCR++ +D+I++ +LE +A  G ++ L V FSRD                  +YV H +  ++  + +LL +Q A ++VCGD+  M++DV    + +     +   T   AD ++  +  +  Y  DVW
Sbjct:  363 TYRTALMHYVDITSTVKTHVLRELAEYA--RDHEEKEFLMAISDSTEEAKKKYNEWVIQPHRHIVAVLEDMPSLKPPLDHILELLPRLQCRYYSISSSPKAHPSHIHVTAVVVKWTTKTGRVQNGVATTWLATKIPKG-----W-VPIFVRRTT--FRLPFKPVTPVIMIGPGTGLAPFRGFIQDRNALVKQGKRVGDTVLFFGCRHKAQDYIYENELEDYAADGTISRLHVAFSRDQDKK--------------RYVTHLMRENTDEIWNLL-DQGAHIYVCGDARNMARDVHTIVTEI--AREKGGMTDSQADDYVKKLSAKGRYATDVW 667          

HSP 2 Score: 67.0106 bits (162), Expect = 1.863e-11
Identity = 42/137 (30.66%), Postives = 69/137 (50.36%), Query Frame = 2
Query:   65 KMTCILYGSQTGQAKSIAENLYAKLKDYIKHINIF--ELDDVEKSFEIHKLN--FAIIICSTTGDGDAPDNASKFLRLIKIYQPKYLSNFKYTVLGLGDTNYSNFCNCSKTIDQILESKGARRFYRSDMADDAVGLE 463
            K   I YGSQTG A+  A  L    + Y     +F  E +D+E+   + +++  FAI + +T G+GD  DNA +F   ++  +   L    + V GLG+  Y ++ +  + +D+ LE  G  R Y+    DD   +E
Sbjct:   70 KPLAIFYGSQTGTAEEFASRLAKDAQRYGIKAMVFDPEENDMEELTRMGEIDNSFAIFVMATYGEGDPTDNAQEFYEWLQNDRDD-LDCLNFAVFGLGNKTYEHYNSMGRYVDKRLEELGGYRIYQRGEGDDDGNIE 205          
BLAST of methionine synthase reductase vs. Ensembl Nematostella
Match: EDO39440 (Nitric oxide synthase [Source:UniProtKB/TrEMBL;Acc:A7SA75])

HSP 1 Score: 124.79 bits (312), Expect = 2.665e-29
Identity = 154/678 (22.71%), Postives = 289/678 (42.63%), Query Frame = 2
Query:   77 ILYGSQTGQAKSIAENLYAKLKDYIKHINIFELDDVEKSFEIHKLNFAIIICSTTGDGDAPDNA--SKFLRLIKIYQPKYLSNFKYTVLGLGDTNYSNFCNCSKTIDQILESKGARRFYRSDMADDAVGLEIVVEPWLDGLYEIAKDMCSEIPIDGFQNLSXXXXXXXXXXXXXXNYKELLGDHLAKDMDGKNLTVPALPSPFLNIIYNNEDSISNFHEPLITSMPMPSSDSELVMGEVQDITKITNKYAIKSVHRATINV-PNAKWKWKPGDSVGILPFNAESEVDSILSRL-SVPETEKNCVVXXXXXXXXXXXXAKVPEHLIV-RENGKMSLKSILLWLCDLRQPLSKVGLRIMSEYCPMKSAEQRRLLELCSREGQSFYTKCLRETSMPVLDLLNWFPSCQIPIVRLLEVLPRLKPRAYSLCDLESVSFAFSKVDIAPIQTFRKR----PLT-GVCTSWMEKMAKFHNEQIWKIPIYLRKNMNGFTVCENPSIPHILIGPGTGVAPFIGFLQYFEK---------LKNENQNIGPIW----LFFGCRNEERDFIFKKQLEHFANSGILTHLCVCFSRDNPTNSGDEQKNFCQPPNCK-YVQHCLLHHSKILSDLLVNQNARVFVCGDSSGMSKDVLETWSNVLLGNHEKIQTKRDADSFITGMRVQKLYLEDVW 2038
            ILY ++TG+++S A  L A L  +     +  +D+     E+      +I+ ST G+GD P+N   S    L    Q + + +    + GLG   Y NFC  ++++D+I++  GA + ++    D+  G E   + W   +++ A   C    +    N++                          + D    T+ +  SP      + ++ + +  + + +    P     +V  +V+ + K+ +  + +S     ++  P A++ + PGD + + P N    V S++ RL   P+ ++   + +    + +    K  +   V R     +++       D+    +   L+ ++      + + R  LE   + G + Y     E    ++++L  FPS  +    LL  LP L+PR YS+   +  S     + +A +Q + KR    P+  GVC++W   +          +P ++RK  + F + ++ S+P I++GPGTG+APF  F Q  +           K  +   G  W    L+FGCR    D I++++ +     G L  +    SR              +P + K YVQ  L   +  + D LV Q A ++ CGD S M+ DV  T   +L        T+++A  FI  ++    Y ED++
Sbjct:  485 ILYATETGKSESYARML-ADLFLHAFDPKVMRMDEYPHP-EMENEQLILIVTSTFGNGDPPENGEVSTINPLDSASQQRIIED---QMFGLGSRAYPNFCAFARSLDKIIQELGAEQIHKCGEGDELAGQEESFKTWAKQVFKAA---CDTFCVGEMVNVA--------------------------EADESLNTLSSGWSPGKYRFTSVKEELQDVCKSIASVNNKP-----IVGAKVKSVKKLQSADSSRSTILLKLDTSPAAEFHYNPGDHLSVFPCNRRELVQSLIDRLCEAPDPDQPIKLEVCQETSGKRPFGKTKKWTPVDRLPTPTTVREAFSRFIDIAGTPTPQILKSLASLA--TNPKDREALETLGK-GDNHYDDWKYEKQSNIVEVLEEFPSVNVEAEMLLTQLPLLQPRFYSISSSQDFSPNEVHLTVAVVQ-YNKREGKGPVHYGVCSTWFNGLKPGD-----IVPCFVRK-AHSFHLPDDGSLPIIMVGPGTGIAPFRSFWQQRQYDIVKKPSPVPKPRDAAPGSGWGDMVLYFGCRCSTLDDIYQEETKTAHQDGALAAVRTALSR--------------EPGHVKQYVQDLLKEDADAIIDKLVGQGAHLYTCGDVS-MAADVCRTIQKLL--EEYAAMTQQEAQEFIDNLKSSGRYHEDIF 1096          
BLAST of methionine synthase reductase vs. Ensembl Nematostella
Match: EDO28992 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T4X1])

HSP 1 Score: 68.5514 bits (166), Expect = 4.141e-12
Identity = 43/148 (29.05%), Postives = 73/148 (49.32%), Query Frame = 2
Query:   65 KMTCILYGSQTGQAKSIAENLYAKLKDYIKHINIF--ELDDVEKSFEIHKLN--FAIIICSTTGDGDAPDNASKFLRLIKIYQPKYLSNFKYTVLGLGDTNYSNFCNCSKTIDQILESKGARRFYRSDMADDAVGLEIVVEPWLDGLY 496
            K   I YGSQTG A+  A  L    + Y     +F  E +D+E+   + +++  FAI + +T G+GD  DNA +F   ++  +   L +  + V GLG+  Y ++ +  + +D+ LE  G  R Y+    DD   +E     W +  +
Sbjct:    2 KPLAIFYGSQTGTAEEFASRLAKDAQRYGIKAMVFDPEENDMEELTRMGEIDNSFAIFVMATYGEGDPTDNAQEFYEWLQNDRDD-LDSLNFAVFGLGNKTYEHYNSMGRYVDKRLEELGGNRIYQRGEGDDDGNIEEDFVRWREEFW 148          
BLAST of methionine synthase reductase vs. Ensembl Medaka
Match: mtrr (5-methyltetrahydrofolate-homocysteine methyltransferase reductase [Source:NCBI gene;Acc:101167253])

