SID1 transmembrane family member 1

Overview
NameSID1 transmembrane family member 1
Smed IDSMED30009553
Length (bp)2855
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SID1 transmembrane family member 1 (SMED30009553) t-SNE clustered cells

Violin plots show distribution of expression levels for SID1 transmembrane family member 1 (SMED30009553) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SID1 transmembrane family member 1 (SMED30009553) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SID1 transmembrane family member 1 (SMED30009553) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30009553

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymal cellSMED30009553SMESG000041572.1 dd_Smed_v4_8231_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
medial muscle cellSMED30009553SMESG000041572.1 dd_Smed_v4_8231_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30009553SMESG000041572.1 dd_Smed_v6_8231_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
glial cellSMED30009553SMESG000041572.1 dd_Smed_v6_8231_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of SID1 transmembrane family member 1 vs. Ensembl Human
Match: SIDT1 (SID1 transmembrane family member 1 [Source:HGNC Symbol;Acc:HGNC:25967])

HSP 1 Score: 204.912 bits (520), Expect = 2.959e-54
Identity = 157/565 (27.79%), Postives = 280/565 (49.56%), Query Frame = 1
Query:  334 NEAKNHNYSSNHSTSIEVSSKSLRKIAVKIQIKWIDNFLIKLNQNQSVSITIYTPVYYLFKFDSKKQTIVIHVQSKDE-ICMNLGIQNHVEPVQDDYRHIKPYYIHQTMSKETTLVIKKGKFISSNSILIIFMLNKMAEKCANFFSLSQKP---WPEMKHFNFHITEL----KTDYMLPIFLAIGFYLSFYVIACLA--------------------------MVGDHFIKSVSSENRFRILSDFSS------VNSHAGTTKKRCLTQNN---------PECE--------KKLIYLSDLTKTNPMHLEQEFFMYIWYLIVISIFNLPSAIQMIWNFYRNFITNGNQDICFYNFRCARPFFVFPAFNNMISNXXXXXXXXXXXXXTWKKHQRYNSWLNELNMSIFYYGLPKYFGLYYAMGFSLLMEGIMSALYHVCPNQRHMIFDQSYKYILVCIMMVQIYQFRHFDITASAHLFYISLAIFIFIGVIHQFF--QEIIFWSLFTVLYMFWTAILMCDIYYFDQFKINIMLPKQVYLVIKSKK-WKAFIPTYKYRMVIVVFALIIN 1848
            +EA N          ++V+S +      K+ +  + +F ++ N     + +   P Y+L+KF     +++I V S+    C  + +QN + PV D   +++   ++Q+M+K+  + ++K  F       ++F++      C   F + +K    W   +  N  +T +    ++ Y+     ++  +LSFY + CL                           MV  H I + + E       D SS      ++S  G    +  T ++         P+ E        K  +YLSDL++ +   + +++ +Y W +I I++F     IQ++  +       GNQDIC+YNF CA P  V  AFNN++SN+G++LLG LFLLI  ++   +   L   ++    YG+PK+FGL+YAMG +L+MEG++SA YHVCPN  +  FD S+ Y++  + M+++YQ RH DI ASA+  Y S A+ I + V+   F   ++ FW +F+ +++  +  L   IYY  +FKI++ + ++  +V  +    +   P Y  RMV++V   ++N
Sbjct:  132 SEATNETGPLQQLIFVDVASMAPLGAQYKLLVTKLKHFQLRTNVAFHFTASPSQPQYFLYKFPKDVDSVIIKVVSEMAYPCSVVSVQNIMCPVYDLDHNVEFNGVYQSMTKKAAITLQKKDF-PGEQFFVVFVIKPEDYACGGSFFIQEKENQTWNLQRKKNLEVTIVPSIKESVYVKSSLFSVFIFLSFY-LGCLLVGFVHYLRFQRKSIDGSFGSNDGSGNMVASHPIAASTPEGSNYGTIDESSSSPGRQMSSSDGGPPGQSDTDSSVEESDFDTMPDIESDKNIIRTKMFLYLSDLSRKDRRIVSKKYKIYFWNIITIAVFYALPVIQLVITYQTVVNVTGNQDICYYNFLCAHPLGVLSAFNNILSNLGHVLLGFLFLLIVLRRDILHRRALEAKDIFAVEYGIPKHFGLFYAMGIALMMEGVLSACYHVCPNYSNFQFDTSFMYMIAGLCMLKLYQTRHPDINASAYSAYASFAVVIMVTVLGVVFGKNDVWFWVIFSAIHVLASLALSTQIYYMGRFKIDLGIFRRAAMVFYTDCIQQCSRPLYMDRMVLLVVGNLVN 694          

HSP 2 Score: 84.3445 bits (207), Expect = 7.261e-16
Identity = 46/109 (42.20%), Postives = 68/109 (62.39%), Query Frame = 1
Query: 2479 SIYGILIKPEEXXXXXXXXXXXXXXXXXGYYIVMKAFYKETFNKTAIFYSIITISCWAVAVYCFIQPTSNWRKTPAVSREQNKKCIFLDFYDIHDISHFLFSIAIFFTF 2805
            +++G++ +P +F  + L     NLL+Y  +YI+MK    E      +F  + T   WA A+Y F Q  S+W  TPA SRE+N++CI LDF+D HDI HFL + A+FF+F
Sbjct:  698 ALFGLIYRPRDFASYMLGIFICNLLLYLAFYIIMKLRSSEKVLPVPLFCIVATAVMWAAALYFFFQNLSSWEGTPAESREKNRECILLDFFDDHDIWHFLSATALFFSF 806          
BLAST of SID1 transmembrane family member 1 vs. Ensembl Human
Match: SIDT2 (SID1 transmembrane family member 2 [Source:HGNC Symbol;Acc:HGNC:24272])

HSP 1 Score: 201.06 bits (510), Expect = 6.437e-53
Identity = 154/566 (27.21%), Postives = 284/566 (50.18%), Query Frame = 1
Query:  379 IEVSSKSLRKIAVKIQIKWIDNFLIKLNQNQSVSITIYTPVYYLFKFDSKKQTIVIHVQSKDEI-CMNLGIQNHVEPVQDDYRHIKPYYIHQTMSKETTLVIKKGKFISSNSILIIFMLNKMAEKCAN---FFSLSQKPWPEMKHFNFHITELKTD------YMLPIFLAIGFYLSFYVI----AC-----------LAMVGDHFIKSVSSENRFRILSD---------------FSSVNSH-------AGT---------TKKRCLTQNNPECE-----------------KKLIYLSDLTKTNPMHLEQEFFMYIWYLIVISIFNLPSAIQMIWNFYRNFITNGNQDICFYNFRCARPFFVFPAFNNMISNXXXXXXXXXXXXXTWKKHQRYNSWLNELNMSIFYYGLPKYFGLYYAMGFSLLMEGIMSALYHVCPNQRHMIFDQSYKYILVCIMMVQIYQFRHFDITASAHLFYISLAIFIFIGVIHQFFQE--IIFWSLFTVLYMFWTAILMCDIYYFDQFKINIMLPKQVYLVIKSKKWK-AFIPTYKYRMVIVVFALIIN 1848
            ++VS+ S      ++++  +D+F+++  +  S + T   P Y+ ++F     ++++ V S     C  + IQ+ + PV D   ++    ++QTM+K+  + +++  F  SNS  ++ ++    + C     F+  ++    +  H    ++ L +       Y+  +   +G +LSFY++    AC           L  +     +S S     R+L+D               F +V+         AGT         T+ R  + ++ E +                 K+ +Y++DL + +   L +++ +Y W +  I++F     +Q++  +       GNQDIC+YNF CA P     AFNN++SN+GYILLG+LFLLI  ++   +N  L   ++     G+PK+FGL+YAMG +L+MEG++SA YHVCPN  +  FD S+ Y++  + M+++YQ RH DI ASA+  Y  LAI IF  V+   F +    FW +F+++++  T +L   +YY  ++K++  + +++  V+ +   +    P Y  RMV++V   +IN
Sbjct:  132 VDVSTLSPVNTTYQLRVSRMDDFVLRTGEQFSFNTTAAQPQYFKYEFPEGVDSVIVKVTSNKAFPCSVISIQDVLCPVYDLDNNVAFIGMYQTMTKKAAITVQRKDF-PSNSFYVVVVVKTEDQACGGSLPFYPFAEDEPVDQGHRQKTLSVLVSQAVTSEAYVSGMLFCLGIFLSFYLLTVLLACWENWRQKKKTLLVAIDRACPESASLLGHPRVLADSFPGSSPYEGYNYGSFENVSGSTDGLVDSAGTGDLSYGYQGTRPRVDSMSSVEEDDYDTLTDIDSDKNVIRTKQYLYVADLARKDKRVLRKKYQIYFWNIATIAVFYALPVVQLVITYQTVVNVTGNQDICYYNFLCAHPLGNLSAFNNILSNLGYILLGLLFLLIILQREINHNRALLRNDLCALECGIPKHFGLFYAMGTALMMEGLLSACYHVCPNYTNFQFDTSFMYMIAGLCMLKLYQKRHPDINASAYSAYACLAIVIFFSVLGVVFGKGNTAFWIVFSIIHIIATLLLSTQLYYMGRWKLDSGIFRRILHVLYTDCIRQCSGPLYVDRMVLLVMGNVIN 696          

HSP 2 Score: 81.6481 bits (200), Expect = 4.466e-15
Identity = 47/109 (43.12%), Postives = 66/109 (60.55%), Query Frame = 1
Query: 2479 SIYGILIKPEEXXXXXXXXXXXXXXXXXGYYIVMKAFYKETFNKTAIFYSIITISCWAVAVYCFIQPTSNWRKTPAVSREQNKKCIFLDFYDIHDISHFLFSIAIFFTF 2805
            + YG++++P +F  + L     NLL+YF +YI+MK    E      +   + T   W  A++ F Q  S W+KTPA SRE N+ CI LDF+D HDI HFL SIA+F +F
Sbjct:  700 AAYGLIMRPNDFASYLLAIGICNLLLYFAFYIIMKLRSGERIKLIPLLCIVCTSVVWGFALFFFFQGLSTWQKTPAESREHNRDCILLDFFDDHDIWHFLSSIAMFGSF 808          
BLAST of SID1 transmembrane family member 1 vs. Ensembl Human
Match: SIDT1 (SID1 transmembrane family member 1 [Source:HGNC Symbol;Acc:HGNC:25967])

HSP 1 Score: 200.29 bits (508), Expect = 1.118e-52
Identity = 159/573 (27.75%), Postives = 277/573 (48.34%), Query Frame = 1
Query:  334 NEAKNHNYSSNHSTSIEVSSKSLRKIAVKIQIKWIDNFLIKLNQNQSVSITIYTPVYYLFKFDSKKQTIVIHVQSKDE-ICMNLGIQNHVEPVQDDYRHIKPYYIHQTMSKETTLVIKKGKFISSNSILIIFMLNKMAEKCANFFSLSQKP---WPEMKHFNFHITEL----KTDYMLPIFLAIGFYLSFYVIACLA--------------------------MVGDHFIKSVSSENRFRILSDFSS------VNSHAGTTKKRCLTQNN---------PECE--------KKLIYLSDLTKTNPMHLEQEFFMYIWYLIVISIFNLPSAIQMIWNFYRNFITNGNQDICFYNFRCARPFFVFPAFNNMISNXXXXXXXXXXXXXTWKKHQRYNSWLNELNMSIFYYGLPKYFGLYYAMGFSLLMEGIMSALYHVCPNQRHMIFDQSYKYILVCIMMVQIYQFRHFDITASAHLFYISLAIFIFIGVIHQFF--QEIIFWSLFTVLYMFWTAILMCDIYYFDQFKINIMLPKQVYLVIKSKKWKAFI---------PTYKYRMVIVVFALIIN 1848
            +EA N          ++V+S +      K+ +  + +F ++ N     + +   P Y+L+KF     +++I V S+    C  + +QN + PV D   +++   ++Q+M+K+  + ++K  F       ++F++      C   F + +K    W   +  N  +T +    ++ Y+     ++  +LSFY + CL                           MV  H I + + E       D SS      ++S  G    +  T ++         P+ E        K  +YLSDL++ +   + +++ +Y W +I I++F     IQ++  +       GNQDIC+YNF CA P  V  AFNN++SN+G++LLG LFLLI  ++   +   L   ++    YG+PK+FGL+YAMG +L+MEG++SA YHVCPN  +  FD S+ Y++  + M+++YQ RH DI ASA+  Y S A+ I + V+   F   ++ FW +F+ +++  +  L   IYY  +FKI++       L I  +    F          P Y  RMV++V   ++N
Sbjct:  132 SEATNETGPLQQLIFVDVASMAPLGAQYKLLVTKLKHFQLRTNVAFHFTASPSQPQYFLYKFPKDVDSVIIKVVSEMAYPCSVVSVQNIMCPVYDLDHNVEFNGVYQSMTKKAAITLQKKDF-PGEQFFVVFVIKPEDYACGGSFFIQEKENQTWNLQRKKNLEVTIVPSIKESVYVKSSLFSVFIFLSFY-LGCLLVGFVHYLRFQRKSIDGSFGSNDGSGNMVASHPIAASTPEGSNYGTIDESSSSPGRQMSSSDGGPPGQSDTDSSVEESDFDTMPDIESDKNIIRTKMFLYLSDLSRKDRRIVSKKYKIYFWNIITIAVFYALPVIQLVITYQTVVNVTGNQDICYYNFLCAHPLGVLSAFNNILSNLGHVLLGFLFLLIVLRRDILHRRALEAKDIFAVEYGIPKHFGLFYAMGIALMMEGVLSACYHVCPNYSNFQFDTSFMYMIAGLCMLKLYQTRHPDINASAYSAYASFAVVIMVTVLGVVFGKNDVWFWVIFSAIHVLASLALSTQIYYMGRFKIDV---SDTDLGIFRRAAMVFYTDCIQQCSRPLYMDRMVLLVVGNLVN 699          

HSP 2 Score: 84.3445 bits (207), Expect = 7.294e-16
Identity = 46/109 (42.20%), Postives = 68/109 (62.39%), Query Frame = 1
Query: 2479 SIYGILIKPEEXXXXXXXXXXXXXXXXXGYYIVMKAFYKETFNKTAIFYSIITISCWAVAVYCFIQPTSNWRKTPAVSREQNKKCIFLDFYDIHDISHFLFSIAIFFTF 2805
            +++G++ +P +F  + L     NLL+Y  +YI+MK    E      +F  + T   WA A+Y F Q  S+W  TPA SRE+N++CI LDF+D HDI HFL + A+FF+F
Sbjct:  703 ALFGLIYRPRDFASYMLGIFICNLLLYLAFYIIMKLRSSEKVLPVPLFCIVATAVMWAAALYFFFQNLSSWEGTPAESREKNRECILLDFFDDHDIWHFLSATALFFSF 811          
BLAST of SID1 transmembrane family member 1 vs. Ensembl Human
Match: SIDT2 (SID1 transmembrane family member 2 [Source:HGNC Symbol;Acc:HGNC:24272])

HSP 1 Score: 172.17 bits (435), Expect = 1.783e-43
Identity = 114/322 (35.40%), Postives = 186/322 (57.76%), Query Frame = 1
Query:  892 CLAMVGDHFIKSVSSENRFRILSDFSSVNSHAGTTKKRCLTQNNPECEKKLIYLSDLTKTNPMHLEQEFFMYIWYLIVISIFNLPSAIQMIWNFYRNFITNGNQDICFYNFRCARPFFVFPAFNNMISNXXXXXXXXXXXXXTWKKHQRYNSWLNELNMSIFYYGLPKYFGLYYAMGFSLLMEGIMSALYHVCPNQRHMIFDQSYKYILVCIMMVQIYQFRHFDITASAHLFYISLAIFIFIGVIHQFFQE--IIFWSLFTVLYMFWTAILMCDIYYFDQFKINIMLPKQVYLVIKSKKWK-AFIPTYKYRMVIVVFALIIN 1848
            C+AM G  F + V +  R   +   SSV      T     +  N    K+ +Y++DL + +   L +++ +Y W +  I++F     +Q++  +       GNQDIC+YNF CA P     AFNN++SN+GYILLG+LFLLI  ++   +N  L   ++     G+PK+FGL+YAMG +L+MEG++SA YHVCPN  +  FD S+ Y++  + M+++YQ RH DI ASA+  Y  LAI IF  V+   F +    FW +F+++++  T +L   +YY  ++K++  + +++  V+ +   +    P Y  RMV++V   +IN
Sbjct:  404 CIAM-GRSF-EPVGTRPR---VDSMSSVEEDDYDTLTDIDSDKNVIRTKQYLYVADLARKDKRVLRKKYQIYFWNIATIAVFYALPVVQLVITYQTVVNVTGNQDICYYNFLCAHPLGNLSAFNNILSNLGYILLGLLFLLIILQREINHNRALLRNDLCALECGIPKHFGLFYAMGTALMMEGLLSACYHVCPNYTNFQFDTSFMYMIAGLCMLKLYQKRHPDINASAYSAYACLAIVIFFSVLGVVFGKGNTAFWIVFSIIHIIATLLLSTQLYYMGRWKLDSGIFRRILHVLYTDCIRQCSGPLYVDRMVLLVMGNVIN 720          

HSP 2 Score: 83.1889 bits (204), Expect = 1.634e-15
Identity = 48/110 (43.64%), Postives = 67/110 (60.91%), Query Frame = 1
Query: 2479 SIYGILIKPEEXXXXXXXXXXXXXXXXXGYYIVMKAFYKETFNKTAIFYSIITISCWAVAVYCFIQPTSNWRKTPAVSREQNKKCIFLDFYDIHDISHFLFSIAIFFTFL 2808
            + YG++++P +F  + L     NLL+YF +YI+MK    E      +   + T   W  A++ F Q  S W+KTPA SRE N+ CI LDF+D HDI HFL SIA+F +FL
Sbjct:  724 AAYGLIMRPNDFASYLLAIGICNLLLYFAFYIIMKLRSGERIKLIPLLCIVCTSVVWGFALFFFFQGLSTWQKTPAESREHNRDCILLDFFDDHDIWHFLSSIAMFGSFL 833          

HSP 3 Score: 56.6102 bits (135), Expect = 2.137e-7
Identity = 37/183 (20.22%), Postives = 89/183 (48.63%), Query Frame = 1
Query:  379 IEVSSKSLRKIAVKIQIKWIDNFLIKLNQNQSVSITIYTPVYYLFKFDSKKQTIVIHVQSKDEI-CMNLGIQNHVEPVQDDYRHIKPYYIHQTMSKETTLVIKKGKFISSNSILIIFMLNKMAEKCAN---FFSLSQKPWPEMKHFNFHITELKTD------YMLPIFLAIGFYLSFYVIACL 897
            ++VS+ S      ++++  +D+F+++  +  S + T   P Y+ ++F     ++++ V S     C  + IQ+ + PV D   ++    ++QTM+K+  + +++  F  SNS  ++ ++    + C     F+  ++    +  H    ++ L +       Y+  +   +G +LSFY++  L
Sbjct:  132 VDVSTLSPVNTTYQLRVSRMDDFVLRTGEQFSFNTTAAQPQYFKYEFPEGVDSVIVKVTSNKAFPCSVISIQDVLCPVYDLDNNVAFIGMYQTMTKKAAITVQRKDF-PSNSFYVVVVVKTEDQACGGSLPFYPFAEDEPVDQGHRQKTLSVLVSQAVTSEAYVSGMLFCLGIFLSFYLLTVL 313          
BLAST of SID1 transmembrane family member 1 vs. Ensembl Human
Match: SIDT2 (SID1 transmembrane family member 2 [Source:HGNC Symbol;Acc:HGNC:24272])

HSP 1 Score: 172.17 bits (435), Expect = 1.783e-43
Identity = 114/322 (35.40%), Postives = 186/322 (57.76%), Query Frame = 1
Query:  892 CLAMVGDHFIKSVSSENRFRILSDFSSVNSHAGTTKKRCLTQNNPECEKKLIYLSDLTKTNPMHLEQEFFMYIWYLIVISIFNLPSAIQMIWNFYRNFITNGNQDICFYNFRCARPFFVFPAFNNMISNXXXXXXXXXXXXXTWKKHQRYNSWLNELNMSIFYYGLPKYFGLYYAMGFSLLMEGIMSALYHVCPNQRHMIFDQSYKYILVCIMMVQIYQFRHFDITASAHLFYISLAIFIFIGVIHQFFQE--IIFWSLFTVLYMFWTAILMCDIYYFDQFKINIMLPKQVYLVIKSKKWK-AFIPTYKYRMVIVVFALIIN 1848
            C+AM G  F + V +  R   +   SSV      T     +  N    K+ +Y++DL + +   L +++ +Y W +  I++F     +Q++  +       GNQDIC+YNF CA P     AFNN++SN+GYILLG+LFLLI  ++   +N  L   ++     G+PK+FGL+YAMG +L+MEG++SA YHVCPN  +  FD S+ Y++  + M+++YQ RH DI ASA+  Y  LAI IF  V+   F +    FW +F+++++  T +L   +YY  ++K++  + +++  V+ +   +    P Y  RMV++V   +IN
Sbjct:  404 CIAM-GRSF-EPVGTRPR---VDSMSSVEEDDYDTLTDIDSDKNVIRTKQYLYVADLARKDKRVLRKKYQIYFWNIATIAVFYALPVVQLVITYQTVVNVTGNQDICYYNFLCAHPLGNLSAFNNILSNLGYILLGLLFLLIILQREINHNRALLRNDLCALECGIPKHFGLFYAMGTALMMEGLLSACYHVCPNYTNFQFDTSFMYMIAGLCMLKLYQKRHPDINASAYSAYACLAIVIFFSVLGVVFGKGNTAFWIVFSIIHIIATLLLSTQLYYMGRWKLDSGIFRRILHVLYTDCIRQCSGPLYVDRMVLLVMGNVIN 720          

HSP 2 Score: 83.1889 bits (204), Expect = 1.634e-15
Identity = 48/110 (43.64%), Postives = 67/110 (60.91%), Query Frame = 1
Query: 2479 SIYGILIKPEEXXXXXXXXXXXXXXXXXGYYIVMKAFYKETFNKTAIFYSIITISCWAVAVYCFIQPTSNWRKTPAVSREQNKKCIFLDFYDIHDISHFLFSIAIFFTFL 2808
            + YG++++P +F  + L     NLL+YF +YI+MK    E      +   + T   W  A++ F Q  S W+KTPA SRE N+ CI LDF+D HDI HFL SIA+F +FL
Sbjct:  724 AAYGLIMRPNDFASYLLAIGICNLLLYFAFYIIMKLRSGERIKLIPLLCIVCTSVVWGFALFFFFQGLSTWQKTPAESREHNRDCILLDFFDDHDIWHFLSSIAMFGSFL 833          

HSP 3 Score: 56.6102 bits (135), Expect = 2.137e-7
Identity = 37/183 (20.22%), Postives = 89/183 (48.63%), Query Frame = 1
Query:  379 IEVSSKSLRKIAVKIQIKWIDNFLIKLNQNQSVSITIYTPVYYLFKFDSKKQTIVIHVQSKDEI-CMNLGIQNHVEPVQDDYRHIKPYYIHQTMSKETTLVIKKGKFISSNSILIIFMLNKMAEKCAN---FFSLSQKPWPEMKHFNFHITELKTD------YMLPIFLAIGFYLSFYVIACL 897
            ++VS+ S      ++++  +D+F+++  +  S + T   P Y+ ++F     ++++ V S     C  + IQ+ + PV D   ++    ++QTM+K+  + +++  F  SNS  ++ ++    + C     F+  ++    +  H    ++ L +       Y+  +   +G +LSFY++  L
Sbjct:  132 VDVSTLSPVNTTYQLRVSRMDDFVLRTGEQFSFNTTAAQPQYFKYEFPEGVDSVIVKVTSNKAFPCSVISIQDVLCPVYDLDNNVAFIGMYQTMTKKAAITVQRKDF-PSNSFYVVVVVKTEDQACGGSLPFYPFAEDEPVDQGHRQKTLSVLVSQAVTSEAYVSGMLFCLGIFLSFYLLTVL 313          
BLAST of SID1 transmembrane family member 1 vs. Ensembl Celegans
Match: chup-1 (CHolesterol UPtake associated [Source:UniProtKB/TrEMBL;Acc:H2L0H7])

