Dynein axonemal light chain 1

Overview
NameDynein axonemal light chain 1
Smed IDSMED30009556
Uniprot Best hitDynein light chain 1, axonemal OS=Mus musculus OX=10090 GN=Dnal1 PE=1 SV=2 (E=1.19314e-88)
Length (bp)640
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Dynein axonemal light chain 1 (SMED30009556) t-SNE clustered cells

Violin plots show distribution of expression levels for Dynein axonemal light chain 1 (SMED30009556) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Dynein axonemal light chain 1 (SMED30009556) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Dynein axonemal light chain 1 (SMED30009556) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30009556

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30009556SMESG000053050.1 SmedASXL_008294SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30009556SMESG000053050.1 dd_Smed_v4_6302_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30009556SMESG000053050.1 dd_Smed_v4_6302_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30009556SMESG000053050.1 dd_Smed_v4_6302_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
neuronSMED30009556SMESG000053050.1 dd_Smed_v4_6302_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30009556SMESG000053050.1 dd_Smed_v4_6302_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30009556SMESG000053050.1 dd_Smed_v6_6302_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30009556SMESG000053050.1 dd_Smed_v4_6302_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30009556SMESG000053050.1 dd_Smed_v4_6302_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Dynein axonemal light chain 1 vs. Ensembl Human
Match: DNAL1 (dynein axonemal light chain 1 [Source:HGNC Symbol;Acc:HGNC:23247])

HSP 1 Score: 256.914 bits (655), Expect = 2.546e-87
Identity = 138/187 (73.80%), Postives = 164/187 (87.70%), Query Frame = 3
Query:   27 MAKATTIKEALAQWEQKNGMKASEALEVKLHGVYPPIEKMDASLSTLHACEKLSLSTNCIEKIANLNGLKNLKVLSLGRNNIKNLNGLEAVGETLEQLWISYNMIEXXXXXXXXXXXXXXYISNNVVKEWVEFMKLADLPCLEDLVFTGNPLEDSET----WRDEACKRLPKLKKLDGIPVVRDEEE 575
            MAKATTIKEALA+WE+K G + SEA E+KL+   PPIEKMDASLS L  CEKLSLSTNCIEKIANLNGLKNL++LSLGRNNIKNLNGLEAVG+TLE+LWISYN IEKLKG++++KKLK+LY+SNN+VK+W EF+KLA+LPCLEDLVF GNPLE+  +    W +EA KR+PKLKKLDG PV++ +EE
Sbjct:    1 MAKATTIKEALARWEEKTGQRPSEAKEIKLYAQIPPIEKMDASLSMLANCEKLSLSTNCIEKIANLNGLKNLRILSLGRNNIKNLNGLEAVGDTLEELWISYNFIEKLKGIHIMKKLKILYMSNNLVKDWAEFVKLAELPCLEDLVFVGNPLEEKHSAENNWIEEATKRVPKLKKLDGTPVIKGDEE 187          
BLAST of Dynein axonemal light chain 1 vs. Ensembl Human
Match: DNAL1 (dynein axonemal light chain 1 [Source:HGNC Symbol;Acc:HGNC:23247])

HSP 1 Score: 202.601 bits (514), Expect = 2.100e-66
Identity = 111/148 (75.00%), Postives = 132/148 (89.19%), Query Frame = 3
Query:  144 MDASLSTLHACEKLSLSTNCIEKIANLNGLKNLKVLSLGRNNIKNLNGLEAVGETLEQLWISYNMIEXXXXXXXXXXXXXXYISNNVVKEWVEFMKLADLPCLEDLVFTGNPLEDSET----WRDEACKRLPKLKKLDGIPVVRDEEE 575
            MDASLS L  CEKLSLSTNCIEKIANLNGLKNL++LSLGRNNIKNLNGLEAVG+TLE+LWISYN IEKLKG++++KKLK+LY+SNN+VK+W EF+KLA+LPCLEDLVF GNPLE+  +    W +EA KR+PKLKKLDG PV++ +EE
Sbjct:    1 MDASLSMLANCEKLSLSTNCIEKIANLNGLKNLRILSLGRNNIKNLNGLEAVGDTLEELWISYNFIEKLKGIHIMKKLKILYMSNNLVKDWAEFVKLAELPCLEDLVFVGNPLEEKHSAENNWIEEATKRVPKLKKLDGTPVIKGDEE 148          
BLAST of Dynein axonemal light chain 1 vs. Ensembl Human
Match: DNAL1 (dynein axonemal light chain 1 [Source:HGNC Symbol;Acc:HGNC:23247])

HSP 1 Score: 189.889 bits (481), Expect = 1.253e-61
Identity = 106/138 (76.81%), Postives = 124/138 (89.86%), Query Frame = 3
Query:  144 MDASLSTLHACEKLSLSTNCIEKIANLNGLKNLKVLSLGRNNIKNLNGLEAVGETLEQLWISYNMIEXXXXXXXXXXXXXXYISNNVVKEWVEFMKLADLPCLEDLVFTGNPLEDSET----WRDEACKRLPKLKKLD 545
            MDASLS L  CEKLSLSTNCIEKIANLNGLKNL++LSLGRNNIKNLNGLEAVG+TLE+LWISYN IEKLKG++++KKLK+LY+SNN+VK+W EF+KLA+LPCLEDLVF GNPLE+  +    W +EA KR+PKLKKLD
Sbjct:    1 MDASLSMLANCEKLSLSTNCIEKIANLNGLKNLRILSLGRNNIKNLNGLEAVGDTLEELWISYNFIEKLKGIHIMKKLKILYMSNNLVKDWAEFVKLAELPCLEDLVFVGNPLEEKHSAENNWIEEATKRVPKLKKLD 138          
BLAST of Dynein axonemal light chain 1 vs. Ensembl Human
Match: DNAL1 (dynein axonemal light chain 1 [Source:HGNC Symbol;Acc:HGNC:23247])

HSP 1 Score: 119.783 bits (299), Expect = 2.053e-34
Identity = 67/100 (67.00%), Postives = 87/100 (87.00%), Query Frame = 3
Query:  288 LEAVGETLEQLWISYNMIEXXXXXXXXXXXXXXYISNNVVKEWVEFMKLADLPCLEDLVFTGNPLEDSET----WRDEACKRLPKLKKLDGIPVVRDEEE 575
            +EAVG+TLE+LWISYN IEKLKG++++KKLK+LY+SNN+VK+W EF+KLA+LPCLEDLVF GNPLE+  +    W +EA KR+PKLKKLDG PV++ +EE
Sbjct:    1 MEAVGDTLEELWISYNFIEKLKGIHIMKKLKILYMSNNLVKDWAEFVKLAELPCLEDLVFVGNPLEEKHSAENNWIEEATKRVPKLKKLDGTPVIKGDEE 100          
BLAST of Dynein axonemal light chain 1 vs. Ensembl Human
Match: DNAL1 (dynein axonemal light chain 1 [Source:HGNC Symbol;Acc:HGNC:23247])

HSP 1 Score: 92.8189 bits (229), Expect = 2.340e-24
Identity = 43/67 (64.18%), Postives = 55/67 (82.09%), Query Frame = 3
Query:  387 YISNNVVKEWVEFMKLADLPCLEDLVFTGNPLEDSET----WRDEACKRLPKLKKLDGIPVVRDEEE 575
            Y+SNN+VK+W EF+KLA+LPCLEDLVF GNPLE+  +    W +EA KR+PKLKKLDG PV++ +EE
Sbjct:    8 YMSNNLVKDWAEFVKLAELPCLEDLVFVGNPLEEKHSAENNWIEEATKRVPKLKKLDGTPVIKGDEE 74          
BLAST of Dynein axonemal light chain 1 vs. Ensembl Celegans
Match: K10D2.8 (pep chromosome:WBcel235:III:5188726:5190175:1 gene:WBGene00189952.1 transcript:K10D2.8.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:K10D2.8)

HSP 1 Score: 51.2174 bits (121), Expect = 1.242e-7
Identity = 54/164 (32.93%), Postives = 80/164 (48.78%), Query Frame = 3
Query:  135 IEKMDASLSTLHACEKLSLSTNCIEKIANLNGLKNLKVL----------------------SLGRNNIKNLNGLEAVGETLEQLWISYNMIEXXXXXXXXXXXXXXYISNNVVKEWVEFMKLADLPCLEDLVFTGNPLEDSE-TWRDEACKRLPKLKKLDGIPV 557
            I+KM+ +LS L   E+L L  N I KI  L+G+  LK L                      SL +N I+ ++GL  +   L+ L ++ N+IEKL+ V   K +  L I  N +  W +  +L  L  L  L    NPL  S+ T+R+   + LP +K LDG P+
Sbjct:  149 IQKME-NLSHLVNLERLFLGANQIRKIEGLDGMAQLKELSLPGNALQIIEGLDTLSGLKSISLAQNGIRKIDGLSGL-TNLKSLDLNDNIIEKLENVEQFKGISSLMIRKNKLNCWQDVRQLKKLENLTVLTMEMNPLYSSDYTYRNRVKEILPDVKLLDGFPI 310          
BLAST of Dynein axonemal light chain 1 vs. Ensembl Celegans
Match: C06A8.6 (pep chromosome:WBcel235:II:7772499:7773914:1 gene:WBGene00015516.1 transcript:C06A8.6.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:C06A8.6)

HSP 1 Score: 50.0618 bits (118), Expect = 3.434e-7
Identity = 39/122 (31.97%), Postives = 65/122 (53.28%), Query Frame = 3
Query:  183 LSLSTNCIEKIANLNGLKNLKVLSLGRNNIKNLNGLEAVGETLEQLWISYNMIEXXXXXXXXXXXXXXYISNNVVKEWVEFMKLADLPCLEDLVFTGNPLEDSETWRDEACKRLPKLKKLDG 548
            LSL  N I  + N++GL NLK + L +N IK + G++     LE L  + N +EK++ ++ LK L   +   N +  W    +L +LP L  +    NP+   +T+R +    L ++ +LDG
Sbjct:  191 LSLPANAITVVDNISGLHNLKEIYLAQNGIKYVCGIDE-HLPLEILDFNQNRLEKVENIHQLKTLTDFWARGNKLDNWSIMDELVELPQLNSVYLDFNPIASVDTYRGKVIHLLQQITRLDG 311          
BLAST of Dynein axonemal light chain 1 vs. Ensembl Fly
Match: CG8800 (gene:FBgn0033408 transcript:FBtr0088555)

HSP 1 Score: 194.126 bits (492), Expect = 6.652e-63
Identity = 110/185 (59.46%), Postives = 140/185 (75.68%), Query Frame = 3
Query:   27 MAKATTIKEALAQWEQKNGMKASEALEVKLHGVYPPIEKMDASLSTLHACEKLSLSTNCIEKIANLNGLKNLKVLSLGRNNIKNLNGLEAVGETLEQLWISYNMIEXXXXXXXXXXXXXXYISNNVVKEWVEFMKLADLPCLEDLVFTGNPLE---DSETWRDEACKRLPKLKKLDGIPVVRDEE 572
            M+KATTIKEAL +WE++    +  A  + L   +PPIEKMD++L TL  CE++S+STN IEKI  L+G+K LKVLSL RN IK ++GLEAV ETLE+LW+SYN+IEK+KG+  LK LKVLYISNN++K+W EF +LA++  LEDLV  GNPL    D  TWR E  KRLP ++KLDG PVV +EE
Sbjct:    1 MSKATTIKEALKRWEEREQQNSLTAKVIDLQFQWPPIEKMDSTLGTLVQCERISMSTNMIEKIFGLSGMKCLKVLSLSRNYIKQISGLEAVAETLEELWLSYNLIEKIKGLTGLKCLKVLYISNNLIKDWSEFNRLAEIESLEDLVVVGNPLSEGLDEPTWRAECIKRLPTIRKLDGEPVVLNEE 185          
BLAST of Dynein axonemal light chain 1 vs. Ensembl Fly
Match: CG10839 (gene:FBgn0028858 transcript:FBtr0343725)