HSP 1 Score: 218.009 bits (554), Expect = 1.629e-60
Identity = 158/487 (32.44%), Postives = 249/487 (51.13%), Query Frame = 2
Query:  647 NLTVPALPSPFLNIIYNNEDSISNFHEPLI-TSMPMPSSDSELVMGEVQDITKITNKYAIKSVHRATINVPN-AKWKWKPGDSVGILPFNAESEVDSILSRLSVPETEKNCVVXXXXXXXXXXXXAKVPEHLIVRENGKMSLKSILLWLCDLRQPLSKVGLRIMSEYCPMKSAEQRRLLELCSREGQSFYTKCLRETSMPVLDLLNWFPSCQIPIVRLLEVLPRLKPRAYS-----LCDLESVSFAFSKVDIAPIQTFRKRPLTGVCTSWMEKMAKFHNEQIW--------------KIPIYLRKNMNGFTVCENPSIPHILIGPGTGVAPFIGFLQYFEKLKNENQN--IGPIWLFFGCRNEERDFIFKKQLEHFANSGILTHLCVCFSRDNPTNSGDEQKNFCQPPNCKYVQHCLLHHSKILSDLLVNQNARVFVCGDSSGMSKDVLETWSNVLLGNHEKIQTKRDADSFITGMRVQKLYLEDVW 2038
            +L VPALP PFL++     D+      PL  T   +P S + L          ++   ++K+     +++       ++PGDS+ +L  N   EVD +L RL + +  ++  V + L ++ + + A VP H+       +SL  +  W  ++R    K  LR + EY      ++RRL ELCS++G + Y   +R+ S+ V++LL  F SC  P+  L+E LP+L+PR YS     L     + F FS V++ P    R     G+CT W+  +   H   ++               I + LR + + F      S+P I++GPGTGVAPFIGFLQ  E+ +  N     G  WLFFGCR+   D++F+++LE F  SG L+HL VCFSRD                N +YVQH LL + + ++D+L+ Q+   +VCGD+  M+KDV ET   ++    E    + +A   +  +R +K YL+D+W
Sbjct:  266 SLNVPALPPPFLDVTLVEVDAPEQNVGPLKETFHEVPISKAVL----------LSRGDSVKTALLLELDISTCPALTYQPGDSLDVLCPNRAEEVDYMLCRLGL-KDRRDHRVHVALRKDTKKKGAHVPPHI----PQNVSLLFLFTWCLEIRSVPKKAFLRALVEYA-ADGTQKRRLQELCSKQGAADYNLHVRDASLSVVELLTAFSSCSPPLSLLIEHLPKLQPRPYSAASSCLRHPGKLHFVFSVVEL-PACFGRPAGRRGLCTGWLFDL--IHPGIVFPGKTESSSSPAPAKAIHVSLRPSCS-FRPPSEQSVPFIMVGPGTGVAPFIGFLQQREEARKRNPEAVFGETWLFFGCRHRNGDYLFREELEGFVASGTLSHLKVCFSRDGREAEEAVASAA----NPRYVQHNLLLYRQQVADILLRQSGCFYVCGDAKNMAKDVNETLMEII--KTELHVDQLEAMKKLAELREKKRYLQDIW 726          

HSP 2 Score: 142.895 bits (359), Expect = 6.315e-35
Identity = 70/159 (44.03%), Postives = 105/159 (66.04%), Query Frame = 2
Query:   53 CDFLKMTCILYGSQTGQAKSIAENLYAKLKDYIKHINIFELDDVEKSFEIHKLNFAIIICSTTGDGDAPDNASKFLRLIKIYQ-PKYLSNFKYTVLGLGDTNYSNFCNCSKTIDQILESKGARRFYRSDMADDAVGLEIVVEPWLDGLYEIAKDMCSEI 526
            C+      +LYGSQ GQA+SIAE +  + +D+     +  L+  EK     ++   + + STTGDG+ PDNA +F++ I   Q P +  +  YT+L LGDTNY+NFCNC KTI++ L++ GAR+FY +  ADD VGLE+VV+PWL+GL++  K+  S++
Sbjct:    3 CETKSRFVVLYGSQKGQAQSIAEGIAEEAEDHGLVAELSCLNQDEKYNLEKEIAPVVFVVSTTGDGEPPDNALQFVKRINKNQSPDHYKHLSYTLLALGDTNYANFCNCGKTIERRLQALGARQFYPAGFADDGVGLELVVDPWLEGLWKAVKEASSKM 161          
BLAST of methionine synthase reductase vs. Ensembl Medaka
Match: mtrr (5-methyltetrahydrofolate-homocysteine methyltransferase reductase [Source:NCBI gene;Acc:101167253])

HSP 1 Score: 218.394 bits (555), Expect = 2.299e-60
Identity = 158/487 (32.44%), Postives = 249/487 (51.13%), Query Frame = 2
Query:  647 NLTVPALPSPFLNIIYNNEDSISNFHEPLI-TSMPMPSSDSELVMGEVQDITKITNKYAIKSVHRATINVPNA-KWKWKPGDSVGILPFNAESEVDSILSRLSVPETEKNCVVXXXXXXXXXXXXAKVPEHLIVRENGKMSLKSILLWLCDLRQPLSKVGLRIMSEYCPMKSAEQRRLLELCSREGQSFYTKCLRETSMPVLDLLNWFPSCQIPIVRLLEVLPRLKPRAYS-----LCDLESVSFAFSKVDIAPIQTFRKRPLTGVCTSWMEKMAKFHNEQIW--------------KIPIYLRKNMNGFTVCENPSIPHILIGPGTGVAPFIGFLQYFEKLKNENQN--IGPIWLFFGCRNEERDFIFKKQLEHFANSGILTHLCVCFSRDNPTNSGDEQKNFCQPPNCKYVQHCLLHHSKILSDLLVNQNARVFVCGDSSGMSKDVLETWSNVLLGNHEKIQTKRDADSFITGMRVQKLYLEDVW 2038
            +L VPALP PFL++     D+      PL  T   +P S + L          ++   ++K+     +++       ++PGDS+ +L  N   EVD +L RL + +  ++  V + L ++ + + A VP H+       +SL  +  W  ++R    K  LR + EY      ++RRL ELCS++G + Y   +R+ S+ V++LL  F SC  P+  L+E LP+L+PR YS     L     + F FS V++ P    R     G+CT W+  +   H   ++               I + LR + + F      S+P I++GPGTGVAPFIGFLQ  E+ +  N     G  WLFFGCR+   D++F+++LE F  SG L+HL VCFSRD                N +YVQH LL + + ++D+L+ Q+   +VCGD+  M+KDV ET   ++    E    + +A   +  +R +K YL+D+W
Sbjct:  294 SLNVPALPPPFLDVTLVEVDAPEQNVGPLKETFHEVPISKAVL----------LSRGDSVKTALLLELDISTCPALTYQPGDSLDVLCPNRAEEVDYMLCRLGLKD-RRDHRVHVALRKDTKKKGAHVPPHI----PQNVSLLFLFTWCLEIRSVPKKAFLRALVEYA-ADGTQKRRLQELCSKQGAADYNLHVRDASLSVVELLTAFSSCSPPLSLLIEHLPKLQPRPYSAASSCLRHPGKLHFVFSVVEL-PACFGRPAGRRGLCTGWLFDL--IHPGIVFPGKTESSSSPAPAKAIHVSLRPSCS-FRPPSEQSVPFIMVGPGTGVAPFIGFLQQREEARKRNPEAVFGETWLFFGCRHRNGDYLFREELEGFVASGTLSHLKVCFSRDGREAEEAVASAA----NPRYVQHNLLLYRQQVADILLRQSGCFYVCGDAKNMAKDVNETLMEII--KTELHVDQLEAMKKLAELREKKRYLQDIW 754          

