RanBP-type and C3HC4-type zinc finger containing 1

Overview
NameRanBP-type and C3HC4-type zinc finger containing 1
Smed IDSMED30009549
Length (bp)874
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of RanBP-type and C3HC4-type zinc finger containing 1 (SMED30009549) t-SNE clustered cells

Violin plots show distribution of expression levels for RanBP-type and C3HC4-type zinc finger containing 1 (SMED30009549) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of RanBP-type and C3HC4-type zinc finger containing 1 (SMED30009549) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for RanBP-type and C3HC4-type zinc finger containing 1 (SMED30009549) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30009549

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
epidermisSMED30009549SMESG000038116.1 dd_Smed_v4_11851_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30009549SMESG000038116.1 dd_Smed_v4_11851_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior muscle cellSMED30009549SMESG000038116.1 dd_Smed_v4_11851_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior sideSMED30009549SMESG000038116.1 dd_Smed_v4_11851_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30009549SMESG000038116.1 dd_Smed_v6_11851_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30009549SMESG000038116.1 dd_Smed_v4_11851_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of RanBP-type and C3HC4-type zinc finger containing 1 vs. Ensembl Human
Match: RBCK1 (RANBP2-type and C3HC4-type zinc finger containing 1 [Source:HGNC Symbol;Acc:HGNC:15864])

HSP 1 Score: 93.5893 bits (231), Expect = 6.272e-21
Identity = 70/214 (32.71%), Postives = 114/214 (53.27%), Query Frame = 2
Query:  164 INKFCRNCLREHIKICKMYPVKLSC-FLENETTSNFELSDYICYQILSKKDHAAYNRLRVDHRVIKIPNLHRCYNLNCSGTVRLSDS-RQIICNLCKVLNCYDCKAVHEKGETCNTWKEKNTTEIQFRIEQQLQNEE---KIRKNQAIYCPSCGIFIGFMGGCDWICCPVCKHEICFRTKMSRWGPGGRGDTSDGCKCKIDGVTLCHPNCNNCH 790
            ++ FCR CL+  I+  +    ++SC F++N  + + +L +     +L+ +D+  +  L +     +    + C   +C G     D   +  C +C  +NC  CKA+HE+   C  ++E      Q  +  +   E     +++ +A+ CP C I +    GCDWI C VC  EIC+ TK  RWGPGG GDTS GC+C+++G+  CHP+C NCH
Sbjct:  259 LHTFCRECLQGTIRNSQE--AEVSCPFIDNTYSCSGKLLEREIKALLTPEDYQRFLDLGISIAENRSAFSYHCKTPDCKGWCFFEDDVNEFTCPVCFHVNCLLCKAIHEQM-NCKEYQEDLALRAQNDVAARQTTEMLKVMLQQGEAMRCPQCQIVVQKKDGCDWIRCTVCHTEICWVTKGPRWGPGGPGDTSGGCRCRVNGIP-CHPSCQNCH 468          
BLAST of RanBP-type and C3HC4-type zinc finger containing 1 vs. Ensembl Human
Match: RBCK1 (RANBP2-type and C3HC4-type zinc finger containing 1 [Source:HGNC Symbol;Acc:HGNC:15864])

HSP 1 Score: 93.2041 bits (230), Expect = 1.040e-20
Identity = 70/214 (32.71%), Postives = 114/214 (53.27%), Query Frame = 2
Query:  164 INKFCRNCLREHIKICKMYPVKLSC-FLENETTSNFELSDYICYQILSKKDHAAYNRLRVDHRVIKIPNLHRCYNLNCSGTVRLSDS-RQIICNLCKVLNCYDCKAVHEKGETCNTWKEKNTTEIQFRIEQQLQNEE---KIRKNQAIYCPSCGIFIGFMGGCDWICCPVCKHEICFRTKMSRWGPGGRGDTSDGCKCKIDGVTLCHPNCNNCH 790
            ++ FCR CL+  I+  +    ++SC F++N  + + +L +     +L+ +D+  +  L +     +    + C   +C G     D   +  C +C  +NC  CKA+HE+   C  ++E      Q  +  +   E     +++ +A+ CP C I +    GCDWI C VC  EIC+ TK  RWGPGG GDTS GC+C+++G+  CHP+C NCH
Sbjct:  301 LHTFCRECLQGTIRNSQE--AEVSCPFIDNTYSCSGKLLEREIKALLTPEDYQRFLDLGISIAENRSAFSYHCKTPDCKGWCFFEDDVNEFTCPVCFHVNCLLCKAIHEQM-NCKEYQEDLALRAQNDVAARQTTEMLKVMLQQGEAMRCPQCQIVVQKKDGCDWIRCTVCHTEICWVTKGPRWGPGGPGDTSGGCRCRVNGIP-CHPSCQNCH 510          
BLAST of RanBP-type and C3HC4-type zinc finger containing 1 vs. Ensembl Human
Match: RBCK1 (RANBP2-type and C3HC4-type zinc finger containing 1 [Source:HGNC Symbol;Acc:HGNC:15864])