HSP 1 Score: 191.815 bits (486), Expect = 5.028e-62
Identity = 98/182 (53.85%), Postives = 132/182 (72.53%), Query Frame = 3
Query:   27 MAKATTIKEALAQWEQKNGMKASEALEVKLHGVYPPIEKMDASLSTLHACEKLSLSTNCIEKIANLNGLKNLKVLSLGRNNIKNLNGLEAVGETLEQLWISYNMIEXXXXXXXXXXXXXXYISNNVVKEWVEFMKLADLPCLEDLVFTGNPLE---DSETWRDEACKRLPKLKKLDGIPVVR 563
            M+K TT+K+ALA+WE +N   A+ A E+ L   YPPIEKMD  L++L  C+KLSLS+N IEKI  ++G+KNLKVLSL RNN+K LNG+E + +TLE+LW+SYN IEK K +  +K L+V YIS N++K+W EFM++   P L ++ F GNPL    D   +  EA +RLP +KKLDG PV+R
Sbjct:    1 MSKPTTLKDALAKWEDRNKQPAATATEIGLQFQYPPIEKMDPILNSLTECQKLSLSSNMIEKITGISGMKNLKVLSLARNNLKTLNGIEPLADTLEELWVSYNNIEKTKPLESMKALRVFYISFNMIKDWTEFMRMGVPPNLSEITFVGNPLNENMDQSAFTAEAVRRLPNMKKLDGEPVIR 182          
BLAST of Dynein axonemal light chain 1 vs. Ensembl Fly
Match: CG10839 (gene:FBgn0028858 transcript:FBtr0305563)

HSP 1 Score: 191.815 bits (486), Expect = 5.028e-62
Identity = 98/182 (53.85%), Postives = 132/182 (72.53%), Query Frame = 3
Query:   27 MAKATTIKEALAQWEQKNGMKASEALEVKLHGVYPPIEKMDASLSTLHACEKLSLSTNCIEKIANLNGLKNLKVLSLGRNNIKNLNGLEAVGETLEQLWISYNMIEXXXXXXXXXXXXXXYISNNVVKEWVEFMKLADLPCLEDLVFTGNPLE---DSETWRDEACKRLPKLKKLDGIPVVR 563
            M+K TT+K+ALA+WE +N   A+ A E+ L   YPPIEKMD  L++L  C+KLSLS+N IEKI  ++G+KNLKVLSL RNN+K LNG+E + +TLE+LW+SYN IEK K +  +K L+V YIS N++K+W EFM++   P L ++ F GNPL    D   +  EA +RLP +KKLDG PV+R
Sbjct:    1 MSKPTTLKDALAKWEDRNKQPAATATEIGLQFQYPPIEKMDPILNSLTECQKLSLSSNMIEKITGISGMKNLKVLSLARNNLKTLNGIEPLADTLEELWVSYNNIEKTKPLESMKALRVFYISFNMIKDWTEFMRMGVPPNLSEITFVGNPLNENMDQSAFTAEAVRRLPNMKKLDGEPVIR 182          
BLAST of Dynein axonemal light chain 1 vs. Ensembl Fly
Match: CG10839 (gene:FBgn0028858 transcript:FBtr0080800)

HSP 1 Score: 191.815 bits (486), Expect = 5.028e-62
Identity = 98/182 (53.85%), Postives = 132/182 (72.53%), Query Frame = 3
Query:   27 MAKATTIKEALAQWEQKNGMKASEALEVKLHGVYPPIEKMDASLSTLHACEKLSLSTNCIEKIANLNGLKNLKVLSLGRNNIKNLNGLEAVGETLEQLWISYNMIEXXXXXXXXXXXXXXYISNNVVKEWVEFMKLADLPCLEDLVFTGNPLE---DSETWRDEACKRLPKLKKLDGIPVVR 563
            M+K TT+K+ALA+WE +N   A+ A E+ L   YPPIEKMD  L++L  C+KLSLS+N IEKI  ++G+KNLKVLSL RNN+K LNG+E + +TLE+LW+SYN IEK K +  +K L+V YIS N++K+W EFM++   P L ++ F GNPL    D   +  EA +RLP +KKLDG PV+R
Sbjct:    1 MSKPTTLKDALAKWEDRNKQPAATATEIGLQFQYPPIEKMDPILNSLTECQKLSLSSNMIEKITGISGMKNLKVLSLARNNLKTLNGIEPLADTLEELWVSYNNIEKTKPLESMKALRVFYISFNMIKDWTEFMRMGVPPNLSEITFVGNPLNENMDQSAFTAEAVRRLPNMKKLDGEPVIR 182          
BLAST of Dynein axonemal light chain 1 vs. Ensembl Zebrafish
Match: dnal1 (Dynein light chain 1, axonemal [Source:UniProtKB/Swiss-Prot;Acc:Q6DHB1])

HSP 1 Score: 253.447 bits (646), Expect = 3.962e-86
Identity = 142/187 (75.94%), Postives = 163/187 (87.17%), Query Frame = 3
Query:   27 MAKATTIKEALAQWEQKNGMKASEALEVKLHGVYPPIEKMDASLSTLHACEKLSLSTNCIEKIANLNGLKNLKVLSLGRNNIKNLNGLEAVGETLEQLWISYNMIEXXXXXXXXXXXXXXYISNNVVKEWVEFMKLADLPCLEDLVFTGNPLEDSET----WRDEACKRLPKLKKLDGIPVVRDEEE 575
            MAKATTIKEAL +WE+K G KA++A  VKL+G  PPIEKMDASLS L  CE+LSLSTNCIEKIANLNGLKNLK+LSLGRNNIKNLNGLEAVG+TLE+LWISYN+IEKLKG++V+KKLKVLY+SNN+VKEW EF+KLADLP L DLVF GNPLE+  +    W +EA KRLPKLKKLDG PV++ EEE
Sbjct:    1 MAKATTIKEALVKWEEKTGEKANDATAVKLYGQIPPIEKMDASLSNLVNCERLSLSTNCIEKIANLNGLKNLKILSLGRNNIKNLNGLEAVGDTLEELWISYNLIEKLKGIHVMKKLKVLYMSNNLVKEWGEFLKLADLPSLVDLVFVGNPLEEKYSADGNWIEEATKRLPKLKKLDGNPVIKQEEE 187          
BLAST of Dynein axonemal light chain 1 vs. Ensembl Zebrafish
Match: dnal1 (dynein, axonemal, light chain 1 [Source:NCBI gene;Acc:445048])

HSP 1 Score: 253.447 bits (646), Expect = 3.962e-86
Identity = 142/187 (75.94%), Postives = 163/187 (87.17%), Query Frame = 3
Query:   27 MAKATTIKEALAQWEQKNGMKASEALEVKLHGVYPPIEKMDASLSTLHACEKLSLSTNCIEKIANLNGLKNLKVLSLGRNNIKNLNGLEAVGETLEQLWISYNMIEXXXXXXXXXXXXXXYISNNVVKEWVEFMKLADLPCLEDLVFTGNPLEDSET----WRDEACKRLPKLKKLDGIPVVRDEEE 575
            MAKATTIKEAL +WE+K G KA++A  VKL+G  PPIEKMDASLS L  CE+LSLSTNCIEKIANLNGLKNLK+LSLGRNNIKNLNGLEAVG+TLE+LWISYN+IEKLKG++V+KKLKVLY+SNN+VKEW EF+KLADLP L DLVF GNPLE+  +    W +EA KRLPKLKKLDG PV++ EEE
Sbjct:    1 MAKATTIKEALVKWEEKTGEKANDATAVKLYGQIPPIEKMDASLSNLVNCERLSLSTNCIEKIANLNGLKNLKILSLGRNNIKNLNGLEAVGDTLEELWISYNLIEKLKGIHVMKKLKVLYMSNNLVKEWGEFLKLADLPSLVDLVFVGNPLEEKYSADGNWIEEATKRLPKLKKLDGNPVIKQEEE 187          
BLAST of Dynein axonemal light chain 1 vs. Ensembl Zebrafish
Match: dnal1 (Dynein light chain 1, axonemal [Source:UniProtKB/Swiss-Prot;Acc:Q6DHB1])

HSP 1 Score: 118.627 bits (296), Expect = 3.304e-34
Identity = 73/97 (75.26%), Postives = 85/97 (87.63%), Query Frame = 3
Query:  267 NIKNLNGLEAVGETLEQLWISYNMIEXXXXXXXXXXXXXXYISNNVVKEWVEFMKLADLPCLEDLVFTGNPLEDSET----WRDEACKRLPKLKKLD 545
            NIKNLNGLEAVG+TLE+LWISYN+IEKLKG++V+KKLKVLY+SNN+VKEW EF+KLADLP L DLVF GNPLE+  +    W +EA KRLPKLKKLD
Sbjct:    1 NIKNLNGLEAVGDTLEELWISYNLIEKLKGIHVMKKLKVLYMSNNLVKEWGEFLKLADLPSLVDLVFVGNPLEEKYSADGNWIEEATKRLPKLKKLD 97          
BLAST of Dynein axonemal light chain 1 vs. Ensembl Zebrafish
Match: lrrc9 (leucine rich repeat containing 9 [Source:ZFIN;Acc:ZDB-GENE-080917-56])

HSP 1 Score: 52.7582 bits (125), Expect = 8.266e-8
Identity = 51/164 (31.10%), Postives = 79/164 (48.17%), Query Frame = 3
Query:   84 MKASEALEVKLHGVYPPIEKMDASLSTLHACEKLSLSTNCIEKIANLNGLKNLKVLSLGRNNIKNLNGLEAVGE-TLEQLWISYNMIEXXXXXXXXXXXXXXYISNNVVKEWVEFMKLADLPCLEDLVFTGNPLEDSETWRDEACKRLPKLKKLDGIPVVRDEE 572
            M + E L +  +G+   I    + L+ L A   L L  N I ++  L+GL+ L+ L L RN IK+L+     G+  L  L +  N I +L  +  L  L+ L++  N +++  E  KL  LP L +L   GNP+      R      L  L+ LDG+ V  +E 
Sbjct:  164 MSSLEVLHLGHNGISNLINLQISRLTNLRA---LFLQGNDISQVDGLDGLQKLRELVLDRNRIKSLSENSFCGQAVLLDLHLRENRIRELNHLQPLTGLRRLFLDMNKIQDISELEKLETLPSLLELSVMGNPVTRRSLHRPPVILHLSTLQVLDGVTVSLEER 324          
BLAST of Dynein axonemal light chain 1 vs. Ensembl Zebrafish
Match: ppp1r7 (protein phosphatase 1, regulatory (inhibitor) subunit 7 [Source:NCBI gene;Acc:560323])

HSP 1 Score: 47.3654 bits (111), Expect = 4.902e-6
Identity = 42/140 (30.00%), Postives = 69/140 (49.29%), Query Frame = 3
Query:  195 TNCIEKIANLNGLKNLKVLSLGRNNIKNLNGLEAVGETLEQLWISYNMIEXXXXXXXXXXXXXXYISNNVVKE----------------------WVEFMKLADLPCLEDLVFTGNPLEDSETWRDEACKRLPKLKKLDG 548
            TN I ++ NL+GL NL VLS+  N I  L GL+ +   L +L++S+N IE ++G+   KKL  L I+ N +K+                      W +  +L +   LE +    NPL+    +R +    LP ++++D 
Sbjct:  202 TNKITQLQNLDGLHNLTVLSIQSNRITKLEGLQNLV-NLRELYLSHNGIEVMEGLENNKKLSTLDIAANRIKKIENISHLTDLKEFWMNDNQIENWADLDELKNAKGLETVYLERNPLQKDPQYRRKIMLALPSVRQIDA 340          
BLAST of Dynein axonemal light chain 1 vs. Ensembl Xenopus
Match: nhlh1 (nescient helix-loop-helix 1 [Source:Xenbase;Acc:XB-GENE-989790])