HSP 2 Score: 142.895 bits (359), Expect = 7.129e-35
Identity = 71/167 (42.51%), Postives = 107/167 (64.07%), Query Frame = 2
Query:   29 FVYIMHLLCDFLKMTCILYGSQTGQAKSIAENLYAKLKDYIKHINIFELDDVEKSFEIHKLNFAIIICSTTGDGDAPDNASKFLRLIKIYQ-PKYLSNFKYTVLGLGDTNYSNFCNCSKTIDQILESKGARRFYRSDMADDAVGLEIVVEPWLDGLYEIAKDMCSEI 526
            F     + C+      +LYGSQ GQA+SIAE +  + +D+     +  L+  EK     ++   + + STTGDG+ PDNA +F++ I   Q P +  +  YT+L LGDTNY+NFCNC KTI++ L++ GAR+FY +  ADD VGLE+VV+PWL+GL++  K+  S++
Sbjct:   23 FSLFCSMPCETKSRFVVLYGSQKGQAQSIAEGIAEEAEDHGLVAELSCLNQDEKYNLEKEIAPVVFVVSTTGDGEPPDNALQFVKRINKNQSPDHYKHLSYTLLALGDTNYANFCNCGKTIERRLQALGARQFYPAGFADDGVGLELVVDPWLEGLWKAVKEASSKM 189          
BLAST of methionine synthase reductase vs. Ensembl Medaka
Match: POR (NADPH--cytochrome P450 reductase [Source:NCBI gene;Acc:101166486])

HSP 1 Score: 194.126 bits (492), Expect = 1.869e-52
Identity = 179/670 (26.72%), Postives = 298/670 (44.48%), Query Frame = 2
Query:   65 KMTCILYGSQTGQAKSIAENLYAKLKDY-IKHINI----FELDDVEKSFEIHKLNFAIIICSTTGDGDAPDNASKFLRLIKIYQPKYLSNFKYTVLGLGDTNYSNFCNCSKTIDQILESKGARRFYRSDMADDAVGLEIVVEPWLDGLYEIAKDMCSEIPIDGFQN-LSXXXXXXXXXXXXXXNYKELLGDHLAKDMDGKNLTVPALPSPFLNIIYNNEDSISNFHEPLITSMPMPSSDSELVMGEVQDITKITNKYAIKSVHRATINVPNAKWKWKPGDSVGILPFNAESEVDSILSRLSVPETEKNCVVXXXXXXXXXXXXAKVPEHLIVRENGKMSLKSILLWLCDLRQPLSKVGLRIMSEYCPM-KSAEQRRLLELCSREGQSFYTKCLRETSMPVLDLLNWFPSCQIPIVRLLEVLPRLKPRAYSLCDLESV---SFAFSKVDIAPIQTFRKRPLTGVCTSWMEKMAKFHNEQIWKIPIYLRKNMNGFTVCENPSIPHILIGPGTGVAPFIGFLQYFEKLKNENQNIGPIWLFFGCRNEERDFIFKKQLEHFANSGILTHLCVCFSRDNPTNSGDEQKNFCQPPNCKYVQHCLLHHSKILSDLLVNQNARVFVCGDSSGMSKDVLETWSNVLLGNHEKIQ--TKRDADSFITGMRVQKLYLEDVW 2038
            K   + YGSQTG A+  A  L    + Y +K +      + + ++ +  EI K + AI   +T G+GD  DNA  F   ++    + LS   YTV  LG+  Y ++    K +D+ LE  GA+R +   + DD   LE     W +  +     +C    ++   + LSI +   K+      N K   G+       G+  +      PF        D+ + F  P+  +  +  +    +M    DIT                    +K +++ GD V + P N  + V+ +   L V   + + V+ L  L+   N++   P           + ++ L    D+  P     L  +++Y    K  E  R +   S EG++ Y   + ++   +L +L   PS + P+  L E+LPRL+ R YS+     V   S     V +    T   R   GV T+W++   K  N     +P+++RK+   F +    + P I+IGPGTG+APF+GF+Q    LK + + +G   L+FGCR++  D+I++++LE    SG+LT L V FSRD                   YVQH L  + + +  L+   NA ++VCGD+  M+KDV       L    E+++  T+  A  +I  +  +  Y +DVW
Sbjct:   72 KNIIVFYGSQTGTAEEFANRLSKDAQRYGMKGMAADPEEYTMGELARMSEI-KNSLAIFCMATYGEGDPTDNAQDFYDWLQENDDEDLSGLNYTVFALGNKTYEHYNAMGKYVDKRLEELGAKRIFDLGLGDDDSNLEEDFVSWREQFWPA---VCEHFGVEASADELSIRQYELKLHNDVNMN-KVFTGE------IGRLKSFEVQKPPF--------DAKNPFLAPVTVNRRLNKAGDRHLMHLELDIT-------------------GSKLRYESGDHVAVFPTNDSALVNRLGEILGV---DLDVVISLNNLDEESNKKHPFP--------CPTTYRTALTHYLDIMNPPRTNVLYELAQYASEPKDQENMRKMASSSPEGKALYQTWVLDSCRNILAILEDMPSLKPPVDHLCELLPRLQARYYSIASSSKVHPNSIHICAV-VVEYSTKTGRVNKGVATNWLKN--KLVNGHKSTVPMFIRKSQ--FRLPFKATNPVIMIGPGTGIAPFMGFIQERGWLKEQGKEVGETVLYFGCRHKNEDYIYQEELEDAEKSGVLTQLNVAFSRDQDHKV--------------YVQHLLKKNKEHVWKLIHTDNAHLYVCGDARNMAKDV----QTALYEIAEELEGMTRTQATDYIKKLMTKGRYSQDVW 669          
BLAST of methionine synthase reductase vs. Ensembl Medaka
Match: nos1 (nitric oxide synthase 1 [Source:NCBI gene;Acc:100049502])