HSP 1 Score: 87.8113 bits (216), Expect = 2.650e-19
Identity = 68/209 (32.54%), Postives = 109/209 (52.15%), Query Frame = 2
Query:  179 RNCLREHIKICKMYPVKLSC-FLENETTSNFELSDYICYQILSKKDHAAYNRLRVDHRVIKIPNLHRCYNLNCSGTVRLSDS-RQIICNLCKVLNCYDCKAVHEKGETCNTWKEKNTTEIQFRIEQQLQNEE---KIRKNQAIYCPSCGIFIGFMGGCDWICCPVCKHEICFRTKMSRWGPGGRGDTSDGCKCKIDGVTLCHPNCNNCH 790
            R CL+  I+       ++SC F++N  + + +L +     +L+ +D+  +  L +     +    + C   +C G     D   +  C +C  +NC  CKA+HE+   C  ++E      Q  +  +   E     +++ +A+ CP C I +    GCDWI C VC  EIC+ TK  RWGPGG GDTS GC+C+++G+  CHP+C NCH
Sbjct:  136 RECLQGTIR--NSQEAEVSCPFIDNTYSCSGKLLEREIKALLTPEDYQRFLDLGISIAENRSAFSYHCKTPDCKGWCFFEDDVNEFTCPVCFHVNCLLCKAIHEQ-MNCKEYQEDLALRAQNDVAARQTTEMLKVMLQQGEAMRCPQCQIVVQKKDGCDWIRCTVCHTEICWVTKGPRWGPGGPGDTSGGCRCRVNGIP-CHPSCQNCH 340          
BLAST of RanBP-type and C3HC4-type zinc finger containing 1 vs. Ensembl Human
Match: RBCK1 (RANBP2-type and C3HC4-type zinc finger containing 1 [Source:HGNC Symbol;Acc:HGNC:15864])

HSP 1 Score: 87.8113 bits (216), Expect = 2.650e-19
Identity = 68/209 (32.54%), Postives = 109/209 (52.15%), Query Frame = 2
Query:  179 RNCLREHIKICKMYPVKLSC-FLENETTSNFELSDYICYQILSKKDHAAYNRLRVDHRVIKIPNLHRCYNLNCSGTVRLSDS-RQIICNLCKVLNCYDCKAVHEKGETCNTWKEKNTTEIQFRIEQQLQNEE---KIRKNQAIYCPSCGIFIGFMGGCDWICCPVCKHEICFRTKMSRWGPGGRGDTSDGCKCKIDGVTLCHPNCNNCH 790
            R CL+  I+       ++SC F++N  + + +L +     +L+ +D+  +  L +     +    + C   +C G     D   +  C +C  +NC  CKA+HE+   C  ++E      Q  +  +   E     +++ +A+ CP C I +    GCDWI C VC  EIC+ TK  RWGPGG GDTS GC+C+++G+  CHP+C NCH
Sbjct:  136 RECLQGTIR--NSQEAEVSCPFIDNTYSCSGKLLEREIKALLTPEDYQRFLDLGISIAENRSAFSYHCKTPDCKGWCFFEDDVNEFTCPVCFHVNCLLCKAIHEQ-MNCKEYQEDLALRAQNDVAARQTTEMLKVMLQQGEAMRCPQCQIVVQKKDGCDWIRCTVCHTEICWVTKGPRWGPGGPGDTSGGCRCRVNGIP-CHPSCQNCH 340          
BLAST of RanBP-type and C3HC4-type zinc finger containing 1 vs. Ensembl Fly
Match: LUBEL (gene:FBgn0031857 transcript:FBtr0331216)