HSP 1 Score: 255.373 bits (651), Expect = 1.047e-86
Identity = 143/190 (75.26%), Postives = 163/190 (85.79%), Query Frame = 3
Query:   27 MAKATTIKEALAQWEQKNGMKASEALEVKLHGVYPPIEKMDASLSTLHACEKLSLSTNCIEKIANLNGLKNLKVLSLGRNNIKNLNGLEAVGETLEQLWISYNMIEXXXXXXXXXXXXXXYISNNVVKEWVEFMKLADLPCLEDLVFTGNPLEDSET----WRDEACKRLPKLKKLDGIPVVRDEEE*FD 584
            MAKATTIKEALA+WE++ G KA EA EVKL+   PPIEKMDASLSTL  CEKLSLSTNCIEKIANLNGLK L++LSLGRNNIKNLNGLEAVGETLE+LWISYN+IEKLKG++V+KKLKVLY+SNN+VK+W EF KL +LP LED+VF GNPLE+  T    W +EA KRLPKLKKLDG PV++ EEE  D
Sbjct:    1 MAKATTIKEALAKWEERTGQKAGEAKEVKLYAQIPPIEKMDASLSTLVNCEKLSLSTNCIEKIANLNGLKFLRILSLGRNNIKNLNGLEAVGETLEELWISYNLIEKLKGIHVMKKLKVLYMSNNLVKDWAEFSKLGELPLLEDMVFVGNPLEERHTAEGNWLEEAVKRLPKLKKLDGNPVIKQEEEEGD 190          
BLAST of Dynein axonemal light chain 1 vs. Ensembl Xenopus
Match: nhlh1 (nescient helix-loop-helix 1 [Source:Xenbase;Acc:XB-GENE-989790])

HSP 1 Score: 254.988 bits (650), Expect = 2.244e-86
Identity = 142/188 (75.53%), Postives = 162/188 (86.17%), Query Frame = 3
Query:   24 EMAKATTIKEALAQWEQKNGMKASEALEVKLHGVYPPIEKMDASLSTLHACEKLSLSTNCIEKIANLNGLKNLKVLSLGRNNIKNLNGLEAVGETLEQLWISYNMIEXXXXXXXXXXXXXXYISNNVVKEWVEFMKLADLPCLEDLVFTGNPLEDSET----WRDEACKRLPKLKKLDGIPVVRDEEE 575
            E AKATTIKEALA+WE++ G KA EA EVKL+   PPIEKMDASLSTL  CEKLSLSTNCIEKIANLNGLK L++LSLGRNNIKNLNGLEAVGETLE+LWISYN+IEKLKG++V+KKLKVLY+SNN+VK+W EF KL +LP LED+VF GNPLE+  T    W +EA KRLPKLKKLDG PV++ EEE
Sbjct:    9 EQAKATTIKEALAKWEERTGQKAGEAKEVKLYAQIPPIEKMDASLSTLVNCEKLSLSTNCIEKIANLNGLKFLRILSLGRNNIKNLNGLEAVGETLEELWISYNLIEKLKGIHVMKKLKVLYMSNNLVKDWAEFSKLGELPLLEDMVFVGNPLEERHTAEGNWLEEAVKRLPKLKKLDGNPVIKQEEE 196          
BLAST of Dynein axonemal light chain 1 vs. Ensembl Xenopus
Match: nhlh1 (nescient helix-loop-helix 1 [Source:Xenbase;Acc:XB-GENE-989790])

HSP 1 Score: 229.18 bits (583), Expect = 1.703e-76
Identity = 129/173 (74.57%), Postives = 148/173 (85.55%), Query Frame = 3
Query:   69 EQKNGMKASEALEVKLHGVYPPIEKMDASLSTLHACEKLSLSTNCIEKIANLNGLKNLKVLSLGRNNIKNLNGLEAVGETLEQLWISYNMIEXXXXXXXXXXXXXXYISNNVVKEWVEFMKLADLPCLEDLVFTGNPLEDSET----WRDEACKRLPKLKKLDGIPVVRDEEE 575
            E++ G KA EA EVKL+   PPIEKMDASLSTL  CEKLSLSTNCIEKIANLNGLK L++LSLGRNNIKNLNGLEAVGETLE+LWISYN+IEKLKG++V+KKLKVLY+SNN+VK+W EF KL +LP LED+VF GNPLE+  T    W +EA KRLPKLKKLDG PV++ EEE
Sbjct:    7 EERTGQKAGEAKEVKLYAQIPPIEKMDASLSTLVNCEKLSLSTNCIEKIANLNGLKFLRILSLGRNNIKNLNGLEAVGETLEELWISYNLIEKLKGIHVMKKLKVLYMSNNLVKDWAEFSKLGELPLLEDMVFVGNPLEERHTAEGNWLEEAVKRLPKLKKLDGNPVIKQEEE 179          
BLAST of Dynein axonemal light chain 1 vs. Ensembl Xenopus
Match: lrrc23 (leucine rich repeat containing 23 [Source:NCBI gene;Acc:549279])

HSP 1 Score: 57.3806 bits (137), Expect = 2.509e-9
Identity = 50/133 (37.59%), Postives = 72/133 (54.14%), Query Frame = 3
Query:  150 ASLSTLHACEKLSLSTNCIEKIANLNGLKNLKVLSLGRNNIKNLNGLEAVGETLEQLWISYNMIEXXXXXXXXXXXXXXY-ISNNVVKEWVEFMKLADLPCLEDLVFTGNPLEDSETWRDEACKRLPKLKKLD 545
            ++LS+LH  E   L +N +   A LN L +L+ L LG+NNI  L GLEA+   L  L +  N +E L G +   +      + +N+V +  E  KL  LP L  LV   NP E+ E +R E    LP+L++LD
Sbjct:  195 SNLSSLHTLE---LRSNQLLSTAGLN-LPSLRELYLGQNNISRLEGLEAL-VNLTTLHLRDNQLESLDGFSEHLQALQYLNLRSNMVAKLQEVQKLYCLPRLRALVLRENPCEEEEGYRMETLIALPQLERLD 322          
BLAST of Dynein axonemal light chain 1 vs. Ensembl Xenopus
Match: rbpms2 (RNA binding protein with multiple splicing 2 [Source:Xenbase;Acc:XB-GENE-490341])

HSP 1 Score: 57.3806 bits (137), Expect = 3.903e-9
Identity = 53/170 (31.18%), Postives = 93/170 (54.71%), Query Frame = 3
Query:   69 EQKNGMKASEALEVKLHGVYPPIEKMDASLSTLHACEKLSLSTNCIEKIANLNGLKNLKVLSLGRNNI---KNLNGLEAVGETLEQLWISYNMIEXXXXXXXXXXXXXXYISNNVVKEWVEFMKLADLPCLEDLVFTGNPLEDSETWRDEACKRLPKLKKLDGIPVVRDE 569
            E+ +G+ +  +L V + G    I+K+ ++L  L   + L L  N I KI N++ L+ L+VL+L RN I   +N+NGL+    +L++L +  N I  L+ V+ L  L++LY+S N +    + + LAD   L D+   GNP+     +R      + +L++LD   +  +E
Sbjct:  147 EEISGLSSLRSLRVLMLG-KNRIQKI-SNLENLKNLDVLDLHGNQIAKIENVSHLRELRVLNLARNQINQVENINGLD----SLKELNLRDNKITFLRDVDTLPSLQLLYLSFNNISRINDILCLADSTSLSDVTLDGNPIAQESWYRQTILGHMLQLRQLDMKRITEEE 310          
BLAST of Dynein axonemal light chain 1 vs. Ensembl Mouse
Match: Dnal1 (dynein, axonemal, light chain 1 [Source:MGI Symbol;Acc:MGI:1921462])

HSP 1 Score: 262.307 bits (669), Expect = 1.706e-89
Identity = 141/187 (75.40%), Postives = 166/187 (88.77%), Query Frame = 3
Query:   27 MAKATTIKEALAQWEQKNGMKASEALEVKLHGVYPPIEKMDASLSTLHACEKLSLSTNCIEKIANLNGLKNLKVLSLGRNNIKNLNGLEAVGETLEQLWISYNMIEXXXXXXXXXXXXXXYISNNVVKEWVEFMKLADLPCLEDLVFTGNPLEDSET----WRDEACKRLPKLKKLDGIPVVRDEEE 575
            MAKATTIKEAL++WE+K G K S+A E+KL+   PPIEKMDASLSTL  CEKLSLSTNCIEKIANLNGLKNL++LSLGRNNIKNLNGLEAVGETLE+LWISYN IEKLKG++V+KKLK+LY+SNN+VK+W EF+KLA+LPCLEDLVF GNPLE+  +    W DEA KR+PKLKKLDG PV++++EE
Sbjct:    1 MAKATTIKEALSRWEEKTGQKPSDAKEIKLYAQIPPIEKMDASLSTLGNCEKLSLSTNCIEKIANLNGLKNLRILSLGRNNIKNLNGLEAVGETLEELWISYNFIEKLKGIHVMKKLKILYMSNNLVKDWAEFLKLAELPCLEDLVFVGNPLEEKHSAEGNWIDEATKRVPKLKKLDGTPVIKEDEE 187          
BLAST of Dynein axonemal light chain 1 vs. Ensembl Mouse
Match: Dnal1 (dynein, axonemal, light chain 1 [Source:MGI Symbol;Acc:MGI:1921462])

HSP 1 Score: 209.534 bits (532), Expect = 3.031e-69
Identity = 115/148 (77.70%), Postives = 134/148 (90.54%), Query Frame = 3
Query:  144 MDASLSTLHACEKLSLSTNCIEKIANLNGLKNLKVLSLGRNNIKNLNGLEAVGETLEQLWISYNMIEXXXXXXXXXXXXXXYISNNVVKEWVEFMKLADLPCLEDLVFTGNPLEDSET----WRDEACKRLPKLKKLDGIPVVRDEEE 575
            MDASLSTL  CEKLSLSTNCIEKIANLNGLKNL++LSLGRNNIKNLNGLEAVGETLE+LWISYN IEKLKG++V+KKLK+LY+SNN+VK+W EF+KLA+LPCLEDLVF GNPLE+  +    W DEA KR+PKLKKLDG PV++++EE
Sbjct:    1 MDASLSTLGNCEKLSLSTNCIEKIANLNGLKNLRILSLGRNNIKNLNGLEAVGETLEELWISYNFIEKLKGIHVMKKLKILYMSNNLVKDWAEFLKLAELPCLEDLVFVGNPLEEKHSAEGNWIDEATKRVPKLKKLDGTPVIKEDEE 148          
BLAST of Dynein axonemal light chain 1 vs. Ensembl Mouse
Match: Dnal1 (dynein, axonemal, light chain 1 [Source:MGI Symbol;Acc:MGI:1921462])

HSP 1 Score: 143.665 bits (361), Expect = 5.789e-44
Identity = 78/104 (75.00%), Postives = 86/104 (82.69%), Query Frame = 3
Query:   27 MAKATTIKEALAQWEQKNGMKASEALEVKLHGVYPPIEKMDASLSTLHACEKLSLSTNCIEKIANLNGLKNLKVLSLGRNNIKNLNGLEAVGETLEQLWISYNM 338
            MAKATTIKEAL++WE+K G K S+A E+KL+   PPIEKMDASLSTL  CEKLSLSTNCIEKIANLNGLKNL++LSLGRNNIKNLNGL A  ET E  W S  M
Sbjct:    1 MAKATTIKEALSRWEEKTGQKPSDAKEIKLYAQIPPIEKMDASLSTLGNCEKLSLSTNCIEKIANLNGLKNLRILSLGRNNIKNLNGLFA--ETREG-WRSRAM 101          
BLAST of Dynein axonemal light chain 1 vs. Ensembl Mouse
Match: Dnal1 (dynein, axonemal, light chain 1 [Source:MGI Symbol;Acc:MGI:1921462])

HSP 1 Score: 77.7962 bits (190), Expect = 1.551e-18
Identity = 37/55 (67.27%), Postives = 45/55 (81.82%), Query Frame = 3
Query:  390 ISNNVVKEWVEFMKLADLPCLEDLVFTGNPLEDSET----WRDEACKRLPKLKKL 542
            +SNN+VK+W EF+KLA+LPCLEDLVF GNPLE+  +    W DEA KR+PKLKKL
Sbjct:    1 MSNNLVKDWAEFLKLAELPCLEDLVFVGNPLEEKHSAEGNWIDEATKRVPKLKKL 55          
BLAST of Dynein axonemal light chain 1 vs. Ensembl Mouse
Match: Dnal1 (dynein, axonemal, light chain 1 [Source:MGI Symbol;Acc:MGI:1921462])

HSP 1 Score: 75.0998 bits (183), Expect = 1.319e-17
Identity = 36/51 (70.59%), Postives = 42/51 (82.35%), Query Frame = 3
Query:   27 MAKATTIKEALAQWEQKNGMKASEALEVKLHGVYPPIEKMDASLSTLHACE 179
            MAKATTIKEAL++WE+K G K S+A E+KL+   PPIEKMDASLSTL  CE
Sbjct:    1 MAKATTIKEALSRWEEKTGQKPSDAKEIKLYAQIPPIEKMDASLSTLGNCE 51          
BLAST of Dynein axonemal light chain 1 vs. UniProt
Match: sp|Q05A62|DNAL1_MOUSE (Dynein light chain 1, axonemal OS=Mus musculus OX=10090 GN=Dnal1 PE=1 SV=2)