HSP 1 Score: 178.333 bits (451), Expect = 4.090e-46
Identity = 145/590 (24.58%), Postives = 282/590 (47.80%), Query Frame = 1
Query:  190 RVYIECDLKPHESISIIIKQDNSYLLSMEL-FQINNEVPVKAARTIHLFNEAKNHNYSSNHSTSIEVSSKSLRKIAVKIQIKWIDNFLIKLNQNQSVSITIYTPVYYLFKFDSKKQTIVIHVQSKDEICMNLGIQNHVEPVQDDYRHIKPYYIHQTMSKETTLVIKKGKFISSNSILIIFMLNKMAEKCANFFSLS-QKP--WP-EMKHFNFHI-TELKT-DYMLPIFLAIGFYLSFYVIACLAMVGDHFIKSV----------------SSENRFRILSDFSSVNSHAGTTKKRCLTQNNPECE-------KKLIYLSDLTKTNPMHLEQEFFMYIWYLIVISIFNLPSAIQMIWNFYRNFITNGNQDICFYNFRCARPFFVFPAFNNMISNXXXXXXXXXXXXXTWKKHQRYNSWLNELNMSIFYYGLPKYFGLYYAMGFSLLMEGIMSALYHVCPNQRHMIFDQSYKYILVCIMMVQIYQFRHFDITASAHLFYISLAIFIFIGVIHQFFQEIIFWSLFTVLYMFWTAILMCDIYYFDQFKINIM-LPKQVYLV-IKSKKWKAFIPTYKYRMVIVVFALIINGTMKI 1863
            R+ + C+     +  + + ++   +LS+++   ++N    + ART+  F E     Y    + ++EV+S   R +    + + + NF +  N  + V+ +   PVY  +       ++ +H+ S   ICM + +Q    PV D   ++    +HQTM+   T+ ++K +    +S  ++F++N   + C+   S+   KP  +P  MK FN  I + +K  DY +PI     F+    ++  + +   H+   +                + E R R   DF  ++          LT     C+       K  + ++DL+ T     E ++ +Y   L +I IF   + +Q+I +   +   +G+ D C +NF+CARP + F AFNN++SN GY+  G L +++ + + + +             YGLP++ GL  A+G +++MEGI SA YHVCPN  +  FD +  Y++  +  ++I+  RH D+  SA+  +  L +F+   +   +   +IFW+LF+++Y+    ++  + Y+   + +N+  L   + L  + S+     +P YK R  +++   I N  + +
Sbjct:   57 RIIMSCNESTEHNPLLAVFREKLAILSLQVPLIVDNYEYSQVARTLCPFTE-----YKEGEAFTVEVTSS--RPVHYNFRAELVQNFYLYNNSQRLVTASASEPVYLRYDIPGDVDSVAVHLDSNSTICMTVSVQKIGCPVFDLPDNVNSMGLHQTMTTSATIPVEKSRM---SSFYVVFVVNTNDDLCSEILSIKPNKPTKFPLRMKSFNVTIESSMKIFDYTIPIV----FWACILLLVTIVVFVYHYFDGIWERRFVSRAYTHLEDNAQEQRIRDFYDFQRMSEDDDLKDYDLLTD----CQDMMVVRAKASLTVADLSMTPYEERELKYDVYKIALAIIGIFYNITVLQLIISKAGSLRQSGDLDECTFNFQCARPLWYFVAFNNVVSNGGYVYFGTLIIVMNYCRERSFRRLFAVQPTLAERYGLPQHSGLMTAIGLAVIMEGISSATYHVCPNNINYQFDTALMYVIGMLGKLKIWSLRHPDMVVSAYHAFGFLGVFLMAAIAGVYVHNMIFWALFSIIYIASMLLVSLEFYFKGIWTLNLRELRNSIRLSWVSSRHLSCVVPAYKARFFVILLLNIANTAVVV 628          

HSP 2 Score: 82.4185 bits (202), Expect = 1.007e-15
Identity = 41/90 (45.56%), Postives = 53/90 (58.89%), Query Frame = 1
Query: 2566 YYIVMKAFYKETFNKTAIFYSIITISCWAVAVYCFIQPTSNWRKTPAVSREQNKKCIFLDFYDIHDISHFLFSIAIFFTFLTLQNMDNCL 2835
            YYI+MK  Y+E   K AI      +  W  A   F Q  S+W K PA+SRE NK CIFL+FYD HD+ H   + AIFF+F  +  +D+ L
Sbjct:  656 YYILMKMIYREKIPKRAIALLFAAVISWTCAGILFNQRVSDWSKMPAISRELNKPCIFLNFYDNHDLWHLSSAFAIFFSFTAINVIDDDL 745          
BLAST of SID1 transmembrane family member 1 vs. Ensembl Celegans
Match: chup-1 (CHolesterol UPtake associated [Source:UniProtKB/TrEMBL;Acc:H2L0H7])

HSP 1 Score: 135.961 bits (341), Expect = 2.007e-33
Identity = 117/462 (25.32%), Postives = 218/462 (47.19%), Query Frame = 1
Query:  181 AALRVYIECDLKPHESISIIIKQDNSYLLSMEL-FQINNEVPVKAARTIHLFNEAKNHNYSSNHSTSIEVSSKSLRKIAVKIQIKWIDNFLIKLNQNQSVSITIYTPVYYLFKFDSKKQTIVIHVQSKDEICMNLGIQNHVEPVQDDYRHIKPYYIHQTMSKETTLVIKKGKFISSNSILIIFMLNKMAEKCANFFSLS-QKP--WP-EMKHFNFHI-TELKT-DYMLPIFLAIGFYLSFYVIACLAMVGDHFIKSV----------------SSENRFRILSDFSSVNSHAGTTKKRCLTQNNPECE-------KKLIYLSDLTKTNPMHLEQEFFMYIWYLIVISIFNLPSAIQMIWNFYRNFITNGNQDICFYNFRCARPFFVFPAFNNMISNXXXXXXXXXXXXXTWKKHQRYNSWLNELNMSIFYYGLPKYFGLYYAMGFSLLMEGIMSALYHVCPN 1476
            +  R+ + C+     +  + + ++   +LS+++   ++N    + ART+  F E     Y    + ++EV+S   R +    + + + NF +  N  + V+ +   PVY  +       ++ +H+ S   ICM + +Q    PV D   ++    +HQTM+   T+ ++K +    +S  ++F++N   + C+   S+   KP  +P  MK FN  I + +K  DY +PI     F+    ++  + +   H+   +                + E R R   DF  ++          LT     C+       K  + ++DL+ T     E ++ +Y   L +I IF   + +Q+I +   +   +G+ D C +NF+CARP + F AFNN++SN GY+  G L +++ + + + +             YGLP++ GL  A+G +++MEGI SA YHVCPN
Sbjct:   54 SVARIIMSCNESTEHNPLLAVFREKLAILSLQVPLIVDNYEYSQVARTLCPFTE-----YKEGEAFTVEVTSS--RPVHYNFRAELVQNFYLYNNSQRLVTASASEPVYLRYDIPGDVDSVAVHLDSNSTICMTVSVQKIGCPVFDLPDNVNSMGLHQTMTTSATIPVEKSRM---SSFYVVFVVNTNDDLCSEILSIKPNKPTKFPLRMKSFNVTIESSMKIFDYTIPIV----FWACILLLVTIVVFVYHYFDGIWERRFVSRAYTHLEDNAQEQRIRDFYDFQRMSEDDDLKDYDLLTD----CQDMMVVRAKASLTVADLSMTPYEERELKYDVYKIALAIIGIFYNITVLQLIISKAGSLRQSGDLDECTFNFQCARPLWYFVAFNNVVSNGGYVYFGTLIIVMNYCRERSFRRLFAVQPTLAERYGLPQHSGLMTAIGLAVIMEGISSATYHVCPN 497          
BLAST of SID1 transmembrane family member 1 vs. Ensembl Celegans
Match: chup-1 (CHolesterol UPtake associated [Source:UniProtKB/TrEMBL;Acc:H2L0H7])

HSP 1 Score: 135.961 bits (341), Expect = 2.549e-33
Identity = 117/462 (25.32%), Postives = 218/462 (47.19%), Query Frame = 1
Query:  181 AALRVYIECDLKPHESISIIIKQDNSYLLSMEL-FQINNEVPVKAARTIHLFNEAKNHNYSSNHSTSIEVSSKSLRKIAVKIQIKWIDNFLIKLNQNQSVSITIYTPVYYLFKFDSKKQTIVIHVQSKDEICMNLGIQNHVEPVQDDYRHIKPYYIHQTMSKETTLVIKKGKFISSNSILIIFMLNKMAEKCANFFSLS-QKP--WP-EMKHFNFHI-TELKT-DYMLPIFLAIGFYLSFYVIACLAMVGDHFIKSV----------------SSENRFRILSDFSSVNSHAGTTKKRCLTQNNPECE-------KKLIYLSDLTKTNPMHLEQEFFMYIWYLIVISIFNLPSAIQMIWNFYRNFITNGNQDICFYNFRCARPFFVFPAFNNMISNXXXXXXXXXXXXXTWKKHQRYNSWLNELNMSIFYYGLPKYFGLYYAMGFSLLMEGIMSALYHVCPN 1476
            +  R+ + C+     +  + + ++   +LS+++   ++N    + ART+  F E     Y    + ++EV+S   R +    + + + NF +  N  + V+ +   PVY  +       ++ +H+ S   ICM + +Q    PV D   ++    +HQTM+   T+ ++K +    +S  ++F++N   + C+   S+   KP  +P  MK FN  I + +K  DY +PI     F+    ++  + +   H+   +                + E R R   DF  ++          LT     C+       K  + ++DL+ T     E ++ +Y   L +I IF   + +Q+I +   +   +G+ D C +NF+CARP + F AFNN++SN GY+  G L +++ + + + +             YGLP++ GL  A+G +++MEGI SA YHVCPN
Sbjct:   54 SVARIIMSCNESTEHNPLLAVFREKLAILSLQVPLIVDNYEYSQVARTLCPFTE-----YKEGEAFTVEVTSS--RPVHYNFRAELVQNFYLYNNSQRLVTASASEPVYLRYDIPGDVDSVAVHLDSNSTICMTVSVQKIGCPVFDLPDNVNSMGLHQTMTTSATIPVEKSRM---SSFYVVFVVNTNDDLCSEILSIKPNKPTKFPLRMKSFNVTIESSMKIFDYTIPIV----FWACILLLVTIVVFVYHYFDGIWERRFVSRAYTHLEDNAQEQRIRDFYDFQRMSEDDDLKDYDLLTD----CQDMMVVRAKASLTVADLSMTPYEERELKYDVYKIALAIIGIFYNITVLQLIISKAGSLRQSGDLDECTFNFQCARPLWYFVAFNNVVSNGGYVYFGTLIIVMNYCRERSFRRLFAVQPTLAERYGLPQHSGLMTAIGLAVIMEGISSATYHVCPN 497          
BLAST of SID1 transmembrane family member 1 vs. Ensembl Celegans
Match: sid-1 (Systemic RNA interference defective protein 1 [Source:UniProtKB/Swiss-Prot;Acc:Q9GZC8])

HSP 1 Score: 63.5438 bits (153), Expect = 5.654e-10
Identity = 31/92 (33.70%), Postives = 49/92 (53.26%), Query Frame = 1
Query: 2566 YYIVMKAFYKETFNKTAIFYSIITISCWAVAVYCFIQPTSNWRKTPAVSREQNKKCIFLDFYDIHDISHFLFSIAIFFTFLTLQNMDNCLEN 2841
            YY  MK  + E     A     +++  WAVA + F Q  ++W ++ A SR  NK C+ L F+  HD+ H   ++A  FTF+ +  +D+ L N
Sbjct:  676 YYGCMKVLHSERITSKAKLCGALSLLAWAVAGFFFFQDDTDWTRSAAASRALNKPCLLLGFFGSHDLWHIFGALAGLFTFIFVSFVDDDLIN 767          
BLAST of SID1 transmembrane family member 1 vs. Ensembl Celegans
Match: sid-1 (Systemic RNA interference defective protein 1 [Source:UniProtKB/Swiss-Prot;Acc:Q9GZC8])

HSP 1 Score: 63.5438 bits (153), Expect = 5.654e-10
Identity = 31/92 (33.70%), Postives = 49/92 (53.26%), Query Frame = 1
Query: 2566 YYIVMKAFYKETFNKTAIFYSIITISCWAVAVYCFIQPTSNWRKTPAVSREQNKKCIFLDFYDIHDISHFLFSIAIFFTFLTLQNMDNCLEN 2841
            YY  MK  + E     A     +++  WAVA + F Q  ++W ++ A SR  NK C+ L F+  HD+ H   ++A  FTF+ +  +D+ L N
Sbjct:  676 YYGCMKVLHSERITSKAKLCGALSLLAWAVAGFFFFQDDTDWTRSAAASRALNKPCLLLGFFGSHDLWHIFGALAGLFTFIFVSFVDDDLIN 767          
BLAST of SID1 transmembrane family member 1 vs. Ensembl Zebrafish
Match: sidt2 (SID1 transmembrane family, member 2 [Source:ZFIN;Acc:ZDB-GENE-030131-7356])

HSP 1 Score: 174.866 bits (442), Expect = 1.744e-44
Identity = 112/312 (35.90%), Postives = 182/312 (58.33%), Query Frame = 1
Query:  922 KSVSSENRFRILSDFSSVNSHAGTTKKRCLTQNNPECEKKLIYLSDLTKTNPMHLEQEFFMYIWYLIVISIFNLPSAIQMIWNFYRNFITNGNQDICFYNFRCARPFFVFPAFNNMISNXXXXXXXXXXXXXTWKKHQRYNSWLNELNMSIFYYGLPKYFGLYYAMGFSLLMEGIMSALYHVCPNQRHMIFDQSYKYILVCIMMVQIYQFRHFDITASAHLFYISLAIFIFIGVIHQFFQE--IIFWSLFTVLYMFWTAILMCDIYYFDQFKINI-MLPKQVYLVIKSKKWKAFIPTYKYRMVIVVFALIIN 1848
            +S+ S +R R  S  SSV      T     +  N    KK + +SDL + +   L +++ +Y W +  I++F     IQ++  +       GNQDIC+YNF CA P     +FNN++SN+GY+LLG+LFLLI  ++   +N  L   + +    G+PK+FGLYYAMG +L+MEG++SA YHVCPN  +  FD S+ Y++  + M+++YQ RH DI ASA+  Y  LA  IF  V+   F +  + FW +F+V+++  T +L   +YY  +++++  ++ + +Y++      +   P Y  RMV++V   I+N
Sbjct:  402 RSLESISRSRQES-LSSVEEDDYDTLADIDSDKNIVRTKKFLCVSDLARKDKRILSKKYQIYFWNIATIAVFYALPVIQLVITYQTVVNVTGNQDICYYNFLCAHPLGALSSFNNILSNLGYVLLGLLFLLIVLQRDILHNRALERNDNTALECGIPKHFGLYYAMGTALMMEGLLSACYHVCPNYTNFQFDTSFMYMIAGLCMLKLYQKRHPDINASAYSAYACLAAVIFFSVLGVVFGKGNMAFWIVFSVIHILATMLLSTQLYYMGRWRLDSGIMRRMLYVIYTDCIRQCSGPMYIDRMVLLVMGNIVN 712          

HSP 2 Score: 87.8113 bits (216), Expect = 3.330e-17
Identity = 52/125 (41.60%), Postives = 76/125 (60.80%), Query Frame = 1
Query: 2479 SIYGILIKPEEXXXXXXXXXXXXXXXXXGYYIVMKAFYKETFNKTAIFYSIITISCWAVAVYCFIQPTSNWRKTPAVSREQNKKCIFLDFYDIHDISHFLFSIAIFFTFLTLQNMDNCLENQEMN 2853
            + YG++ +P +F  + L     NLL+YF +YI+MK    E     A+   + T   W  A++ F Q  S W+KTPA SRE N++CI L F+D HDI HFL SIA+F +FL L  MD+ L++ + +
Sbjct:  716 AAYGLINRPNDFASYLLAIAICNLLLYFAFYIIMKLRSGERIQCLALVCVLFTAVVWGFALFFFFQGLSTWQKTPAESREHNRECILLSFFDDHDIWHFLSSIAMFGSFLVLLTMDDDLDSVQRD 840          
BLAST of SID1 transmembrane family member 1 vs. Ensembl Xenopus
Match: SIDT2 (SID1 transmembrane family member 2 [Source:NCBI gene;Acc:100492598])

HSP 1 Score: 194.126 bits (492), Expect = 3.084e-51
Identity = 147/529 (27.79%), Postives = 272/529 (51.42%), Query Frame = 1
Query:  358 SSNHSTSIEVSSKSLRKIAVKIQIKWIDNFLIKLNQNQSVSITIYTPVYYLFKFDSKKQTIVIHVQSKDEI-CMNLGIQNHVEPVQDDYRHIKPYYIHQTMSKETTLVIKKGKFISSNSILIIFMLNKMAEKCANFFSLSQKPWPEMKHFNF----HI--TELKTDYMLPIFLAIGFYLSFYVIACL------------------AMVGDHFIKSVSSENRFRILSDFSSVNSHAGTTKKRCLTQNNPECEKKLIYLSDLTKTNPMHLEQEFFMYIWYLIVISIFNLPSAIQMIWNFYRNFITNGNQDICFYNFRCARPFFVFPAFNNMISNXXXXXXXXXXXXXTWKKHQRYNSWLNELNMSIFYYGLPKYFGLYYAMGFSLLMEGIMSALYHVCPNQRHMIFDQSYKYILVCIMMVQIYQFRHFDITASAHLFYISLAIFIFIGVIHQFF--QEIIFWSLFTVLYMFWTAILMCDIYYFDQFKINIMLPKQVYLVIKSKKWK-AFIPTYKYRMVIVVFALIINGTMK 1860
            +   S  ++VS+ + +    ++++  ++NF+++ N   + + T   P Y+ + F    +++++ V S     C  + +Q+   PV D   ++    ++QTM+K+  + ++           + F        C   F  S  P+ ++ +  F    H+    L   Y+  +   +G +LSFY++A L                    + D  ++++ S NR   L   SSV      T     +  N    KK + +SDL + +   + +++ +Y W +  I++F     IQ++  +       GNQDIC+YNF CA P     AFNN++SN+GY++LG+LFL+I  ++   +N     +   +   G+PK+FGL+YAMG +L+MEG++SA YHVCPN  +  FD S+ Y++  + M+++YQ RH DI ASA+  Y  LAI IF  V+   F     IFW +F+V+++ +T +L   +YY  +++++  + ++++ V+ +   +    P Y  RMV++V   I+N ++ 
Sbjct:   69 AETESFYVDVSTLAEKNTTYRLRVTHVENFVLQTNGPFNFNATPAQPQYFKYLFPEGVESVIVKVSSSSVFPCSVISVQDIQCPVYDLDNNVAFIGMYQTMTKKAAITVQ-----------VTFAHLSCYPNCILSFYSSYTPFTQINYLKFISHTHLFCNFLGNVYVAGMLFCLGVFLSFYLVALLISLFPQCYLPLIDFNKTSGFLIDRSLENLVSRNR---LESLSSVEEDDYDTLTDIESDKNVIRTKKFLCVSDLARKDKRVMRKKYQIYFWNISTIAVFYALPVIQLVITYQTVVNVTGNQDICYYNFLCAHPLGSLSAFNNILSNLGYVMLGLLFLVIVLQRELSHNHNRMNIRGQLQECGIPKHFGLFYAMGTALMMEGLLSACYHVCPNYTNFQFDTSFMYMIAGLCMLKLYQKRHPDINASAYSAYACLAIVIFFSVVGVVFGNGNTIFWVVFSVIHILFTLLLSTQLYYMGRWRLDSAILRRIFHVLYTDCVRQCSPPMYVDRMVLLVMGNIVNWSLA 583          

HSP 2 Score: 80.1073 bits (196), Expect = 1.029e-14
Identity = 47/110 (42.73%), Postives = 66/110 (60.00%), Query Frame = 1
Query: 2479 SIYGILIKPEEXXXXXXXXXXXXXXXXXGYYIVMKAFYKETFNKTAIFYSIITISCWAVAVYCFIQPTSNWRKTPAVSREQNKKCIFLDFYDIHDISHFLFSIAIFFTFL 2808
            + YG++++P++F  + L     NLL+YF +YI+MK    E      +     T   W  A++ F Q  S W+KTPA SRE N+ CI L F+D HDI HFL SIA+F +FL
Sbjct:  583 AAYGLIVRPKDFASYLLAIGICNLLLYFAFYIIMKLRSGERILPIPLLCITCTSVVWGFALFFFFQGLSTWQKTPAESREHNRNCILLGFFDDHDIWHFLSSIAMFGSFL 692          
BLAST of SID1 transmembrane family member 1 vs. Ensembl Xenopus
Match: SIDT2 (SID1 transmembrane family member 2 [Source:NCBI gene;Acc:100492598])

HSP 1 Score: 184.496 bits (467), Expect = 4.600e-48
Identity = 150/517 (29.01%), Postives = 263/517 (50.87%), Query Frame = 1
Query:  358 SSNHSTSIEVSSKSLRKIAVKIQIKWIDNFLIKLNQNQSVSITIYTPVYYLFKFDSKKQTIVIHVQSKDEI-CMNLGIQNHVEPVQDDYRHIKPYYIHQTMSKETTLVIKKGKFISSNSILIIFMLNKMAEKCAN---FFSLSQKPWPEMKHFNFHITEL---KTDYMLPIFLAIGFYLSFYVIA-C-LAMVG---------DHFIKSVSSENRFRILSDFSSVNSHAGTTKKRCLTQNNPECEKKLIYLSDLTKTNPMHLEQEFFMYIWYLIVISIFNLPSAIQMIWNFYRNFITNGNQDICFYNFRCARPFFVFPAFNNMISNXXXXXXXXXXXXXTWKKHQRYNSWLNELNMSIFYYGLPKYFGLYYAMGFSLLMEGIMSALYHVCPNQRHMIFDQSYKYILVCIMMVQIYQFRHFDITASAHLFYISLAIFIFIGVIHQFF--QEIIFWSLFTVLYMFWTAILMCDIYYFDQFKINIMLPKQVYLVIKSKKWKAFIPTYKYRMVIVVFALIIN 1848
            +   S  ++VS+ + +    ++++  ++NF+++ N   + + T   P Y+ + F    +++++ V S     C  + +Q+   PV D   ++    ++QTM+K+  + +++  F SS    ++ ++    E C      F L Q     + +  F +  +   K    L IF    F L   V   C L ++          D  ++++ S NR   L   SSV      T     +  N    KK + +SDL + +   + +++ +Y W +  I++F     IQ++  +       GNQDIC+YNF CA P     AFNN++SN+GY++LG+LFL+I  ++   +N     +   +   G+PK+FGL+YAMG +L+MEG++SA YHVCPN  +  FD S+ Y++  + M+++YQ RH DI ASA+  Y  LAI IF  V+   F     IFW +F+V+++ +T +L   +YY     I   L +  +++      +   P Y  RMV++V   I+N
Sbjct:   69 AETESFYVDVSTLAEKNTTYRLRVTHVENFVLQTNGPFNFNATPAQPQYFKYLFPEGVESVIVKVSSSSVFPCSVISVQDIQCPVYDLDNNVAFIGMYQTMTKKAAITVQRKDF-SSGGFYVVVVVKTEDEACGGALPLFPLHQGTCNFVFYCPFLVNYVLLQKCVNTLCIFKMACFLLDPPVFPQCYLPLIDFNKTSGFLIDRSLENLVSRNR---LESLSSVEEDDYDTLTDIESDKNVIRTKKFLCVSDLARKDKRVMRKKYQIYFWNISTIAVFYALPVIQLVITYQTVVNVTGNQDICYYNFLCAHPLGSLSAFNNILSNLGYVMLGLLFLVIVLQRELSHNHNRMNIRGQLQECGIPKHFGLFYAMGTALMMEGLLSACYHVCPNYTNFQFDTSFMYMIAGLCMLKLYQKRHPDINASAYSAYACLAIVIFFSVVGVVFGNGNTIFWVVFSVIHILFTLLLSTQLYYMGHSAI---LRRIFHVLYTDCVRQCSPPMYVDRMVLLVMGNIVN 578          

HSP 2 Score: 79.337 bits (194), Expect = 1.606e-14
Identity = 47/110 (42.73%), Postives = 66/110 (60.00%), Query Frame = 1
Query: 2479 SIYGILIKPEEXXXXXXXXXXXXXXXXXGYYIVMKAFYKETFNKTAIFYSIITISCWAVAVYCFIQPTSNWRKTPAVSREQNKKCIFLDFYDIHDISHFLFSIAIFFTFL 2808
            + YG++++P++F  + L     NLL+YF +YI+MK    E      +     T   W  A++ F Q  S W+KTPA SRE N+ CI L F+D HDI HFL SIA+F +FL
Sbjct:  582 AAYGLIVRPKDFASYLLAIGICNLLLYFAFYIIMKLRSGERILPIPLLCITCTSVVWGFALFFFFQGLSTWQKTPAESREHNRNCILLGFFDDHDIWHFLSSIAMFGSFL 691          
BLAST of SID1 transmembrane family member 1 vs. Ensembl Xenopus
Match: SIDT2 (SID1 transmembrane family member 2 [Source:NCBI gene;Acc:100492598])