HSP 1 Score: 58.9214 bits (141), Expect = 2.315e-9
Identity = 49/194 (25.26%), Postives = 76/194 (39.18%), Query Frame = 2
Query:  164 INKFCRNCLREHIKI--------------CKMYPVKLSCFLENETTSNFELSDYICYQILSKKDHAAYNRLRVDHRVIKIPNLHRCYNLNCS-GTVRLSDSRQIICNLCKVLNCYDCKAVHEK---GETCNT---WKEKNTTEIQFRIEQQLQNEEKIRKNQAIYCPSCGIFIGFM-GGCDWICCPVCKHEICF 679
            ++K C+ C + +  +              CK+  +      E+E    F   D     IL    H  + R   D  +++ PN   C  + CS G       +++IC  C  + C  C+   E+   G +C     WK +N  E+Q    Q +Q  E + +N  I CP C        GGC    C  CK E C+
Sbjct: 2533 LHKCCKQCAKSYFTVQITDRSINDCSCPFCKLPELSNEAQHEDEHLEYFSNLDIFLKSILDNDVHELFQRKLRDRSLLQDPNFKWC--IQCSSGFFARPKQKRLICPDCGSVTCAQCRKPWERQHEGSSCEAYLEWKRENDPELQ---AQGVQ--EHLAQN-GIDCPKCKFRYSLARGGCMHFTCTQCKFEFCY 2718          
BLAST of RanBP-type and C3HC4-type zinc finger containing 1 vs. Ensembl Fly
Match: LUBEL (gene:FBgn0031857 transcript:FBtr0331220)

HSP 1 Score: 58.9214 bits (141), Expect = 2.398e-9
Identity = 49/194 (25.26%), Postives = 76/194 (39.18%), Query Frame = 2
Query:  164 INKFCRNCLREHIKI--------------CKMYPVKLSCFLENETTSNFELSDYICYQILSKKDHAAYNRLRVDHRVIKIPNLHRCYNLNCS-GTVRLSDSRQIICNLCKVLNCYDCKAVHEK---GETCNT---WKEKNTTEIQFRIEQQLQNEEKIRKNQAIYCPSCGIFIGFM-GGCDWICCPVCKHEICF 679
            ++K C+ C + +  +              CK+  +      E+E    F   D     IL    H  + R   D  +++ PN   C  + CS G       +++IC  C  + C  C+   E+   G +C     WK +N  E+Q    Q +Q  E + +N  I CP C        GGC    C  CK E C+
Sbjct: 2480 LHKCCKQCAKSYFTVQITDRSINDCSCPFCKLPELSNEAQHEDEHLEYFSNLDIFLKSILDNDVHELFQRKLRDRSLLQDPNFKWC--IQCSSGFFARPKQKRLICPDCGSVTCAQCRKPWERQHEGSSCEAYLEWKRENDPELQ---AQGVQ--EHLAQN-GIDCPKCKFRYSLARGGCMHFTCTQCKFEFCY 2665          
BLAST of RanBP-type and C3HC4-type zinc finger containing 1 vs. Ensembl Fly
Match: LUBEL (gene:FBgn0031857 transcript:FBtr0331218)

HSP 1 Score: 58.9214 bits (141), Expect = 2.398e-9
Identity = 49/194 (25.26%), Postives = 76/194 (39.18%), Query Frame = 2
Query:  164 INKFCRNCLREHIKI--------------CKMYPVKLSCFLENETTSNFELSDYICYQILSKKDHAAYNRLRVDHRVIKIPNLHRCYNLNCS-GTVRLSDSRQIICNLCKVLNCYDCKAVHEK---GETCNT---WKEKNTTEIQFRIEQQLQNEEKIRKNQAIYCPSCGIFIGFM-GGCDWICCPVCKHEICF 679
            ++K C+ C + +  +              CK+  +      E+E    F   D     IL    H  + R   D  +++ PN   C  + CS G       +++IC  C  + C  C+   E+   G +C     WK +N  E+Q    Q +Q  E + +N  I CP C        GGC    C  CK E C+
Sbjct: 2492 LHKCCKQCAKSYFTVQITDRSINDCSCPFCKLPELSNEAQHEDEHLEYFSNLDIFLKSILDNDVHELFQRKLRDRSLLQDPNFKWC--IQCSSGFFARPKQKRLICPDCGSVTCAQCRKPWERQHEGSSCEAYLEWKRENDPELQ---AQGVQ--EHLAQN-GIDCPKCKFRYSLARGGCMHFTCTQCKFEFCY 2677          
BLAST of RanBP-type and C3HC4-type zinc finger containing 1 vs. Ensembl Fly
Match: LUBEL (gene:FBgn0031857 transcript:FBtr0331221)