HSP 1 Score: 262.307 bits (669), Expect = 1.193e-88
Identity = 141/187 (75.40%), Postives = 166/187 (88.77%), Query Frame = 3
Query:   27 MAKATTIKEALAQWEQKNGMKASEALEVKLHGVYPPIEKMDASLSTLHACEKLSLSTNCIEKIANLNGLKNLKVLSLGRNNIKNLNGLEAVGETLEQLWISYNMIEXXXXXXXXXXXXXXYISNNVVKEWVEFMKLADLPCLEDLVFTGNPLEDSET----WRDEACKRLPKLKKLDGIPVVRDEEE 575
            MAKATTIKEAL++WE+K G K S+A E+KL+   PPIEKMDASLSTL  CEKLSLSTNCIEKIANLNGLKNL++LSLGRNNIKNLNGLEAVGETLE+LWISYN IEKLKG++V+KKLK+LY+SNN+VK+W EF+KLA+LPCLEDLVF GNPLE+  +    W DEA KR+PKLKKLDG PV++++EE
Sbjct:    1 MAKATTIKEALSRWEEKTGQKPSDAKEIKLYAQIPPIEKMDASLSTLGNCEKLSLSTNCIEKIANLNGLKNLRILSLGRNNIKNLNGLEAVGETLEELWISYNFIEKLKGIHVMKKLKILYMSNNLVKDWAEFLKLAELPCLEDLVFVGNPLEEKHSAEGNWIDEATKRVPKLKKLDGTPVIKEDEE 187          
BLAST of Dynein axonemal light chain 1 vs. UniProt
Match: sp|A0A096MJZ0|DNAL1_RAT (Dynein light chain 1, axonemal OS=Rattus norvegicus OX=10116 GN=Dnal1 PE=1 SV=1)

HSP 1 Score: 260.766 bits (665), Expect = 4.897e-88
Identity = 139/187 (74.33%), Postives = 166/187 (88.77%), Query Frame = 3
Query:   27 MAKATTIKEALAQWEQKNGMKASEALEVKLHGVYPPIEKMDASLSTLHACEKLSLSTNCIEKIANLNGLKNLKVLSLGRNNIKNLNGLEAVGETLEQLWISYNMIEXXXXXXXXXXXXXXYISNNVVKEWVEFMKLADLPCLEDLVFTGNPLEDSET----WRDEACKRLPKLKKLDGIPVVRDEEE 575
            MAKATTIKEAL++WE+K G K S+A E+KL+   PPIEKMDASLSTL  CEKLSLSTNCIEKIANLNGLKNL++LSLGRNNIKNLNGLEAVG+TLE+LWISYN IEKLKG++V++KLK+LYISNN+VK+W EF+KLA+LPCLEDLVF GNPLE+  +    W +EA KR+PKLKKLDG PV++++EE
Sbjct:    1 MAKATTIKEALSRWEEKTGQKPSDAREIKLYAQIPPIEKMDASLSTLANCEKLSLSTNCIEKIANLNGLKNLRILSLGRNNIKNLNGLEAVGDTLEELWISYNFIEKLKGIHVMRKLKILYISNNLVKDWAEFVKLAELPCLEDLVFVGNPLEEKHSAEGNWIEEATKRVPKLKKLDGTPVIKEDEE 187          
BLAST of Dynein axonemal light chain 1 vs. UniProt
Match: sp|Q2KID4|DNAL1_BOVIN (Dynein light chain 1, axonemal OS=Bos taurus OX=9913 GN=DNAL1 PE=2 SV=1)

HSP 1 Score: 259.996 bits (663), Expect = 1.020e-87
Identity = 140/187 (74.87%), Postives = 165/187 (88.24%), Query Frame = 3
Query:   27 MAKATTIKEALAQWEQKNGMKASEALEVKLHGVYPPIEKMDASLSTLHACEKLSLSTNCIEKIANLNGLKNLKVLSLGRNNIKNLNGLEAVGETLEQLWISYNMIEXXXXXXXXXXXXXXYISNNVVKEWVEFMKLADLPCLEDLVFTGNPLEDSET----WRDEACKRLPKLKKLDGIPVVRDEEE 575
            MAKATTIKEALA+WE+K   K SEA E+KL+   PPIEKMDASLSTL  CEKLSLSTNCIEKIANLNGLKNL++LSLGRNNIKNLNGLEAVG+TLE+LWISYN IEKLKG++V+KKLK+LY+SNN+VK+W EF+KLA+LPCLEDLVF GNPLE+  +    W +EA KR+PKLKKLDG PV++++EE
Sbjct:    1 MAKATTIKEALARWEEKTSQKPSEAREIKLYAQIPPIEKMDASLSTLSNCEKLSLSTNCIEKIANLNGLKNLRILSLGRNNIKNLNGLEAVGDTLEELWISYNFIEKLKGIHVMKKLKILYMSNNLVKDWAEFVKLAELPCLEDLVFVGNPLEEKHSAEGNWVEEATKRVPKLKKLDGTPVIKEDEE 187          
BLAST of Dynein axonemal light chain 1 vs. UniProt
Match: sp|Q4LDG9|DNAL1_HUMAN (Dynein light chain 1, axonemal OS=Homo sapiens OX=9606 GN=DNAL1 PE=1 SV=1)

HSP 1 Score: 256.914 bits (655), Expect = 1.223e-86
Identity = 138/187 (73.80%), Postives = 164/187 (87.70%), Query Frame = 3
Query:   27 MAKATTIKEALAQWEQKNGMKASEALEVKLHGVYPPIEKMDASLSTLHACEKLSLSTNCIEKIANLNGLKNLKVLSLGRNNIKNLNGLEAVGETLEQLWISYNMIEXXXXXXXXXXXXXXYISNNVVKEWVEFMKLADLPCLEDLVFTGNPLEDSET----WRDEACKRLPKLKKLDGIPVVRDEEE 575
            MAKATTIKEALA+WE+K G + SEA E+KL+   PPIEKMDASLS L  CEKLSLSTNCIEKIANLNGLKNL++LSLGRNNIKNLNGLEAVG+TLE+LWISYN IEKLKG++++KKLK+LY+SNN+VK+W EF+KLA+LPCLEDLVF GNPLE+  +    W +EA KR+PKLKKLDG PV++ +EE
Sbjct:    1 MAKATTIKEALARWEEKTGQRPSEAKEIKLYAQIPPIEKMDASLSMLANCEKLSLSTNCIEKIANLNGLKNLRILSLGRNNIKNLNGLEAVGDTLEELWISYNFIEKLKGIHIMKKLKILYMSNNLVKDWAEFVKLAELPCLEDLVFVGNPLEEKHSAENNWIEEATKRVPKLKKLDGTPVIKGDEE 187          
BLAST of Dynein axonemal light chain 1 vs. UniProt
Match: sp|Q28G94|DNAL1_XENTR (Dynein light chain 1, axonemal OS=Xenopus tropicalis OX=8364 GN=dnal1 PE=2 SV=1)

HSP 1 Score: 255.373 bits (651), Expect = 5.546e-86
Identity = 143/190 (75.26%), Postives = 163/190 (85.79%), Query Frame = 3
Query:   27 MAKATTIKEALAQWEQKNGMKASEALEVKLHGVYPPIEKMDASLSTLHACEKLSLSTNCIEKIANLNGLKNLKVLSLGRNNIKNLNGLEAVGETLEQLWISYNMIEXXXXXXXXXXXXXXYISNNVVKEWVEFMKLADLPCLEDLVFTGNPLEDSET----WRDEACKRLPKLKKLDGIPVVRDEEE*FD 584
            MAKATTIKEALA+WE++ G KA EA EVKL+   PPIEKMDASLSTL  CEKLSLSTNCIEKIANLNGLK L++LSLGRNNIKNLNGLEAVGETLE+LWISYN+IEKLKG++V+KKLKVLY+SNN+VK+W EF KL +LP LED+VF GNPLE+  T    W +EA KRLPKLKKLDG PV++ EEE  D
Sbjct:    1 MAKATTIKEALAKWEERTGQKAGEAKEVKLYAQIPPIEKMDASLSTLVNCEKLSLSTNCIEKIANLNGLKFLRILSLGRNNIKNLNGLEAVGETLEELWISYNLIEKLKGIHVMKKLKVLYMSNNLVKDWAEFSKLGELPLLEDMVFVGNPLEERHTAEGNWLEEAVKRLPKLKKLDGNPVIKQEEEEGD 190          
BLAST of Dynein axonemal light chain 1 vs. TrEMBL
Match: gnl|BL_ORD_ID|17192732 (tr|C1LFH9|C1LFH9_SCHJA Protein phosphatase 1 regulatory subunit 7 OS=Schistosoma japonicum OX=6182 PE=2 SV=1)

HSP 1 Score: 266.544 bits (680), Expect = 9.617e-88
Identity = 147/183 (80.33%), Postives = 164/183 (89.62%), Query Frame = 3
Query:   27 MAKATTIKEALAQWEQKNGMKASEALEVKLHGVYPPIEKMDASLSTLHACEKLSLSTNCIEKIANLNGLKNLKVLSLGRNNIKNLNGLEAVGETLEQLWISYNMIEXXXXXXXXXXXXXXYISNNVVKEWVEFMKLADLPCLEDLVFTGNPLEDS--ETWRDEACKRLPKLKKLDGIPVVRDE 569
            M K TTIKEA+ +WE+K G KASEA EVKL G YPPIEK+DA+LSTL ACEKLSLSTNCIEKI+NLNGLKNLK+LSLGRNNIKNL GLE VG+TLEQLWISYN IEKLKG+NVLKKLKVLY+SNN VKEW EF KLADLP LEDL+F GNPLE++  ++WRDEACKRLPKLKKLDG+PV+RDE
Sbjct:   10 MDKPTTIKEAIKKWEEKTGQKASEATEVKLLGQYPPIEKIDATLSTLVACEKLSLSTNCIEKISNLNGLKNLKILSLGRNNIKNLTGLEPVGDTLEQLWISYNNIEKLKGINVLKKLKVLYMSNNFVKEWSEFQKLADLPALEDLLFVGNPLEENSGDSWRDEACKRLPKLKKLDGVPVLRDE 192          
BLAST of Dynein axonemal light chain 1 vs. TrEMBL
Match: gnl|BL_ORD_ID|22838515 (tr|A0A5K4F1M3|A0A5K4F1M3_SCHMA Uncharacterized protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 263.462 bits (672), Expect = 1.207e-86
Identity = 144/183 (78.69%), Postives = 162/183 (88.52%), Query Frame = 3
Query:   27 MAKATTIKEALAQWEQKNGMKASEALEVKLHGVYPPIEKMDASLSTLHACEKLSLSTNCIEKIANLNGLKNLKVLSLGRNNIKNLNGLEAVGETLEQLWISYNMIEXXXXXXXXXXXXXXYISNNVVKEWVEFMKLADLPCLEDLVFTGNPLEDS--ETWRDEACKRLPKLKKLDGIPVVRDE 569
            M K TTIKEA+ +WE+K G KASEA EVKL+G YPPIEKMDASLSTL  CEKLSLSTNCIEKI+NLNGLKNLK+LSLGRNNIKNL GLE VG+TLEQLWISYN IEK+KG+NVLKKLKVLY+SNN VK+W EF KLADLP LEDL+F GNPLE++  + WR+EACKRLPKLKKLDG+PV+ DE
Sbjct:    1 MDKPTTIKEAIKKWEEKTGQKASEATEVKLYGQYPPIEKMDASLSTLTMCEKLSLSTNCIEKISNLNGLKNLKILSLGRNNIKNLTGLEPVGDTLEQLWISYNSIEKMKGINVLKKLKVLYMSNNFVKDWSEFQKLADLPVLEDLLFVGNPLEENSGDNWREEACKRLPKLKKLDGVPVLHDE 183          
BLAST of Dynein axonemal light chain 1 vs. TrEMBL
Match: gnl|BL_ORD_ID|176263685 (tr|A0A2G9P0E6|A0A2G9P0E6_LITCT Dynein light chain 1, axonemal OS=Lithobates catesbeianus OX=8400 GN=AB205_0041730 PE=4 SV=1)