HSP 1 Score: 184.496 bits (467), Expect = 1.241e-47
Identity = 137/484 (28.31%), Postives = 240/484 (49.59%), Query Frame = 1
Query:  571 CMNLGIQNHVEPVQDDYRHIKPYYIHQTMSKETTLVIKKGKFISSNSILIIFMLNKMAEKCAN---FFSLSQK-PWPEM-KHFNFHI-------TELKTDYMLPIFLAIGFYLSFYVIACL-------------------------------------------AMVGDHFIKSVSSENRFRILSDFSSVNSHAGTTKKRCLTQNNPECEKKLIYLSDLTKTNPMHLEQEFFMYIWYLIVISIFNLPSAIQMIWNFYRNFITNGNQDICFYNFRCARPFFVFPAFNNMISNXXXXXXXXXXXXXTWKKHQRYNSWLNELNMSIFYYGLPKYFGLYYAMGFSLLMEGIMSALYHVCPNQRHMIFDQSYKYILVCIMMVQIYQFRHFDITASAHLFYISLAIFIFIGVIHQFF--QEIIFWSLFTVLYMFWTAILMCDIYYFDQFKINIMLPKQVYLVIKSKKWK-AFIPTYKYRMVIVVFALIIN 1848
            C  + +Q+   PV D   ++    ++QTM+K+  + +++  F SS    ++ ++    E C      F L Q  P   + +  N  +       +  +  Y+  +   +G +LSFY++A L                                             + D  ++++ S NR   L   SSV      T     +  N    KK + +SDL + +   + +++ +Y W +  I++F     IQ++  +       GNQDIC+YNF CA P     AFNN++SN+GY++LG+LFL+I  ++   +N     +   +   G+PK+FGL+YAMG +L+MEG++SA YHVCPN  +  FD S+ Y++  + M+++YQ RH DI ASA+  Y  LAI IF  V+   F     IFW +F+V+++ +T +L   +YY  +++++  + ++++ V+ +   +    P Y  RMV++V   I+N
Sbjct:  198 CSVISVQDIQCPVYDLDNNVAFIGMYQTMTKKAAITVQRKDF-SSGGFYVVVVVKTEDEACGGALPLFPLHQDIPVDHLSRQKNLEVLVSPAINSMYRNVYVAGMLFCLGVFLSFYLVALLISCWEQYRRKRNPHSSTPRLVQFSPNKMFPQCYLPLIDFNKTSGFLIDRSLENLVSRNR---LESLSSVEEDDYDTLTDIESDKNVIRTKKFLCVSDLARKDKRVMRKKYQIYFWNISTIAVFYALPVIQLVITYQTVVNVTGNQDICYYNFLCAHPLGSLSAFNNILSNLGYVMLGLLFLVIVLQRELSHNHNRMNIRGQLQECGIPKHFGLFYAMGTALMMEGLLSACYHVCPNYTNFQFDTSFMYMIAGLCMLKLYQKRHPDINASAYSAYACLAIVIFFSVVGVVFGNGNTIFWVVFSVIHILFTLLLSTQLYYMGRWRLDSAILRRIFHVLYTDCVRQCSPPMYVDRMVLLVMGNIVN 677          

HSP 2 Score: 79.7221 bits (195), Expect = 1.332e-14
Identity = 47/110 (42.73%), Postives = 66/110 (60.00%), Query Frame = 1
Query: 2479 SIYGILIKPEEXXXXXXXXXXXXXXXXXGYYIVMKAFYKETFNKTAIFYSIITISCWAVAVYCFIQPTSNWRKTPAVSREQNKKCIFLDFYDIHDISHFLFSIAIFFTFL 2808
            + YG++++P++F  + L     NLL+YF +YI+MK    E      +     T   W  A++ F Q  S W+KTPA SRE N+ CI L F+D HDI HFL SIA+F +FL
Sbjct:  681 AAYGLIVRPKDFASYLLAIGICNLLLYFAFYIIMKLRSGERILPIPLLCITCTSVVWGFALFFFFQGLSTWQKTPAESREHNRNCILLGFFDDHDIWHFLSSIAMFGSFL 790          
BLAST of SID1 transmembrane family member 1 vs. Ensembl Xenopus
Match: SIDT2 (SID1 transmembrane family member 2 [Source:NCBI gene;Acc:100492598])

HSP 1 Score: 183.726 bits (465), Expect = 1.857e-47
Identity = 137/485 (28.25%), Postives = 240/485 (49.48%), Query Frame = 1
Query:  571 CMNLGIQNHVEPVQDDYRHIKPYYIHQTMSKETTLVIKKGKFISSNSILIIFMLNKMAEKCAN---FFSLSQK-PWPEM-KHFNFHI-------TELKTDYMLPIFLAIGFYLSFYVIACL--------------------------------------------AMVGDHFIKSVSSENRFRILSDFSSVNSHAGTTKKRCLTQNNPECEKKLIYLSDLTKTNPMHLEQEFFMYIWYLIVISIFNLPSAIQMIWNFYRNFITNGNQDICFYNFRCARPFFVFPAFNNMISNXXXXXXXXXXXXXTWKKHQRYNSWLNELNMSIFYYGLPKYFGLYYAMGFSLLMEGIMSALYHVCPNQRHMIFDQSYKYILVCIMMVQIYQFRHFDITASAHLFYISLAIFIFIGVIHQFF--QEIIFWSLFTVLYMFWTAILMCDIYYFDQFKINIMLPKQVYLVIKSKKWK-AFIPTYKYRMVIVVFALIIN 1848
            C  + +Q+   PV D   ++    ++QTM+K+  + +++  F SS    ++ ++    E C      F L Q  P   + +  N  +       +  +  Y+  +   +G +LSFY++A L                                              + D  ++++ S NR   L   SSV      T     +  N    KK + +SDL + +   + +++ +Y W +  I++F     IQ++  +       GNQDIC+YNF CA P     AFNN++SN+GY++LG+LFL+I  ++   +N     +   +   G+PK+FGL+YAMG +L+MEG++SA YHVCPN  +  FD S+ Y++  + M+++YQ RH DI ASA+  Y  LAI IF  V+   F     IFW +F+V+++ +T +L   +YY  +++++  + ++++ V+ +   +    P Y  RMV++V   I+N
Sbjct:  185 CSVISVQDIQCPVYDLDNNVAFIGMYQTMTKKAAITVQRKDF-SSGGFYVVVVVKTEDEACGGALPLFPLHQDIPVDHLSRQKNLEVLVSPAINSMYRNVYVAGMLFCLGVFLSFYLVALLISCWEQYRQKCVNTLCIFKMACFLLDPPVFPQCYLPLIDFNKTSGFLIDRSLENLVSRNR---LESLSSVEEDDYDTLTDIESDKNVIRTKKFLCVSDLARKDKRVMRKKYQIYFWNISTIAVFYALPVIQLVITYQTVVNVTGNQDICYYNFLCAHPLGSLSAFNNILSNLGYVMLGLLFLVIVLQRELSHNHNRMNIRGQLQECGIPKHFGLFYAMGTALMMEGLLSACYHVCPNYTNFQFDTSFMYMIAGLCMLKLYQKRHPDINASAYSAYACLAIVIFFSVVGVVFGNGNTIFWVVFSVIHILFTLLLSTQLYYMGRWRLDSAILRRIFHVLYTDCVRQCSPPMYVDRMVLLVMGNIVN 665          

HSP 2 Score: 79.7221 bits (195), Expect = 1.436e-14
Identity = 47/110 (42.73%), Postives = 66/110 (60.00%), Query Frame = 1
Query: 2479 SIYGILIKPEEXXXXXXXXXXXXXXXXXGYYIVMKAFYKETFNKTAIFYSIITISCWAVAVYCFIQPTSNWRKTPAVSREQNKKCIFLDFYDIHDISHFLFSIAIFFTFL 2808
            + YG++++P++F  + L     NLL+YF +YI+MK    E      +     T   W  A++ F Q  S W+KTPA SRE N+ CI L F+D HDI HFL SIA+F +FL
Sbjct:  669 AAYGLIVRPKDFASYLLAIGICNLLLYFAFYIIMKLRSGERILPIPLLCITCTSVVWGFALFFFFQGLSTWQKTPAESREHNRNCILLGFFDDHDIWHFLSSIAMFGSFL 778          
BLAST of SID1 transmembrane family member 1 vs. Ensembl Xenopus
Match: SIDT2 (SID1 transmembrane family member 2 [Source:NCBI gene;Acc:100492598])

HSP 1 Score: 183.726 bits (465), Expect = 1.954e-47
Identity = 137/485 (28.25%), Postives = 240/485 (49.48%), Query Frame = 1
Query:  571 CMNLGIQNHVEPVQDDYRHIKPYYIHQTMSKETTLVIKKGKFISSNSILIIFMLNKMAEKCAN---FFSLSQK-PWPEM-KHFNFHI-------TELKTDYMLPIFLAIGFYLSFYVIACL--------------------------------------------AMVGDHFIKSVSSENRFRILSDFSSVNSHAGTTKKRCLTQNNPECEKKLIYLSDLTKTNPMHLEQEFFMYIWYLIVISIFNLPSAIQMIWNFYRNFITNGNQDICFYNFRCARPFFVFPAFNNMISNXXXXXXXXXXXXXTWKKHQRYNSWLNELNMSIFYYGLPKYFGLYYAMGFSLLMEGIMSALYHVCPNQRHMIFDQSYKYILVCIMMVQIYQFRHFDITASAHLFYISLAIFIFIGVIHQFF--QEIIFWSLFTVLYMFWTAILMCDIYYFDQFKINIMLPKQVYLVIKSKKWK-AFIPTYKYRMVIVVFALIIN 1848
            C  + +Q+   PV D   ++    ++QTM+K+  + +++  F SS    ++ ++    E C      F L Q  P   + +  N  +       +  +  Y+  +   +G +LSFY++A L                                              + D  ++++ S NR   L   SSV      T     +  N    KK + +SDL + +   + +++ +Y W +  I++F     IQ++  +       GNQDIC+YNF CA P     AFNN++SN+GY++LG+LFL+I  ++   +N     +   +   G+PK+FGL+YAMG +L+MEG++SA YHVCPN  +  FD S+ Y++  + M+++YQ RH DI ASA+  Y  LAI IF  V+   F     IFW +F+V+++ +T +L   +YY  +++++  + ++++ V+ +   +    P Y  RMV++V   I+N
Sbjct:  189 CSVISVQDIQCPVYDLDNNVAFIGMYQTMTKKAAITVQRKDF-SSGGFYVVVVVKTEDEACGGALPLFPLHQDIPVDHLSRQKNLEVLVSPAINSMYRNVYVAGMLFCLGVFLSFYLVALLISCWEQYRQKCVNTLCIFKMACFLLDPPVFPQCYLPLIDFNKTSGFLIDRSLENLVSRNR---LESLSSVEEDDYDTLTDIESDKNVIRTKKFLCVSDLARKDKRVMRKKYQIYFWNISTIAVFYALPVIQLVITYQTVVNVTGNQDICYYNFLCAHPLGSLSAFNNILSNLGYVMLGLLFLVIVLQRELSHNHNRMNIRGQLQECGIPKHFGLFYAMGTALMMEGLLSACYHVCPNYTNFQFDTSFMYMIAGLCMLKLYQKRHPDINASAYSAYACLAIVIFFSVVGVVFGNGNTIFWVVFSVIHILFTLLLSTQLYYMGRWRLDSAILRRIFHVLYTDCVRQCSPPMYVDRMVLLVMGNIVN 669          

HSP 2 Score: 79.7221 bits (195), Expect = 1.369e-14
Identity = 47/110 (42.73%), Postives = 66/110 (60.00%), Query Frame = 1
Query: 2479 SIYGILIKPEEXXXXXXXXXXXXXXXXXGYYIVMKAFYKETFNKTAIFYSIITISCWAVAVYCFIQPTSNWRKTPAVSREQNKKCIFLDFYDIHDISHFLFSIAIFFTFL 2808
            + YG++++P++F  + L     NLL+YF +YI+MK    E      +     T   W  A++ F Q  S W+KTPA SRE N+ CI L F+D HDI HFL SIA+F +FL
Sbjct:  673 AAYGLIVRPKDFASYLLAIGICNLLLYFAFYIIMKLRSGERILPIPLLCITCTSVVWGFALFFFFQGLSTWQKTPAESREHNRNCILLGFFDDHDIWHFLSSIAMFGSFL 782          
BLAST of SID1 transmembrane family member 1 vs. Ensembl Mouse
Match: Sidt1 (SID1 transmembrane family, member 1 [Source:MGI Symbol;Acc:MGI:2443155])

HSP 1 Score: 200.675 bits (509), Expect = 5.077e-53
Identity = 155/550 (28.18%), Postives = 272/550 (49.45%), Query Frame = 1
Query:  379 IEVSSKSLRKIAVKIQIKWIDNFLIKLNQNQSVSITIYTPVYYLFKFDSKKQTIVIHVQS-KDEICMNLGIQNHVEPVQDDYRHIKPYYIHQTMSKETTLVIKKGKFISSNSILIIFMLNKMAEKCANFFSLSQ---KPWPEMKHFNFHITEL----KTDYMLPIFLAIGFYLSFYVIACLAMVGDHFIK----------------------------------------SVSSENRFRILSDF---------SSVNSHAGTTKKRCLTQNNPECEKKLIYLSDLTKTNPMHLEQEFFMYIWYLIVISIFNLPSAIQMIWNFYRNFITNGNQDICFYNFRCARPFFVFPAFNNMISNXXXXXXXXXXXXXTWKKHQRYNSWLNELNMSIFYYGLPKYFGLYYAMGFSLLMEGIMSALYHVCPNQRHMIFDQSYKYILVCIMMVQIYQFRHFDITASAHLFYISLAIFIFIGVIHQFF--QEIIFWSLFTVLYMFWTAILMCDIYYFDQFKINIMLPKQVYLVIKSKK-WKAFIPTYKYRMVIVVFALIIN 1848
            ++V+S +      K+ +  I +F +  N     + +   P Y+L+KF     +++I V S K   C  + +QN + PV D   +++   ++Q+M+K+  + ++K  F       ++F++      C   FS+ +   + W   +  N  +T +    ++ Y+     +I  +LSFY + CL +V  H ++                                        S SS  R    SD          SSV      T     +  N    K  +YLSDL++ +   + +++ +Y W +I I++F     +Q++  +       GNQDIC+YNF CA P  V  AFNN++SN+G++LLG LFLLI  ++   +   L   ++    YG+PK+FGL+YAMG +L+MEG++SA YHVCPN  +  FD S+ Y++  + M+++YQ RH DI ASA+  Y S A+ I + V+   F   ++ FW +F+ +++  +  L   IYY  +FKI++ + ++  +V  +    +   P Y  RMV+++   ++N
Sbjct:  147 VDVASMAPHGAHYKLLVTKIKHFQLPTNVAFYFTASPSQPQYFLYKFPEDVDSVIIKVVSEKAYPCSVVSVQNIMCPVYDLDHNVEFNGVYQSMTKKAAITLQKKDF-PDEQFFVVFVIKPEDYACGGSFSIQENENQTWNLQRSKNLKVTIVPSIKESVYVKSSLFSIFVFLSFY-LGCLLVVLVHHVRFQRKSIDGSFGSSDGSGNMAVSHPITASTPEGSNYGAIDESSSSPGRQMSSSDGGQPCHSDTDSSVEESDFDTMPDIESDKNVIRTKMFLYLSDLSRKDRRIVSKKYKIYFWNIITIAVFYALPVMQLVITYQTVVNVTGNQDICYYNFLCAHPLGVLSAFNNILSNLGHVLLGFLFLLIVLRRDLLHRRALEAKDIFAMEYGIPKHFGLFYAMGIALMMEGVLSACYHVCPNYSNFQFDTSFMYMIAGLCMLKLYQTRHPDINASAYSAYASFAVVITLTVLGVVFGKNDVWFWIIFSAIHILSSLALSTQIYYMGRFKIDLGIFRRAAMVFYTDCIQQCSRPLYMDRMVLLIVGNLVN 694          

HSP 2 Score: 70.4774 bits (171), Expect = 8.530e-12
Identity = 45/109 (41.28%), Postives = 66/109 (60.55%), Query Frame = 1
Query: 2479 SIYGILIKPEEXXXXXXXXXXXXXXXXXGYYIVMKAFYKETFNKTAIFYSIITISCWAVAVYCFIQPTSNWRKTPAVSREQNKKCIFLDFYDIHDISHFLFSIAIFFTF 2805
            + +G++ +P +F  + L     NLL+Y  +YI+MK    E      +F    T   WA A+Y F Q  S+W  TPA SRE+N++C+ LDF+D HDI HFL + A+FF+F
Sbjct:  698 AFFGLIYRPRDFASYMLGIFICNLLLYLAFYIIMKLRSSEKVLPLPVFCIAATAVVWAAALYFFFQNLSSWEGTPAESREKNRECVLLDFFDDHDIWHFLSATALFFSF 806          
BLAST of SID1 transmembrane family member 1 vs. Ensembl Mouse
Match: Sidt2 (SID1 transmembrane family, member 2 [Source:MGI Symbol;Acc:MGI:2446134])

HSP 1 Score: 196.823 bits (499), Expect = 1.036e-51
Identity = 149/569 (26.19%), Postives = 277/569 (48.68%), Query Frame = 1
Query:  379 IEVSSKSLRKIAVKIQIKWIDNFLIKLNQNQSVSITIYTPVYYLFKFDSKKQTIVIHVQSKDEI-CMNLGIQNHVEPVQDDYRHIKPYYIHQTMSKETTLVIKKGKFISSNSILIIFMLNKMAEKCAN---FFSLSQKPWPEMKHFNFHITELKTD------YMLPIFLAIGFYLSFYVIACLAMVGDHF-----------IKSVSSENRFRILSD------------FSSVNSHAGTT----------------KKRCLTQNNPECE---------------------------KKLIYLSDLTKTNPMHLEQEFFMYIWYLIVISIFNLPSAIQMIWNFYRNFITNGNQDICFYNFRCARPFFVFPAFNNMISNXXXXXXXXXXXXXTWKKHQRYNSWLNELNMSIFYYGLPKYFGLYYAMGFSLLMEGIMSALYHVCPNQRHMIFDQSYKYILVCIMMVQIYQFRHFDITASAHLFYISLAIFIFIGVIHQFFQE--IIFWSLFTVLYMFWTAILMCDIYYFDQFKINIMLPKQVYLVIKSKKWK-AFIPTYKYRMVIVVFALIIN 1848
            ++VS+ S      ++++  +DNF+++  +  + + T   P Y+ ++F     ++++ V SK    C  + IQ+ + PV D   ++    ++QTM+K+  + +++  F  SNS  ++ ++    + C     F+   +    +  H    ++ L +       Y+  +   +G +LSFY++  L    +++            ++       R+L+D            + S  + +G+T                + R      P                              K+ + ++DL + +   L +++ +Y W +  I++F     +Q++  +       GNQDIC+YNF CA P     AFNN++SN+GYILLG+LFLLI  ++   +N  L   ++     G+PK+FGL+YAMG +L+MEG++SA YHVCPN  +  FD S+ Y++  + M+++YQ RH DI ASA+  Y  LAI IF  V+   F +    FW +F+V+++  T +L   +YY  ++K++  + +++  V+ +   +    P Y  RMV++V   IIN
Sbjct:  132 VDVSTLSPVNTTYQLRVNRVDNFVLRTGELFTFNTTAAQPQYFKYEFPDGVDSVIVKVTSKKAFPCSVISIQDVLCPVYDLDNNVAFIGMYQTMTKKAAITVQRKDF-PSNSFYVVVVVKTEDQACGGSLPFYPFVEDEPVDQGHRQKTLSVLVSQAVTSEAYVGGMLFCLGIFLSFYLLTVLLACWENWRQRKKTLLLAIDRACPESGHARVLADSFPGSAPYEGYNYGSFENGSGSTDGLVESAGSGDLSYSYQDRSFDAVGPRPRLDSMSSVEEDDYDTLTDIDSDKNVIRTKQYLCVADLARKDKRVLRKKYQIYFWNIATIAVFYALPVVQLVITYQTVVNVTGNQDICYYNFLCAHPLGNLSAFNNILSNLGYILLGLLFLLIILQREINHNRALLRNDLYALECGIPKHFGLFYAMGTALMMEGLLSACYHVCPNYTNFQFDTSFMYMIAGLCMLKLYQKRHPDINASAYSAYACLAIVIFFSVLGVVFGKGNTAFWIVFSVIHIISTLLLSTQLYYMGRWKLDSGIFRRILHVLYTDCIRQCSGPLYTDRMVLLVMGNIIN 699          

HSP 2 Score: 81.6481 bits (200), Expect = 3.435e-15
Identity = 47/109 (43.12%), Postives = 66/109 (60.55%), Query Frame = 1
Query: 2479 SIYGILIKPEEXXXXXXXXXXXXXXXXXGYYIVMKAFYKETFNKTAIFYSIITISCWAVAVYCFIQPTSNWRKTPAVSREQNKKCIFLDFYDIHDISHFLFSIAIFFTF 2805
            + YG++++P +F  + L     NLL+YF +YI+MK    E      +   + T   W  A++ F Q  S W+KTPA SRE N+ CI LDF+D HDI HFL SIA+F +F
Sbjct:  703 AAYGLIMRPNDFASYLLAIGICNLLLYFAFYIIMKLRSGERIKLIPLLCIVCTSVVWGFALFFFFQGLSTWQKTPAESREHNRDCILLDFFDDHDIWHFLSSIAMFGSF 811          
BLAST of SID1 transmembrane family member 1 vs. Ensembl Mouse
Match: Sidt1 (SID1 transmembrane family, member 1 [Source:MGI Symbol;Acc:MGI:2443155])

HSP 1 Score: 196.052 bits (497), Expect = 1.845e-51
Identity = 157/558 (28.14%), Postives = 269/558 (48.21%), Query Frame = 1
Query:  379 IEVSSKSLRKIAVKIQIKWIDNFLIKLNQNQSVSITIYTPVYYLFKFDSKKQTIVIHVQS-KDEICMNLGIQNHVEPVQDDYRHIKPYYIHQTMSKETTLVIKKGKFISSNSILIIFMLNKMAEKCANFFSLSQ---KPWPEMKHFNFHITEL----KTDYMLPIFLAIGFYLSFYVIACLAMVGDHFIK----------------------------------------SVSSENRFRILSDF---------SSVNSHAGTTKKRCLTQNNPECEKKLIYLSDLTKTNPMHLEQEFFMYIWYLIVISIFNLPSAIQMIWNFYRNFITNGNQDICFYNFRCARPFFVFPAFNNMISNXXXXXXXXXXXXXTWKKHQRYNSWLNELNMSIFYYGLPKYFGLYYAMGFSLLMEGIMSALYHVCPNQRHMIFDQSYKYILVCIMMVQIYQFRHFDITASAHLFYISLAIFIFIGVIHQFF--QEIIFWSLFTVLYMFWTAILMCDIYYFDQFKINIMLPKQVYLVIKSKKWKAFI---------PTYKYRMVIVVFALIIN 1848
            ++V+S +      K+ +  I +F +  N     + +   P Y+L+KF     +++I V S K   C  + +QN + PV D   +++   ++Q+M+K+  + ++K  F       ++F++      C   FS+ +   + W   +  N  +T +    ++ Y+     +I  +LSFY + CL +V  H ++                                        S SS  R    SD          SSV      T     +  N    K  +YLSDL++ +   + +++ +Y W +I I++F     +Q++  +       GNQDIC+YNF CA P  V  AFNN++SN+G++LLG LFLLI  ++   +   L   ++    YG+PK+FGL+YAMG +L+MEG++SA YHVCPN  +  FD S+ Y++  + M+++YQ RH DI ASA+  Y S A+ I + V+   F   ++ FW +F+ +++  +  L   IYY  +FKI++       L I  +    F          P Y  RMV+++   ++N
Sbjct:  147 VDVASMAPHGAHYKLLVTKIKHFQLPTNVAFYFTASPSQPQYFLYKFPEDVDSVIIKVVSEKAYPCSVVSVQNIMCPVYDLDHNVEFNGVYQSMTKKAAITLQKKDF-PDEQFFVVFVIKPEDYACGGSFSIQENENQTWNLQRSKNLKVTIVPSIKESVYVKSSLFSIFVFLSFY-LGCLLVVLVHHVRFQRKSIDGSFGSSDGSGNMAVSHPITASTPEGSNYGAIDESSSSPGRQMSSSDGGQPCHSDTDSSVEESDFDTMPDIESDKNVIRTKMFLYLSDLSRKDRRIVSKKYKIYFWNIITIAVFYALPVMQLVITYQTVVNVTGNQDICYYNFLCAHPLGVLSAFNNILSNLGHVLLGFLFLLIVLRRDLLHRRALEAKDIFAMEYGIPKHFGLFYAMGIALMMEGVLSACYHVCPNYSNFQFDTSFMYMIAGLCMLKLYQTRHPDINASAYSAYASFAVVITLTVLGVVFGKNDVWFWIIFSAIHILSSLALSTQIYYMGRFKIDV---SDTDLGIFRRAAMVFYTDCIQQCSRPLYMDRMVLLIVGNLVN 699          