HSP 1 Score: 58.5362 bits (140), Expect = 3.058e-9
Identity = 49/194 (25.26%), Postives = 76/194 (39.18%), Query Frame = 2
Query:  164 INKFCRNCLREHIKI--------------CKMYPVKLSCFLENETTSNFELSDYICYQILSKKDHAAYNRLRVDHRVIKIPNLHRCYNLNCS-GTVRLSDSRQIICNLCKVLNCYDCKAVHEK---GETCNT---WKEKNTTEIQFRIEQQLQNEEKIRKNQAIYCPSCGIFIGFM-GGCDWICCPVCKHEICF 679
            ++K C+ C + +  +              CK+  +      E+E    F   D     IL    H  + R   D  +++ PN   C  + CS G       +++IC  C  + C  C+   E+   G +C     WK +N  E+Q    Q +Q  E + +N  I CP C        GGC    C  CK E C+
Sbjct: 2439 LHKCCKQCAKSYFTVQITDRSINDCSCPFCKLPELSNEAQHEDEHLEYFSNLDIFLKSILDNDVHELFQRKLRDRSLLQDPNFKWC--IQCSSGFFARPKQKRLICPDCGSVTCAQCRKPWERQHEGSSCEAYLEWKRENDPELQ---AQGVQ--EHLAQN-GIDCPKCKFRYSLARGGCMHFTCTQCKFEFCY 2624          
BLAST of RanBP-type and C3HC4-type zinc finger containing 1 vs. Ensembl Zebrafish
Match: rbck1 (RanBP-type and C3HC4-type zinc finger containing 1 [Source:ZFIN;Acc:ZDB-GENE-040704-3])

HSP 1 Score: 124.79 bits (312), Expect = 5.590e-32
Identity = 75/214 (35.05%), Postives = 119/214 (55.61%), Query Frame = 2
Query:  164 INKFCRNCLREHIKICKMYPVKLSC-FLENETTSNFELSDYICYQILSKKDHAAYNRLRVDHRVIKIPNLHRCYNLNCSGT-VRLSDSRQIICNLCKVLNCYDCKAVHEKGETCNTWKEKNTTEIQ--FRIEQQLQNEEKIRKN-QAIYCPSCGIFIGFMGGCDWICCPVCKHEICFRTKMSRWGPGGRGDTSDGCKCKIDGVTLCHPNCNNCH 790
            ++ FCR+CL+  +  C     ++ C + +N    N +L D     +L++ ++  +  LR++    +  N + C   +C+G  +   D  +  C++C   NC  CKA+H KG  C  +++      Q      Q  +  +++ KN +A+ CP C + +    GCDWICC +CK EIC+ TK +RWGP G GDTS GCKC+++GV LCHP C NCH
Sbjct:  306 LHSFCRDCLKGTVVNC--LDAEVCCPYGDNAYACNCKLQDREIKSLLTQDEYQKFLELRLNIAESRSENSYHCKTPDCAGWCIFEDDVNEFKCDICNETNCLLCKAIH-KGMNCKEYQDDLRVRAQNDEAARQTTEMLDQLLKNGEAMNCPKCQVIVQKKDGCDWICCLMCKTEICWVTKQARWGPLGAGDTSGGCKCRVNGV-LCHPQCQNCH 515          
BLAST of RanBP-type and C3HC4-type zinc finger containing 1 vs. Ensembl Zebrafish
Match: rbck1 (RanBP-type and C3HC4-type zinc finger containing 1 [Source:ZFIN;Acc:ZDB-GENE-040704-3])