HSP 1 Score: 262.692 bits (670), Expect = 2.524e-86
Identity = 147/190 (77.37%), Postives = 165/190 (86.84%), Query Frame = 3
Query:   27 MAKATTIKEALAQWEQKNGMKASEALEVKLHGVYPPIEKMDASLSTLHACEKLSLSTNCIEKIANLNGLKNLKVLSLGRNNIKNLNGLEAVGETLEQLWISYNMIEXXXXXXXXXXXXXXYISNNVVKEWVEFMKLADLPCLEDLVFTGNPLEDSET----WRDEACKRLPKLKKLDGIPVVRDEEE*FD 584
            MAKATTIK+ALA+WE+K G KASEA EVKL+   PPIEKMDASLSTL  CEKLSLSTNCIEKIANLNGLKNL++LSLGRNNIKNLNGLEAVGETLE+LWISYN+IEKLKG++V+KKLKVLY+SNN VK+W EF KL DLPCLEDLVF GNPLE+  T    W +EA KRLPKLKKLDG PV++ E+E  D
Sbjct:    1 MAKATTIKDALAKWEEKTGQKASEAKEVKLYAQVPPIEKMDASLSTLINCEKLSLSTNCIEKIANLNGLKNLRILSLGRNNIKNLNGLEAVGETLEELWISYNLIEKLKGIHVMKKLKVLYMSNNTVKDWGEFSKLVDLPCLEDLVFVGNPLEEKHTLEGNWVEEATKRLPKLKKLDGNPVIKQEDEEGD 190          
BLAST of Dynein axonemal light chain 1 vs. TrEMBL
Match: gnl|BL_ORD_ID|26381985 (tr|F7GW85|F7GW85_CALJA Dynein axonemal light chain 1 OS=Callithrix jacchus OX=9483 GN=DNAL1 PE=4 SV=2)

HSP 1 Score: 262.307 bits (669), Expect = 2.660e-86
Identity = 141/187 (75.40%), Postives = 166/187 (88.77%), Query Frame = 3
Query:   27 MAKATTIKEALAQWEQKNGMKASEALEVKLHGVYPPIEKMDASLSTLHACEKLSLSTNCIEKIANLNGLKNLKVLSLGRNNIKNLNGLEAVGETLEQLWISYNMIEXXXXXXXXXXXXXXYISNNVVKEWVEFMKLADLPCLEDLVFTGNPLEDSET----WRDEACKRLPKLKKLDGIPVVRDEEE 575
            MAKATTIKEALA+WE+K G + SEA E+KL+   PPIEKMDASLSTL  CEKLSLSTNCIEKIANLNGLKNL++LSLGRNNIKNLNGLEAVG+TLE+LWISYN IEKLKG++V+KKLK+LY+SNN+VK+W EF+KLA+LPCLEDLVF GNPLE+  +    W +EA KR+PKLKKLDG PV++D+EE
Sbjct:    1 MAKATTIKEALARWEEKTGQRPSEAKEIKLYAQIPPIEKMDASLSTLANCEKLSLSTNCIEKIANLNGLKNLRILSLGRNNIKNLNGLEAVGDTLEELWISYNFIEKLKGIHVMKKLKILYMSNNLVKDWAEFVKLAELPCLEDLVFVGNPLEEKHSAENNWIEEATKRVPKLKKLDGTPVIKDDEE 187          
BLAST of Dynein axonemal light chain 1 vs. TrEMBL
Match: gnl|BL_ORD_ID|28037267 (tr|G1SSQ9|G1SSQ9_RABIT Dynein axonemal light chain 1 OS=Oryctolagus cuniculus OX=9986 GN=DNAL1 PE=4 SV=2)

HSP 1 Score: 261.922 bits (668), Expect = 5.075e-86
Identity = 141/187 (75.40%), Postives = 165/187 (88.24%), Query Frame = 3
Query:   27 MAKATTIKEALAQWEQKNGMKASEALEVKLHGVYPPIEKMDASLSTLHACEKLSLSTNCIEKIANLNGLKNLKVLSLGRNNIKNLNGLEAVGETLEQLWISYNMIEXXXXXXXXXXXXXXYISNNVVKEWVEFMKLADLPCLEDLVFTGNPLEDSET----WRDEACKRLPKLKKLDGIPVVRDEEE 575
            MAKATTIKEALA+WE+K G + SEA E+KL+   PPIEKMDASLSTL  CEKLSLSTNCIEKIANLNGLKNL++LSLGRNNIKNLNGLEAVG+TLE+LWISYN IEKLKG++V+KKLK+LY+SNN+VK+W EF+KLA+LPCLEDLVF GNPLE+  +    W DEA KR+P+LKKLDG PVV+ +EE
Sbjct:    1 MAKATTIKEALARWEEKTGQRPSEAKEIKLYAQIPPIEKMDASLSTLSNCEKLSLSTNCIEKIANLNGLKNLRILSLGRNNIKNLNGLEAVGDTLEELWISYNFIEKLKGIHVMKKLKILYMSNNLVKDWAEFVKLAELPCLEDLVFVGNPLEEKHSAESNWIDEATKRVPRLKKLDGTPVVKGDEE 187          
BLAST of Dynein axonemal light chain 1 vs. Ensembl Cavefish
Match: dnal1 (dynein axonemal light chain 1 [Source:NCBI gene;Acc:103044406])

HSP 1 Score: 247.669 bits (631), Expect = 7.558e-84
Identity = 135/183 (73.77%), Postives = 159/183 (86.89%), Query Frame = 3
Query:   27 MAKATTIKEALAQWEQKNGMKASEALEVKLHGVYPPIEKMDASLSTLHACEKLSLSTNCIEKIANLNGLKNLKVLSLGRNNIKNLNGLEAVGETLEQLWISYNMIEXXXXXXXXXXXXXXYISNNVVKEWVEFMKLADLPCLEDLVFTGNPLEDS----ETWRDEACKRLPKLKKLDGIPVVR 563
            MAKAT+IKEAL +WE+K+G KA++A  VKL G  PPIEKMDASLSTL  CE LSLSTNCIEKIANLNGLKNLK+LSLGRNNIKNLNGLEAVG+TLE+LWISYN+IEKLKG++V+KKL+VLY+SNN+V+EW EF+KLAD+P L D+VF GNPLE+      TW DEA KR+P LKKLDG PV++
Sbjct:    1 MAKATSIKEALVKWEEKSGEKAADAKAVKLFGQIPPIEKMDASLSTLVNCENLSLSTNCIEKIANLNGLKNLKILSLGRNNIKNLNGLEAVGDTLEELWISYNLIEKLKGIHVMKKLRVLYMSNNLVREWAEFVKLADIPSLVDMVFVGNPLEEKYSAEGTWIDEATKRVPSLKKLDGTPVIK 183          
BLAST of Dynein axonemal light chain 1 vs. Ensembl Cavefish
Match: LRRC9 (leucine-rich repeat-containing protein 9-like [Source:NCBI gene;Acc:103026999])

HSP 1 Score: 56.9954 bits (136), Expect = 3.555e-9
Identity = 56/160 (35.00%), Postives = 81/160 (50.62%), Query Frame = 3
Query:   99 ALEVKLHGVYPPIEKM-DASLSTLHACEKLSLSTNCIEKIANLNGLKNLKVLSLGRNNIK--NLNGLEAVGETLEQLWISYNMIEXXXXXXXXXXXXXXYISNNVVKEWVEFMKLADLPCLEDLVFTGNPLEDSETWRDEACKRLPKLKKLDGIPVVRDE 569
            +LEV LH  Y  I  + +  LS L   + L L  N + ++  L GL+ L+ L L RN ++  + N   A    LE L +S N +  L  ++ L +L+ L++ NN V++  E  KL  LP L  L   GNP+      R     RLP L+ LDGI +  DE
Sbjct: 1202 SLEV-LHLGYNGISNLSELQLSRLTNLKSLFLQGNEMVQVEGLEGLRRLQELVLDRNRLRCVSANSFSAQAALLE-LHMSDNRLRDLSHLHTLSQLRSLHLDNNKVQDLSELEKLDALPSLIKLSVLGNPVARRCLHRPVVVLRLPGLQVLDGISITLDE 1359          
BLAST of Dynein axonemal light chain 1 vs. Ensembl Cavefish
Match: LRRC9 (leucine-rich repeat-containing protein 9-like [Source:NCBI gene;Acc:103026999])

HSP 1 Score: 56.6102 bits (135), Expect = 4.003e-9
Identity = 56/160 (35.00%), Postives = 81/160 (50.62%), Query Frame = 3
Query:   99 ALEVKLHGVYPPIEKM-DASLSTLHACEKLSLSTNCIEKIANLNGLKNLKVLSLGRNNIK--NLNGLEAVGETLEQLWISYNMIEXXXXXXXXXXXXXXYISNNVVKEWVEFMKLADLPCLEDLVFTGNPLEDSETWRDEACKRLPKLKKLDGIPVVRDE 569
            +LEV LH  Y  I  + +  LS L   + L L  N + ++  L GL+ L+ L L RN ++  + N   A    LE L +S N +  L  ++ L +L+ L++ NN V++  E  KL  LP L  L   GNP+      R     RLP L+ LDGI +  DE
Sbjct: 1202 SLEV-LHLGYNGISNLSELQLSRLTNLKSLFLQGNEMVQVEGLEGLRRLQELVLDRNRLRCVSANSFSAQAALLE-LHMSDNRLRDLSHLHTLSQLRSLHLDNNKVQDLSELEKLDALPSLIKLSVLGNPVARRCLHRPVVVLRLPGLQVLDGISITLDE 1359          
BLAST of Dynein axonemal light chain 1 vs. Ensembl Cavefish
Match: ppp1r7 (protein phosphatase 1 regulatory subunit 7 [Source:NCBI gene;Acc:111191999])

HSP 1 Score: 53.9138 bits (128), Expect = 2.480e-8
Identity = 50/160 (31.25%), Postives = 79/160 (49.38%), Query Frame = 3
Query:  135 IEKMDASLSTLHACEKLSLSTNCIEKIANLNGLKNLKVLSLGRNNIKNLNGLEAVGETLEQLWISYNMIEXXXXXXXXXXXXXXYISNNVVKE----------------------WVEFMKLADLPCLEDLVFTGNPLEDSETWRDEACKRLPKLKKLDG 548
            IE +DA    L + + L L TN I K+ NL+GL NL VLS+  N I  L GL+ +   L +L++S+N IE ++G+   KKL  L I+ N +K+                      W +  +L +   LE +    NPL+    +R +    LP ++++D 
Sbjct:  187 IENLDA----LTSLDSLFLGTNKITKLQNLDGLHNLTVLSIQSNRITKLEGLQNMV-NLRELYLSHNGIEVIEGLENNKKLTTLDIAANRIKKIENISHLTDLQEFWMNDNQIENWSDLDELKNAKGLETVYLERNPLQKDPQYRRKIMLALPSVRQIDA 341          
BLAST of Dynein axonemal light chain 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002931.1 (pep scaffold:Pmarinus_7.0:GL477629:181338:188018:1 gene:ENSPMAG00000002677.1 transcript:ENSPMAT00000002931.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 227.639 bits (579), Expect = 1.489e-76
Identity = 129/184 (70.11%), Postives = 152/184 (82.61%), Query Frame = 3
Query:   36 ATTIKEALAQWEQKNGMKASEALEVKLHGVYPPIEKMDASLSTLHACEKLSLSTNCIEKIANLNGLKNLKVLSLGRNNIKNLNGLEAVGETLEQLWISYNMIEXXXXXXXXXXXXXXYISNNVVKEWVEFMKLADLPCLEDLVFTGNPLEDSET----WRDEACKRLPKLKKLDGIPVVRDEEE 575
             T +  +L   E+K G KA EA  VKL+  YPPIEKMDASLS L +CEKLSLSTNCIEKIANLNGLK +K+LSLGRNNIKNL+GLEAVG+TLE+LWISYN IEKLKG++VLKKL+VLY+SNN+VKEW EF++LADLP L DLVF GNPLED  +    W +EA +RLP+LKKLDG PV+R +EE
Sbjct:    4 GTFLTLSLCLQEEKAGEKAGEAKIVKLYAQYPPIEKMDASLSLLASCEKLSLSTNCIEKIANLNGLKFIKILSLGRNNIKNLSGLEAVGDTLEELWISYNNIEKLKGIHVLKKLRVLYMSNNLVKEWSEFVRLADLPALADLVFVGNPLEDKHSGEGNWMEEATRRLPRLKKLDGCPVIRQDEE 187          
BLAST of Dynein axonemal light chain 1 vs. Ensembl Sea Lamprey
Match: LRRC9 (leucine rich repeat containing 9 [Source:HGNC Symbol;Acc:HGNC:19848])