HSP 1 Score: 113.235 bits (282), Expect = 3.017e-25
Identity = 109/401 (27.18%), Postives = 192/401 (47.88%), Query Frame = 2
Query:  863 KWKWKPGDSVGILPFNAESEVDSILSRLS-VPETEKNCVVXXXXXXXXXXXXAKVPEHLIVRENGKMSLKSILLWLCDLRQPLSKVGLRIMSEYCPMKSAE-QRRLLELCSREGQSFYTKCLRETSMPVLDLLNWFPSCQIPIVRLLEVLPRLKPRAYSLCDLESVSFAFSKVDIAPIQTFRKR----PLT-GVCTSWMEKMAKFHNEQIWKIPIYLRKNMNGFTVCENPSIPHILIGPGTGVAPFIGFLQY-FEKLKNENQNIGPIWLFFGCRNEERDFIFKKQLEHFANSGILTHLCVCFSRDNPTNSGDEQKNFCQPPNCKYVQHCLLHH-SKILSDLLVNQNARVFVCGDSSGMSKDVLETWSNVLLGNHEKIQTKRDADSFITGMRVQKLYLEDVW 2038
            K  +KPGD +GI P N E  V +++ +L   P    N +V++E LE        +            ++     +  D+  P + V   ++ ++  + + E ++R LE+ S+ G   Y +     +  ++++L  FPS Q+P   LL  LP L+ R YS+            + +A + ++R R    P+  GVC+SW+ ++ K        +P ++R +   F + ++   P IL+GPGTG+APF  F Q+    L++      P+ L FGCR  E D I+K++     N G+   L   +SR+     G  +         KYVQ  L  H S+++   L  +   ++VCGD + M+ DVL+T   ++    +   +  DA  +I+ +R +  Y ED++
Sbjct: 1026 KLSYKPGDHLGIFPGNHEDLVTALIDKLEDAPPV--NQIVKVEFLEERNTALGVISNWTHETRIPPCTIYQAFQYFLDITTPPTPV---LLQQFAALATNEKEKRKLEILSK-GLQEYEEWKWYNNPTLVEVLEEFPSIQMPSTLLLTQLPLLQARYYSISSSPDTYPGEIHLTVA-VVSYRTRDGGGPIHHGVCSSWLNRIEKGE-----MVPCFVR-SAPSFQLPKDDQAPCILVGPGTGIAPFRSFWQHRLYNLEHNGIKSCPMILVFGCRQSEMDHIYKEETLQAKNKGVFKELYTAYSRE----PGKPK---------KYVQDVLREHLSEMVYQCLKKEGGHIYVCGDVT-MAGDVLKTVQQIV--KQQGNMSLEDAGFYISKLRDENRYHEDIF 1397          
BLAST of methionine synthase reductase vs. Ensembl Medaka
Match: nos1 (nitric oxide synthase 1 [Source:NCBI gene;Acc:100049502])

HSP 1 Score: 113.235 bits (282), Expect = 3.442e-25
Identity = 109/401 (27.18%), Postives = 192/401 (47.88%), Query Frame = 2
Query:  863 KWKWKPGDSVGILPFNAESEVDSILSRLS-VPETEKNCVVXXXXXXXXXXXXAKVPEHLIVRENGKMSLKSILLWLCDLRQPLSKVGLRIMSEYCPMKSAE-QRRLLELCSREGQSFYTKCLRETSMPVLDLLNWFPSCQIPIVRLLEVLPRLKPRAYSLCDLESVSFAFSKVDIAPIQTFRKR----PLT-GVCTSWMEKMAKFHNEQIWKIPIYLRKNMNGFTVCENPSIPHILIGPGTGVAPFIGFLQY-FEKLKNENQNIGPIWLFFGCRNEERDFIFKKQLEHFANSGILTHLCVCFSRDNPTNSGDEQKNFCQPPNCKYVQHCLLHH-SKILSDLLVNQNARVFVCGDSSGMSKDVLETWSNVLLGNHEKIQTKRDADSFITGMRVQKLYLEDVW 2038
            K  +KPGD +GI P N E  V +++ +L   P    N +V++E LE        +            ++     +  D+  P + V   ++ ++  + + E ++R LE+ S+ G   Y +     +  ++++L  FPS Q+P   LL  LP L+ R YS+            + +A + ++R R    P+  GVC+SW+ ++ K        +P ++R +   F + ++   P IL+GPGTG+APF  F Q+    L++      P+ L FGCR  E D I+K++     N G+   L   +SR+     G  +         KYVQ  L  H S+++   L  +   ++VCGD + M+ DVL+T   ++    +   +  DA  +I+ +R +  Y ED++
Sbjct: 1033 KLSYKPGDHLGIFPGNHEDLVTALIDKLEDAPPV--NQIVKVEFLEERNTALGVISNWTHETRIPPCTIYQAFQYFLDITTPPTPV---LLQQFAALATNEKEKRKLEILSK-GLQEYEEWKWYNNPTLVEVLEEFPSIQMPSTLLLTQLPLLQARYYSISSSPDTYPGEIHLTVA-VVSYRTRDGGGPIHHGVCSSWLNRIEKGE-----MVPCFVR-SAPSFQLPKDDQAPCILVGPGTGIAPFRSFWQHRLYNLEHNGIKSCPMILVFGCRQSEMDHIYKEETLQAKNKGVFKELYTAYSRE----PGKPK---------KYVQDVLREHLSEMVYQCLKKEGGHIYVCGDVT-MAGDVLKTVQQIV--KQQGNMSLEDAGFYISKLRDENRYHEDIF 1404          
BLAST of methionine synthase reductase vs. Planmine SMEST
Match: SMESG000061482.1 (SMESG000061482.1)