HSP 2 Score: 70.4774 bits (171), Expect = 9.241e-12
Identity = 45/109 (41.28%), Postives = 66/109 (60.55%), Query Frame = 1
Query: 2479 SIYGILIKPEEXXXXXXXXXXXXXXXXXGYYIVMKAFYKETFNKTAIFYSIITISCWAVAVYCFIQPTSNWRKTPAVSREQNKKCIFLDFYDIHDISHFLFSIAIFFTF 2805
            + +G++ +P +F  + L     NLL+Y  +YI+MK    E      +F    T   WA A+Y F Q  S+W  TPA SRE+N++C+ LDF+D HDI HFL + A+FF+F
Sbjct:  703 AFFGLIYRPRDFASYMLGIFICNLLLYLAFYIIMKLRSSEKVLPLPVFCIAATAVVWAAALYFFFQNLSSWEGTPAESREKNRECVLLDFFDDHDIWHFLSATALFFSF 811          
BLAST of SID1 transmembrane family member 1 vs. Ensembl Mouse
Match: Sidt2 (SID1 transmembrane family, member 2 [Source:MGI Symbol;Acc:MGI:2446134])

HSP 1 Score: 172.555 bits (436), Expect = 1.128e-43
Identity = 115/322 (35.71%), Postives = 183/322 (56.83%), Query Frame = 1
Query:  892 CLAMVGDHFIKSVSSENRFRILSDFSSVNSHAGTTKKRCLTQNNPECEKKLIYLSDLTKTNPMHLEQEFFMYIWYLIVISIFNLPSAIQMIWNFYRNFITNGNQDICFYNFRCARPFFVFPAFNNMISNXXXXXXXXXXXXXTWKKHQRYNSWLNELNMSIFYYGLPKYFGLYYAMGFSLLMEGIMSALYHVCPNQRHMIFDQSYKYILVCIMMVQIYQFRHFDITASAHLFYISLAIFIFIGVIHQFFQE--IIFWSLFTVLYMFWTAILMCDIYYFDQFKINIMLPKQVYLVIKSKKWK-AFIPTYKYRMVIVVFALIIN 1848
            C+AM  D    +V    R   L   SSV      T     +  N    K+ + ++DL + +   L +++ +Y W +  I++F     +Q++  +       GNQDIC+YNF CA P     AFNN++SN+GYILLG+LFLLI  ++   +N  L   ++     G+PK+FGL+YAMG +L+MEG++SA YHVCPN  +  FD S+ Y++  + M+++YQ RH DI ASA+  Y  LAI IF  V+   F +    FW +F+V+++  T +L   +YY  ++K++  + +++  V+ +   +    P Y  RMV++V   IIN
Sbjct:  404 CIAM--DRSFDAVGPRPR---LDSMSSVEEDDYDTLTDIDSDKNVIRTKQYLCVADLARKDKRVLRKKYQIYFWNIATIAVFYALPVVQLVITYQTVVNVTGNQDICYYNFLCAHPLGNLSAFNNILSNLGYILLGLLFLLIILQREINHNRALLRNDLYALECGIPKHFGLFYAMGTALMMEGLLSACYHVCPNYTNFQFDTSFMYMIAGLCMLKLYQKRHPDINASAYSAYACLAIVIFFSVLGVVFGKGNTAFWIVFSVIHIISTLLLSTQLYYMGRWKLDSGIFRRILHVLYTDCIRQCSGPLYTDRMVLLVMGNIIN 720          

HSP 2 Score: 81.6481 bits (200), Expect = 3.290e-15
Identity = 47/109 (43.12%), Postives = 66/109 (60.55%), Query Frame = 1
Query: 2479 SIYGILIKPEEXXXXXXXXXXXXXXXXXGYYIVMKAFYKETFNKTAIFYSIITISCWAVAVYCFIQPTSNWRKTPAVSREQNKKCIFLDFYDIHDISHFLFSIAIFFTF 2805
            + YG++++P +F  + L     NLL+YF +YI+MK    E      +   + T   W  A++ F Q  S W+KTPA SRE N+ CI LDF+D HDI HFL SIA+F +F
Sbjct:  724 AAYGLIMRPNDFASYLLAIGICNLLLYFAFYIIMKLRSGERIKLIPLLCIVCTSVVWGFALFFFFQGLSTWQKTPAESREHNRDCILLDFFDDHDIWHFLSSIAMFGSF 832          

HSP 3 Score: 56.9954 bits (136), Expect = 1.205e-7
Identity = 38/183 (20.77%), Postives = 89/183 (48.63%), Query Frame = 1
Query:  379 IEVSSKSLRKIAVKIQIKWIDNFLIKLNQNQSVSITIYTPVYYLFKFDSKKQTIVIHVQSKDEI-CMNLGIQNHVEPVQDDYRHIKPYYIHQTMSKETTLVIKKGKFISSNSILIIFMLNKMAEKCAN---FFSLSQKPWPEMKHFNFHITELKTD------YMLPIFLAIGFYLSFYVIACL 897
            ++VS+ S      ++++  +DNF+++  +  + + T   P Y+ ++F     ++++ V SK    C  + IQ+ + PV D   ++    ++QTM+K+  + +++  F  SNS  ++ ++    + C     F+   +    +  H    ++ L +       Y+  +   +G +LSFY++  L
Sbjct:  132 VDVSTLSPVNTTYQLRVNRVDNFVLRTGELFTFNTTAAQPQYFKYEFPDGVDSVIVKVTSKKAFPCSVISIQDVLCPVYDLDNNVAFIGMYQTMTKKAAITVQRKDF-PSNSFYVVVVVKTEDQACGGSLPFYPFVEDEPVDQGHRQKTLSVLVSQAVTSEAYVGGMLFCLGIFLSFYLLTVL 313          
BLAST of SID1 transmembrane family member 1 vs. Ensembl Mouse
Match: Sidt2 (SID1 transmembrane family, member 2 [Source:MGI Symbol;Acc:MGI:2446134])

HSP 1 Score: 53.9138 bits (128), Expect = 8.589e-9
Identity = 24/37 (64.86%), Postives = 28/37 (75.68%), Query Frame = 1
Query: 2704 AVSREQNKKCIFLDFYDIHDISHFLFSIAIFFTFLTL 2814
            A SRE N+ CI LDF+D HDI HFL SIA+F +FL L
Sbjct:   36 AESREHNRDCILLDFFDDHDIWHFLSSIAMFGSFLVL 72          
BLAST of SID1 transmembrane family member 1 vs. UniProt/SwissProt
Match: sp|Q9NXL6|SIDT1_HUMAN (SID1 transmembrane family member 1 OS=Homo sapiens OX=9606 GN=SIDT1 PE=2 SV=2)

HSP 1 Score: 204.912 bits (520), Expect = 1.421e-53
Identity = 157/565 (27.79%), Postives = 280/565 (49.56%), Query Frame = 1
Query:  334 NEAKNHNYSSNHSTSIEVSSKSLRKIAVKIQIKWIDNFLIKLNQNQSVSITIYTPVYYLFKFDSKKQTIVIHVQSKDE-ICMNLGIQNHVEPVQDDYRHIKPYYIHQTMSKETTLVIKKGKFISSNSILIIFMLNKMAEKCANFFSLSQKP---WPEMKHFNFHITEL----KTDYMLPIFLAIGFYLSFYVIACLA--------------------------MVGDHFIKSVSSENRFRILSDFSS------VNSHAGTTKKRCLTQNN---------PECE--------KKLIYLSDLTKTNPMHLEQEFFMYIWYLIVISIFNLPSAIQMIWNFYRNFITNGNQDICFYNFRCARPFFVFPAFNNMISNXXXXXXXXXXXXXTWKKHQRYNSWLNELNMSIFYYGLPKYFGLYYAMGFSLLMEGIMSALYHVCPNQRHMIFDQSYKYILVCIMMVQIYQFRHFDITASAHLFYISLAIFIFIGVIHQFF--QEIIFWSLFTVLYMFWTAILMCDIYYFDQFKINIMLPKQVYLVIKSKK-WKAFIPTYKYRMVIVVFALIIN 1848
            +EA N          ++V+S +      K+ +  + +F ++ N     + +   P Y+L+KF     +++I V S+    C  + +QN + PV D   +++   ++Q+M+K+  + ++K  F       ++F++      C   F + +K    W   +  N  +T +    ++ Y+     ++  +LSFY + CL                           MV  H I + + E       D SS      ++S  G    +  T ++         P+ E        K  +YLSDL++ +   + +++ +Y W +I I++F     IQ++  +       GNQDIC+YNF CA P  V  AFNN++SN+G++LLG LFLLI  ++   +   L   ++    YG+PK+FGL+YAMG +L+MEG++SA YHVCPN  +  FD S+ Y++  + M+++YQ RH DI ASA+  Y S A+ I + V+   F   ++ FW +F+ +++  +  L   IYY  +FKI++ + ++  +V  +    +   P Y  RMV++V   ++N
Sbjct:  132 SEATNETGPLQQLIFVDVASMAPLGAQYKLLVTKLKHFQLRTNVAFHFTASPSQPQYFLYKFPKDVDSVIIKVVSEMAYPCSVVSVQNIMCPVYDLDHNVEFNGVYQSMTKKAAITLQKKDF-PGEQFFVVFVIKPEDYACGGSFFIQEKENQTWNLQRKKNLEVTIVPSIKESVYVKSSLFSVFIFLSFY-LGCLLVGFVHYLRFQRKSIDGSFGSNDGSGNMVASHPIAASTPEGSNYGTIDESSSSPGRQMSSSDGGPPGQSDTDSSVEESDFDTMPDIESDKNIIRTKMFLYLSDLSRKDRRIVSKKYKIYFWNIITIAVFYALPVIQLVITYQTVVNVTGNQDICYYNFLCAHPLGVLSAFNNILSNLGHVLLGFLFLLIVLRRDILHRRALEAKDIFAVEYGIPKHFGLFYAMGIALMMEGVLSACYHVCPNYSNFQFDTSFMYMIAGLCMLKLYQTRHPDINASAYSAYASFAVVIMVTVLGVVFGKNDVWFWVIFSAIHVLASLALSTQIYYMGRFKIDLGIFRRAAMVFYTDCIQQCSRPLYMDRMVLLVVGNLVN 694          

HSP 2 Score: 84.3445 bits (207), Expect = 3.487e-15
Identity = 46/109 (42.20%), Postives = 68/109 (62.39%), Query Frame = 1
Query: 2479 SIYGILIKPEEXXXXXXXXXXXXXXXXXGYYIVMKAFYKETFNKTAIFYSIITISCWAVAVYCFIQPTSNWRKTPAVSREQNKKCIFLDFYDIHDISHFLFSIAIFFTF 2805
            +++G++ +P +F  + L     NLL+Y  +YI+MK    E      +F  + T   WA A+Y F Q  S+W  TPA SRE+N++CI LDF+D HDI HFL + A+FF+F
Sbjct:  698 ALFGLIYRPRDFASYMLGIFICNLLLYLAFYIIMKLRSSEKVLPVPLFCIVATAVMWAAALYFFFQNLSSWEGTPAESREKNRECILLDFFDDHDIWHFLSATALFFSF 806          
BLAST of SID1 transmembrane family member 1 vs. UniProt/SwissProt
Match: sp|Q6AXF6|SIDT1_MOUSE (SID1 transmembrane family member 1 OS=Mus musculus OX=10090 GN=Sidt1 PE=1 SV=1)

HSP 1 Score: 200.675 bits (509), Expect = 3.551e-52
Identity = 155/550 (28.18%), Postives = 272/550 (49.45%), Query Frame = 1
Query:  379 IEVSSKSLRKIAVKIQIKWIDNFLIKLNQNQSVSITIYTPVYYLFKFDSKKQTIVIHVQS-KDEICMNLGIQNHVEPVQDDYRHIKPYYIHQTMSKETTLVIKKGKFISSNSILIIFMLNKMAEKCANFFSLSQ---KPWPEMKHFNFHITEL----KTDYMLPIFLAIGFYLSFYVIACLAMVGDHFIK----------------------------------------SVSSENRFRILSDF---------SSVNSHAGTTKKRCLTQNNPECEKKLIYLSDLTKTNPMHLEQEFFMYIWYLIVISIFNLPSAIQMIWNFYRNFITNGNQDICFYNFRCARPFFVFPAFNNMISNXXXXXXXXXXXXXTWKKHQRYNSWLNELNMSIFYYGLPKYFGLYYAMGFSLLMEGIMSALYHVCPNQRHMIFDQSYKYILVCIMMVQIYQFRHFDITASAHLFYISLAIFIFIGVIHQFF--QEIIFWSLFTVLYMFWTAILMCDIYYFDQFKINIMLPKQVYLVIKSKK-WKAFIPTYKYRMVIVVFALIIN 1848
            ++V+S +      K+ +  I +F +  N     + +   P Y+L+KF     +++I V S K   C  + +QN + PV D   +++   ++Q+M+K+  + ++K  F       ++F++      C   FS+ +   + W   +  N  +T +    ++ Y+     +I  +LSFY + CL +V  H ++                                        S SS  R    SD          SSV      T     +  N    K  +YLSDL++ +   + +++ +Y W +I I++F     +Q++  +       GNQDIC+YNF CA P  V  AFNN++SN+G++LLG LFLLI  ++   +   L   ++    YG+PK+FGL+YAMG +L+MEG++SA YHVCPN  +  FD S+ Y++  + M+++YQ RH DI ASA+  Y S A+ I + V+   F   ++ FW +F+ +++  +  L   IYY  +FKI++ + ++  +V  +    +   P Y  RMV+++   ++N
Sbjct:  147 VDVASMAPHGAHYKLLVTKIKHFQLPTNVAFYFTASPSQPQYFLYKFPEDVDSVIIKVVSEKAYPCSVVSVQNIMCPVYDLDHNVEFNGVYQSMTKKAAITLQKKDF-PDEQFFVVFVIKPEDYACGGSFSIQENENQTWNLQRSKNLKVTIVPSIKESVYVKSSLFSIFVFLSFY-LGCLLVVLVHHVRFQRKSIDGSFGSSDGSGNMAVSHPITASTPEGSNYGAIDESSSSPGRQMSSSDGGQPCHSDTDSSVEESDFDTMPDIESDKNVIRTKMFLYLSDLSRKDRRIVSKKYKIYFWNIITIAVFYALPVMQLVITYQTVVNVTGNQDICYYNFLCAHPLGVLSAFNNILSNLGHVLLGFLFLLIVLRRDLLHRRALEAKDIFAMEYGIPKHFGLFYAMGIALMMEGVLSACYHVCPNYSNFQFDTSFMYMIAGLCMLKLYQTRHPDINASAYSAYASFAVVITLTVLGVVFGKNDVWFWIIFSAIHILSSLALSTQIYYMGRFKIDLGIFRRAAMVFYTDCIQQCSRPLYMDRMVLLIVGNLVN 694          

HSP 2 Score: 70.4774 bits (171), Expect = 5.967e-11
Identity = 45/109 (41.28%), Postives = 66/109 (60.55%), Query Frame = 1
Query: 2479 SIYGILIKPEEXXXXXXXXXXXXXXXXXGYYIVMKAFYKETFNKTAIFYSIITISCWAVAVYCFIQPTSNWRKTPAVSREQNKKCIFLDFYDIHDISHFLFSIAIFFTF 2805
            + +G++ +P +F  + L     NLL+Y  +YI+MK    E      +F    T   WA A+Y F Q  S+W  TPA SRE+N++C+ LDF+D HDI HFL + A+FF+F
Sbjct:  698 AFFGLIYRPRDFASYMLGIFICNLLLYLAFYIIMKLRSSEKVLPLPVFCIAATAVVWAAALYFFFQNLSSWEGTPAESREKNRECVLLDFFDDHDIWHFLSATALFFSF 806          
BLAST of SID1 transmembrane family member 1 vs. UniProt/SwissProt
Match: sp|Q8CIF6|SIDT2_MOUSE (SID1 transmembrane family member 2 OS=Mus musculus OX=10090 GN=Sidt2 PE=1 SV=1)

HSP 1 Score: 196.823 bits (499), Expect = 7.243e-51
Identity = 149/569 (26.19%), Postives = 277/569 (48.68%), Query Frame = 1
Query:  379 IEVSSKSLRKIAVKIQIKWIDNFLIKLNQNQSVSITIYTPVYYLFKFDSKKQTIVIHVQSKDEI-CMNLGIQNHVEPVQDDYRHIKPYYIHQTMSKETTLVIKKGKFISSNSILIIFMLNKMAEKCAN---FFSLSQKPWPEMKHFNFHITELKTD------YMLPIFLAIGFYLSFYVIACLAMVGDHF-----------IKSVSSENRFRILSD------------FSSVNSHAGTT----------------KKRCLTQNNPECE---------------------------KKLIYLSDLTKTNPMHLEQEFFMYIWYLIVISIFNLPSAIQMIWNFYRNFITNGNQDICFYNFRCARPFFVFPAFNNMISNXXXXXXXXXXXXXTWKKHQRYNSWLNELNMSIFYYGLPKYFGLYYAMGFSLLMEGIMSALYHVCPNQRHMIFDQSYKYILVCIMMVQIYQFRHFDITASAHLFYISLAIFIFIGVIHQFFQE--IIFWSLFTVLYMFWTAILMCDIYYFDQFKINIMLPKQVYLVIKSKKWK-AFIPTYKYRMVIVVFALIIN 1848
            ++VS+ S      ++++  +DNF+++  +  + + T   P Y+ ++F     ++++ V SK    C  + IQ+ + PV D   ++    ++QTM+K+  + +++  F  SNS  ++ ++    + C     F+   +    +  H    ++ L +       Y+  +   +G +LSFY++  L    +++            ++       R+L+D            + S  + +G+T                + R      P                              K+ + ++DL + +   L +++ +Y W +  I++F     +Q++  +       GNQDIC+YNF CA P     AFNN++SN+GYILLG+LFLLI  ++   +N  L   ++     G+PK+FGL+YAMG +L+MEG++SA YHVCPN  +  FD S+ Y++  + M+++YQ RH DI ASA+  Y  LAI IF  V+   F +    FW +F+V+++  T +L   +YY  ++K++  + +++  V+ +   +    P Y  RMV++V   IIN
Sbjct:  132 VDVSTLSPVNTTYQLRVNRVDNFVLRTGELFTFNTTAAQPQYFKYEFPDGVDSVIVKVTSKKAFPCSVISIQDVLCPVYDLDNNVAFIGMYQTMTKKAAITVQRKDF-PSNSFYVVVVVKTEDQACGGSLPFYPFVEDEPVDQGHRQKTLSVLVSQAVTSEAYVGGMLFCLGIFLSFYLLTVLLACWENWRQRKKTLLLAIDRACPESGHARVLADSFPGSAPYEGYNYGSFENGSGSTDGLVESAGSGDLSYSYQDRSFDAVGPRPRLDSMSSVEEDDYDTLTDIDSDKNVIRTKQYLCVADLARKDKRVLRKKYQIYFWNIATIAVFYALPVVQLVITYQTVVNVTGNQDICYYNFLCAHPLGNLSAFNNILSNLGYILLGLLFLLIILQREINHNRALLRNDLYALECGIPKHFGLFYAMGTALMMEGLLSACYHVCPNYTNFQFDTSFMYMIAGLCMLKLYQKRHPDINASAYSAYACLAIVIFFSVLGVVFGKGNTAFWIVFSVIHIISTLLLSTQLYYMGRWKLDSGIFRRILHVLYTDCIRQCSGPLYTDRMVLLVMGNIIN 699          

HSP 2 Score: 81.6481 bits (200), Expect = 2.403e-14
Identity = 47/109 (43.12%), Postives = 66/109 (60.55%), Query Frame = 1
Query: 2479 SIYGILIKPEEXXXXXXXXXXXXXXXXXGYYIVMKAFYKETFNKTAIFYSIITISCWAVAVYCFIQPTSNWRKTPAVSREQNKKCIFLDFYDIHDISHFLFSIAIFFTF 2805
            + YG++++P +F  + L     NLL+YF +YI+MK    E      +   + T   W  A++ F Q  S W+KTPA SRE N+ CI LDF+D HDI HFL SIA+F +F
Sbjct:  703 AAYGLIMRPNDFASYLLAIGICNLLLYFAFYIIMKLRSGERIKLIPLLCIVCTSVVWGFALFFFFQGLSTWQKTPAESREHNRDCILLDFFDDHDIWHFLSSIAMFGSF 811          
BLAST of SID1 transmembrane family member 1 vs. UniProt/SwissProt
Match: sp|Q6Q3F5|SIDT1_RAT (SID1 transmembrane family member 1 OS=Rattus norvegicus OX=10116 GN=Sidt1 PE=1 SV=2)

HSP 1 Score: 192.971 bits (489), Expect = 1.273e-49
Identity = 155/558 (27.78%), Postives = 267/558 (47.85%), Query Frame = 1
Query:  379 IEVSSKSLRKIAVKIQIKWIDNFLIKLNQNQSVSITIYTPVYYLFKFDSKKQTIVIHVQS-KDEICMNLGIQNHVEPVQDDYRHIKPYYIHQTMSKETTLVIKKGKFISSNSILIIFMLNKMAEKCANFFSLSQ---KPWPEMKHFNFHITEL----KTDYMLPIFLAIGFYLSFYVIACLAMVGDHFIK----------------------------------------SVSSENRFRILSDF---------SSVNSHAGTTKKRCLTQNNPECEKKLIYLSDLTKTNPMHLEQEFFMYIWYLIVISIFNLPSAIQMIWNFYRNFITNGNQDICFYNFRCARPFFVFPAFNNMISNXXXXXXXXXXXXXTWKKHQRYNSWLNELNMSIFYYGLPKYFGLYYAMGFSLLMEGIMSALYHVCPNQRHMIFDQSYKYILVCIMMVQIYQFRHFDITASAHLFYISLAIFIFIGVIHQFF--QEIIFWSLFTVLYMFWTAILMCDIYYFDQFKINIMLPKQVYLVIKSKKWKAFI---------PTYKYRMVIVVFALIIN 1848
            ++V+S +      K+ +  I +F ++ N     + +   P Y+L+KF     +++I V S K   C  + +QN + PV D    ++   ++Q+M+K+  + ++K          ++F++      C   FS+ +   + W   +  N  +T +     + Y+     ++  +LSFY + CL +V  H ++                                        S SS  R    SD          SSV      T     +  N    K  +YLSDL++ +   + +++ +Y W +I I++F     +Q++  +       GNQDIC+YNF CA P  V  AFNN++SN+G++LLG LFLLI  ++   +   L   ++    YG+PK+FGL+YAMG +L+MEG++SA YHVCPN  +  FD S+ Y++  + M+++YQ RH DI ASA+  Y S A+ I + V+   F   ++ FW +F+ +++  +  L   IYY  +FKI++       L I  +    F          P Y  RMV+++   ++N
Sbjct:  147 VDVASMAPHGAHYKLLVTKIKHFQLRTNVAFYFTASPSQPQYFLYKFPEDVDSVIIKVVSEKAYPCSVVSVQNIMCPVYDLDHDVEFNGVYQSMTKQAAITLQKD--FPDEQFFVVFVIKPEDYACGGSFSIQENENQTWNLQRSKNLKVTIVPSVKGSVYVKSSLFSVFVFLSFY-LGCLLVVFVHHMRFQRKPVDGSFGSGDGSGNMAVSHPITASTPEGSNYGAIDESSSSPGRQMSSSDGGQPCHSDTDSSVEESDFDTMPDIESDKNVIRTKMFLYLSDLSRKDRRIVSKKYKIYFWNIITIAVFYALPVMQLVITYQTVVNVTGNQDICYYNFLCAHPLGVLSAFNNILSNLGHVLLGFLFLLIVLRRDLLHRRALEAKDIFAMEYGIPKHFGLFYAMGIALMMEGVLSACYHVCPNYSNFQFDTSFMYMIAGLCMLKLYQTRHPDINASAYSAYASFAVVITLTVLGVVFGKNDVWFWIIFSAIHVLASLALSTQIYYMGRFKIDV---SDTDLGIFRRAAMVFYTDCIQQCSRPLYMDRMVLLIVGNLVN 698          

HSP 2 Score: 68.5514 bits (166), Expect = 2.011e-10
Identity = 44/109 (40.37%), Postives = 67/109 (61.47%), Query Frame = 1
Query: 2479 SIYGILIKPEEXXXXXXXXXXXXXXXXXGYYIVMKAFYKETFNKTAIFYSIITISCWAVAVYCFIQPTSNWRKTPAVSREQNKKCIFLDFYDIHDISHFLFSIAIFFTF 2805
            +++G++ +P +F  + L     NLL+Y  +YI+MK    E      +F  + T   WA A+Y F Q  S+W  TPA SRE+N++C+ L F+D HDI HFL + A+FF+F
Sbjct:  702 ALFGLIYRPRDFASYMLGIFICNLLLYLAFYIIMKLRSSEKVLPLPVFCIVATAVVWAAALYFFFQNLSSWEGTPAESREKNRECVLLGFFDDHDIWHFLSATALFFSF 810          
BLAST of SID1 transmembrane family member 1 vs. UniProt/SwissProt
Match: sp|Q8NBJ9|SIDT2_HUMAN (SID1 transmembrane family member 2 OS=Homo sapiens OX=9606 GN=SIDT2 PE=1 SV=2)