HSP 1 Score: 58.9214 bits (141), Expect = 1.430e-10
Identity = 59/183 (32.24%), Postives = 93/183 (50.82%), Query Frame = 3
Query:   27 MAKATTIKEALAQWEQKNGMKASEALEVKLHGVYPPIEKMDA-SLSTLHACEKLSLSTNCIEKIANLNGLKNLKVLSLGRNNIKNLNGLEAVGE-TLEQLWISYNMIEXXXXXXXXXXXXXXYISNNVVKEWVEFMKLADLPCLEDLVFTGNPLEDSETWRDEACKRLPKLKKLDGIPVVRDE 569
            +AKAT  ++ALA    +N     E LEV LH  Y  I  +    L  L     L L  N I ++  L G   L+ L L  N +++L     +G+ +L +L +  N + +L  ++ L +L+ LY+ NN +++  E  KL  LP L ++  TGNPL      R     + P+L  +DG+PV ++E
Sbjct:  634 VAKAT--RDALAC---ENLAPIMERLEV-LHLAYNRISSLALLQLGRLTGLRTLYLQGNEISRVEGLEGAAALRELVLDANRVRSLGESSFLGQGSLVELHLRDNRLRQLSNLHPLCRLQRLYLDNNKLQDMSELEKLNQLPSLTEITLTGNPLARRCLHRPVLVLQTPRLLLVDGLPVSQEE 810          
BLAST of Dynein axonemal light chain 1 vs. Ensembl Sea Lamprey
Match: LRRC9 (leucine rich repeat containing 9 [Source:HGNC Symbol;Acc:HGNC:19848])

HSP 1 Score: 58.5362 bits (140), Expect = 1.814e-10
Identity = 59/183 (32.24%), Postives = 93/183 (50.82%), Query Frame = 3
Query:   27 MAKATTIKEALAQWEQKNGMKASEALEVKLHGVYPPIEKMDA-SLSTLHACEKLSLSTNCIEKIANLNGLKNLKVLSLGRNNIKNLNGLEAVGE-TLEQLWISYNMIEXXXXXXXXXXXXXXYISNNVVKEWVEFMKLADLPCLEDLVFTGNPLEDSETWRDEACKRLPKLKKLDGIPVVRDE 569
            +AKAT  ++ALA    +N     E LEV LH  Y  I  +    L  L     L L  N I ++  L G   L+ L L  N +++L     +G+ +L +L +  N + +L  ++ L +L+ LY+ NN +++  E  KL  LP L ++  TGNPL      R     + P+L  +DG+PV ++E
Sbjct:  647 VAKAT--RDALAC---ENLAPIMERLEV-LHLAYNRISSLALLQLGRLTGLRTLYLQGNEISRVEGLEGAAALRELVLDANRVRSLGESSFLGQGSLVELHLRDNRLRQLSNLHPLCRLQRLYLDNNKLQDMSELEKLNQLPSLTEITLTGNPLARRCLHRPVLVLQTPRLLLVDGLPVSQEE 823          
BLAST of Dynein axonemal light chain 1 vs. Ensembl Sea Lamprey
Match: LRRC9 (leucine rich repeat containing 9 [Source:HGNC Symbol;Acc:HGNC:19848])

HSP 1 Score: 58.151 bits (139), Expect = 2.128e-10
Identity = 59/183 (32.24%), Postives = 93/183 (50.82%), Query Frame = 3
Query:   27 MAKATTIKEALAQWEQKNGMKASEALEVKLHGVYPPIEKMDA-SLSTLHACEKLSLSTNCIEKIANLNGLKNLKVLSLGRNNIKNLNGLEAVGE-TLEQLWISYNMIEXXXXXXXXXXXXXXYISNNVVKEWVEFMKLADLPCLEDLVFTGNPLEDSETWRDEACKRLPKLKKLDGIPVVRDE 569
            +AKAT  ++ALA    +N     E LEV LH  Y  I  +    L  L     L L  N I ++  L G   L+ L L  N +++L     +G+ +L +L +  N + +L  ++ L +L+ LY+ NN +++  E  KL  LP L ++  TGNPL      R     + P+L  +DG+PV ++E
Sbjct:  647 VAKAT--RDALAC---ENLAPIMERLEV-LHLAYNRISSLALLQLGRLTGLRTLYLQGNEISRVEGLEGAAALRELVLDANRVRSLGESSFLGQGSLVELHLRDNRLRQLSNLHPLCRLQRLYLDNNKLQDMSELEKLNQLPSLTEITLTGNPLARRCLHRPVLVLQTPRLLLVDGLPVSQEE 823          
BLAST of Dynein axonemal light chain 1 vs. Ensembl Sea Lamprey
Match: lrrc6 (leucine rich repeat containing 6 [Source:NCBI gene;Acc:432388])

HSP 1 Score: 55.4546 bits (132), Expect = 1.829e-9
Identity = 40/129 (31.01%), Postives = 59/129 (45.74%), Query Frame = 3
Query:  183 LSLSTNCIEKIANLNGLKNLKVLSLGRNNIKNLNGLEAVGETLEQLWISYNMIEXXXXXXXXXXXXXXYISNNVVKEWVEFMKLADLPCLEDLVFTGNPLEDSETWRDEACKRLPKLKKLDGIPVVRDE 569
            L L  N I +I NL+ LK L+ ++L  NN++ +  L+   E+L++L ++ N                       V E      L   P LE+L   GNP  D E +R      LP+LK+LDG  + R E
Sbjct:   46 LYLHNNVIPRIENLSRLKELEYINLALNNVERIENLQGC-ESLQKLDLTVNF----------------------VGELSSVETLRHNPLLEELFLVGNPCADFEGYRPYVVATLPQLKRLDGQEIERSE 151          
BLAST of Dynein axonemal light chain 1 vs. Ensembl Nematostella
Match: EDO46786 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RP35])

HSP 1 Score: 246.514 bits (628), Expect = 8.703e-84
Identity = 138/183 (75.41%), Postives = 156/183 (85.25%), Query Frame = 3
Query:   27 MAKATTIKEALAQWEQKNGMKASEALEVKLHGVYPPIEKMDASLSTLHACEKLSLSTNCIEKIANLNGLKNLKVLSLGRNNIKNLNGLEAVGETLEQLWISYNMIEXXXXXXXXXXXXXXYISNNVVKEWVEFMKLADLPCLEDLVFTGNPLEDSET----WRDEACKRLPKLKKLDGIPVVR 563
            M+K TTIK+AL++WE+KNG KASE+ E+KL    PP+EKMDASLSTL  CEKLSLSTNCIEKIANLNGLKNLKVLSLGRNNIKNLNGLEAV +TLE+LWISYN IEKLKGV VLKKLKVLY+SNN VK W EF KL +LP LEDL+F GNPLE+  +    WR EA KRLPKLKKLDG+P+V+
Sbjct:    1 MSKGTTIKDALSKWEEKNGAKASESKEIKLIAQMPPVEKMDASLSTLSNCEKLSLSTNCIEKIANLNGLKNLKVLSLGRNNIKNLNGLEAVADTLEELWISYNNIEKLKGVGVLKKLKVLYMSNNSVKAWEEFTKLGELPALEDLLFIGNPLEEKHSSDGDWRGEATKRLPKLKKLDGVPIVK 183          
BLAST of Dynein axonemal light chain 1 vs. Ensembl Nematostella
Match: EDO45359 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RSZ1])

HSP 1 Score: 56.225 bits (134), Expect = 1.427e-9
Identity = 42/121 (34.71%), Postives = 67/121 (55.37%), Query Frame = 3
Query:  144 MDASLSTLHACEKLSLSTNCIEKIANLNGLKNLKVLSLGRNNIKNL-NGLEAVGETLEQLWISYNMIEXXXXXXXXXXXXXXYISNNVVKEWVEFMKLADLPCLEDLVFTGNPLEDSETWR 503
            +D S+S L   E L+LS NCIE+I +L  L  L+VL L  N ++ +   L A    + +L ++ N +  + G+  L  L  L + +N++ E    + + DLPCLE+L   GNPL    ++R
Sbjct:  288 IDESVSLLPNIESLNLSHNCIEEINHLESLSELEVLDLSHNKLRAIPTNLNAKLGNIRKLNLANNQLSCVDGLEKLYSLVELDLRSNLLTEVSSVVLIGDLPCLENLHLEGNPLTKESSYR 408          
BLAST of Dynein axonemal light chain 1 vs. Ensembl Nematostella
Match: EDO44937 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RU20])

HSP 1 Score: 53.1434 bits (126), Expect = 1.280e-8
Identity = 51/153 (33.33%), Postives = 77/153 (50.33%), Query Frame = 3
Query:  156 LSTLHACEKLSLSTNCIEKIANLNGLKNLKVLSLGRNNIKNLNGLEAVGETLEQLWISYNMIEXXXXXXXXXXXXXXYISNNVVK----------------------EWVEFMKLADLPCLEDLVFTGNPLEDSETWRDEACKRLPKLKKLDG 548
            L  L   E L +  N I ++ NL+GL +LKVLS+  N I  L GLE + ++LE+L+IS+N IE++KG+  L KL  L +++N +K                       W +  +LA  P L  +    NPL     +R +    LP LK++D 
Sbjct:  155 LEHLTKLESLFVGKNKITELQNLSGLCSLKVLSIQSNRIVELKGLEHL-DSLEELYISHNGIEEIKGLESLTKLNTLDLASNRIKRISNVGHLLNLEEFWFNDNQLEHWEDLDELAKCPKLHTVYLERNPLSRDTAYRRKVKLALPALKQIDA 306          
BLAST of Dynein axonemal light chain 1 vs. Ensembl Nematostella
Match: EDO31771 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SWZ8])

HSP 1 Score: 51.9878 bits (123), Expect = 5.249e-8
Identity = 52/159 (32.70%), Postives = 77/159 (48.43%), Query Frame = 3
Query:  102 LEVKLHGVYPPIEKMDA-SLSTLHACEKLSLSTNCIEKIANLNGLKNLKVLSLGRNNIKNLNGLEAVGE-TLEQLWISYNMIEXXXXXXXXXXXXXXYISNNVVKEWVEFMKLADLPCLEDLVFTGNPLEDSETWRDEACKRLPKLKKLDGIPVVRDEE 572
            LEV LH  Y  I  +    LS L   + L L  N I K+  L GL++L+ L L RN IK ++    + +  L +L I  N ++ L  ++ L+    LY+  N +++  +F KL  L  L +L    N +      R     R+P L  +DGIPV  DE 
Sbjct:  721 LEV-LHLGYNSIPSISGLQLSRLPNLKALFLQGNEITKVDGLEGLQDLRELVLDRNKIKCISEYSFINQWNLIELHIEENRLKDLSNLDHLQYQVRLYLGMNRIQDLSQFEKLESLSNLIELSVINNAVTRRLLHRPMLVFRMPSLLCIDGIPVSSDER 878          

HSP 2 Score: 45.4394 bits (106), Expect = 8.808e-6
Identity = 50/136 (36.76%), Postives = 68/136 (50.00%), Query Frame = 3
Query:  171 ACEKLSLSTNCIEKIANLNGLKNLKVLSLGRNNIKNLNG--LEAVGETLEQLWISYNMIEXXXXXXXXXXXXXXYISNNVVKEWVEFMKLADLPCLEDLVFTGNPL-EDSETWRDEACKRLPKLKKLDGIPVVRDE 569
            + E+LSL  NCI K   L     LK L+L  NN+  L+   LE + E L  L +  N I  LKG+    +L+ LY+ NN +    E   L  +P L  L   GNPL E++  +R      L  LK LDG+ V  +E
Sbjct:  463 SLEELSLEGNCISKFEGLVRNPKLKWLNLSSNNLTILDTGMLERLPE-LRYLSLENNNITCLKGLQHAVELQELYLGNNHLANIREIFSLKPIPMLVILDLYGNPLVENTANYRLFVIFHLTTLKALDGLAVEPNE 597          
BLAST of Dynein axonemal light chain 1 vs. Ensembl Nematostella
Match: EDO30347 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T121])