HSP 1 Score: 1289.25 bits (3335), Expect = 0.000e+0
Identity = 651/658 (98.94%), Postives = 652/658 (99.09%), Query Frame = 2
Query:   68 MTCILYGSQTGQAKSIAENLYAKLKDYIKHINIFELDDVEKSFEIHKLNFAIIICSTTGDGDAPDNASKFLRLIKIYQPKYLSNFKYTVLGLGDTNYSNFCNCSKTIDQILESKGARRFYRSDMADDAVGLEIVVEPWLDGLYEIAKDMCSEIPIDGFQNLSXXXXXXXXXXXXXXNYKELLGDHLAKDMDGKNLTVPALPSPFLNIIYNNEDSISNFHEPLITSMPMPSSDSELVMGEVQDITKITNKYAIKSVHRATINVPNAKWKWKPGDSVGILPFNAESEVDSILSRLSVPETEKNCVVXXXXXXXXXXXXAKVPEHLIVRENGKMSLKSILLWLCDLRQPLSKVGLRIMSEYCPMKSAEQRRLLELCSREGQSFYTKCLRETSMPVLDLLNWFPSCQIPIVRLLEVLPRLKPRAYSLCDLESVSFAFSKVDIAPIQTFRKRPLTGVCTSWMEKMAKFHNEQIWKIPIYLRKNMNGFTVCENPSIPHILIGPGTGVAPFIGFLQYFEKLKNENQNIGPIWLFFGCRNEERDFIFKKQLEHFANSGILTHLCVCFSRDNPTNSGDEQKNFCQPPNCKYVQHCLLHHSKILSDLLVNQNARVFVCGDSSGMSKDVLETWSNVLLGNHEKIQTKRDADSFITGMRVQKLYLEDVWI 2041
            MTCILYGSQTGQAKSIAENLYAKLKDYIKHINIFELDDVEK FEIHKLNFAIIICSTTGDGDAPDNASKFLRLIKIYQPKYLSNFKYTVLGLGDTNYSNFCNCSKTIDQILESKGARRFYRSDMADDAVGLEIVVEPWLDGLYEIAKDMCSEIPIDGFQNLSITEKISKIEIKPIENYKELLGDHLAKDMDGKNLTVPALPSPFLNIIYNNEDSISNFHEPLITSMPMPSSDSELVMGE+QDITKITNKYAIKSVHRATINVPNAKWKWKPGDSVGILP NAESEVDSILSRL VPETEKNC VRLELLENLENRRAKVPEHLIVRENGKMSLKSILLWLCDLRQPLSKVGLRIMSEYCPMKSAEQRRLLELCSREGQSFYTKCLRETSMPVLDLLNWFPSCQIPIVRLLEVLPRLKPRAYSLCDLESVSFAFSKVDIAPIQTFRKRPLTGVCTSWMEKMA FHNEQIWKIPIYLRKNMNGFTVCENPSIPHILIGPGTGVAPFIGFLQYFEKLKNENQNIGPIWLFFGCRNEERDFIFKKQLEHFANSGILTHLCVCFSRDNPTNSGDEQKNFCQPPNCKYVQHCLLHHS ILSDLLVNQNARVFVCGDSSGMSKDVLETWSNVLLGNHEKIQTKRDADSFITGMRVQKLYLEDVWI
Sbjct:    1 MTCILYGSQTGQAKSIAENLYAKLKDYIKHINIFELDDVEKCFEIHKLNFAIIICSTTGDGDAPDNASKFLRLIKIYQPKYLSNFKYTVLGLGDTNYSNFCNCSKTIDQILESKGARRFYRSDMADDAVGLEIVVEPWLDGLYEIAKDMCSEIPIDGFQNLSITEKISKIEIKPIENYKELLGDHLAKDMDGKNLTVPALPSPFLNIIYNNEDSISNFHEPLITSMPMPSSDSELVMGEIQDITKITNKYAIKSVHRATINVPNAKWKWKPGDSVGILPCNAESEVDSILSRLFVPETEKNCAVRLELLENLENRRAKVPEHLIVRENGKMSLKSILLWLCDLRQPLSKVGLRIMSEYCPMKSAEQRRLLELCSREGQSFYTKCLRETSMPVLDLLNWFPSCQIPIVRLLEVLPRLKPRAYSLCDLESVSFAFSKVDIAPIQTFRKRPLTGVCTSWMEKMANFHNEQIWKIPIYLRKNMNGFTVCENPSIPHILIGPGTGVAPFIGFLQYFEKLKNENQNIGPIWLFFGCRNEERDFIFKKQLEHFANSGILTHLCVCFSRDNPTNSGDEQKNFCQPPNCKYVQHCLLHHSNILSDLLVNQNARVFVCGDSSGMSKDVLETWSNVLLGNHEKIQTKRDADSFITGMRVQKLYLEDVWI 658          
BLAST of methionine synthase reductase vs. Planmine SMEST
Match: SMESG000022047.1 (SMESG000022047.1)

HSP 1 Score: 179.104 bits (453), Expect = 3.389e-47
Identity = 174/679 (25.63%), Postives = 292/679 (43.00%), Query Frame = 2
Query:   65 KMTCILYGSQTGQAKSIAENLYAKLKDY-IKHINIF-ELDDVEKSFEIHKL--NFAIIICSTTGDGDAPDNASKFLRLIKIYQPKYLSNFKYTVLGLGDTNYSNFCNCSKTIDQILESKGARRFYRSDMADDAVGLEIVVEPWLDGLYEIAKDMCSEIPIDGFQNLSXXXXXXXXXXXXXXNYKELLGDHLAKDMDGKNLTVPA-LPSPFLNIIYNNE----DSISNFHEPLITSMPMPSSDSELVMGEVQDITKITNKYAIKSVHRATINVPNAKWKWKPGDSVGILPFNAESEVDSILSRLSVPETEKNCVVXXXXXXXXXXXXAKVPEHLIVRENGK-------MSLKSILLWLCDLRQPLSKVGLRIMSEYCPMKSAEQRRLLELCSREGQSFYTKCLRETSMPVLDLLNWFPSCQIPIVRLLEVLPRLKPRAYSLCDLESV---SFAFSKVDIAPIQTFRKRPLTGVCTSWMEKMAKFHNEQIWKIPIYLRKNMNGFTVCENPSIPHILIGPGTGVAPFIGFLQYFEKLKNENQNIGPIWLFFGCRNEERDFIFKKQLEHFANSGILTHLCVCFSRDNPTNSGDEQKNFCQPPNCKYVQHCLL--HHSKILSDLLVNQNARVFVCGDSSGMSKDVLETWSNVLLGNHEKIQTKRDADSFITGMRVQKLYLEDVW 2038
            K   + YGSQTG A+  A  L  +   Y +K +    E  D+E+   +  +  + AI   +T G+GD  DNA +F   ++      ++  +YTV GLG+  Y NF    K  D+ L   GA R +   + DD   +E     W + ++     +C+   I G                          D +  ++    L +PA +P    N IY  E     +      P     P  +    LV  E+        K   +SV    +++ N++ K++ GD V + P N    VD +  RL++   +   +V                   I  +N K        + ++ LL   D+  PL    L  +SEY   KS E   L  L S EG+  Y + + ++   +L +L   PS ++P   LLE+LPRL+ R YS+     +   +   + V +  I T   R + GVCT ++  M      +   +PIY+R++   F +      P I++GPG+G+APF GF++     K+  + +G   ++FGCR +  DF+++ +L+      +++ L + FSRD                +  YVQH +    + K + D ++N     ++CGD+  M+KDV  T  N+     E   T   A  ++  M+ +  +  DVW
Sbjct:   90 KNVVVFYGSQTGTAEDFANRLAKEAVRYGLKGMAADPEECDMEELLNLKSIENSLAIFCMATYGEGDPTDNAQEFYNWLQNATVN-MNGLRYTVFGLGNKTYENFNAMGKYFDRRLSELGATRIHELGIGDDDSNIEDHFITWKEDMW---TSVCNHFGISG--------------------------DKIDINVRQYRLELPANVPE---NKIYKGEVTRLGAFEKQRPPFDAKNPFLAK--VLVKQELC-------KGGDRSVMHIELDITNSRIKYESGDHVAVFPTNDPILVDKLAKRLNINLDQVISMVA------------------IDEDNSKRHPFPCPTTYRTALLHYIDINNPLKTNVLGDLSEYATDKS-EADFLKNLSSIEGKIKYQEWILDSRRNILAVLEDLPSLKVPTDHLLELLPRLQVRYYSISSSPKIYPNTIHITAVLLDYI-TNTGRNMKGVCTHYL-NMKNPSPSETPVVPIYVRRSQ--FRLPYKSKSPIIMVGPGSGIAPFKGFIEDRSVAKSAGKPLGETVMYFGCRKQSEDFLYEDELKKAHQDNVISDLYLAFSRDQ--------------SDKIYVQHLMAKEKNRKQIWD-IINSGGHFYICGDAKHMAKDVNNTLLNIF--QTEGGMTNSQAQDYLKMMQNKGRHSSDVW 686          
BLAST of methionine synthase reductase vs. Planmine SMEST
Match: SMESG000056879.1 (SMESG000056879.1)