HSP 1 Score: 171.4 bits (433), Expect = 1.533e-42
Identity = 102/274 (37.23%), Postives = 169/274 (61.68%), Query Frame = 1
Query: 1036 KKLIYLSDLTKTNPMHLEQEFFMYIWYLIVISIFNLPSAIQMIWNFYRNFITNGNQDICFYNFRCARPFFVFPAFNNMISNXXXXXXXXXXXXXTWKKHQRYNSWLNELNMSIFYYGLPKYFGLYYAMGFSLLMEGIMSALYHVCPNQRHMIFDQSYKYILVCIMMVQIYQFRHFDITASAHLFYISLAIFIFIGVIHQFFQE--IIFWSLFTVLYMFWTAILMCDIYYFDQFKINIMLPKQVYLVIKSKKWK-AFIPTYKYRMVIVVFALIIN 1848
            K+ +Y++DL + +   L +++ +Y W +  I++F     +Q++  +       GNQDIC+YNF CA P     AFNN++SN+GYILLG+LFLLI  ++   +N  L   ++     G+PK+FGL+YAMG +L+MEG++SA YHVCPN  +  FD S+ Y++  + M+++YQ RH DI ASA+  Y  LAI IF  V+   F +    FW +F+++++  T +L   +YY  ++K++  + +++  V+ +   +    P Y  RMV++V   +IN
Sbjct:  426 KQYLYVADLARKDKRVLRKKYQIYFWNIATIAVFYALPVVQLVITYQTVVNVTGNQDICYYNFLCAHPLGNLSAFNNILSNLGYILLGLLFLLIILQREINHNRALLRNDLCALECGIPKHFGLFYAMGTALMMEGLLSACYHVCPNYTNFQFDTSFMYMIAGLCMLKLYQKRHPDINASAYSAYACLAIVIFFSVLGVVFGKGNTAFWIVFSIIHIIATLLLSTQLYYMGRWKLDSGIFRRILHVLYTDCIRQCSGPLYVDRMVLLVMGNVIN 699          

HSP 2 Score: 81.6481 bits (200), Expect = 2.362e-14
Identity = 47/109 (43.12%), Postives = 66/109 (60.55%), Query Frame = 1
Query: 2479 SIYGILIKPEEXXXXXXXXXXXXXXXXXGYYIVMKAFYKETFNKTAIFYSIITISCWAVAVYCFIQPTSNWRKTPAVSREQNKKCIFLDFYDIHDISHFLFSIAIFFTF 2805
            + YG++++P +F  + L     NLL+YF +YI+MK    E      +   + T   W  A++ F Q  S W+KTPA SRE N+ CI LDF+D HDI HFL SIA+F +F
Sbjct:  703 AAYGLIMRPNDFASYLLAIGICNLLLYFAFYIIMKLRSGERIKLIPLLCIVCTSVVWGFALFFFFQGLSTWQKTPAESREHNRDCILLDFFDDHDIWHFLSSIAMFGSF 811          

HSP 3 Score: 56.6102 bits (135), Expect = 1.025e-6
Identity = 37/183 (20.22%), Postives = 89/183 (48.63%), Query Frame = 1
Query:  379 IEVSSKSLRKIAVKIQIKWIDNFLIKLNQNQSVSITIYTPVYYLFKFDSKKQTIVIHVQSKDEI-CMNLGIQNHVEPVQDDYRHIKPYYIHQTMSKETTLVIKKGKFISSNSILIIFMLNKMAEKCAN---FFSLSQKPWPEMKHFNFHITELKTD------YMLPIFLAIGFYLSFYVIACL 897
            ++VS+ S      ++++  +D+F+++  +  S + T   P Y+ ++F     ++++ V S     C  + IQ+ + PV D   ++    ++QTM+K+  + +++  F  SNS  ++ ++    + C     F+  ++    +  H    ++ L +       Y+  +   +G +LSFY++  L
Sbjct:  132 VDVSTLSPVNTTYQLRVSRMDDFVLRTGEQFSFNTTAAQPQYFKYEFPEGVDSVIVKVTSNKAFPCSVISIQDVLCPVYDLDNNVAFIGMYQTMTKKAAITVQRKDF-PSNSFYVVVVVKTEDQACGGSLPFYPFAEDEPVDQGHRQKTLSVLVSQAVTSEAYVSGMLFCLGIFLSFYLLTVL 313          
BLAST of SID1 transmembrane family member 1 vs. TrEMBL
Match: A0A0L8FH08 (Uncharacterized protein OS=Octopus bimaculoides OX=37653 GN=OCBIM_22021211mg PE=4 SV=1)

HSP 1 Score: 258.84 bits (660), Expect = 1.731e-69
Identity = 186/575 (32.35%), Postives = 301/575 (52.35%), Query Frame = 1
Query:  313 ARTIHLFNEAKNHNYSSNHSTSIEVSSKSLRKIAVKIQIKWIDNFLIKLNQNQSVSITIYTPVYYLFKFDSKKQTIVIHVQSKDEICMNLGIQNHVEPVQDDYRHIKPYYIHQTMSKETTLVIKKGKFISSNS--ILIIFMLNKMAEKCANFFSLSQKPWP----EMKHFNFHITELKT--DYMLPIFLAIGFYLSFYVIACLAMV----------------------GDHFIKSVSSENRFR----------------ILSDFSSVNSHAGTTKKRCLTQNNPECEKKL------IYLSDLTKTNPMHLEQEFFMYIWYLIVISIFNLPSAIQMIWNFYRNFITNGNQDICFYNFRCARPFFVFPAFNNMISNXXXXXXXXXXXXXTWKKHQRYNSWLNELNMSIFYYGLPKYFGLYYAMGFSLLMEGIMSALYHVCPNQRHMIFDQSYKYILVCIMMVQIYQFRHFDITASAHLFYISLAIFIFIGVIHQFFQEIIFWSLFTVLYMFWTAILMCDIYYFDQFKINIMLPKQVYLVIKSKKWKAFIPTYKYRMVIVVFALIINGTMKIN*SVGK 1881
            +RT+   ++    N S +    IEVSS+        +Q   + NF ++L   + V++T   P+YY+F F    +++++   S D  CM + IQ+   P+ D  R+I+ + I QTMSKE+ +V++K  + S N+  ++++ MLN +  KC+   S S+K +P      K     + E  +   Y   I  ++G +LSFY++A LA++                        +  +   S N  R                   D SSVNS   T     L  N+ E EK +      +++SDL++     LE+   +Y W L  I IF     IQ++  + +     GN+D C+YNF+CA P+ V  +FNN+ SNIGYILLGILFLL+ W++   +   + +   +   YG+P+ +GL+YAMG  L MEG+MSA YHVCP   +  FD S+ YI+ C+ M+++YQ RH DI A AH  Y+ +A  IFI VI   +Q  +FW +F  ++   T +L   IYY  ++KI++ L  ++ L++ S   +   P YK R+++++ + I+N T  +  +V K
Sbjct:  168 SRTLCPLDQEHRANISKHQKIIIEVSSQVKEPSDFLLQTSIVKNFKLQLGVEKQVTVTPAEPIYYMFTFPDDIESVIVTGLSNDTSCMTISIQDIKCPIYDLDRNIRFHGIFQTMSKESAIVVQKNLY-SQNAFYVVLVLMLNNL--KCSA--SDSEKVFPMGSVRTKDLTILVKETISVAHYSRAIIASVGLFLSFYIVAGLALLIYNKCGKKPQFPEISELERALPQGYQTQRYGSINERRNDNVSAPLLNPMSPSATTEDTSSVNSSLDTEDIDFL--NDAEEEKDVFRTKTALFVSDLSRKGRKKLEKYGKVYNWNLWTIVIFYGLPVIQLVITYQKVLNVTGNEDTCYYNFKCAMPYKVLSSFNNVFSNIGYILLGILFLLLVWRRDLIHREIVKKYGKAEELYGIPQPYGLFYAMGLGLCMEGVMSACYHVCPTYSNFQFDTSFMYIIACLCMLRLYQTRHPDINAKAHTAYLYMAFIIFIAVIGVVYQTPVFWIVFAAIHFVTTLVLSVQIYYMGRWKIDLGLFNRMRLMLCSDFIQCAKPMYKDRLILLIISNIMNWTFAVYGAVKK 735          

HSP 2 Score: 77.7962 bits (190), Expect = 1.064e-10
Identity = 44/110 (40.00%), Postives = 70/110 (63.64%), Query Frame = 1
Query: 2479 SIYGILIKPEEXXXXXXXXXXXXXXXXXGYYIVMKAFYKETFNKTAIFYSIITISCWAVAVYCFIQPTSNWRKTPAVSREQNKKCIFLDFYDIHDISHFLFSIAIFFTFL 2808
            ++YG + KP +F  + L     NLL Y  +Y++MK   KET      FY ++T   WA A+Y F+   ++W+ +PA+SR++N+ CI L F+D HDI HFL + ++FF+F+
Sbjct:  728 AVYGAVKKPSDFASYLLAIFIGNLLFYLFFYLIMKLRSKETIKIWTRFYILMTGILWAFALYFFLNHLTSWQLSPAMSRDKNRACILLGFFDEHDIWHFLSATSMFFSFM 837          
BLAST of SID1 transmembrane family member 1 vs. TrEMBL
Match: A0A210QFY5 (SID1 transmembrane family member 1 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT21910 PE=4 SV=1)

HSP 1 Score: 239.195 bits (609), Expect = 7.703e-63
Identity = 179/646 (27.71%), Postives = 307/646 (47.52%), Query Frame = 1
Query:  130 RNTSIIF-YEYNNLSTKEAALRVYIECDLKPHESISI------IIKQDN---SYLLSMELFQI-------NNEVPVKAARTIHLFNEAKNHNYSSNHSTSIEVSSKSLRKIAVKIQIKWIDNFLIKLNQNQSVSITIYTPVYYLFKFDSKKQTIVIHVQSKDEICMNLGIQNHVEPVQDDYRHIKPYYIHQTMSKETTLVIKKGKFISSNSILIIFMLNKMAEKCANFFSLSQKPWPEMKHFNFHI--TELKTDYMLPIFLAIGFYLSFYVIACLAMVGDHFIKS------------------VSSENR------FRILSDFSSVNSHAGTTKK-------------------------RCLTQNNPECEKKLIYLSDLTKTNPMHLEQEFFMYIWYLIVISIFNLPSAIQMIWNFYRNFITNGNQDICFYNFRCARPFFVFPAFNNMISNXXXXXXXXXXXXXTWKKHQRYNSWLNELNMSIFYYGLPKYFGLYYAMGFSLLMEGIMSALYHVCPNQRHMIFDQSYKYILVCIMMVQIYQFRHFDITASAHLFYISLAIFIFIGVIHQFFQEIIFWSLFTVLYMFWTAILMCDIYYFDQFKINIMLPKQVYLVIKSKKWKAFIPTYKYRMVIVVFALIINGTMKI 1863
             +  +IF Y Y  +  K  A+RV +     P++ + I      +++Q     S+ L M L  I        N  PV A   IH  +  K+       +  ++VS+ S + I   I   ++ +F ++ ++ ++V++T   P Y++F F     ++++  +S  ++CM   +Q+   PV D  R ++   +HQTM+++  +  +K  +   NS  I+ +L      C    ++    +   K     +  T     Y + I  A+  ++ FY++A L  V  H  +                   ++ E+R        +  D  S +S A   K+                            ++ N    K  +++ DL +      E+ + ++   L+ ISIF     +Q++  + +     G+QDIC+YNF C+RP  V  AFNN+ SNIGY++LG+LFLL+ W++   Y   +         YGLP++ GL YAMG +L MEG+MS  YHVCPN  +  FD S+ YI+ C+ M+++YQ RH DI+A AH  Y+ +A  IFI V+   +   IFW LF ++ M  + IL   IYY  +FK+N  +  ++YL ++ +      P YK R+VI+    ++N +  I
Sbjct:   69 EDREVIFKYTYEEIINKTTAVRVTVSL---PNKEVDINNPVLFVVRQQQGILSWRLPMYLEYIYTYNLVSRNLCPVDA---IHRNSSTKDQ------TVFVDVSTFSKQNITFTISADFVKDFHLRTDEIRNVNVTPSQPQYFMFTFPDNVDSVIVQAKSDSDLCMIFSLQDVKCPVFDLDRDVEFSGVHQTMTRQAAITAEKSSY-DQNSFYIVTVLKPSDYDCNGIETIQAAGYTRRKQLTLQVYGTISAKKYYVAIIGAVSVFVGFYLVAFLVGVLYHGCRKNWGVWEFVLEEDTEETNPLTGESRPSRHGYGTVEPDLDSEDSSAQRNKEMYRVTPSRPPSLARTPSEDDVDFLDDATSEKNVLRTKTALFVCDLARKPKKRQEKNYKLFCRNLVAISIFYGLPVLQLVMTYQKVLHVTGDQDICYYNFDCSRPLGVLSAFNNVFSNIGYVMLGLLFLLLVWRRDLVYRKAVERNPEVETKYGLPQHNGLLYAMGLALCMEGVMSGCYHVCPNYSNFQFDTSFMYIIACLCMLRVYQSRHPDISAKAHTSYLVMAFVIFIAVVGVVYGTNIFWILFALVDMLASLILSVYIYYMGRFKMNTGIVTKMYLSLRYECGHCTTPMYKDRLVILFIGNVLNWSFAI 701          

HSP 2 Score: 78.1814 bits (191), Expect = 6.568e-11
Identity = 44/109 (40.37%), Postives = 67/109 (61.47%), Query Frame = 1
Query: 2479 SIYGILIKPEEXXXXXXXXXXXXXXXXXGYYIVMKAFYKETFNKTAIFYSIITISCWAVAVYCFIQPTSNWRKTPAVSREQNKKCIFLDFYDIHDISHFLFSIAIFFTF 2805
            +IYG + +P +F  + L     NLL+Y  +YI+MK  YKE  +  A+   +     W +A+Y F    ++W+ TP+ SR+ NK C+ LDFYD HD+ HFL +IA+F +F
Sbjct:  700 AIYGAVTRPSDFASYLLGIFIGNLLLYSLFYIIMKLRYKEKIHPLAVMCILTATVFWCMALYFFFAHLTSWQLTPSQSRKGNKSCMLLDFYDAHDVWHFLSAIAMFMSF 808          
BLAST of SID1 transmembrane family member 1 vs. TrEMBL
Match: A0A2C9JQS9 (Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106064074 PE=4 SV=1)

HSP 1 Score: 231.491 bits (589), Expect = 3.788e-61
Identity = 159/522 (30.46%), Postives = 265/522 (50.77%), Query Frame = 1
Query:  436 IDNFLIKLNQNQSVSITIYTPVYYLFKFDSKKQTIVIHVQSKDEICMNLGIQNHVEPVQDDYRHIKPYYIHQTMSKETTLVIKKGKFISSNSILIIFMLNKMAEKCANFFSLSQ-KPWPEMKHFNFHITELK-----TDYMLPIFLAIGFYLSFYVIA-----CLAMVGDHFI-------------KSVSSENRFRILSDFSSVNSHAGTTKKRCLTQNNPECE--------------------------KKLIYLSDLTKTNPMHLEQEFFMYIWYLIVISIFNLPSAIQMIWNFYRNFITNGNQDICFYNFRCARPFFVF-PAFNNMISNXXXXXXXXXXXXXTWKKHQRYNSWLNELNMSIFYYGLPKYFGLYYAMGFSLLMEGIMSALYHVCPNQRHMIFDQSYKYILVCIMMVQIYQFRHFDITASAHLFYISLAIFIFIGVIHQFFQEIIFWSLFTVLYMFWTAILMCDIYYFDQFKINIMLPKQVYLVIKSKKWKAFIPTYKYRMVIVVFALIIN 1848
            + +F ++  + ++ +++++ P Y+++ F     TI++ V S   ICM + +QN   PV D   +++    HQTM+ +  + ++K  F   N   ++F++    E C  +   +   P  E         E+K     + Y+  I  AIGFYL FYVIA       A  G H               +S+SS+      S  +S  S          + N  EC                           K  +++SDL +     L + + +Y W LI I+IF     +Q++  + R   + GNQD+C+YNF C+ P   +  +FNN+ SNIGYI+LG+LF++I +++   +   L++       YG+P++FGL+YAMG +L MEGIMSA YHVCPN  +  FD S+ YI+ C+ M++IYQ RH DI A AH  Y S+A+ IFI V+   +   IFW L+ +++M  T +L   +YY  ++ I+  + ++++ ++ ++  K   P Y  R  +++   IIN
Sbjct:   15 VTDFELEHEKPRTFNLSVWQPTYFMYTFPENVSTILLKVTSASHICMTVSVQNIKCPVFDLETNVEFEGKHQTMTTQAAMFLEKDDFKEMNGFYVVFIVKPSNEVCEGYLQQTVIGPSNETDSKKTVTVEIKGTISGSQYLSAILGAIGFYLIFYVIAFIIGIVFAGCGLHKGLDELTQEEIGNERRSISSQPNESYGSICASTESSGDNILSPATSMNQIECSNSSDSLDESSIDFLHDASIEKEIVRTKTALFVSDLARKKRKKLAKSYRLYHWNLITIAIFYGLPVVQLVITYQRVLTSTGNQDLCYYNFACSHPLENYLSSFNNVFSNIGYIMLGLLFIVIVYRRDVLHKKILHKHGKLEKLYGIPQHFGLFYAMGLALFMEGIMSACYHVCPNYTNFQFDTSFMYIIACLNMLKIYQSRHPDINAKAHTAYFSMAVIIFIAVLGVVYGTNIFWILYALIHMLVTLVLTAQVYYMGRWNIDCNIFRRIWRLVITEGRKCTNPVYPSRFTLLLIGNIIN 536          

HSP 2 Score: 83.5741 bits (205), Expect = 1.225e-12
Identity = 50/113 (44.25%), Postives = 73/113 (64.60%), Query Frame = 1
Query: 2479 SIYGILIKPEEXXXXXXXXXXXXXXXXXGYYIVMKAFYKETFN---KTAIFYSIITISCWAVAVYCFIQPTSNWRKTPAVSREQNKKCIFLDFYDIHDISHFLFSIAIFFTFL 2808
            ++YG + +P +F  + L     NLL+Y  +YI+MK  YKE  N   K  I  S+IT   WA ++Y F Q  ++W +TPA SR  N++CI LDFYD HD+ HFL +I++FF+F+
Sbjct:  540 ALYGAIKQPSDFATYLLAIFIGNLLLYCIFYIIMKLLYKEHLNWLVKIVICTSVIT---WAGSLYFFFQNLTSWSETPAGSRSGNRECILLDFYDHHDVWHFLSAISLFFSFM 649          
BLAST of SID1 transmembrane family member 1 vs. TrEMBL
Match: A0A1I8IS62 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 232.646 bits (592), Expect = 1.608e-60
Identity = 184/647 (28.44%), Postives = 307/647 (47.45%), Query Frame = 1
Query:  184 ALRVYIECDLKPHESISIIIKQDNSYLLSMELFQI--NNEVPVKAARTIHLFNEAKNHNYSSNHSTSIEVSSKSLRKIAVKIQIKWIDNFLIKLNQNQSVSITIYTPVYYLFKFDSKKQTIVIHVQSKDEICMNLGIQNHVEPVQDDYRHIKPYYIHQTMSKETTLVIKKGKFISSNSILIIFMLNKMAEKCA------------------NFFSLS-----------QKPWPEM----KHFNFHITEL--KTDYMLPIFLAIGFYLSFYVIA-----------------------------CLAMVGDHFIKS-----------VSSENRFRILSDFSSVNSHAGTTKKRCLTQNNPECEKKLIYLSDLTKTNPMHLEQEFFMYIWYLIVISIFNLPSAIQMIWNFYRNFITNGNQDICFYNFRCARPFFVFPAFNNMISNXXXXXXXXXXXXXTWKKHQRYNSWLNELNMSI----------FYYGLPKYFGLYYAMGFSLLMEGIMSALYHVCPNQRHMIFDQSYKYILVCIMMVQIYQFRHFDITASAHLFYISLAIFIFIGVIHQFFQEIIFWSLFTVLYMFWTAILMCDIYYFDQFKINIMLPKQVYLVIKSKKWKAFIPTYKYRMVIVVFALIINGTMKI 1863
            A+RV++       +   + + +    +LS +L QI  N     + ART+     +       N +  I+VSS S R +   + +  +  F++++ Q    S+T   P YY   F    + + I V+S D  CM +  Q+   PV D  R+++   ++QTMS +  + + +  F  + S  I+F++    E C+                  N  S +           + P  E+    K F F + +   +  Y+LP+F A+ F+L+F++IA                             C  + GD                 S ++     S  S+V+          ++  +P  +         + T+      ++ +Y WYLI++SIF     +Q++  + +    +GNQDIC+YNF C RP  V  AFNN+ SNIGYI+LG+LFL +T ++        N                   G+P++FG++YAMG +L+MEGIMS  YHVCP+  +  FD +Y Y+L  + M++IYQ RH DI ASAH+  +++AI IF+ V+   +  + FW+ FTV ++  +  L  ++YY   +K+N+ L ++ YL+I S+  + F P YK RMVI+V A +IN T+ I
Sbjct:   57 AVRVHVVSSSAGQDYPVLFVVRQQRSILSFQLPQILENEYYYSEVARTLCPVERSSKGVADKNQTIYIDVSSASARAVPFLLNVTLVRAFMLQVGQVYRDSVTPSRPKYYRVAFPPGVRHLSIIVESNDTACMIVSTQSVGCPVYDLVRNVEFTGVYQTMSSKAEITLGRHDF-DNESFYIVFVMKPSQEHCSFTRLKDLQPKAPSGPYSSNMDSRAAEDALANATEIRGPSGEVVFTSKSFVFTVVQSLDRGQYLLPVFGAVAFFLAFHLIAFLILLVHWKVTGGNSDGDGEAACANVSLCCPRLEGDGGTAEGSRQRLNEKPQPSGKSTAEPASYGSTVDGKPRGAAGDRVSLKHPRSDTSGAEADANSDTD------DYRLYYWYLIIVSIFYGLPVVQLVITYQQILRISGNQDICYYNFYCTRPLGVISAFNNVFSNIGYIMLGLLFLGLTRRRDLLDRRRRNAAAAVADESDSQSDHRCLLGIPQHFGIFYAMGIALIMEGIMSGCYHVCPSYSNFQFDTAYMYVLAVLCMLKIYQTRHPDINASAHVACMAMAIVIFVSVVGVVYGTVFFWAAFTVFFILSSLFLTGEVYYMGHWKVNVGLFRRFYLLISSQGIRCFKPMYKDRMVILVTANLINWTIAI 696          

HSP 2 Score: 90.1225 bits (222), Expect = 1.602e-14
Identity = 49/119 (41.18%), Postives = 75/119 (63.03%), Query Frame = 1
Query: 2479 SIYGILIKPEEXXXXXXXXXXXXXXXXXGYYIVMKAFYKETFNKTAIFYSIITISCWAVAVYCFIQPTSNWRKTPAVSREQNKKCIFLDFYDIHDISHFLFSIAIFFTFLTLQNMDNCL 2835
            +I+G + +P++F  F L    +NLL+Y  +Y+VMK    E        + + +   WA  +Y F+Q  SNW K+PA SR  N++C+ LDFYDIHDI HFL S+++FF+F+ L  +D+ L
Sbjct:  695 AIFGAVRQPQDFNSFLLYIFLVNLLMYIAFYVVMKVRSGEKIRLLTTLFVVASCITWAAGLYFFMQRPSNWAKSPADSRALNQRCLLLDFYDIHDIWHFLSSMSLFFSFMVLLTLDDDL 813          
BLAST of SID1 transmembrane family member 1 vs. TrEMBL
Match: A0A2C9JQS7 (Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106064074 PE=4 SV=1)