HSP 1 Score: 124.79 bits (312), Expect = 5.590e-32
Identity = 75/214 (35.05%), Postives = 119/214 (55.61%), Query Frame = 2
Query:  164 INKFCRNCLREHIKICKMYPVKLSC-FLENETTSNFELSDYICYQILSKKDHAAYNRLRVDHRVIKIPNLHRCYNLNCSGT-VRLSDSRQIICNLCKVLNCYDCKAVHEKGETCNTWKEKNTTEIQ--FRIEQQLQNEEKIRKN-QAIYCPSCGIFIGFMGGCDWICCPVCKHEICFRTKMSRWGPGGRGDTSDGCKCKIDGVTLCHPNCNNCH 790
            ++ FCR+CL+  +  C     ++ C + +N    N +L D     +L++ ++  +  LR++    +  N + C   +C+G  +   D  +  C++C   NC  CKA+H KG  C  +++      Q      Q  +  +++ KN +A+ CP C + +    GCDWICC +CK EIC+ TK +RWGP G GDTS GCKC+++GV LCHP C NCH
Sbjct:  306 LHSFCRDCLKGTVVNC--LDAEVCCPYGDNAYACNCKLQDREIKSLLTQDEYQKFLELRLNIAESRSENSYHCKTPDCAGWCIFEDDVNEFKCDICNETNCLLCKAIH-KGMNCKEYQDDLRVRAQNDEAARQTTEMLDQLLKNGEAMNCPKCQVIVQKKDGCDWICCLMCKTEICWVTKQARWGPLGAGDTSGGCKCRVNGV-LCHPQCQNCH 515          
BLAST of RanBP-type and C3HC4-type zinc finger containing 1 vs. Ensembl Zebrafish
Match: rbck1 (RanBP-type and C3HC4-type zinc finger containing 1 [Source:ZFIN;Acc:ZDB-GENE-040704-3])

HSP 1 Score: 112.849 bits (281), Expect = 3.640e-30
Identity = 62/174 (35.63%), Postives = 97/174 (55.75%), Query Frame = 2
Query:  269 ELSDYICYQILSKKDHAAYNRLRVDHRVIKIPNLHRCYNLNCSGT-VRLSDSRQIICNLCKVLNCYDCKAVHEKGETCNTWKEKNTTEIQFRIEQQLQNE---EKIRKNQAIYCPSCGIFIGFMGGCDWICCPVCKHEICFRTKMSRWGPGGRGDTSDGCKCKIDGVTLCHPNC 778
            EL+     Q+L++ ++  +  LR++    +  N + C   +C+G  +   D  +  C++C   NC  CKA+H KG  C  +++      Q     +   E   + ++  +A+ CP C + +    GCDWICC +CK EIC+ TK +RWGP G GDTS GCKC+++GV LCHP C
Sbjct:    2 ELASLQYEQLLTQDEYQKFLELRLNIAESRSENSYHCKTPDCAGWCIFEDDVNEFKCDICNETNCLLCKAIH-KGMNCKEYQDDLRVRAQNDEAARQTTEMLDQLLKNGEAMNCPKCQVIVQKKDGCDWICCLMCKTEICWVTKQARWGPLGAGDTSGGCKCRVNGV-LCHPQC 173          
BLAST of RanBP-type and C3HC4-type zinc finger containing 1 vs. Ensembl Zebrafish
Match: shrprbck1r (sharpin and rbck1 related [Source:NCBI gene;Acc:569903])