HSP 1 Score: 46.595 bits (109), Expect = 1.038e-6
Identity = 52/165 (31.52%), Postives = 80/165 (48.48%), Query Frame = 3
Query:  135 IEKMDASLSTLHACEKLSLSTNCIEKIANLNGLKNLK-----VLSLGRNNIKNLNGLEAVGETLEQLWISYNMIEXXXXXXXXXXXXXXYISNNVVK----------------------EWVEFMKLADLPCLEDLVFTGNPLEDSETWRDEACKRLPKLKKLDG 548
            I+K++ +L TL + E+L    N I KI NL+ L NL      +     N I  L GLE + ++LE+L+IS+N IE++KG+  L KL  L +++N +K                       W +  +LA  P L  +    NPL     +R +    LP LK++D 
Sbjct:   15 IKKLE-NLETLTSLEELDFYDNQISKIENLDRLVNLSCHHVFLFVFQSNRIVELKGLEHL-DSLEELYISHNGIEEIKGLESLAKLNTLDLASNRIKRISNVGHLLNLEEFWFNDNQLEHWEDLDELAKCPKLHTVYLERNPLSRDTAYRRKVKLALPALKQIDA 177          
BLAST of Dynein axonemal light chain 1 vs. Ensembl Medaka
Match: dnal1 (dynein axonemal light chain 1 [Source:NCBI gene;Acc:101157711])

HSP 1 Score: 189.889 bits (481), Expect = 3.389e-61
Identity = 118/186 (63.44%), Postives = 142/186 (76.34%), Query Frame = 3
Query:   27 MAKATTIKEALAQWEQKNGMKASEALEVKLHGVYPPIEKMDASLSTLHACEKLSLSTNCIEKIANLNGLKNLKVLSLGRNNIKNLNGLEAVGETLEQLWISYNMIEXXXXXXXXXXXXXXYISNNVVKEWVEFMKLADLPCLEDLVFTGNPLED----SETWRDEACKRLPKLKKLDGIPVVRDEE 572
            MA ATT+K ALA+WE  +  KASEA E+KL G  PPIEK+D SLSTL  CEKLSLSTN IEKI NL GLKNLK+LSL RNNIK L GLE + +TLE+LWISYN+IE+L+G+   KKLKVLY+SNN+V +W EFM+LADLP L DL F GNPL++       W  E  KRLP LKK+DG  +V++E+
Sbjct:    1 MAGATTVKNALAKWEMDSKQKASEATEIKLFGQIPPIEKLDDSLSTLINCEKLSLSTNRIEKITNLGGLKNLKILSLSRNNIKTLVGLEPLQDTLEELWISYNLIERLRGIQSFKKLKVLYMSNNLVNDWDEFMRLADLPLLADLAFVGNPLQEKCAPQYNWIQEVSKRLPHLKKVDGAHIVKNED 186          
BLAST of Dynein axonemal light chain 1 vs. Ensembl Medaka
Match: ppp1r7 (protein phosphatase 1 regulatory subunit 7 [Source:NCBI gene;Acc:101158055])

HSP 1 Score: 52.373 bits (124), Expect = 8.044e-8
Identity = 40/132 (30.30%), Postives = 72/132 (54.55%), Query Frame = 3
Query:  153 SLSTLHACEKLSLSTNCIEKIANLNGLKNLKVLSLGRNNIKNLNGLEAVGETLEQLWISYNMIEXXXXXXXXXXXXXXYISNNVVKEWVEFMKLADLPCLEDLVFTGNPLEDSETWRDEACKRLPKLKKLDG 548
            +L  LH    LS+ +N I KI  L  L NLK L L  N I+ + GLE   + L  L I+ N ++K++ ++ L +L+  ++++N ++ W +  +L +   LE +    NPL+    +R +    LP ++++D 
Sbjct:  211 NLDALHNLSVLSIQSNRITKIEGLQNLVNLKELYLSHNGIEVIEGLEN-NKKLTTLDIAANRVKKIENISHLTELQEFWMNDNQIENWSDLDELKNAKSLETVYLERNPLQKDPQYRRKIMLALPSVRQIDA 341          
BLAST of Dynein axonemal light chain 1 vs. Ensembl Medaka
Match: ppp1r7 (protein phosphatase 1 regulatory subunit 7 [Source:NCBI gene;Acc:101158055])

HSP 1 Score: 51.2174 bits (121), Expect = 1.771e-7
Identity = 40/135 (29.63%), Postives = 73/135 (54.07%), Query Frame = 3
Query:  153 SLSTLHACEKLSLSTNCIEKIANLNGLKNLKVLSLGRNNIKNLNGLEAVGETLEQLWISYNMIEXXXXXXXXXXXXXXYISNNVVKEWVEFMKLADLPCLEDLVFTGNPLEDSETWRDEACKRLPKLKKLDGIPV 557
            +L  LH    LS+ +N I KI  L  L NLK L L  N I+ + GLE   + L  L I+ N ++K++ ++ L +L+  ++++N ++ W +  +L +   LE +    NPL+    +R +    LP ++++D   +
Sbjct:  250 NLDALHNLSVLSIQSNRITKIEGLQNLVNLKELYLSHNGIEVIEGLEN-NKKLTTLDIAANRVKKIENISHLTELQEFWMNDNQIENWSDLDELKNAKSLETVYLERNPLQKDPQYRRKIMLALPSVRQIDATFI 383          
BLAST of Dynein axonemal light chain 1 vs. Ensembl Medaka
Match: LRRC9 (leucine-rich repeat-containing protein 9 [Source:NCBI gene;Acc:101159959])

HSP 1 Score: 51.2174 bits (121), Expect = 2.927e-7
Identity = 57/160 (35.62%), Postives = 80/160 (50.00%), Query Frame = 3
Query:   99 ALEVKLHGVYPPIEKM-DASLSTLHACEKLSLSTNCIEKIANLNGLKNLKVLSLGRNNIKNL--NGLEAVGETLEQLWISYNMIEXXXXXXXXXXXXXXYISNNVVKEWVEFMKLADLPCLEDLVFTGNPLEDSETWRDEACKRLPKLKKLDGIPVVRDE 569
             LEV LH  +  I  M +  LS L   + L L  N I ++  L GL+ L+ L L RN IK L  N   A  E LE L + YN I +L  ++ L  L+ L++  N +++  E  KL  LP L +L   GNP+  +   R      L  L+ LDG+ V  +E
Sbjct: 1250 GLEV-LHLSHNGISNMANLQLSRLTNLKSLFLQGNDISQVEGLEGLQQLRELVLDRNRIKALARNSFIAQSELLE-LHLEYNRIRELNHLDPLVGLQKLFLGMNKLQDVAEIEKLEVLPSLTELSVIGNPVAQNSLHRPAVLLHLSSLQLLDGVMVTLEE 1407          
BLAST of Dynein axonemal light chain 1 vs. Ensembl Medaka
Match: nisch (nischarin [Source:NCBI gene;Acc:101164628])

HSP 1 Score: 47.3654 bits (111), Expect = 4.553e-6
Identity = 36/116 (31.03%), Postives = 60/116 (51.72%), Query Frame = 3
Query:  135 IEKMDASLSTLHACEKLSLSTNCIEKIANLNGLKNLKVLSLGRNNIKNLNGLEAVGETLEQLWISYNMIEXXXXXXXXXXXXXXYISNNVVKEWVEFMKLADLPCLEDLVFTGNPL 482
            I  +D+S+  +   E L LS N +  + NL  L NL  + L  NN++ L         ++ L ++ N +E L G++ L  L  L +S+N + +  E   ++ LPCLE L  + NP+
Sbjct:  295 ISTIDSSVRVIPKVEFLDLSYNKLSSVENLQHLYNLVHVDLSFNNLRVLEAAHTRLGNIKTLNLAGNQLECLSGLSKLYSLVNLDLSHNQLAQLEEIRNISHLPCLEKLNLSSNPI 410          
BLAST of Dynein axonemal light chain 1 vs. Planmine SMEST
Match: SMESG000053050.1 (SMESG000053050.1)

HSP 1 Score: 338.576 bits (867), Expect = 9.710e-120
Identity = 183/184 (99.46%), Postives = 184/184 (100.00%), Query Frame = 3
Query:   24 EMAKATTIKEALAQWEQKNGMKASEALEVKLHGVYPPIEKMDASLSTLHACEKLSLSTNCIEKIANLNGLKNLKVLSLGRNNIKNLNGLEAVGETLEQLWISYNMIEXXXXXXXXXXXXXXYISNNVVKEWVEFMKLADLPCLEDLVFTGNPLEDSETWRDEACKRLPKLKKLDGIPVVRDEEE 575
            E+AKATTIKEALAQWEQKNGMKASEALEVKLHGVYPPIEKMDASLSTLHACEKLSLSTNCIEKIANLNGLKNLKVLSLGRNNIKNLNGLEAVGETLEQLWISYNMIEKLKGVNVLKKLKVLYISNNVVKEWVEFMKLADLPCLEDLVFTGNPLEDSETWRDEACKRLPKLKKLDGIPVVRDEEE
Sbjct:   22 ELAKATTIKEALAQWEQKNGMKASEALEVKLHGVYPPIEKMDASLSTLHACEKLSLSTNCIEKIANLNGLKNLKVLSLGRNNIKNLNGLEAVGETLEQLWISYNMIEKLKGVNVLKKLKVLYISNNVVKEWVEFMKLADLPCLEDLVFTGNPLEDSETWRDEACKRLPKLKKLDGIPVVRDEEE 205          
BLAST of Dynein axonemal light chain 1 vs. Planmine SMEST
Match: SMESG000058220.1 (SMESG000058220.1)

HSP 1 Score: 48.1358 bits (113), Expect = 1.579e-6
Identity = 38/129 (29.46%), Postives = 64/129 (49.61%), Query Frame = 3
Query:  183 LSLSTNCIEKIANLNGLKNLKVLSLGRNNIKNLNGLEAVGETLEQLWISYNMIEXXXXXXXXXXXXXXYISNNVVKEWVEFMKLADLPCLEDLVFTGNPLEDSETWRDEACKRLPKLKKLDGIPVVRDE 569
            L L +N I +I N++ LK L+ ++L  NNI+ +  LE   E+L++L ++ N +  L             I N           L +L   E+L  TGNP +  + +R+     LP+L+ LDG+ + + E
Sbjct:   49 LYLQSNLISRIENVSRLKKLEYINLALNNIEIIENLENC-ESLKKLDLTVNFVGILTS-----------IGN-----------LKNLYNFEELYLTGNPCQSYDGYREYVITTLPQLQTLDGVEITKSE 154          
BLAST of Dynein axonemal light chain 1 vs. Planmine SMEST
Match: SMESG000047633.1 (SMESG000047633.1)

HSP 1 Score: 46.9802 bits (110), Expect = 2.949e-6
Identity = 43/122 (35.25%), Postives = 69/122 (56.56%), Query Frame = 3
Query:  180 KLSLSTNCIEKIANLNGLKNLKVLSLGRNNIKNLNGLEAVGETLEQLWISYNMIEXXXXXXXXXXXXXXYISNNVVKEWVEFMKLADLPCLEDLVFTGNPLEDSETWRDEACKRLPKLKKLD 545
            KL L  N IEKI+ LN L +LK L L  NNI+ + G++++   +E L +  N I+K++ +  LK+L+VL I NN++ +      L     L+ +  +GNP  + + +R      LP+L  LD
Sbjct:   69 KLQLDNNIIEKISGLNHLISLKWLDLSFNNIEIIEGIDSLV-NIEDLTLFNNRIKKMENLEHLKQLQVLSIGNNLIDDLNNLKYLRTFKSLKAINLSGNPCCEKDEFRVVVLAYLPQLIYLD 189          
BLAST of Dynein axonemal light chain 1 vs. Planmine SMEST
Match: SMESG000023354.1 (SMESG000023354.1)