HSP 1 Score: 73.9442 bits (180), Expect = 2.409e-13
Identity = 92/410 (22.44%), Postives = 168/410 (40.98%), Query Frame = 2
Query:  845 INVPNAKWKWKPGDSVGILPFNAESEVD-----SILSRLSVPETEKNCVVXXXXXXXXXXXXAKVPEHLIVRENGKMSLKSILLWLCDLRQPLSKVGLRIMSEYCPMKSAEQRRLLELCSREG-QSFYTKCLRETSMPVLDLLNWFP--SCQIPIVRLLEVLPRLKPRAYSLCDLESVSFAFSKVDIAPIQ----TFRKRPLTGVCTSWMEKMAKFHNEQIWKIPIYLRKNMNGFTVCENPSIPHILIGPGTGVAPFIGFLQYFEKLKNENQNIGPIWLFFGCRNEERDFIFKKQLEHFANSGILTHLCVCFSRDNPTNSGDEQKNFCQPPNCKYVQHCLLHHSKILSDLLVNQNARVFVCGDSSGMSKDVLETWSNVLLGNHEKIQTKRDADSFITGMRVQKLYLEDVW 2038
            I   N   K+  GD + I P N++ EVD     + L R ++   ++N                K+P   +   +  +S ++I+ +  DL     K      + +      E+ RL EL   E     Y+ C  +    ++++L  FP  S  I I + + ++P ++PR YS+     V     +V ++ ++     F  R   G+C++++  +            I   +   G     +   P ILI PGTG+A F G++   E++     NIG   L FG R + RDF F  + + F  +     L   FSR+                   Y+Q  L   S+++  ++   +  +F+ G S  M + V     N+++   E   ++++A + +  M   K Y  + W
Sbjct:  233 IAFDNKNLKYDVGDVLSIYPQNSKIEVDLFFELTNLCRNTLLTIKRNL-------------NFKIPSIFV---SNSLSFENIVYYGLDLNSVPRKSFFEHFA-FISDDKVEKERLQELSDAENIDELYSYCF-QPKRTIIEVLQDFPNTSKYINISQWINLIPFIRPRDYSIASSNVVHNGEIQVLVSRVKYKTKMFNSR--IGLCSNFLCDLKP--------SDIVFSRIKKGTLKFPDSYFPLILISPGTGIAAFRGYIS--ERML--ANNIGRTLLCFGSRYKNRDFYFASEFKSFCKNNNF-KLLTAFSREEKV----------------YIQDKLKEQSELIWKIIKEPSGFLFISGRSVDMPQQVHNEIKNIII--KEGGISEKEAANILNVMEKHKRYQIETW 591          