HSP 1 Score: 225.713 bits (574), Expect = 5.280e-59
Identity = 159/541 (29.39%), Postives = 266/541 (49.17%), Query Frame = 1
Query:  436 IDNFLIKLNQNQSVSITIYTPVYYLFKFDSKKQTIVIHVQSKDEICMNLGIQNHVEPVQDDYRHIKPYYIHQTMSKETTLVIKKGKFISSNSILIIFMLNKMAEKCANFFSLSQ-KPWPEMKHFNFHITELK-----TDYMLPIFLAIGFYLSFYVIA-------------------------------------CLAMVGDHFIKSVSSENRFRILSDFSSVNSHAGTTKKRCLTQNNPECE--------------------------KKLIYLSDLTKTNPMHLEQEFFMYIWYLIVISIFNLPSAIQMIWNFYRNFITNGNQDICFYNFRCARPFFVF-PAFNNMISNXXXXXXXXXXXXXTWKKHQRYNSWLNELNMSIFYYGLPKYFGLYYAMGFSLLMEGIMSALYHVCPNQRHMIFDQSYKYILVCIMMVQIYQFRHFDITASAHLFYISLAIFIFIGVIHQFFQEIIFWSLFTVLYMFWTAILMCDIYYFDQFKINIMLPKQVYLVIKSKKWKAFIPTYKYRMVIVVFALIIN 1848
            + +F ++  + ++ +++++ P Y+++ F     TI++ V S   ICM + +QN   PV D   +++    HQTM+ +  + ++K  F   N   ++F++    E C  +   +   P  E         E+K     + Y+  I  AIGFYL FYVIA                                      LA  G+   +S+SS+      S  +S  S          + N  EC                           K  +++SDL +     L + + +Y W LI I+IF     +Q++  + R   + GNQD+C+YNF C+ P   +  +FNN+ SNIGYI+LG+LF++I +++   +   L++       YG+P++FGL+YAMG +L MEGIMSA YHVCPN  +  FD S+ YI+ C+ M++IYQ RH DI A AH  Y S+A+ IFI V+   +   IFW L+ +++M  T +L   +YY  ++ I+  + ++++ ++ ++  K   P Y  R  +++   IIN
Sbjct:   15 VTDFELEHEKPRTFNLSVWQPTYFMYTFPENVSTILLKVTSASHICMTVSVQNIKCPVFDLETNVEFEGKHQTMTTQAAMFLEKDDFKEMNGFYVVFIVKPSNEVCEGYLQQTVIGPSNETDSKKTVTVEIKGTISGSQYLSAILGAIGFYLIFYVIAFIIGIVFAGCGLHKGLDELTQEEIEQSCYLFERSMENVLATPGNER-RSISSQPNESYGSICASTESSGDNILSPATSMNQIECSNSSDSLDESSIDFLHDASIEKEIVRTKTALFVSDLARKKRKKLAKSYRLYHWNLITIAIFYGLPVVQLVITYQRVLTSTGNQDLCYYNFACSHPLENYLSSFNNVFSNIGYIMLGLLFIVIVYRRDVLHKKILHKHGKLEKLYGIPQHFGLFYAMGLALFMEGIMSACYHVCPNYTNFQFDTSFMYIIACLNMLKIYQSRHPDINAKAHTAYFSMAVIIFIAVLGVVYGTNIFWILYALIHMLVTLVLTAQVYYMGRWNIDCNIFRRIWRLVITEGRKCTNPVYPSRFTLLLIGNIIN 554          

HSP 2 Score: 83.5741 bits (205), Expect = 1.293e-12
Identity = 50/113 (44.25%), Postives = 73/113 (64.60%), Query Frame = 1
Query: 2479 SIYGILIKPEEXXXXXXXXXXXXXXXXXGYYIVMKAFYKETFN---KTAIFYSIITISCWAVAVYCFIQPTSNWRKTPAVSREQNKKCIFLDFYDIHDISHFLFSIAIFFTFL 2808
            ++YG + +P +F  + L     NLL+Y  +YI+MK  YKE  N   K  I  S+IT   WA ++Y F Q  ++W +TPA SR  N++CI LDFYD HD+ HFL +I++FF+F+
Sbjct:  558 ALYGAIKQPSDFATYLLAIFIGNLLLYCIFYIIMKLLYKEHLNWLVKIVICTSVIT---WAGSLYFFFQNLTSWSETPAGSRSGNRECILLDFYDHHDVWHFLSAISLFFSFM 667          
BLAST of SID1 transmembrane family member 1 vs. Ensembl Cavefish
Match: sidt2 (SID1 transmembrane family member 2 [Source:NCBI gene;Acc:103036191])

HSP 1 Score: 197.978 bits (502), Expect = 2.100e-52
Identity = 145/473 (30.66%), Postives = 247/473 (52.22%), Query Frame = 1
Query:  502 YYLFKFDSKKQTIVIHVQS-KDEICMNLGIQNHVEPVQDDYRHIKPYYIHQTMSKETTLVIKKGKFISSNSILIIFMLNKMAEKCANFFSLSQKPWPEMKHFNFHITELKTD-----------YMLPIFLAIGFYLSFYV----IACL-----AMVGDHFIKSVSSENRFRILSDFSSVNSHAGTTKKRCLTQNNPECEKKLIYLSDLTKTNPMHLEQEFFMYIWYLIVISIFNLPSAIQMIWNFYRNFITNGNQDICFYNFRCARPFFVFPAFNNMISNXXXXXXXXXXXXXTWKKHQRYNSWLNELNMSIFYYGLPKYFGLYYAMGFSLLMEGIMSALYHVCPNQRHMIFDQSYKYILVCIMMVQIYQFRHFDITASAHLFYISLAIFIFIGVIHQFFQE--IIFWSLFTVLYMFWTAILMCDIYYFDQFKINI-MLPKQVYLVIKSKKWKAFIPTYKYRMVIVVFALIIN 1848
            ++ + F     T+++ V S K+  C  + IQ+   PV D   ++    ++QTM+K+  + +++  F  SNS  ++ ++    E C     L   P    +  +        D           Y++ +   +G +LSFYV    +AC+        G    +S+ +  R R  S  SSV      T     +  N    KK + +SDL + +   L +++ +Y W +  I++F     IQ++  +       GNQDIC+YNF CA P     +FNN++SN+GY++LG+LFLLI  ++   +N  L   +++    G+PK+FGL+YAMG +L+MEG++SA YHVCPN  +  FD S+ Y++  + M+++YQ RH DI ASA+  Y  LA  IF  V+   F +    FW +F+V+++  T +L   +YY  +++++  +L + +YL+      +   P Y  RMV++V   I+N
Sbjct:  165 FFKYVFPDGVDTVIVKVNSEKNFPCSVMSIQDIQCPVYDLDNNVAFIGMYQTMTKKGAITVQRKDF-PSNSFYVVVVVKTEDEACGG--PLKYYPLLPDELLDAGNRSKTLDVVVYPAIDSEVYVMGMLFCLGIFLSFYVLTFLVACIENKRCVYNGSTINRSLDTVGRCRQES-LSSVEEDDYDTLADVDSDKNIVRTKKYLCVSDLARKDKRVLNKKYQIYFWNIATIAVFYALPVIQLVITYQTVVNVTGNQDICYYNFLCAHPLGALSSFNNILSNLGYVMLGLLFLLIILQRDIIHNRALMRNDINALECGIPKHFGLFYAMGTALMMEGLLSACYHVCPNYTNFQFDTSFMYMIAGLCMLKLYQKRHPDINASAYTAYACLAAVIFFSVLGVVFGKGNTAFWIVFSVIHILATMLLSTQLYYMGRWRLDSGILRRMLYLIYTDCIRQCSGPMYIDRMVLLVMGNIVN 633          

HSP 2 Score: 88.1965 bits (217), Expect = 2.007e-17
Identity = 52/125 (41.60%), Postives = 74/125 (59.20%), Query Frame = 1
Query: 2479 SIYGILIKPEEXXXXXXXXXXXXXXXXXGYYIVMKAFYKETFNKTAIFYSIITISCWAVAVYCFIQPTSNWRKTPAVSREQNKKCIFLDFYDIHDISHFLFSIAIFFTFLTLQNMDNCLENQEMN 2853
            + YG++ +P +F  + L     NLL+YF +YI+MK    E     A+   + T   W  A++ F Q  S W+KTPA SRE N+ CI L F+D HDI HFL SIA+F +FL L  MD+ L+  + +
Sbjct:  637 AAYGLIKRPNDFASYLLAIAICNLLLYFAFYIIMKLRSGERIKCLALVCVLFTAVVWGFALFFFFQGLSTWQKTPAESREHNRDCILLSFFDDHDIWHFLSSIAMFGSFLVLLTMDDDLDTVQRD 761          
BLAST of SID1 transmembrane family member 1 vs. Ensembl Cavefish
Match: sidt2 (SID1 transmembrane family member 2 [Source:NCBI gene;Acc:103036191])

HSP 1 Score: 179.104 bits (453), Expect = 6.847e-46
Identity = 114/318 (35.85%), Postives = 184/318 (57.86%), Query Frame = 1
Query:  904 VGDHFIKSVSSENRFRILSDFSSVNSHAGTTKKRCLTQNNPECEKKLIYLSDLTKTNPMHLEQEFFMYIWYLIVISIFNLPSAIQMIWNFYRNFITNGNQDICFYNFRCARPFFVFPAFNNMISNXXXXXXXXXXXXXTWKKHQRYNSWLNELNMSIFYYGLPKYFGLYYAMGFSLLMEGIMSALYHVCPNQRHMIFDQSYKYILVCIMMVQIYQFRHFDITASAHLFYISLAIFIFIGVIHQFFQE--IIFWSLFTVLYMFWTAILMCDIYYFDQFKINI-MLPKQVYLVIKSKKWKAFIPTYKYRMVIVVFALIIN 1848
            V  HF +S+ +  R R  S  SSV      T     +  N    KK + +SDL + +   L +++ +Y W +  I++F     IQ++  +       GNQDIC+YNF CA P     +FNN++SN+GY++LG+LFLLI  ++   +N  L   +++    G+PK+FGL+YAMG +L+MEG++SA YHVCPN  +  FD S+ Y++  + M+++YQ RH DI ASA+  Y  LA  IF  V+   F +    FW +F+V+++  T +L   +YY  +++++  +L + +YL+      +   P Y  RMV++V   I+N
Sbjct:  428 VAIHFDRSLDTVGRCRQES-LSSVEEDDYDTLADVDSDKNIVRTKKYLCVSDLARKDKRVLNKKYQIYFWNIATIAVFYALPVIQLVITYQTVVNVTGNQDICYYNFLCAHPLGALSSFNNILSNLGYVMLGLLFLLIILQRDIIHNRALMRNDINALECGIPKHFGLFYAMGTALMMEGLLSACYHVCPNYTNFQFDTSFMYMIAGLCMLKLYQKRHPDINASAYTAYACLAAVIFFSVLGVVFGKGNTAFWIVFSVIHILATMLLSTQLYYMGRWRLDSGILRRMLYLIYTDCIRQCSGPMYIDRMVLLVMGNIVN 744          

HSP 2 Score: 87.8113 bits (216), Expect = 2.687e-17
Identity = 52/125 (41.60%), Postives = 74/125 (59.20%), Query Frame = 1
Query: 2479 SIYGILIKPEEXXXXXXXXXXXXXXXXXGYYIVMKAFYKETFNKTAIFYSIITISCWAVAVYCFIQPTSNWRKTPAVSREQNKKCIFLDFYDIHDISHFLFSIAIFFTFLTLQNMDNCLENQEMN 2853
            + YG++ +P +F  + L     NLL+YF +YI+MK    E     A+   + T   W  A++ F Q  S W+KTPA SRE N+ CI L F+D HDI HFL SIA+F +FL L  MD+ L+  + +
Sbjct:  748 AAYGLIKRPNDFASYLLAIAICNLLLYFAFYIIMKLRSGERIKCLALVCVLFTAVVWGFALFFFFQGLSTWQKTPAESREHNRDCILLSFFDDHDIWHFLSSIAMFGSFLVLLTMDDDLDTVQRD 872          
BLAST of SID1 transmembrane family member 1 vs. Ensembl Cavefish
Match: sidt2 (SID1 transmembrane family member 2 [Source:NCBI gene;Acc:103036191])

HSP 1 Score: 179.104 bits (453), Expect = 7.619e-46
Identity = 114/318 (35.85%), Postives = 184/318 (57.86%), Query Frame = 1
Query:  904 VGDHFIKSVSSENRFRILSDFSSVNSHAGTTKKRCLTQNNPECEKKLIYLSDLTKTNPMHLEQEFFMYIWYLIVISIFNLPSAIQMIWNFYRNFITNGNQDICFYNFRCARPFFVFPAFNNMISNXXXXXXXXXXXXXTWKKHQRYNSWLNELNMSIFYYGLPKYFGLYYAMGFSLLMEGIMSALYHVCPNQRHMIFDQSYKYILVCIMMVQIYQFRHFDITASAHLFYISLAIFIFIGVIHQFFQE--IIFWSLFTVLYMFWTAILMCDIYYFDQFKINI-MLPKQVYLVIKSKKWKAFIPTYKYRMVIVVFALIIN 1848
            V  HF +S+ +  R R  S  SSV      T     +  N    KK + +SDL + +   L +++ +Y W +  I++F     IQ++  +       GNQDIC+YNF CA P     +FNN++SN+GY++LG+LFLLI  ++   +N  L   +++    G+PK+FGL+YAMG +L+MEG++SA YHVCPN  +  FD S+ Y++  + M+++YQ RH DI ASA+  Y  LA  IF  V+   F +    FW +F+V+++  T +L   +YY  +++++  +L + +YL+      +   P Y  RMV++V   I+N
Sbjct:  428 VAIHFDRSLDTVGRCRQES-LSSVEEDDYDTLADVDSDKNIVRTKKYLCVSDLARKDKRVLNKKYQIYFWNIATIAVFYALPVIQLVITYQTVVNVTGNQDICYYNFLCAHPLGALSSFNNILSNLGYVMLGLLFLLIILQRDIIHNRALMRNDINALECGIPKHFGLFYAMGTALMMEGLLSACYHVCPNYTNFQFDTSFMYMIAGLCMLKLYQKRHPDINASAYTAYACLAAVIFFSVLGVVFGKGNTAFWIVFSVIHILATMLLSTQLYYMGRWRLDSGILRRMLYLIYTDCIRQCSGPMYIDRMVLLVMGNIVN 744          

HSP 2 Score: 81.2629 bits (199), Expect = 3.655e-15
Identity = 49/114 (42.98%), Postives = 67/114 (58.77%), Query Frame = 1
Query: 2479 SIYGILIKPEEXXXXXXXXXXXXXXXXXGYYIVMKAFYKETFNKTAIFYSIITISCWAVAVYCFIQPTSNWRKTPAVSREQNKKCIFLDFYDIHDISHFLFSIAIFFTFLTLQN 2820
            + YG++ +P +F  + L     NLL+YF +YI+MK    E     A+   + T   W  A++ F Q  S W+KTPA SRE N+ CI L F+D HDI HFL SIA+F +FL   N
Sbjct:  748 AAYGLIKRPNDFASYLLAIAICNLLLYFAFYIIMKLRSGERIKCLALVCVLFTAVVWGFALFFFFQGLSTWQKTPAESREHNRDCILLSFFDDHDIWHFLSSIAMFGSFLVSPN 861          
BLAST of SID1 transmembrane family member 1 vs. Ensembl Cavefish
Match: sidt2 (SID1 transmembrane family member 2 [Source:NCBI gene;Acc:103036191])

HSP 1 Score: 125.176 bits (313), Expect = 8.784e-29
Identity = 78/201 (38.81%), Postives = 129/201 (64.18%), Query Frame = 1
Query: 1255 AFNNMISNXXXXXXXXXXXXXTWKKHQRYNSWLNELNMSIFYYGLPKYFGLYYAMGFSLLMEGIMSALYHVCPNQRHMIFDQSYKYILVCIMMVQIYQFRHFDITASAHLFYISLAIFIFIGVIHQFFQE--IIFWSLFTVLYMFWTAILMCDIYYFDQFKINI-MLPKQVYLVIKSKKWKAFIPTYKYRMVIVVFALIIN 1848
            +FNN++SN+GY++LG+LFLLI  ++   +N  L   +++    G+PK+FGL+YAMG +L+MEG++SA YHVCPN  +  FD S+ Y++  + M+++YQ RH DI ASA+  Y  LA  IF  V+   F +    FW +F+V+++  T +L   +YY  +++++  +L + +YL+      +   P Y  RMV++V   I+N
Sbjct:  580 SFNNILSNLGYVMLGLLFLLIILQRDIIHNRALMRNDINALECGIPKHFGLFYAMGTALMMEGLLSACYHVCPNYTNFQFDTSFMYMIAGLCMLKLYQKRHPDINASAYTAYACLAAVIFFSVLGVVFGKGNTAFWIVFSVIHILATMLLSTQLYYMGRWRLDSGILRRMLYLIYTDCIRQCSGPMYIDRMVLLVMGNIVN 780          

HSP 2 Score: 79.7221 bits (195), Expect = 1.115e-14
Identity = 49/114 (42.98%), Postives = 67/114 (58.77%), Query Frame = 1
Query: 2479 SIYGILIKPEEXXXXXXXXXXXXXXXXXGYYIVMKAFYKETFNKTAIFYSIITISCWAVAVYCFIQPTSNWRKTPAVSREQNKKCIFLDFYDIHDISHFLFSIAIFFTFLTLQN 2820
            + YG++ +P +F  + L     NLL+YF +YI+MK    E     A+   + T   W  A++ F Q  S W+KTPA SRE N+ CI L F+D HDI HFL SIA+F +FL   N
Sbjct:  784 AAYGLIKRPNDFASYLLAIAICNLLLYFAFYIIMKLRSGERIKCLALVCVLFTAVVWGFALFFFFQGLSTWQKTPAESREHNRDCILLSFFDDHDIWHFLSSIAMFGSFLVSPN 897          
BLAST of SID1 transmembrane family member 1 vs. Ensembl Cavefish
Match: sidt2 (SID1 transmembrane family member 2 [Source:NCBI gene;Acc:103036191])

HSP 1 Score: 124.79 bits (312), Expect = 9.949e-29
Identity = 78/201 (38.81%), Postives = 129/201 (64.18%), Query Frame = 1
Query: 1255 AFNNMISNXXXXXXXXXXXXXTWKKHQRYNSWLNELNMSIFYYGLPKYFGLYYAMGFSLLMEGIMSALYHVCPNQRHMIFDQSYKYILVCIMMVQIYQFRHFDITASAHLFYISLAIFIFIGVIHQFFQE--IIFWSLFTVLYMFWTAILMCDIYYFDQFKINI-MLPKQVYLVIKSKKWKAFIPTYKYRMVIVVFALIIN 1848
            +FNN++SN+GY++LG+LFLLI  ++   +N  L   +++    G+PK+FGL+YAMG +L+MEG++SA YHVCPN  +  FD S+ Y++  + M+++YQ RH DI ASA+  Y  LA  IF  V+   F +    FW +F+V+++  T +L   +YY  +++++  +L + +YL+      +   P Y  RMV++V   I+N
Sbjct:  599 SFNNILSNLGYVMLGLLFLLIILQRDIIHNRALMRNDINALECGIPKHFGLFYAMGTALMMEGLLSACYHVCPNYTNFQFDTSFMYMIAGLCMLKLYQKRHPDINASAYTAYACLAAVIFFSVLGVVFGKGNTAFWIVFSVIHILATMLLSTQLYYMGRWRLDSGILRRMLYLIYTDCIRQCSGPMYIDRMVLLVMGNIVN 799          
BLAST of SID1 transmembrane family member 1 vs. Ensembl Sea Lamprey
Match: SIDT1 (SID1 transmembrane family member 1 [Source:HGNC Symbol;Acc:HGNC:25967])

HSP 1 Score: 155.606 bits (392), Expect = 5.517e-41
Identity = 91/257 (35.41%), Postives = 156/257 (60.70%), Query Frame = 1
Query:  994 TKKRCLTQNNPECEKKLIYLSDLTKTNPMHLEQEFFMYIWYLIVISIFNLPSAIQMIWNFYRNFITNGNQDICFYNFRCARPFFVFPAFNNMISNXXXXXXXXXXXXXTWKKHQRYNSWLNELNMSIFYYGLPKYFGLYYAMGFSLLMEGIMSALYHVCPNQRHMIFDQSYKYILVCIMMVQIYQFRHFDITASAHLFYISLAIFIFIGVIHQFFQE--IIFWSLFTVLYMFWTAILMCDIYYFDQFKINIMLPKQV 1758
            T +  L+  N    K  +Y+SDL++     + +++ +Y W L+ + +F +   IQ++  +     T G+QDIC+YNF CARP  +  +FNN+ SN+GY LLG+LFLLI   +   +   + +    +  +GLPK+FGL+Y+MGF+L+MEG++SA YHVCPN  +  FD ++ YI+  + M+++YQ RH D+ ASA+  Y S A+ IF  V+     +  + FW L T++++     L   IY+  +++ ++ + + +
Sbjct:   24 TLEDMLSDKNVIRSKACLYVSDLSRKRATVIRRKYRIYCWNLLTVGVFYVLPVIQLVLTYQNVLHTTGDQDICYYNFLCARPLGMLSSFNNVFSNLGYFLLGLLFLLIVGFREFSHQLAVRKDPAHLQDHGLPKHFGLFYSMGFALMMEGVLSACYHVCPNYSNFQFDTAFMYIIAGLCMLKLYQKRHSDVNASAYKAYASFAVIIFFAVLGVVVAKSAVWFWILCTIVHILAALALSFHIYHVGRWRFSLGIFRTI 280          

HSP 2 Score: 67.3958 bits (163), Expect = 7.578e-12
Identity = 44/133 (33.08%), Postives = 70/133 (52.63%), Query Frame = 1
Query: 2419 VKELIYFNFLNEFEFKYLYRSIYGILIKPEEXXXXXXXXXXXXXXXXXGYYIVMKAFYK--ETFNKTAIFYSIITISCWAVAVYCFIQPTSNWRKTPAVSREQNKKCIFLDFYDIHDISHFLFSIAIFFTFLT 2811
            +  LI     N F + Y   +I+G++ +P +F  + L     NL       ++  AF +  E+   T +   +     W  A+Y F Q  ++W +T A SRE+NK+C+ L FYD HDI HF+ SIA+F +F+ 
Sbjct:  298 MDRLILLLLGNAFNWSY---AIWGMVYRPRDFDSYLLAIFMSNL-------LLYSAFIRSGESIRPTPLLCILAASVAWGFAMYFFFQGLTSWEETAAQSRERNKECVLLKFYDHHDIWHFISSIAMFLSFMV 420          
BLAST of SID1 transmembrane family member 1 vs. Ensembl Sea Lamprey
Match: SIDT1 (SID1 transmembrane family member 1 [Source:HGNC Symbol;Acc:HGNC:25967])

HSP 1 Score: 154.066 bits (388), Expect = 1.288e-40
Identity = 94/275 (34.18%), Postives = 159/275 (57.82%), Query Frame = 1
Query: 1036 KKLIYLSDLTKTNPMHLEQEFFMYIWYLIVISIFNLPSAIQMIWNFYRNFITNGNQDICFYNFRCARPFFVFPAFNNMISNXXXXXXXXXXXXXTWKKHQRYNSWLNELNMSIFYYGLPKYFGLYYAMGFSLLMEGIMSALYHVCPNQRHMIFDQSYKYILVCIMMVQIYQFRHFDITASAHLFYISLAIFIFIGVIHQFFQE--IIFWSLFTVLYMFWTAILMCDIYYFDQF-------KINIMLPKQVYLVIKSKKWKAFIPTYKYRMVIVVF 1833
            +  +Y+SDL++     + +++ +Y W L+ + +F +   IQ++  +     T G+QDIC+YNF CARP  +  +FNN+ SN+GY LLG+LFLLI             E +  +  +GLPK+FGL+Y+MGF+L+MEG++SA YHVCPN  +  FD ++ YI+  + M+++YQ RH D+ ASA+  Y S A+ IF  V+     +  + FW L T++++     L   IY+  ++       ++N+       +V+    W A  P ++   +I++ 
Sbjct:    6 QACLYVSDLSRKRATVIRRKYRIYCWNLLTVGVFYVLPVIQLVLTYQNVLHTTGDQDICYYNFLCARPLGMLSSFNNVFSNLGYFLLGLLFLLIVG---------FREFSHQLADHGLPKHFGLFYSMGFALMMEGVLSACYHVCPNYSNFQFDTAFMYIIAGLCMLKLYQKRHSDVNASAYKAYASFAVIIFFAVLGVVVAKSAVWFWILCTIVHILAALALSFHIYHVGRWRFTCNHARVNVSCLSLSPIVVGGGGWAA--PRHRQDRLILLL 269          

HSP 2 Score: 70.0922 bits (170), Expect = 8.423e-13
Identity = 46/135 (34.07%), Postives = 73/135 (54.07%), Query Frame = 1
Query: 2422 KELIYFNFLNEFEFKYLYRSIYGILIKPEEXXXXXXXXXXXXXXXXXGYYIVMKAFY-----KETFNKTAIFYSIITISCWAVAVYCFIQPTSNWRKTPAVSREQNKKCIFLDFYDIHDISHFLFSIAIFFTFLT 2811
              LI     N F + Y   +I+G++ +P +F  + L     NLL+Y  + I++ A +      E+   T +   +     W  A+Y F Q  ++W +T A SRE+NK+C+ L FYD HDI HF+ SIA+F +F+ 
Sbjct:  263 DRLILLLLGNAFNWSY---AIWGMVYRPRDFDSYLLAIFMSNLLLYSAFDIIVVARFTLIRSGESIRPTPLLCILAASVAWGFAMYFFFQGLTSWEETAAQSRERNKECVLLKFYDHHDIWHFISSIAMFLSFMV 394          
BLAST of SID1 transmembrane family member 1 vs. Ensembl Nematostella
Match: EDO43450 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RYF1])

HSP 1 Score: 75.8702 bits (185), Expect = 2.493e-15
Identity = 41/109 (37.61%), Postives = 68/109 (62.39%), Query Frame = 1
Query: 2479 SIYGILIKPEEXXXXXXXXXXXXXXXXXGYYIVMKAFYKETFNKTAIFYSIITISCWAVAVYCFIQPTSNWRKTPAVSREQNKKCIFLDFYDIHDISHFLFSIAIFFTF 2805
            +I G++I+P +F  + L  L +N L+Y G+Y++MK   KE         S +++ CW  A+  F +  ++W+++PA SRE N  C+ + FYD HD+ HFL + A+FF+F
Sbjct:   95 AINGVVIEPRDFATYLLAILIVNGLLYIGFYVIMKLRNKERILPLPFVVSGLSLLCWIAALVFFFKRLTSWQESPAHSREGNSHCLLMGFYDDHDVWHFLSACAMFFSF 203          
BLAST of SID1 transmembrane family member 1 vs. Ensembl Nematostella
Match: EDO30767 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SZV2])