HSP 1 Score: 46.595 bits (109), Expect = 4.527e-6
Identity = 38/121 (31.40%), Postives = 59/121 (48.76%), Query Frame = 3
Query:  183 LSLSTNCIEKIANLNGLKNLKVLSLGRNNIKNLNGLEAVGETLEQLWISYNMIEXXXXXXXXXXXXXXYISNNVVKEWVEFMKLADLPCLEDLVFTGNPLEDSETWRDEACKRLPKLKKLD 545
            L L+ N I +I +L   ++L  L L  N I+NL+GL      L+  +I+                    + NN +  + E  KL  LP LE LV   NP+E++E +R  + + +P LK+LD
Sbjct:  158 LYLAANQITEIHDLLDHRSLTTLHLRDNKIENLDGLHESIPFLK--YIN--------------------LRNNKLSNFDEVKKLISLPELEHLVLRENPIEENEEYRIASLRCIPHLKRLD 256          
BLAST of Dynein axonemal light chain 1 vs. Planmine SMEST
Match: SMESG000023354.1 (SMESG000023354.1)

HSP 1 Score: 46.595 bits (109), Expect = 5.069e-6
Identity = 38/121 (31.40%), Postives = 59/121 (48.76%), Query Frame = 3
Query:  183 LSLSTNCIEKIANLNGLKNLKVLSLGRNNIKNLNGLEAVGETLEQLWISYNMIEXXXXXXXXXXXXXXYISNNVVKEWVEFMKLADLPCLEDLVFTGNPLEDSETWRDEACKRLPKLKKLD 545
            L L+ N I +I +L   ++L  L L  N I+NL+GL      L+  +I+                    + NN +  + E  KL  LP LE LV   NP+E++E +R  + + +P LK+LD
Sbjct:  184 LYLAANQITEIHDLLDHRSLTTLHLRDNKIENLDGLHESIPFLK--YIN--------------------LRNNKLSNFDEVKKLISLPELEHLVLRENPIEENEEYRIASLRCIPHLKRLD 282          
The following BLAST results are available for this feature:
BLAST of Dynein axonemal light chain 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DNAL12.546e-8773.80dynein axonemal light chain 1 [Source:HGNC Symbol;... [more]
DNAL12.100e-6675.00dynein axonemal light chain 1 [Source:HGNC Symbol;... [more]
DNAL11.253e-6176.81dynein axonemal light chain 1 [Source:HGNC Symbol;... [more]
DNAL12.053e-3467.00dynein axonemal light chain 1 [Source:HGNC Symbol;... [more]
DNAL12.340e-2464.18dynein axonemal light chain 1 [Source:HGNC Symbol;... [more]
back to top
BLAST of Dynein axonemal light chain 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
K10D2.81.242e-732.93pep chromosome:WBcel235:III:5188726:5190175:1 gene... [more]
C06A8.63.434e-731.97pep chromosome:WBcel235:II:7772499:7773914:1 gene:... [more]
back to top
BLAST of Dynein axonemal light chain 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 4
Match NameE-valueIdentityDescription
CG88006.652e-6359.46gene:FBgn0033408 transcript:FBtr0088555[more]
CG108395.028e-6253.85gene:FBgn0028858 transcript:FBtr0343725[more]
CG108395.028e-6253.85gene:FBgn0028858 transcript:FBtr0305563[more]
CG108395.028e-6253.85gene:FBgn0028858 transcript:FBtr0080800[more]
back to top
BLAST of Dynein axonemal light chain 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dnal13.962e-8675.94Dynein light chain 1, axonemal [Source:UniProtKB/... [more]
dnal13.962e-8675.94dynein, axonemal, light chain 1 [Source:NCBI gene;... [more]
dnal13.304e-3475.26Dynein light chain 1, axonemal [Source:UniProtKB/... [more]
lrrc98.266e-831.10leucine rich repeat containing 9 [Source:ZFIN;Acc:... [more]
ppp1r74.902e-630.00protein phosphatase 1, regulatory (inhibitor) subu... [more]
back to top
BLAST of Dynein axonemal light chain 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nhlh11.047e-8675.26nescient helix-loop-helix 1 [Source:Xenbase;Acc:XB... [more]
nhlh12.244e-8675.53nescient helix-loop-helix 1 [Source:Xenbase;Acc:XB... [more]
nhlh11.703e-7674.57nescient helix-loop-helix 1 [Source:Xenbase;Acc:XB... [more]
lrrc232.509e-937.59leucine rich repeat containing 23 [Source:NCBI gen... [more]
rbpms23.903e-931.18RNA binding protein with multiple splicing 2 [Sour... [more]
back to top
BLAST of Dynein axonemal light chain 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dnal11.706e-8975.40dynein, axonemal, light chain 1 [Source:MGI Symbol... [more]
Dnal13.031e-6977.70dynein, axonemal, light chain 1 [Source:MGI Symbol... [more]
Dnal15.789e-4475.00dynein, axonemal, light chain 1 [Source:MGI Symbol... [more]
Dnal11.551e-1867.27dynein, axonemal, light chain 1 [Source:MGI Symbol... [more]
Dnal11.319e-1770.59dynein, axonemal, light chain 1 [Source:MGI Symbol... [more]
back to top
BLAST of Dynein axonemal light chain 1 vs. UniProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q05A62|DNAL1_MOUSE1.193e-8875.40Dynein light chain 1, axonemal OS=Mus musculus OX=... [more]
sp|A0A096MJZ0|DNAL1_RAT4.897e-8874.33Dynein light chain 1, axonemal OS=Rattus norvegicu... [more]
sp|Q2KID4|DNAL1_BOVIN1.020e-8774.87Dynein light chain 1, axonemal OS=Bos taurus OX=99... [more]
sp|Q4LDG9|DNAL1_HUMAN1.223e-8673.80Dynein light chain 1, axonemal OS=Homo sapiens OX=... [more]
sp|Q28G94|DNAL1_XENTR5.546e-8675.26Dynein light chain 1, axonemal OS=Xenopus tropical... [more]
back to top
BLAST of Dynein axonemal light chain 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
gnl|BL_ORD_ID|171927329.617e-8880.33tr|C1LFH9|C1LFH9_SCHJA Protein phosphatase 1 regul... [more]
gnl|BL_ORD_ID|228385151.207e-8678.69tr|A0A5K4F1M3|A0A5K4F1M3_SCHMA Uncharacterized pro... [more]
gnl|BL_ORD_ID|1762636852.524e-8677.37tr|A0A2G9P0E6|A0A2G9P0E6_LITCT Dynein light chain ... [more]
gnl|BL_ORD_ID|263819852.660e-8675.40tr|F7GW85|F7GW85_CALJA Dynein axonemal light chain... [more]
gnl|BL_ORD_ID|280372675.075e-8675.40tr|G1SSQ9|G1SSQ9_RABIT Dynein axonemal light chain... [more]
back to top
BLAST of Dynein axonemal light chain 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
dnal17.558e-8473.77dynein axonemal light chain 1 [Source:NCBI gene;Ac... [more]
LRRC93.555e-935.00leucine-rich repeat-containing protein 9-like [Sou... [more]
LRRC94.003e-935.00leucine-rich repeat-containing protein 9-like [Sou... [more]
ppp1r72.480e-831.25protein phosphatase 1 regulatory subunit 7 [Source... [more]
back to top
BLAST of Dynein axonemal light chain 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000002931.11.489e-7670.11pep scaffold:Pmarinus_7.0:GL477629:181338:188018:1... [more]
LRRC91.430e-1032.24leucine rich repeat containing 9 [Source:HGNC Symb... [more]
LRRC91.814e-1032.24leucine rich repeat containing 9 [Source:HGNC Symb... [more]
LRRC92.128e-1032.24leucine rich repeat containing 9 [Source:HGNC Symb... [more]
lrrc61.829e-931.01leucine rich repeat containing 6 [Source:NCBI gene... [more]
back to top
BLAST of Dynein axonemal light chain 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Dynein axonemal light chain 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO467868.703e-8475.41Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO453591.427e-934.71Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO449371.280e-833.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO317715.249e-832.70Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO303471.038e-631.52Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Dynein axonemal light chain 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dnal13.389e-6163.44dynein axonemal light chain 1 [Source:NCBI gene;Ac... [more]
ppp1r78.044e-830.30protein phosphatase 1 regulatory subunit 7 [Source... [more]
ppp1r71.771e-729.63protein phosphatase 1 regulatory subunit 7 [Source... [more]
LRRC92.927e-735.63leucine-rich repeat-containing protein 9 [Source:N... [more]
nisch4.553e-631.03nischarin [Source:NCBI gene;Acc:101164628][more]
back to top
BLAST of Dynein axonemal light chain 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000053050.19.710e-12099.46SMESG000053050.1[more]
SMESG000058220.11.579e-629.46SMESG000058220.1[more]
SMESG000047633.12.949e-635.25SMESG000047633.1[more]
SMESG000023354.14.527e-631.40SMESG000023354.1[more]
SMESG000023354.15.069e-631.40SMESG000023354.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30009556 ID=SMED30009556|Name=Dynein axonemal light chain 1|organism=Schmidtea mediterranea sexual|type=transcript|length=640bp
CTTATCGAAATCTATATAAATCTGAGATGGCTAAAGCAACTACAATTAAG
GAAGCACTTGCGCAGTGGGAACAAAAAAATGGAATGAAAGCATCTGAAGC
ATTAGAAGTAAAGTTACACGGAGTTTATCCTCCGATAGAGAAAATGGATG
CCTCATTATCTACATTACATGCGTGCGAAAAATTGTCATTATCAACAAAT
TGCATTGAGAAAATTGCAAATCTGAATGGATTAAAAAATCTAAAAGTTTT
GTCGTTGGGAAGGAATAACATAAAAAATCTAAATGGATTGGAGGCAGTCG
GAGAAACTTTGGAGCAGTTATGGATATCATACAATATGATTGAGAAATTG
AAAGGTGTTAATGTGTTGAAGAAATTGAAAGTTTTGTATATATCAAACAA
TGTTGTGAAAGAATGGGTGGAATTCATGAAATTGGCAGACCTGCCTTGCC
TTGAGGATCTCGTGTTCACAGGGAATCCACTCGAAGACAGTGAGACCTGG
AGAGATGAAGCTTGTAAACGACTACCCAAGTTGAAAAAACTTGATGGAAT
TCCGGTCGTTCGCGATGAGGAAGAGTAATTCGATTTTTGATTGGTTGTCT
CTCGTGATAGGATTGATTAATATATAATTGCGAGATCGGA
back to top

protein sequence of SMED30009556-orf-1

>SMED30009556-orf-1 ID=SMED30009556-orf-1|Name=SMED30009556-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=192bp
YRNLYKSEMAKATTIKEALAQWEQKNGMKASEALEVKLHGVYPPIEKMDA
SLSTLHACEKLSLSTNCIEKIANLNGLKNLKVLSLGRNNIKNLNGLEAVG
ETLEQLWISYNMIEKLKGVNVLKKLKVLYISNNVVKEWVEFMKLADLPCL
EDLVFTGNPLEDSETWRDEACKRLPKLKKLDGIPVVRDEEE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0036158outer dynein arm assembly
GO:0008150biological_process
Vocabulary: molecular function
TermDefinition
GO:0043014alpha-tubulin binding
GO:0045504dynein heavy chain binding
GO:0005515protein binding
GO:0003674molecular_function
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000096ventral epidermis
PLANA:0000099neuron
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR025875Leu-rich_rpt_4
IPR032675LRR_dom_sf
IPR001611Leu-rich_rpt
Vocabulary: cellular component
TermDefinition
GO:0036157outer dynein arm
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableSMARTSM00365LRR_sd22_2coord: 46..67
e-value: 35.0
score: 11.2
coord: 91..112
e-value: 27.0
score: 12.0
coord: 113..134
e-value: 360.0
score: 2.9
coord: 68..89
e-value: 0.4
score: 19.7
NoneNo IPR availablePANTHERPTHR15454NISCHARIN RELATEDcoord: 1..182
NoneNo IPR availablePANTHERPTHR15454:SF33DYNEIN LIGHT CHAIN 1, AXONEMALcoord: 1..182
NoneNo IPR availableSUPERFAMILYSSF52058L domain-likecoord: 35..179
IPR032675Leucine-rich repeat domain superfamilyGENE3DG3DSA:3.80.10.10coord: 1..182
e-value: 1.5E-48
score: 166.2
IPR025875Leucine rich repeat 4PFAMPF12799LRR_4coord: 49..88
e-value: 1.7E-6
score: 28.2
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 93..114
score: 7.543
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 48..69
score: 7.319
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 115..136
score: 6.172
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 70..91
score: 7.912