HSP 1 Score: 96.6709 bits (239), Expect = 5.519e-22
Identity = 65/211 (30.81%), Postives = 106/211 (50.24%), Query Frame = 2
Query:  173 FCRNCLREHIKICKMYPVKLSCFLENETTS-NFELSDYICYQILSKKDHAAYNRLRVDHRVIKIPNLHRCYNLNCSGTVRLSDSRQII-CNLCKVLNCYDCKAVHEKGETCNTWKEKNTTE-IQFRIEQQLQNEEK--IRKNQAIYCPSCGIFIGFMGGCDWICCPVCKHEICFRTKMSRWGPGGRGDTSDGCKCKIDGVTLCHPNCNNCH 790
            FC+ CLR  I + +    +++C   +E+ + +  L +     ++S  D+  + +  +     +    + C   +C G     D+     C +CK  NC  CKA+HE G  C  +++  T   I     ++ ++  K  +   +A++CP CGI +    GCDW+ C VC  EIC+ T+  RWGP G GD S GC+C ++    CHP C NCH
Sbjct:  508 FCKECLRSVILMSE--DPQVACPYRDESYACDCVLQEREIRALVSVDDYQHWLQRGLSVAESRCEGSYHCATADCPGWCVYEDTVNTFHCPVCKKQNCLLCKAIHE-GMNCKQYQDDLTARAINDSAARRTRDLLKTLVNSGEAMHCPQCGIIVQKKEGCDWLRCTVCHTEICWVTRGPRWGPKGPGDISGGCRCNVNK-QRCHPKCQNCH 714          
BLAST of RanBP-type and C3HC4-type zinc finger containing 1 vs. Ensembl Zebrafish
Match: zmp:0000000524 (zmp:0000000524 [Source:ZFIN;Acc:ZDB-GENE-130530-527])

HSP 1 Score: 50.447 bits (119), Expect = 1.013e-6
Identity = 36/129 (27.91%), Postives = 60/129 (46.51%), Query Frame = 2
Query:  296 ILSKKDHAAYNRLRVDHRVIKIPNLHRCYNLNCSGTVRLSDSRQI-ICNLCKVLNCYDCKAVHEKGETCNTWKEKNTTEIQFRIEQQLQNEEKIRKNQAIYCPSCGIFIGFMGGCDWICCPVCKHEICF 679
            ++S++  A Y+RL +   +  + ++  C   +C   V L   R + IC  CK + C  C  V+     CN  + +N      R E Q + +E   K  +  CP+CG+ I    GCD + C  C+   C+
Sbjct:  225 LVSQEVFARYDRLLLQWSLNLMTDVVYCPRKSCGMAVMLEPDRTMGICPSCKFVFCTLCNRVYHALALCNEIQRENE-----RRENQRKEDEVWVKQNSKQCPTCGVKIQKDMGCDMMTCSSCQQFFCW 348          
BLAST of RanBP-type and C3HC4-type zinc finger containing 1 vs. Ensembl Xenopus
Match: ENSXETT00000033448.1 (RanBP-type and C3HC4-type zinc finger containing 1 [Source:NCBI gene;Acc:100491300])

HSP 1 Score: 110.923 bits (276), Expect = 2.979e-28
Identity = 68/214 (31.78%), Postives = 111/214 (51.87%), Query Frame = 2
Query:  164 INKFCRNCLREHIKICKMYPVKLSCFLENETTS-NFELSDYICYQILSKKDHAAYNRLRVDHRVIKIPNLHRCYNLNCSGTVRLSDS-RQIICNLCKVLNCYDCKAVHEKGETCNTWKEKNTTEIQFRIEQQLQNE---EKIRKNQAIYCPSCGIFIGFMGGCDWICCPVCKHEICFRTKMSRWGPGGRGDTSDGCKCKIDGVTLCHPNCNNCH 790
            ++ FCR CLR+ +  C+    ++SC   +ET + N +L       ++++++++ +    +     +  + + C   +C G     DS  +  C +C   NC  CKA+H+ G  C  +++      Q     +  N+     ++  +A+YCP C I +    GCDWI C +C+ EIC+ TK  RWGP G GDTS GC+C I+G   C P C NCH
Sbjct:   73 LHSFCRECLRQLVNCCE--EPEVSCPFRDETYACNSKLQQREIRALVAQEEYSRFLERGLVVAESRSHDSYHCRTADCRGWCVYEDSVNEFTCPICHAQNCLTCKAIHD-GMNCREYQDDLRIRAQNDAAARQTNDMLKTLVQTGEAMYCPVCQIIVQKKDGCDWIRCTMCQTEICWVTKGPRWGPQGPGDTSGGCQCNINGKK-CDPRCQNCH 282          
BLAST of RanBP-type and C3HC4-type zinc finger containing 1 vs. Ensembl Mouse
Match: Rbck1 (RanBP-type and C3HC4-type zinc finger containing 1 [Source:MGI Symbol;Acc:MGI:1344372])