HSP 2 Score: 69.3218 bits (168), Expect = 5.674e-12
Identity = 49/153 (32.03%), Postives = 81/153 (52.94%), Query Frame = 2
Query:   77 ILYGSQTGQAKSIAENLY---AKLKDYIKHINIFELDDVEKSFE-IHKLNFAIIICSTTGDGDAPDNASKFLRLI--KIYQPKYLSNFKYTVLGLGDTNYSNFCNCSKTIDQILESKGARRFYRSDMADD--AVGLEIVVEPWLDGLYEIAKD 511
            I YGSQTG A+ +AE +Y     L      + I E++DV  +F+ + + +  I ICSTTG GD PDN   F + +  + + P  LS   + V GLGD+ Y+ +   +K + + L    A       +ADD  ++G++     W+  L+++ +D
Sbjct:    6 IFYGSQTGNAQDVAEKVYRFSQNLPPKYASVKIGEMNDV--AFDSLSQNDIFIFICSTTGQGDPPDNMKHFWQCVMKRSFNPN-LSCLDFAVFGLGDSKYNKYNFIAKKLYRRLIQLKANSMINIGLADDQHSLGIDGEFSLWIKLLWKVLED 155          
The following BLAST results are available for this feature:
BLAST of methionine synthase reductase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MTRR1.107e-10333.155-methyltetrahydrofolate-homocysteine methyltransf... [more]
MTRR1.223e-10333.295-methyltetrahydrofolate-homocysteine methyltransf... [more]
POR5.841e-4825.60cytochrome p450 oxidoreductase [Source:HGNC Symbol... [more]
POR4.385e-4225.24cytochrome p450 oxidoreductase [Source:HGNC Symbol... [more]
NDOR11.049e-3824.18NADPH dependent diflavin oxidoreductase 1 [Source:... [more]
back to top
BLAST of methionine synthase reductase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mtrr-11.736e-7929.44Methionine synthase reductase [Source:UniProtKB/S... [more]
mtrr-11.736e-7929.44Methionine synthase reductase [Source:UniProtKB/S... [more]
emb-83.343e-3526.74NADPH--cytochrome P450 reductase [Source:UniProtK... [more]
emb-83.343e-3526.74NADPH--cytochrome P450 reductase [Source:UniProtK... [more]
fre-13.709e-3125.12NADPH-dependent diflavin oxidoreductase 1 [Source... [more]
back to top
BLAST of methionine synthase reductase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Cpr2.000e-4824.55gene:FBgn0015623 transcript:FBtr0331224[more]
Cpr2.000e-4824.55gene:FBgn0015623 transcript:FBtr0331223[more]
Cpr2.000e-4824.55gene:FBgn0015623 transcript:FBtr0079250[more]
CG136671.504e-3823.46gene:FBgn0035890 transcript:FBtr0076611[more]
CG136671.504e-3823.46gene:FBgn0035890 transcript:FBtr0076610[more]
back to top
BLAST of methionine synthase reductase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mtrr1.153e-11734.305-methyltetrahydrofolate-homocysteine methyltransf... [more]
mtrr1.429e-11734.065-methyltetrahydrofolate-homocysteine methyltransf... [more]
mtrr1.989e-11333.855-methyltetrahydrofolate-homocysteine methyltransf... [more]
mtrr2.020e-5832.675-methyltetrahydrofolate-homocysteine methyltransf... [more]
porb1.295e-5425.90P450 (cytochrome) oxidoreductase b [Source:ZFIN;Ac... [more]
back to top
BLAST of methionine synthase reductase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MTRR1.368e-11634.145-methyltetrahydrofolate-homocysteine methyltransf... [more]
MTRR3.292e-11634.145-methyltetrahydrofolate-homocysteine methyltransf... [more]
MTRR7.758e-11033.765-methyltetrahydrofolate-homocysteine methyltransf... [more]
MTRR1.057e-10533.195-methyltetrahydrofolate-homocysteine methyltransf... [more]
MTRR8.050e-8235.565-methyltetrahydrofolate-homocysteine methyltransf... [more]
back to top
BLAST of methionine synthase reductase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Mtrr4.527e-10832.375-methyltetrahydrofolate-homocysteine methyltransf... [more]
Mtrr4.527e-10832.375-methyltetrahydrofolate-homocysteine methyltransf... [more]
Por9.154e-5125.38P450 (cytochrome) oxidoreductase [Source:MGI Symbo... [more]
Por1.359e-4125.26P450 (cytochrome) oxidoreductase [Source:MGI Symbo... [more]
Ndor12.484e-3925.49NADPH dependent diflavin oxidoreductase 1 [Source:... [more]
back to top
BLAST of methionine synthase reductase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8C1A3|MTRR_MOUSE8.224e-10932.09Methionine synthase reductase OS=Mus musculus OX=1... [more]
sp|Q4JIJ2|MTRR_BOVIN3.166e-10433.05Methionine synthase reductase OS=Bos taurus OX=991... [more]
sp|Q9UBK8|MTRR_HUMAN5.318e-10333.15Methionine synthase reductase OS=Homo sapiens OX=9... [more]
sp|Q17574|MTRR_CAEEL2.209e-7829.44Methionine synthase reductase OS=Caenorhabditis el... [more]
sp|Q498R1|MTRR_RAT3.622e-7133.13Methionine synthase reductase OS=Rattus norvegicus... [more]
back to top
BLAST of methionine synthase reductase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
C3XSJ59.910e-12934.18Uncharacterized protein OS=Branchiostoma floridae ... [more]
A0A2D0PRR01.661e-11433.57methionine synthase reductase OS=Ictalurus punctat... [more]
F1RE282.580e-11434.305-methyltetrahydrofolate-homocysteine methyltransf... [more]
A0A2R8QQ953.197e-11434.065-methyltetrahydrofolate-homocysteine methyltransf... [more]
W5U6V53.490e-11433.57Methionine synthase reductase OS=Ictalurus punctat... [more]
back to top
BLAST of methionine synthase reductase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mtrr2.310e-11734.345-methyltetrahydrofolate-homocysteine methyltransf... [more]
mtrr4.248e-11734.345-methyltetrahydrofolate-homocysteine methyltransf... [more]
pora1.491e-5125.83NADPH--cytochrome P450 reductase [Source:NCBI gene... [more]
porb3.033e-4825.41NADPH--cytochrome P450 reductase-like [Source:NCBI... [more]
NOS21.082e-3525.33nitric oxide synthase, inducible-like [Source:NCBI... [more]
back to top
BLAST of methionine synthase reductase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSPMAT00000004550.11.154e-10432.53pep scaffold:Pmarinus_7.0:GL501143:124546:139236:-... [more]
porb2.722e-4129.85P450 (cytochrome) oxidoreductase b [Source:ZFIN;Ac... [more]
back to top
BLAST of methionine synthase reductase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
TAH181.980e-3424.93Conserved NAPDH-dependent diflavin reductase; comp... [more]
NCP11.161e-3224.27NADP-cytochrome P450 reductase; involved in ergost... [more]
MET106.266e-1521.89Subunit alpha of assimilatory sulfite reductase; c... [more]
back to top
BLAST of methionine synthase reductase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO402461.169e-6031.79Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO308772.628e-4724.40Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO394344.243e-3528.31NADPH--cytochrome P450 reductase [Source:UniProtK... [more]
EDO394402.665e-2922.71Nitric oxide synthase [Source:UniProtKB/TrEMBL;Ac... [more]
EDO289924.141e-1229.05Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of methionine synthase reductase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mtrr1.629e-6032.445-methyltetrahydrofolate-homocysteine methyltransf... [more]
mtrr2.299e-6032.445-methyltetrahydrofolate-homocysteine methyltransf... [more]
POR1.869e-5226.72NADPH--cytochrome P450 reductase [Source:NCBI gene... [more]
nos13.017e-2527.18nitric oxide synthase 1 [Source:NCBI gene;Acc:1000... [more]
nos13.442e-2527.18nitric oxide synthase 1 [Source:NCBI gene;Acc:1000... [more]
back to top
BLAST of methionine synthase reductase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000061482.10.000e+098.94SMESG000061482.1[more]
SMESG000022047.13.389e-4725.63SMESG000022047.1[more]
SMESG000056879.12.409e-1322.44SMESG000056879.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30009557 ID=SMED30009557|Name=methionine synthase reductase|organism=Schmidtea mediterranea sexual|type=transcript|length=2263bp
AAAATCTTTAGGATAACATTTGAAATGTTTTGTTTATATAATGCACTTAT
TATGTGATTTTTTAAAAATGACATGTATATTGTATGGCTCTCAAACTGGT
CAAGCTAAGTCTATTGCTGAAAATTTATATGCAAAATTAAAGGATTATAT
AAAGCACATAAATATATTTGAACTAGATGATGTAGAAAAGTCTTTTGAAA
TTCATAAATTAAATTTTGCAATCATTATTTGCTCCACAACAGGAGATGGC
GACGCACCTGATAATGCATCAAAATTTTTAAGATTAATTAAAATTTACCA
GCCTAAATACTTAAGCAATTTTAAGTATACTGTCTTAGGTTTGGGTGATA
CAAATTATTCCAATTTTTGTAATTGTAGTAAGACTATTGATCAAATTTTA
GAATCCAAAGGTGCAAGAAGATTTTATCGTTCTGATATGGCAGACGATGC
GGTCGGACTAGAAATAGTCGTTGAACCTTGGCTAGATGGATTATACGAAA
TTGCGAAGGACATGTGTAGCGAAATTCCAATTGATGGTTTCCAAAATTTG
TCAATTACTGAAAAAATTTCTAAAATTGAAATAAAACCGATTGAAAACTA
TAAAGAATTATTAGGTGATCATTTAGCAAAAGATATGGATGGGAAAAATT
TAACTGTCCCAGCGTTACCATCACCATTTCTTAATATTATTTACAATAAT
GAAGATAGTATTAGTAATTTTCACGAACCGTTAATTACTAGTATGCCTAT
GCCATCAAGCGATTCTGAATTAGTAATGGGAGAAGTTCAAGATATTACCA
AAATAACAAATAAATATGCTATAAAATCCGTTCACAGGGCGACAATTAAC
GTTCCGAATGCCAAATGGAAATGGAAACCCGGTGACTCTGTCGGCATTTT
ACCATTCAATGCCGAAAGTGAAGTCGACTCAATTTTGTCGAGATTGTCCG
TTCCTGAAACGGAAAAGAATTGCGTTGTAAGATTGGAATTGCTAGAAAAT
TTAGAAAATCGACGCGCTAAAGTACCTGAACATTTAATTGTGCGAGAAAA
TGGGAAAATGTCTCTGAAATCAATTCTCTTGTGGCTTTGTGATTTGAGAC
AGCCACTAAGCAAAGTCGGATTGCGGATAATGAGCGAGTATTGTCCAATG
AAAAGTGCTGAACAACGAAGACTTCTTGAATTATGCTCTCGGGAGGGTCA
GAGCTTTTATACTAAGTGTCTTAGAGAAACAAGCATGCCAGTTCTGGATC
TATTGAACTGGTTTCCTTCTTGCCAAATTCCGATTGTACGACTCCTCGAA
GTATTACCTCGACTTAAACCTCGAGCATATTCGTTATGTGATCTCGAGTC
CGTTTCATTTGCATTTAGTAAAGTAGATATAGCGCCAATTCAGACATTCA
GGAAGCGTCCTTTAACGGGAGTTTGCACCTCATGGATGGAAAAAATGGCA
AAGTTTCACAATGAACAGATTTGGAAGATTCCCATTTACTTACGTAAAAA
TATGAATGGATTTACAGTTTGTGAGAACCCTTCAATTCCTCATATTTTAA
TTGGTCCGGGAACCGGAGTTGCGCCATTTATTGGTTTTCTACAATATTTC
GAAAAACTAAAAAATGAAAACCAAAATATTGGTCCGATTTGGTTGTTTTT
CGGTTGCCGAAATGAAGAGCGGGATTTTATATTCAAAAAGCAATTAGAGC
ATTTTGCAAACTCTGGCATTCTCACGCATTTGTGCGTATGTTTCTCTAGA
GATAATCCCACGAATTCAGGTGATGAGCAGAAGAACTTCTGCCAGCCTCC
GAATTGCAAATATGTTCAACACTGTTTATTGCATCATTCCAAAATTCTCA
GTGATTTGCTTGTGAATCAGAATGCTCGAGTATTTGTTTGTGGTGACAGC
TCTGGAATGTCCAAAGATGTTCTTGAAACCTGGTCAAACGTGTTGCTGGG
TAATCACGAAAAGATTCAAACCAAGAGAGATGCTGATTCATTTATCACGG
GAATGAGGGTTCAGAAATTGTACCTGGAGGATGTGTGGATTTAAATTTCC
TGAAATAAGTGAAGTGCTGTGATTTTAACATTTTTCAATAGTGCTTTATC
AATAAAACATTTGATTTTCTTTTTACAAAAACCTTTAGATATATTCTTAT
TAATGAATTCAGTGGGGATCTCGTTTATGGCTTCATTGGGCGCTGCTAGC
TTAATGAATAAGTGTATATGATAAATATATTGAGGCTAAATATATTGTAT
TATTGTGCCAAAA
back to top