HSP 1 Score: 63.1586 bits (152), Expect = 4.836e-10
Identity = 41/161 (25.47%), Postives = 82/161 (50.93%), Query Frame = 1
Query: 1105 YIWYLIVISIFNLPSAIQMIWNFYRNFITNGNQDICFYNFRCARP--FFVFPAFNNMISNX---------XXXXXXXXXXXXTWKKHQRYNSWLNELNMSIFYYGLPKYFGLYYAMGFSLLMEGIMSALYHVCPNQRHMIFDQSYKYILVCIMMVQIYQFR 1554
            Y +   V++I  +  + Q +   + + I +G++D CFYN RC RP  F   P+ N M+SN+                  + + + K +R       +N+ +    +P  + + YA+ ++L+ +GI SA YH+CP++    FD ++ +I+  ++++ +Y  R
Sbjct:  367 YSYLTAVLAIAFMVGSAQFVIGRWSDMIASGDRDKCFYNERCYRPIAFADLPS-NFMVSNVPYVLHGVILSISFSLREAIALDFYKPKR------GINLQVKGEHVPYDYSIAYALSWALIFQGIFSATYHLCPSRMTFQFDSAFMFIISGLVVIALYNSR 520          

HSP 2 Score: 51.2174 bits (121), Expect = 1.933e-6
Identity = 25/63 (39.68%), Postives = 39/63 (61.90%), Query Frame = 1
Query: 2617 IFYSIITISCWAVAVYCF-IQPTSNWRKTPAVSREQNKKCIFLDFYDIHDISHFLFSIAIFFT 2802
            +F+ I+    W  A+Y F ++PT+     P+ SR +N++CI  DF+D HDI H L S A+F +
Sbjct:  694 VFFMIVLFLFWVFAMYFFKLKPTTKKTAAPSFSRTRNQECILWDFFDYHDIWHMLSSFALFMS 756          
BLAST of SID1 transmembrane family member 1 vs. Ensembl Nematostella
Match: EDO27616 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T8S0])

HSP 1 Score: 50.0618 bits (118), Expect = 4.399e-8
Identity = 19/44 (43.18%), Postives = 33/44 (75.00%), Query Frame = 1
Query: 1369 SIFYYGLPKYFGLYYAMGFSLLMEGIMSALYHVCPNQRHMIFDQ 1500
            S+ + G+P+++ ++YAM  +L+MEG++SA YHVCPN  +  F +
Sbjct:   11 SLQHNGIPQHYQIFYAMAMALVMEGVLSACYHVCPNNSNFQFGK 54          
BLAST of SID1 transmembrane family member 1 vs. Ensembl Medaka
Match: sidt2 (SID1 transmembrane family member 2 [Source:NCBI gene;Acc:101171099])

HSP 1 Score: 177.948 bits (450), Expect = 1.615e-45
Identity = 112/312 (35.90%), Postives = 181/312 (58.01%), Query Frame = 1
Query:  922 KSVSSENRFRILSDFSSVNSHAGTTKKRCLTQNNPECEKKLIYLSDLTKTNPMHLEQEFFMYIWYLIVISIFNLPSAIQMIWNFYRNFITNGNQDICFYNFRCARPFFVFPAFNNMISNXXXXXXXXXXXXXTWKKHQRYNSWLNELNMSIFYYGLPKYFGLYYAMGFSLLMEGIMSALYHVCPNQRHMIFDQSYKYILVCIMMVQIYQFRHFDITASAHLFYISLAIFIFIGVIHQFFQE--IIFWSLFTVLYMFWTAILMCDIYYFDQFKINI-MLPKQVYLVIKSKKWKAFIPTYKYRMVIVVFALIIN 1848
            +S+ S  R R  S  SSV      T     +  N    KK + ++DL++ +   L +++ +Y W +  I++F     IQ++  +       GNQD+C+YNF CA P     AFNN+ SN+GY++LG+LFLLI  ++   +   L+  +++    G+PK+FGLYYAMG +L+MEG++SA YHVCPN  +  FD S+ Y++  + M+++YQ RH DI ASA+  Y  LA  IF  VI   F     +FW +F+V+++  T +L   +YY  +++++  +L + VY++      +   P Y  RMV++V   I+N
Sbjct:  420 RSLDSIARSRQES-LSSVEEEDYDTLDDIDSDKNIVRTKKYLSVADLSRKDKRVLSKKYQIYFWNIATIAVFYALPVIQLVITYQTAVNITGNQDLCYYNFLCAHPLGALSAFNNIFSNLGYVMLGLLFLLIVLQREIVHKQALDRNDLNALECGIPKHFGLYYAMGTALMMEGLLSACYHVCPNYTNFQFDTSFMYMIAGLCMLKLYQKRHPDINASAYTAYACLAAVIFFSVIGVVFGRGNTVFWIVFSVIHILATLLLSTQLYYMGRWRLDSGILRRIVYVIYTDCIRQCSGPMYIDRMVLLVMGNIVN 730          

HSP 2 Score: 86.2705 bits (212), Expect = 9.692e-17
Identity = 52/125 (41.60%), Postives = 74/125 (59.20%), Query Frame = 1
Query: 2479 SIYGILIKPEEXXXXXXXXXXXXXXXXXGYYIVMKAFYKETFNKTAIFYSIITISCWAVAVYCFIQPTSNWRKTPAVSREQNKKCIFLDFYDIHDISHFLFSIAIFFTFLTLQNMDNCLENQEMN 2853
            + YG++ +P +F  + L     NLL+YF +YI+MK    E      +   + T   W  A+Y F Q  S W+KTPA SRE N+ CI L F+D HDI HFL SIA+F +FL L  MD+ L++ + +
Sbjct:  734 AAYGLIQRPNDFASYLLAIAICNLLLYFAFYIIMKLRSGERIKCLPLVCILFTAVVWGFALYFFFQGLSTWQKTPAESREHNRNCILLSFFDDHDIWHFLSSIAMFGSFLVLLTMDDDLDSVQRD 858          
BLAST of SID1 transmembrane family member 1 vs. Ensembl Medaka
Match: sidt2 (SID1 transmembrane family member 2 [Source:NCBI gene;Acc:101171099])

HSP 1 Score: 177.563 bits (449), Expect = 1.902e-45
Identity = 112/312 (35.90%), Postives = 181/312 (58.01%), Query Frame = 1
Query:  922 KSVSSENRFRILSDFSSVNSHAGTTKKRCLTQNNPECEKKLIYLSDLTKTNPMHLEQEFFMYIWYLIVISIFNLPSAIQMIWNFYRNFITNGNQDICFYNFRCARPFFVFPAFNNMISNXXXXXXXXXXXXXTWKKHQRYNSWLNELNMSIFYYGLPKYFGLYYAMGFSLLMEGIMSALYHVCPNQRHMIFDQSYKYILVCIMMVQIYQFRHFDITASAHLFYISLAIFIFIGVIHQFFQE--IIFWSLFTVLYMFWTAILMCDIYYFDQFKINI-MLPKQVYLVIKSKKWKAFIPTYKYRMVIVVFALIIN 1848
            +S+ S  R R  S  SSV      T     +  N    KK + ++DL++ +   L +++ +Y W +  I++F     IQ++  +       GNQD+C+YNF CA P     AFNN+ SN+GY++LG+LFLLI  ++   +   L+  +++    G+PK+FGLYYAMG +L+MEG++SA YHVCPN  +  FD S+ Y++  + M+++YQ RH DI ASA+  Y  LA  IF  VI   F     +FW +F+V+++  T +L   +YY  +++++  +L + VY++      +   P Y  RMV++V   I+N
Sbjct:  429 RSLDSIARSRQES-LSSVEEEDYDTLDDIDSDKNIVRTKKYLSVADLSRKDKRVLSKKYQIYFWNIATIAVFYALPVIQLVITYQTAVNITGNQDLCYYNFLCAHPLGALSAFNNIFSNLGYVMLGLLFLLIVLQREIVHKQALDRNDLNALECGIPKHFGLYYAMGTALMMEGLLSACYHVCPNYTNFQFDTSFMYMIAGLCMLKLYQKRHPDINASAYTAYACLAAVIFFSVIGVVFGRGNTVFWIVFSVIHILATLLLSTQLYYMGRWRLDSGILRRIVYVIYTDCIRQCSGPMYIDRMVLLVMGNIVN 739          

HSP 2 Score: 86.2705 bits (212), Expect = 9.933e-17
Identity = 52/125 (41.60%), Postives = 74/125 (59.20%), Query Frame = 1
Query: 2479 SIYGILIKPEEXXXXXXXXXXXXXXXXXGYYIVMKAFYKETFNKTAIFYSIITISCWAVAVYCFIQPTSNWRKTPAVSREQNKKCIFLDFYDIHDISHFLFSIAIFFTFLTLQNMDNCLENQEMN 2853
            + YG++ +P +F  + L     NLL+YF +YI+MK    E      +   + T   W  A+Y F Q  S W+KTPA SRE N+ CI L F+D HDI HFL SIA+F +FL L  MD+ L++ + +
Sbjct:  743 AAYGLIQRPNDFASYLLAIAICNLLLYFAFYIIMKLRSGERIKCLPLVCILFTAVVWGFALYFFFQGLSTWQKTPAESREHNRNCILLSFFDDHDIWHFLSSIAMFGSFLVLLTMDDDLDSVQRD 867          
BLAST of SID1 transmembrane family member 1 vs. Ensembl Medaka
Match: sidt2 (SID1 transmembrane family member 2 [Source:NCBI gene;Acc:101171099])

HSP 1 Score: 177.563 bits (449), Expect = 2.475e-45
Identity = 112/312 (35.90%), Postives = 181/312 (58.01%), Query Frame = 1
Query:  922 KSVSSENRFRILSDFSSVNSHAGTTKKRCLTQNNPECEKKLIYLSDLTKTNPMHLEQEFFMYIWYLIVISIFNLPSAIQMIWNFYRNFITNGNQDICFYNFRCARPFFVFPAFNNMISNXXXXXXXXXXXXXTWKKHQRYNSWLNELNMSIFYYGLPKYFGLYYAMGFSLLMEGIMSALYHVCPNQRHMIFDQSYKYILVCIMMVQIYQFRHFDITASAHLFYISLAIFIFIGVIHQFFQE--IIFWSLFTVLYMFWTAILMCDIYYFDQFKINI-MLPKQVYLVIKSKKWKAFIPTYKYRMVIVVFALIIN 1848
            +S+ S  R R  S  SSV      T     +  N    KK + ++DL++ +   L +++ +Y W +  I++F     IQ++  +       GNQD+C+YNF CA P     AFNN+ SN+GY++LG+LFLLI  ++   +   L+  +++    G+PK+FGLYYAMG +L+MEG++SA YHVCPN  +  FD S+ Y++  + M+++YQ RH DI ASA+  Y  LA  IF  VI   F     +FW +F+V+++  T +L   +YY  +++++  +L + VY++      +   P Y  RMV++V   I+N
Sbjct:  450 RSLDSIARSRQES-LSSVEEEDYDTLDDIDSDKNIVRTKKYLSVADLSRKDKRVLSKKYQIYFWNIATIAVFYALPVIQLVITYQTAVNITGNQDLCYYNFLCAHPLGALSAFNNIFSNLGYVMLGLLFLLIVLQREIVHKQALDRNDLNALECGIPKHFGLYYAMGTALMMEGLLSACYHVCPNYTNFQFDTSFMYMIAGLCMLKLYQKRHPDINASAYTAYACLAAVIFFSVIGVVFGRGNTVFWIVFSVIHILATLLLSTQLYYMGRWRLDSGILRRIVYVIYTDCIRQCSGPMYIDRMVLLVMGNIVN 760          

HSP 2 Score: 86.2705 bits (212), Expect = 1.054e-16
Identity = 52/125 (41.60%), Postives = 74/125 (59.20%), Query Frame = 1
Query: 2479 SIYGILIKPEEXXXXXXXXXXXXXXXXXGYYIVMKAFYKETFNKTAIFYSIITISCWAVAVYCFIQPTSNWRKTPAVSREQNKKCIFLDFYDIHDISHFLFSIAIFFTFLTLQNMDNCLENQEMN 2853
            + YG++ +P +F  + L     NLL+YF +YI+MK    E      +   + T   W  A+Y F Q  S W+KTPA SRE N+ CI L F+D HDI HFL SIA+F +FL L  MD+ L++ + +
Sbjct:  764 AAYGLIQRPNDFASYLLAIAICNLLLYFAFYIIMKLRSGERIKCLPLVCILFTAVVWGFALYFFFQGLSTWQKTPAESREHNRNCILLSFFDDHDIWHFLSSIAMFGSFLVLLTMDDDLDSVQRD 888          
BLAST of SID1 transmembrane family member 1 vs. Ensembl Medaka
Match: sidt2 (SID1 transmembrane family member 2 [Source:NCBI gene;Acc:101171099])

HSP 1 Score: 60.077 bits (144), Expect = 8.069e-9
Identity = 74/333 (22.22%), Postives = 142/333 (42.64%), Query Frame = 1
Query:  436 IDNFLIKLNQNQSVSITIYTPVYYLFKFDSKKQTIVIHVQSK-DEICMNLGIQNHVEPVQDDYRHIKPYYIHQTMSKETTLVIKKGKFISSNSILIIFMLNKMAEKCANFFSLSQKPWPEM-------KHFNFHITE-LKTD-YMLPIFLAIGFYLSFYV----IAC------------------------LAMVGDHFIKS-----VSSENRFRILS-----DFSSVNSHAGTTKKRCLTQNNPECEKKLIYLSDLTKTNPMHLEQEFFMYIWYLIV----ISIFNLPSAIQMIWNFYRNFITNGNQDICFYNFRCARPFFVFPAFNNMISN 1278
            +++F ++ ++  + S +   P Y+ + F     T+++ V S  +  C  + IQ+   PV D   ++    ++QTM+K+  + +++  F  SNS  ++ ++    E C     L      E+       K  +  ++  + +D Y++ +   +G +LS Y+    +AC                        L + G   +K+     +SSE     ++       SSV      T     +  N    KK + ++DL++ +   L +    +I  + V    I++F     IQ++  +       GNQD+C+YNF CA P     AFNN+ SN
Sbjct:  170 VESFTLQTDKRFTFSASPSQPQYFKYVFPDGVDTVIVKVDSDMNFPCSVMSIQDIQCPVYDLDNNVAFIGMYQTMTKKGAITVQRKDF-PSNSFYVVVVVKTEDEACGGPLRLYPLRPDELIDAGNRSKVLDVLVSRAISSDTYVMGVLFCLGIFLSLYLLTLLVACVENKRDQRLVRFAVNLVKSRLQPPLGVAGVSQLKAPSAPLLSSERSLDSIARSRQESLSSVEEEDYDTLDDIDSDKNIVRTKKYLSVADLSRKDKRVLSRLPKPHIQMIAVNIATIAVFYALPVIQLVITYQTAVNITGNQDLCYYNFLCAHPLGALSAFNNIFSN 501          
BLAST of SID1 transmembrane family member 1 vs. Planmine SMEST
Match: SMESG000041572.1 (SMESG000041572.1)

HSP 1 Score: 1190.25 bits (3078), Expect = 0.000e+0
Identity = 615/617 (99.68%), Postives = 616/617 (99.84%), Query Frame = 1
Query:   13 MKVLLFILIIICERFTVENHFXXXXXXXXXXXXXXXXSVRNTSIIFYEYNNLSTKEAALRVYIECDLKPHESISIIIKQDNSYLLSMELFQINNEVPVKAARTIHLFNEAKNHNYSSNHSTSIEVSSKSLRKIAVKIQIKWIDNFLIKLNQNQSVSITIYTPVYYLFKFDSKKQTIVIHVQSKDEICMNLGIQNHVEPVQDDYRHIKPYYIHQTMSKETTLVIKKGKFISSNSILIIFMLNKMAEKCANFFSLSQKPWPEMKHFNFHITELKTDYMLPIFLAIGFYLSFYVIACLAMVGDHFIKSVSSENRFRILSDFSSVNSHAGTTKKRCLTQNNPECEKKLIYLSDLTKTNPMHLEQEFFMYIWYLIVISIFNLPSAIQMIWNFYRNFITNGNQDICFYNFRCARPFFVFPAFNNMISNXXXXXXXXXXXXXTWKKHQRYNSWLNELNMSIFYYGLPKYFGLYYAMGFSLLMEGIMSALYHVCPNQRHMIFDQSYKYILVCIMMVQIYQFRHFDITASAHLFYISLAIFIFIGVIHQFFQEIIFWSLFTVLYMFWTAILMCDIYYFDQFKINIMLPKQVYLVIKSKKWKAFIPTYKYRMVIVVFALIINGTMKI 1863
            MKVLLFILIIICERFTVENHFYNIYNGIINEVNEINISVRNTSIIFYEYNNLSTKEAALRVYIECDLKPHESISIIIKQDNSYLLSMELFQINNEVPVKAARTIHLFNEAKNHNYSSNHSTSIEVSSKSLRKIAVKIQIKWIDNFLIKLNQNQSVSITIYTPVYYLFKFDSKKQTIVIHVQSKDEICMNLGIQNHVEPVQDDYRHIKPYYIHQTMSKETTLVIKKGKFISSNSILIIFMLNKMAEKCANFFSLSQKPWPEMKHFNFHITELKTDYMLPIFLAIGFYLSFYVIACLAMVGDHFIKSVSSENRFRILSDFSSVNSHAGTTKKRCLTQNNPECEKKLIYLSDLTKTNPMHLEQEFFMYIWYLIVISIFNLPSAIQMIWNFYRNFITNGNQDICFYNFRCARPFFVFPAFNNMISNIGYILLGILFLLITWKKHQRYNSWLNELNMSIFYYGLPKYFGLYYAMGFSLLMEGIMSALYHVCPNQRHMIFDQSYKYILVCIMMVQIYQFRHFDITASAHLFYISLAIFIFIGVIHQFFQEIIFWSLFTVLYMFWTAILMCDIYYFDQFKINIMLPKQVYLVIKSKKWKAFIPTYKYRMVIVVFALIINGT+ I
Sbjct:    1 MKVLLFILIIICERFTVENHFYNIYNGIINEVNEINISVRNTSIIFYEYNNLSTKEAALRVYIECDLKPHESISIIIKQDNSYLLSMELFQINNEVPVKAARTIHLFNEAKNHNYSSNHSTSIEVSSKSLRKIAVKIQIKWIDNFLIKLNQNQSVSITIYTPVYYLFKFDSKKQTIVIHVQSKDEICMNLGIQNHVEPVQDDYRHIKPYYIHQTMSKETTLVIKKGKFISSNSILIIFMLNKMAEKCANFFSLSQKPWPEMKHFNFHITELKTDYMLPIFLAIGFYLSFYVIACLAMVGDHFIKSVSSENRFRILSDFSSVNSHAGTTKKRCLTQNNPECEKKLIYLSDLTKTNPMHLEQEFFMYIWYLIVISIFNLPSAIQMIWNFYRNFITNGNQDICFYNFRCARPFFVFPAFNNMISNIGYILLGILFLLITWKKHQRYNSWLNELNMSIFYYGLPKYFGLYYAMGFSLLMEGIMSALYHVCPNQRHMIFDQSYKYILVCIMMVQIYQFRHFDITASAHLFYISLAIFIFIGVIHQFFQEIIFWSLFTVLYMFWTAILMCDIYYFDQFKINIMLPKQVYLVIKSKKWKAFIPTYKYRMVIVVFALIINGTISI 617          

HSP 2 Score: 220.705 bits (561), Expect = 1.763e-60
Identity = 125/125 (100.00%), Postives = 125/125 (100.00%), Query Frame = 1
Query: 2479 SIYGILIKPEEXXXXXXXXXXXXXXXXXGYYIVMKAFYKETFNKTAIFYSIITISCWAVAVYCFIQPTSNWRKTPAVSREQNKKCIFLDFYDIHDISHFLFSIAIFFTFLTLQNMDNCLENQEMN 2853
            SIYGILIKPEEFPLFFLTFLSLNLLIYFGYYIVMKAFYKETFNKTAIFYSIITISCWAVAVYCFIQPTSNWRKTPAVSREQNKKCIFLDFYDIHDISHFLFSIAIFFTFLTLQNMDNCLENQEMN
Sbjct:  616 SIYGILIKPEEFPLFFLTFLSLNLLIYFGYYIVMKAFYKETFNKTAIFYSIITISCWAVAVYCFIQPTSNWRKTPAVSREQNKKCIFLDFYDIHDISHFLFSIAIFFTFLTLQNMDNCLENQEMN 740          
BLAST of SID1 transmembrane family member 1 vs. Planmine SMEST
Match: SMESG000041575.1 (SMESG000041575.1)

HSP 1 Score: 380.563 bits (976), Expect = 1.946e-118
Identity = 233/612 (38.07%), Postives = 353/612 (57.68%), Query Frame = 1
Query:  136 TSIIFYEYNNLSTKEAALRVYIECDLKPHESISIIIKQDNSYLLSMELFQINNEVPVKAARTIHLFNEAKNHNYSSNHSTSIEVSSKSLRKIAVKIQIKWIDNFLIKLNQNQSVSITIYTPVYYLFKFDSKKQTIVIHVQSKDEICMNLGIQNHVEPVQDDYRHIKPYYIHQTMSKETTLVIKKGKFISSNSILIIFMLNKMAEKCAN---FFSLSQKPWPEMKHFNFHITELKTDYMLPIFLAIGFYLSFYVIACLAMVGDHF--IKSVSSEN--------------RFRILSDFSSVNSHA------------GTTKKRCLTQNNPECEKKL----------IYLSDLTKTNPMHLEQEFFMYIWYLIVISIFNLPSAIQMIWNFYRNFITNGNQDICFYNFRCARPFFVFPAFNNMISNXXXXXXXXXXXXXTWKKHQRYNSWLNELNMSIFYYGLPKYFGLYYAMGFSLLMEGIMSALYHVCPNQRHMIFDQSYKYILVCIMMVQIYQFRHFDITASAHLFYISLAIFIFIGVIHQFFQEIIFWSLFTVLYMFWTAILMCDIYYFDQFKINIMLPKQVYLVIKSKKWKAFIPTYKYRMVIVVFALIIN 1848
            T++  Y Y     +E  LRV++E  +   +S+ IIIK D S + S EL + +N+  ++AARTI  F +        N + SIE SS+S   I V + ++ I NFLI +N  ++++IT  TP Y+LFKF    + ++++V S D  CM L IQ  V P+ D   ++K    +Q++++   +V++K  + SSN  +I+F LN    +C N      L + P    K+  FH+TE+  DY+LPI  AIGFYL FY+I  +      F  IKS  SEN               +  + + + + + +             +     L ++N   +             I++SDL+K N   +++++F+Y+WY+I+IS+F     +Q++ N+ R     GNQDICFYNFRC RP +VF AFNN++SN GY+LLGILF LITW++H  YN     L    +  G+P+Y+GL+YAMG SL MEGIMSA YHVCP+  +  FD +Y YIL  + +++IYQ RH DI A+AH FY+++A+FIFIGVI   F  +I W +FT+LY+F    L C+IY+  Q+ I++ +P Q+Y   K  KW    P +  RM+I++   I+N
Sbjct:   42 TTVAVYNY----PEEYFLRVFVESKIDILQSLVIIIKDDKSVVTSFELVRDSNQSVIRAARTICPFLQDSTVGLIRNRTLSIEFSSQSQSAINVSVTVRTI-NFLISVNDPRNLTITRNTPYYFLFKFQPTMKEVIVYVDSTDSECMILSIQESVCPIHDISGNVKFKGSYQSVTRSGAMVVQKKHYNSSN-FVIVFTLNINNYECFNKNLMQKLQKYPPIRKKYITFHVTEIIEDYLLPILGAIGFYLFFYLIFPIISFIYRFYCIKSSVSENVENSPIAHSDERPVSYETIEERADMKNMSYNDNQSYNIEVTSSVSGNQLAEDNEIIDSGFGVFVHSRLGNIFVSDLSKKNSALVDRKYFLYLWYVIIISVFYSLPVVQLVINYQRTLEVTGNQDICFYNFRCTRPLYVFIAFNNVMSNCGYVLLGILFTLITWRRHSLYNECKLRLCKKDYNLGIPQYYGLFYAMGVSLTMEGIMSACYHVCPSHDNFQFDTAYMYILASLCLIKIYQIRHPDIDATAHSFYMTMALFIFIGVIGVIFNRLILWIIFTMLYLFGLMFLSCEIYFLGQWNIDVKVPIQIYNRFKQDKWLILCPDHVVRMIIILIFNIVN 647          