HSP 1 Score: 90.8929 bits (224), Expect = 4.403e-20
Identity = 69/214 (32.24%), Postives = 113/214 (52.80%), Query Frame = 2
Query:  164 INKFCRNCLREHIKICKMYPVKLSC-FLENETTSNFELSDYICYQILSKKDHAAYNRLRVDHRVIKIPNLHRCYNLNCSGTVRLSDS-RQIICNLCKVLNCYDCKAVHEKGETCNTWKEKNTTEIQFRIEQQLQNEE---KIRKNQAIYCPSCGIFIGFMGGCDWICCPVCKHEICFRTKMSRWGPGGRGDTSDGCKCKIDGVTLCHPNCNNCH 790
            ++ FCR CL+  I+  +    +++C F+++  +   +L +     +LS +D+  +  L V     +    + C   +C G     D   +  C +C  +NC  CKA+HE    C  +++      Q  +  +   E     +++ +A++CP C I +    GCDWI C VC  EIC+ TK  RWGPGG GDTS GC+C+++G+  CHP+C NCH
Sbjct:  299 LHTFCRECLQGTIRNSQE--AEVACPFIDSTYSCPGKLLEREIRALLSPEDYQRFLDLGVSIAENRSTLSYHCKTPDCRGWCFFEDDVNEFTCPVCTRVNCLLCKAIHEHM-NCREYQDDLALRAQNDVAARQTTEMLKVMLQQGEAMHCPQCRIVVQKKDGCDWIRCTVCHTEICWVTKGPRWGPGGPGDTSGGCRCRVNGIP-CHPSCQNCH 508          
BLAST of RanBP-type and C3HC4-type zinc finger containing 1 vs. Ensembl Mouse
Match: Rbck1 (RanBP-type and C3HC4-type zinc finger containing 1 [Source:MGI Symbol;Acc:MGI:1344372])

HSP 1 Score: 90.8929 bits (224), Expect = 4.403e-20
Identity = 69/214 (32.24%), Postives = 113/214 (52.80%), Query Frame = 2
Query:  164 INKFCRNCLREHIKICKMYPVKLSC-FLENETTSNFELSDYICYQILSKKDHAAYNRLRVDHRVIKIPNLHRCYNLNCSGTVRLSDS-RQIICNLCKVLNCYDCKAVHEKGETCNTWKEKNTTEIQFRIEQQLQNEE---KIRKNQAIYCPSCGIFIGFMGGCDWICCPVCKHEICFRTKMSRWGPGGRGDTSDGCKCKIDGVTLCHPNCNNCH 790
            ++ FCR CL+  I+  +    +++C F+++  +   +L +     +LS +D+  +  L V     +    + C   +C G     D   +  C +C  +NC  CKA+HE    C  +++      Q  +  +   E     +++ +A++CP C I +    GCDWI C VC  EIC+ TK  RWGPGG GDTS GC+C+++G+  CHP+C NCH
Sbjct:  299 LHTFCRECLQGTIRNSQE--AEVACPFIDSTYSCPGKLLEREIRALLSPEDYQRFLDLGVSIAENRSTLSYHCKTPDCRGWCFFEDDVNEFTCPVCTRVNCLLCKAIHEHM-NCREYQDDLALRAQNDVAARQTTEMLKVMLQQGEAMHCPQCRIVVQKKDGCDWIRCTVCHTEICWVTKGPRWGPGGPGDTSGGCRCRVNGIP-CHPSCQNCH 508          
BLAST of RanBP-type and C3HC4-type zinc finger containing 1 vs. UniProt/SwissProt
Match: sp|E6ZIJ1|HOIL1_DICLA (RanBP-type and C3HC4-type zinc finger-containing protein 1 OS=Dicentrarchus labrax OX=13489 GN=rbck1 PE=3 SV=1)