protein sequence of SMED30009557-orf-1

>SMED30009557-orf-1 ID=SMED30009557-orf-1|Name=SMED30009557-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=668bp
MHLLCDFLKMTCILYGSQTGQAKSIAENLYAKLKDYIKHINIFELDDVEK
SFEIHKLNFAIIICSTTGDGDAPDNASKFLRLIKIYQPKYLSNFKYTVLG
LGDTNYSNFCNCSKTIDQILESKGARRFYRSDMADDAVGLEIVVEPWLDG
LYEIAKDMCSEIPIDGFQNLSITEKISKIEIKPIENYKELLGDHLAKDMD
GKNLTVPALPSPFLNIIYNNEDSISNFHEPLITSMPMPSSDSELVMGEVQ
DITKITNKYAIKSVHRATINVPNAKWKWKPGDSVGILPFNAESEVDSILS
RLSVPETEKNCVVRLELLENLENRRAKVPEHLIVRENGKMSLKSILLWLC
DLRQPLSKVGLRIMSEYCPMKSAEQRRLLELCSREGQSFYTKCLRETSMP
VLDLLNWFPSCQIPIVRLLEVLPRLKPRAYSLCDLESVSFAFSKVDIAPI
QTFRKRPLTGVCTSWMEKMAKFHNEQIWKIPIYLRKNMNGFTVCENPSIP
HILIGPGTGVAPFIGFLQYFEKLKNENQNIGPIWLFFGCRNEERDFIFKK
QLEHFANSGILTHLCVCFSRDNPTNSGDEQKNFCQPPNCKYVQHCLLHHS
KILSDLLVNQNARVFVCGDSSGMSKDVLETWSNVLLGNHEKIQTKRDADS
FITGMRVQKLYLEDVWI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000101muscle cell
PLANA:0000142posterior region of the whole animal
Vocabulary: INTERPRO
TermDefinition
IPR039261FNR_nucleotide-bd
IPR001094Flavdoxin-like
IPR001709Flavoprot_Pyr_Nucl_cyt_Rdtase
IPR001433OxRdtase_FAD/NAD-bd
IPR003097CysJ-like_FAD-binding
IPR029039Flavoprotein-like_sf
IPR008254Flavodoxin/NO_synth
IPR023173NADPH_Cyt_P450_Rdtase_alpha
IPR017938Riboflavin_synthase-like_b-brl
Vocabulary: molecular function
TermDefinition
GO:0010181FMN binding
GO:0016491oxidoreductase activity
GO:0003958NADPH-hemoprotein reductase activity
GO:0005515protein binding
GO:0016723oxidoreductase activity, oxidizing metal ions, NAD or NADP as acceptor
GO:0030586[methionine synthase] reductase activity
GO:0050444aquacobalamin reductase (NADPH) activity
GO:0050660flavin adenine dinucleotide binding
GO:0050661NADP binding
GO:0070402NADPH binding
GO:0071949FAD binding
Vocabulary: biological process
TermDefinition
GO:0055114oxidation-reduction process
GO:0000096sulfur amino acid metabolic process
GO:0006306DNA methylation
GO:0006555methionine metabolic process
GO:0008652cellular amino acid biosynthetic process
GO:0009086methionine biosynthetic process
GO:0009235cobalamin metabolic process
GO:0032259methylation
GO:0033353S-adenosylmethionine cycle
GO:0043418homocysteine catabolic process
GO:0046655folic acid metabolic process
GO:1904042negative regulation of cystathionine beta-synthase activity
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0005829cytosol
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001709Flavoprotein pyridine nucleotide cytochrome reductasePRINTSPR00371FPNCRcoord: 531..540
score: 44.94
coord: 502..521
score: 50.06
coord: 278..288
score: 39.71
coord: 544..555
score: 21.74
coord: 460..469
score: 32.41
IPR001094Flavodoxin-likePRINTSPR00369FLAVODOXINcoord: 93..103
score: 46.45
coord: 12..25
score: 41.52
coord: 61..72
score: 38.93
coord: 117..136
score: 32.34
IPR039261Ferredoxin-NADP reductase (FNR), nucleotide-binding domainGENE3DG3DSA:3.40.50.80coord: 499..666
e-value: 4.7E-46
score: 158.8
IPR039261Ferredoxin-NADP reductase (FNR), nucleotide-binding domainSUPERFAMILYSSF52343Ferredoxin reductase-like, C-terminal NADP-linked domaincoord: 490..666
IPR003097Sulfite reductase [NADPH] flavoprotein alpha-component-like, FAD-bindingPFAMPF00667FAD_binding_1coord: 262..465
e-value: 5.6E-22
score: 78.4
IPR023173NADPH-cytochrome p450 reductase, FAD-binding, alpha-helical domain superfamilyGENE3DG3DSA:1.20.990.10coord: 242..426
e-value: 3.0E-47
score: 162.9
NoneNo IPR availableGENE3DG3DSA:2.40.30.10coord: 244..467
e-value: 3.0E-47
score: 162.9
NoneNo IPR availablePANTHERPTHR19384FLAVODOXIN-RELATEDcoord: 12..666
NoneNo IPR availablePANTHERPTHR19384:SF84METHIONINE SYNTHASE REDUCTASEcoord: 12..666
IPR001433Oxidoreductase FAD/NAD(P)-bindingPFAMPF00175NAD_binding_1coord: 503..627
e-value: 7.2E-12
score: 45.9
IPR029039Flavoprotein-like superfamilyGENE3DG3DSA:3.40.50.360coord: 8..164
e-value: 5.1E-40
score: 138.8
IPR029039Flavoprotein-like superfamilySUPERFAMILYSSF52218Flavoproteinscoord: 12..158
IPR008254Flavodoxin/nitric oxide synthasePFAMPF00258Flavodoxin_1coord: 13..146
e-value: 3.5E-26
score: 92.1
IPR008254Flavodoxin/nitric oxide synthasePROSITEPS50902FLAVODOXIN_LIKEcoord: 11..152
score: 24.091
IPR017938Riboflavin synthase-like beta-barrelSUPERFAMILYSSF63380Riboflavin synthase domain-likecoord: 235..487