HSP 2 Score: 97.8265 bits (242), Expect = 1.627e-20
Identity = 52/119 (43.70%), Postives = 82/119 (68.91%), Query Frame = 1
Query: 2479 SIYGILIKPEEXXXXXXXXXXXXXXXXXGYYIVMKAFYKETFNKTAIFYSIITISCWAVAVYCFIQPTSNWRKTPAVSREQNKKCIFLDFYDIHDISHFLFSIAIFFTFLTLQNMDNCL 2835
            +++G +IKP  F  +FL    +NLL+YF  Y+++K  Y E+    +I Y +I + CW  A+YCFI+  ++W ++PA SR  N+ C+ L+FYDIHDI HFL S+++FF+F+ L N+D+ L
Sbjct:  651 ALFGAIIKPSNFSSYFLAIFMINLLLYFFIYVILKIIYCESIYYLSILYVLIAMVCWGFALYCFIKHPTDWEQSPASSRAFNQNCLLLNFYDIHDIWHFLSSLSMFFSFMALLNIDDGL 769          
BLAST of SID1 transmembrane family member 1 vs. Planmine SMEST
Match: SMESG000075887.1 (SMESG000075887.1)

HSP 1 Score: 295.049 bits (754), Expect = 7.944e-87
Identity = 209/615 (33.98%), Postives = 327/615 (53.17%), Query Frame = 1
Query:  139 SIIFYEYNNLSTKEAALRVYIECDLKPHESISIIIKQDNSYLLSMELFQINNEVPVKAARTIHLFNEAKNHNYSSNHSTSIEVSSKSLRKIAVKIQIKWIDNFLIKLNQNQSVSITIYTPVYYLFKFDSKKQTIVIHVQSKDEICMNLGIQNHVEPVQDDYRHIKPYYIHQTMSKETTLVIKKGKFISS-----NSILIIFMLNKMAEKCANFFSLSQKPWPEMKHFNFHITELKTDYMLPIFLAIGFYLSFYVIA---------CLAMVGDHFIKSVSSENRFRILSDFSSVNSHA--GTTKKRCL---------------------------TQNNPECEKKLIYLSDLTKTNPMHLEQEFFMYIWYLIVISIFNLPSAIQMIWNFYRNFITNGNQDICFYNFRCARPFFVFPAFNNMISNXXXXXXXXXXXXXTWKKHQRYNSWLNELNMSIFYYGLPKYFGLYYAMGFSLLMEGIMSALYHVCPNQRHMIFDQSYKYILVCIMMVQIYQFRHFDITASAHLFYISLAIFIFIGVIH--QFFQEIIFWSLFTVLYMFWTAILMCDIYYFDQFKINIMLPKQVYLVIKSKKWKAFIPTYKYRMVIVVFALIIN 1848
            S ++YEY+  ST    LRV ++ D   + S+ IIIK  N  + S+++ +IN+   + A RT+  F + + +        S+EVS+ S     V I +  +DNF +K+N  ++ +IT Y+P ++LF+  + K    ++V+S D  CM   IQ    P+     +I  + I +  S     V + G   ++         ++F+++ +   C    +L      E K F   I++    Y LP+F AIGF+L FY+ +         C   +     + +  E+       + S+  HA   T   R L                           T +N     K + LSD ++ N   L++++F+Y WYLIVIS+F     +Q++  +  NF   G+QD C+YNFRC +P+++F AFNN+ISNIGY+LLGILF L+TW++   Y             +G+P+YFGL+YAMG SL MEGIMSA YH+CP+  +  FD +Y YIL C+ M++IYQ RH DI A+AH F++++A+FIF+ VI     +  IIFW  F +LY+     L  ++YY   +K++  + K++Y +I   KWK FIPTYK RM I+ F   +N
Sbjct:   44 SFVYYEYSPRST----LRVQVKVDSNLNASLLIIIKDQNRIVSSIDIPKINH---ILAERTVCPFPDLREN---KTRLMSLEVSTSSSVLTVVTILVLVVDNFQLKVNIKRNFTITQYSPSFFLFELKN-KYIYKLYVESSDNTCMIFSIQEAKCPI-----NIYDHKIIELNSVAYQTVTRIGSITTAYETKLEKAYVVFVVD-VTGACGTLATLKNITVVE-KSFTLLISQHDKTYYLPVFGAIGFFLIFYLFSPIISFIYMRCYKNLNSKVDEEMLIESSMESPVSYGSIIDHADIATINNRILLPQSESNNLYYRRENSDNSYDSLSDVYTDSNVFRLNKNVRLSDFSRKNRAVLDRKYFLYFWYLIVISVFYGLPVVQLVIKYQENFDKTGDQDTCYYNFRCVKPYYIFSAFNNVISNIGYVLLGILFTLLTWRREIYYKEGSKS-------HGVPQYFGLFYAMGVSLTMEGIMSACYHICPSNNNFQFDTAYMYILACLCMIKIYQTRHPDINATAHSFFMTMALFIFVSVIGVVTMYNRIIFWIFFLILYLCICGFLTSEVYYMGCWKLDFQIFKRIYNMILLDKWKIFIPTYKRRMAILSFFNAVN 633          

HSP 2 Score: 129.413 bits (324), Expect = 1.897e-30
Identity = 65/125 (52.00%), Postives = 96/125 (76.80%), Query Frame = 1
Query: 2479 SIYGILIKPEEXXXXXXXXXXXXXXXXXGYYIVMKAFYKETFNKTAIFYSIITISCWAVAVYCFIQPTSNWRKTPAVSREQNKKCIFLDFYDIHDISHFLFSIAIFFTFLTLQNMDNCLENQEMN 2853
            S+YGI+ KP+ FP +FL    +NLL+YFG+YI+MK  + E F++ ++FY I++I CWA A+YCFI   ++W+K P++SR +NK C+F DFYDIHD  HFL ++++FF+F+ LQNMD+CL + E N
Sbjct:  637 SLYGIIAKPKNFPSYFLAVFMVNLLLYFGFYILMKVIHSERFHRISLFYVIVSILCWATALYCFINHPTDWQKPPSLSRIENKDCLFFDFYDIHDTWHFLSAMSMFFSFMGLQNMDDCLIHTERN 761          
BLAST of SID1 transmembrane family member 1 vs. Planmine SMEST
Match: SMESG000075887.1 (SMESG000075887.1)

HSP 1 Score: 294.664 bits (753), Expect = 1.372e-86
Identity = 209/614 (34.04%), Postives = 333/614 (54.23%), Query Frame = 1
Query:  139 SIIFYEYNNLSTKEAALRVYIECDLKPHESISIIIKQDNSYLLSMELFQINNEVPVKAARTIHLFNEAKNHNYSSNHSTSIEVSSKSLRKIAVKIQIKWIDNFLIKLNQNQSVSITIYTPVYYLFKFDSKKQTIVIHVQSKDEICMNLGIQNHVEPVQDDYRHIKPYYIHQTMSKETTLVIKKGKFISS-----NSILIIFMLNKMAEKCANFFSLSQKPWPEMKHFNFHITELKTDYMLPIFLAIGFYLSFYVIA-CLAMVGDHFIKSVSSENRFRILS-------DFSSVNSHA--GTTKKRCL---------------------------TQNNPECEKKLIYLSDLTKTNPMHLEQEFFMYIWYLIVISIFNLPSAIQMIWNFYRNFITNGNQDICFYNFRCARPFFVFPAFNNMISNXXXXXXXXXXXXXTWKKHQRYNSWLNELNMSIFYYGLPKYFGLYYAMGFSLLMEGIMSALYHVCPNQRHMIFDQSYKYILVCIMMVQIYQFRHFDITASAHLFYISLAIFIFIGVIH--QFFQEIIFWSLFTVLYMFWTAILMCDIYYFDQFKINIMLPKQVYLVIKSKKWKAFIPTYKYRMVIVVFALIIN 1848
            S ++YEY+  ST    LRV ++ D   + S+ IIIK  N  + S+++ +IN+   + A RT+  F + + +        S+EVS+ S     V I +  +DNF +K+N  ++ +IT Y+P ++LF+  + K    ++V+S D  CM   IQ    P+     +I  + I +  S     V + G   ++         ++F+++ +   C    +L      E K F   I++    Y LP+F AIGF+L FY+ +  ++ +     K+++S++   ++         + S+  HA   T   R L                           T +N     K + LSD ++ N   L++++F+Y WYLIVIS+F     +Q++  +  NF   G+QD C+YNFRC +P+++F AFNN+ISNIGY+LLGILF L+TW++   Y             +G+P+YFGL+YAMG SL MEGIMSA YH+CP+  +  FD +Y YIL C+ M++IYQ RH DI A+AH F++++A+FIF+ VI     +  IIFW  F +LY+     L  ++YY   +K++  + K++Y +I   KWK FIPTYK RM I+ F   +N
Sbjct:   44 SFVYYEYSPRST----LRVQVKVDSNLNASLLIIIKDQNRIVSSIDIPKINH---ILAERTVCPFPDLREN---KTRLMSLEVSTSSSVLTVVTILVLVVDNFQLKVNIKRNFTITQYSPSFFLFELKN-KYIYKLYVESSDNTCMIFSIQEAKCPI-----NIYDHKIIELNSVAYQTVTRIGSITTAYETKLEKAYVVFVVD-VTGACGTLATLKNITVVE-KSFTLLISQHDKTYYLPVFGAIGFFLIFYLFSPIISFIYMRCYKNLNSKDEEMLIESSMESPVSYGSIIDHADIATINNRILLPQSESNNLYYRRENSDNSYDSLSDVYTDSNVFRLNKNVRLSDFSRKNRAVLDRKYFLYFWYLIVISVFYGLPVVQLVIKYQENFDKTGDQDTCYYNFRCVKPYYIFSAFNNVISNIGYVLLGILFTLLTWRREIYYKEGSKS-------HGVPQYFGLFYAMGVSLTMEGIMSACYHICPSNNNFQFDTAYMYILACLCMIKIYQTRHPDINATAHSFFMTMALFIFVSVIGVVTMYNRIIFWIFFLILYLCICGFLTSEVYYMGCWKLDFQIFKRIYNMILLDKWKIFIPTYKRRMAILSFFNAVN 632          

HSP 2 Score: 129.413 bits (324), Expect = 1.908e-30
Identity = 65/125 (52.00%), Postives = 96/125 (76.80%), Query Frame = 1
Query: 2479 SIYGILIKPEEXXXXXXXXXXXXXXXXXGYYIVMKAFYKETFNKTAIFYSIITISCWAVAVYCFIQPTSNWRKTPAVSREQNKKCIFLDFYDIHDISHFLFSIAIFFTFLTLQNMDNCLENQEMN 2853
            S+YGI+ KP+ FP +FL    +NLL+YFG+YI+MK  + E F++ ++FY I++I CWA A+YCFI   ++W+K P++SR +NK C+F DFYDIHD  HFL ++++FF+F+ LQNMD+CL + E N
Sbjct:  636 SLYGIIAKPKNFPSYFLAVFMVNLLLYFGFYILMKVIHSERFHRISLFYVIVSILCWATALYCFINHPTDWQKPPSLSRIENKDCLFFDFYDIHDTWHFLSAMSMFFSFMGLQNMDDCLIHTERN 760          
The following BLAST results are available for this feature:
BLAST of SID1 transmembrane family member 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SIDT12.959e-5427.79SID1 transmembrane family member 1 [Source:HGNC Sy... [more]
SIDT26.437e-5327.21SID1 transmembrane family member 2 [Source:HGNC Sy... [more]
SIDT11.118e-5227.75SID1 transmembrane family member 1 [Source:HGNC Sy... [more]
SIDT21.783e-4335.40SID1 transmembrane family member 2 [Source:HGNC Sy... [more]
SIDT21.783e-4335.40SID1 transmembrane family member 2 [Source:HGNC Sy... [more]
back to top
BLAST of SID1 transmembrane family member 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
chup-14.090e-4624.58CHolesterol UPtake associated [Source:UniProtKB/T... [more]
chup-12.007e-3325.32CHolesterol UPtake associated [Source:UniProtKB/T... [more]
chup-12.549e-3325.32CHolesterol UPtake associated [Source:UniProtKB/T... [more]
sid-15.654e-1033.70Systemic RNA interference defective protein 1 [So... [more]
sid-15.654e-1033.70Systemic RNA interference defective protein 1 [So... [more]
back to top
BLAST of SID1 transmembrane family member 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SID1 transmembrane family member 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
sidt21.744e-4435.90SID1 transmembrane family, member 2 [Source:ZFIN;A... [more]
back to top
BLAST of SID1 transmembrane family member 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SIDT23.084e-5127.79SID1 transmembrane family member 2 [Source:NCBI ge... [more]
SIDT24.600e-4829.01SID1 transmembrane family member 2 [Source:NCBI ge... [more]
SIDT21.241e-4728.31SID1 transmembrane family member 2 [Source:NCBI ge... [more]
SIDT21.857e-4728.25SID1 transmembrane family member 2 [Source:NCBI ge... [more]
SIDT21.954e-4728.25SID1 transmembrane family member 2 [Source:NCBI ge... [more]
back to top
BLAST of SID1 transmembrane family member 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Sidt15.077e-5328.18SID1 transmembrane family, member 1 [Source:MGI Sy... [more]
Sidt21.036e-5126.19SID1 transmembrane family, member 2 [Source:MGI Sy... [more]
Sidt11.845e-5128.14SID1 transmembrane family, member 1 [Source:MGI Sy... [more]
Sidt21.128e-4335.71SID1 transmembrane family, member 2 [Source:MGI Sy... [more]
Sidt28.589e-964.86SID1 transmembrane family, member 2 [Source:MGI Sy... [more]
back to top
BLAST of SID1 transmembrane family member 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9NXL6|SIDT1_HUMAN1.421e-5327.79SID1 transmembrane family member 1 OS=Homo sapiens... [more]
sp|Q6AXF6|SIDT1_MOUSE3.551e-5228.18SID1 transmembrane family member 1 OS=Mus musculus... [more]
sp|Q8CIF6|SIDT2_MOUSE7.243e-5126.19SID1 transmembrane family member 2 OS=Mus musculus... [more]
sp|Q6Q3F5|SIDT1_RAT1.273e-4927.78SID1 transmembrane family member 1 OS=Rattus norve... [more]
sp|Q8NBJ9|SIDT2_HUMAN1.533e-4237.23SID1 transmembrane family member 2 OS=Homo sapiens... [more]
back to top
BLAST of SID1 transmembrane family member 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0L8FH081.731e-6932.35Uncharacterized protein OS=Octopus bimaculoides OX... [more]
A0A210QFY57.703e-6327.71SID1 transmembrane family member 1 OS=Mizuhopecten... [more]
A0A2C9JQS93.788e-6130.46Uncharacterized protein OS=Biomphalaria glabrata O... [more]
A0A1I8IS621.608e-6028.44Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A2C9JQS75.280e-5929.39Uncharacterized protein OS=Biomphalaria glabrata O... [more]
back to top
BLAST of SID1 transmembrane family member 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sidt22.100e-5230.66SID1 transmembrane family member 2 [Source:NCBI ge... [more]
sidt26.847e-4635.85SID1 transmembrane family member 2 [Source:NCBI ge... [more]
sidt27.619e-4635.85SID1 transmembrane family member 2 [Source:NCBI ge... [more]
sidt28.784e-2938.81SID1 transmembrane family member 2 [Source:NCBI ge... [more]
sidt29.949e-2938.81SID1 transmembrane family member 2 [Source:NCBI ge... [more]
back to top
BLAST of SID1 transmembrane family member 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
SIDT15.517e-4135.41SID1 transmembrane family member 1 [Source:HGNC Sy... [more]
SIDT11.288e-4034.18SID1 transmembrane family member 1 [Source:HGNC Sy... [more]
back to top
BLAST of SID1 transmembrane family member 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SID1 transmembrane family member 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO434502.493e-1537.61Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO307674.836e-1025.47Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO276164.399e-843.18Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SID1 transmembrane family member 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
sidt21.615e-4535.90SID1 transmembrane family member 2 [Source:NCBI ge... [more]
sidt21.902e-4535.90SID1 transmembrane family member 2 [Source:NCBI ge... [more]
sidt22.475e-4535.90SID1 transmembrane family member 2 [Source:NCBI ge... [more]
sidt28.069e-922.22SID1 transmembrane family member 2 [Source:NCBI ge... [more]
back to top
BLAST of SID1 transmembrane family member 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000041572.11.763e-6099.68SMESG000041572.1[more]
SMESG000041575.11.946e-11838.07SMESG000041575.1[more]
SMESG000075887.17.944e-8733.98SMESG000075887.1[more]
SMESG000075887.11.372e-8634.04SMESG000075887.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30009553 ID=SMED30009553|Name=SID1 transmembrane family member 1|organism=Schmidtea mediterranea sexual|type=transcript|length=2855bp
CCTTGATTGATAATGAAAGTCTTGTTGTTTATCTTGATTATTATTTGTGA
ACGTTTTACGGTGGAAAATCATTTTTACAATATTTATAATGGAATTATAA
ATGAAGTTAATGAAATAAATATTTCTGTCAGAAATACATCAATCATTTTC
TATGAATATAATAATTTATCTACAAAGGAAGCTGCATTAAGGGTTTATAT
AGAATGTGACCTAAAACCCCATGAATCTATTTCTATTATTATCAAGCAAG
ACAACAGTTATTTATTATCAATGGAGTTATTTCAGATTAATAACGAAGTA
CCGGTAAAGGCAGCAAGAACAATTCATCTATTCAACGAGGCAAAGAATCA
TAATTACAGTTCAAACCACAGCACATCTATTGAAGTTTCATCAAAATCTT
TACGAAAAATAGCGGTTAAAATTCAAATCAAATGGATTGATAATTTTTTA
ATAAAACTCAACCAAAATCAATCGGTTTCAATTACAATTTACACGCCAGT
TTATTATTTATTTAAATTTGATTCGAAAAAACAAACAATTGTAATTCATG
TTCAGTCCAAAGATGAAATTTGTATGAATTTAGGAATTCAAAATCATGTC
GAGCCAGTTCAAGATGATTATAGGCATATTAAGCCTTATTATATTCACCA
AACAATGTCCAAAGAAACGACGCTTGTTATTAAAAAGGGCAAATTCATTT
CAAGCAATAGCATTTTAATTATATTTATGCTAAATAAAATGGCTGAAAAA
TGTGCAAATTTTTTCAGTTTGTCCCAAAAACCTTGGCCAGAAATGAAGCA
TTTCAATTTCCATATTACAGAACTCAAAACGGACTATATGCTTCCTATTT
TCTTGGCTATTGGGTTCTACCTCTCATTTTACGTTATTGCTTGTCTTGCC
ATGGTGGGAGATCACTTTATTAAATCGGTTTCAAGTGAAAACAGATTCAG
AATACTGTCGGACTTTTCGTCGGTCAATTCCCATGCAGGAACTACCAAAA
AAAGATGTCTCACCCAAAATAATCCAGAATGTGAAAAGAAATTAATTTAT
CTTTCGGATTTAACCAAGACGAATCCAATGCATTTGGAGCAAGAGTTTTT
TATGTACATCTGGTACCTTATTGTCATTTCCATATTTAATTTGCCTTCTG
CTATACAAATGATATGGAACTTCTACAGGAATTTTATAACCAATGGAAAT
CAAGATATTTGCTTTTATAATTTCCGATGCGCCCGACCATTTTTCGTTTT
TCCAGCTTTTAATAATATGATTTCAAACATTGGATATATACTTCTCGGGA
TTTTATTTCTCCTTATTACGTGGAAAAAGCATCAACGTTACAATTCATGG
CTGAATGAACTAAATATGTCAATCTTTTATTATGGCTTACCAAAATATTT
TGGACTTTATTATGCAATGGGGTTTTCTCTTCTGATGGAAGGTATTATGA
GTGCATTATATCACGTTTGTCCAAATCAGAGACATATGATATTTGACCAA
TCTTACAAGTATATTCTTGTTTGTATAATGATGGTACAAATCTATCAGTT
CCGCCATTTTGATATAACTGCTTCAGCTCATTTATTTTACATTTCCTTGG
CAATATTCATCTTCATTGGCGTTATCCACCAGTTTTTTCAAGAAATTATT
TTCTGGTCGCTATTTACAGTTTTATATATGTTCTGGACTGCCATTTTGAT
GTGCGATATTTACTATTTCGATCAATTTAAAATTAATATTATGTTGCCAA
AACAAGTGTATTTGGTTATAAAATCAAAAAAATGGAAAGCTTTCATTCCA
ACTTATAAATATCGGATGGTTATTGTGGTATTTGCGCTTATTATCAACGG
AACTATGAAAATCAATTGATCAGTGGGAAAATTTCGGAGTAATCAGTGAA
AGTAATCCAAACAATTATTTGTTTGCCCCAAGAAATGGACGTGACAAGAT
TCATTAATAGGGAAGCATGATTACCAGGGATTCTTATATATACCAGCTCT
AAGATTAGACATTTACAATTATATATAGCAGACGAATATTTCAAATAATC
AAACGAGAGAAAAGACCATTCAAACGACAATAAGGGTTTTACCGTAGTAT
ATTTATCCGTGTTTGAAATAGTGACAATTGTGAATAAAGTGTATTTGTTG
TAATTAATGGATTGCCATTAATTTTCAACTCGAGGAGCCAGCTCAAGATA
TTTTTCCTATCGATACTTTATTTATATTTCAACATTAGAATAATAAATCA
TTCCAACTAATTTCTTTCAAATACTTTTTTGTACATCAGCAAATATTGGA
TGAATACTTGGAAAGTAACCTCGTAAACGGTTGGATTACAATCTCCAATT
CCGCGAATTTTCAAAAAACATTTACAATTCGAATTAAGTTTCGATATTCT
TCACAGGGTTTTGATTTTGTAAAAGAATTAATTTATTTTAATTTTTTAAA
TGAGTTTGAGTTTAAATATCTCTATAGATCAATTTATGGAATTCTAATAA
AACCGGAAGAATTTCCATTATTTTTTCTGACTTTTCTATCTCTAAACTTG
CTAATCTATTTCGGATATTACATTGTCATGAAGGCTTTTTACAAGGAAAC
TTTCAACAAAACGGCAATTTTCTATTCAATAATTACCATTTCGTGTTGGG
CAGTGGCTGTTTATTGCTTCATCCAGCCGACTTCAAACTGGCGGAAAACT
CCAGCAGTATCTCGAGAACAAAACAAAAAATGTATATTTTTAGATTTTTA
CGACATTCATGACATTTCACACTTTTTATTTTCAATTGCAATTTTTTTCA
CATTTCTGACACTTCAAAATATGGATAACTGCTTGGAAAACCAAGAAATG
AACAA
back to top

protein sequence of SMED30009553-orf-1

>SMED30009553-orf-1 ID=SMED30009553-orf-1|Name=SMED30009553-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=619bp
MKVLLFILIIICERFTVENHFYNIYNGIINEVNEINISVRNTSIIFYEYN
NLSTKEAALRVYIECDLKPHESISIIIKQDNSYLLSMELFQINNEVPVKA
ARTIHLFNEAKNHNYSSNHSTSIEVSSKSLRKIAVKIQIKWIDNFLIKLN
QNQSVSITIYTPVYYLFKFDSKKQTIVIHVQSKDEICMNLGIQNHVEPVQ
DDYRHIKPYYIHQTMSKETTLVIKKGKFISSNSILIIFMLNKMAEKCANF
FSLSQKPWPEMKHFNFHITELKTDYMLPIFLAIGFYLSFYVIACLAMVGD
HFIKSVSSENRFRILSDFSSVNSHAGTTKKRCLTQNNPECEKKLIYLSDL
TKTNPMHLEQEFFMYIWYLIVISIFNLPSAIQMIWNFYRNFITNGNQDIC
FYNFRCARPFFVFPAFNNMISNIGYILLGILFLLITWKKHQRYNSWLNEL
NMSIFYYGLPKYFGLYYAMGFSLLMEGIMSALYHVCPNQRHMIFDQSYKY
ILVCIMMVQIYQFRHFDITASAHLFYISLAIFIFIGVIHQFFQEIIFWSL
FTVLYMFWTAILMCDIYYFDQFKINIMLPKQVYLVIKSKKWKAFIPTYKY
RMVIVVFALIINGTMKIN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002056medial muscle cell
PLANA:0003116parenchymal cell
PLANA:0007528glial cell
Vocabulary: INTERPRO
TermDefinition
IPR025958SID1_TM_fam
Vocabulary: molecular function
TermDefinition
GO:0051033RNA transmembrane transporter activity
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
Vocabulary: biological process
TermDefinition
GO:0033227dsRNA transport
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR025958SID1 transmembrane familyPFAMPF13965SID-1_RNA_chancoord: 163..618
e-value: 1.5E-95
score: 320.9
IPR025958SID1 transmembrane familyPANTHERPTHR12185FAMILY NOT NAMEDcoord: 39..615
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..18
score: 0.657
NoneNo IPR availableTMHMMTMhelixcoord: 455..477
NoneNo IPR availableTMHMMTMhelixcoord: 413..435
NoneNo IPR availableTMHMMTMhelixcoord: 518..540
NoneNo IPR availableTMHMMTMhelixcoord: 595..617
NoneNo IPR availableTMHMMTMhelixcoord: 364..386
NoneNo IPR availableTMHMMTMhelixcoord: 547..569
NoneNo IPR availableTMHMMTMhelixcoord: 278..300