HSP 1 Score: 99.3673 bits (246), Expect = 5.259e-22
Identity = 65/212 (30.66%), Postives = 107/212 (50.47%), Query Frame = 2
Query:  173 FCRNCLREHIKICKMYPVKLSCFLENETTS-NFELSDYICYQILSKKDHAAYNRLRVDHRVIKIPNLHRCYNLNCSGTVRLSDSRQII-CNLCKVLNCYDCKAVHEKGETCNTWKE----KNTTEIQFRIEQQLQNEEKIRKNQAIYCPSCGIFIGFMGGCDWICCPVCKHEICFRTKMSRWGPGGRGDTSDGCKCKIDGVTLCHPNCNNCH 790
            FCR CLR  I + +    ++SC   ++T S    L +     ++  +++  + +  +     +    + C   +C G     D+  +  C +C+  NC  CK++HE G  C  +++    +   +   R   QL  +  ++  +A++CP CGI +    GCDW+ C VC  EIC+ T+  RWGP G GDTS GC+C ++    CHP C NCH
Sbjct:  501 FCRECLRSVIMLSEE--PEVSCPYRDDTYSCACSLQEREIRALVPAEEYERWLQRGLSVAESRCEGSYHCATPDCLGWCVYEDTVNVFHCPVCRKHNCLICKSIHE-GMNCKQYQDDLAARAINDSAARRTTQLL-KTLVQSGEAMHCPQCGIIVQKRDGCDWLRCTVCHTEICWVTRGPRWGPKGPGDTSGGCRCNVNNQK-CHPKCQNCH 707          
BLAST of RanBP-type and C3HC4-type zinc finger containing 1 vs. UniProt/SwissProt
Match: sp|Q62921|HOIL1_RAT (RanBP-type and C3HC4-type zinc finger-containing protein 1 OS=Rattus norvegicus OX=10116 GN=Rbck1 PE=1 SV=3)

HSP 1 Score: 96.6709 bits (239), Expect = 3.663e-21
Identity = 74/215 (34.42%), Postives = 115/215 (53.49%), Query Frame = 2
Query:  164 INKFCRNCLREHIKICKMYPVKLSC-FLENETTSNFELSDYICYQILSKKDHAAYNRLRVDHRVIKIPNLHRCYNLNCSGTVRLSDS-RQIICNLCKVLNCYDCKAVHEKGETCNTWKEKNTTEIQFRIEQQLQNEEKIR----KNQAIYCPSCGIFIGFMGGCDWICCPVCKHEICFRTKMSRWGPGGRGDTSDGCKCKIDGVTLCHPNCNNCH 790
            ++ FCR CL+  I+  +    ++SC F++N  +   +L +     +LS +D+  +  L V     +    + C   +C G     D   +  C +C  +NC  CKA+HE+   C  +++      +  +  Q Q  E +R    + +A+YCP C I +    GCDWI C VC  EIC+ TK  RWGPGG GDTS GC+C+++G+  CHP+C NCH
Sbjct:  299 LHTFCRECLQGTIRNSQE--AEVSCPFIDNTYSCPGKLLEREIRALLSPEDYQRFLDLGVSIAENRSTLSYHCKTPDCRGWCFFEDDVNEFTCPVCTRVNCLLCKAIHERM-NCREYQDDLAHRARNDVAAQ-QTTEMLRVMLQQGEAMYCPQCRIVVQKKDGCDWIRCTVCHTEICWVTKGPRWGPGGPGDTSGGCRCRVNGIP-CHPSCQNCH 508          
BLAST of RanBP-type and C3HC4-type zinc finger containing 1 vs. UniProt/SwissProt
Match: sp|A9JTG5|HOIL1_DANRE (RanBP-type and C3HC4-type zinc finger-containing protein 1 OS=Danio rerio OX=7955 GN=rbck1 PE=2 SV=1)

HSP 1 Score: 96.6709 bits (239), Expect = 4.167e-21
Identity = 65/211 (30.81%), Postives = 106/211 (50.24%), Query Frame = 2
Query:  173 FCRNCLREHIKICKMYPVKLSCFLENETTS-NFELSDYICYQILSKKDHAAYNRLRVDHRVIKIPNLHRCYNLNCSGTVRLSDSRQII-CNLCKVLNCYDCKAVHEKGETCNTWKEKNTTE-IQFRIEQQLQNEEK--IRKNQAIYCPSCGIFIGFMGGCDWICCPVCKHEICFRTKMSRWGPGGRGDTSDGCKCKIDGVTLCHPNCNNCH 790
            FC+ CLR  I + +    +++C   +E+ + +  L +     ++S  D+  + +  +     +    + C   +C G     D+     C +CK  NC  CKA+HE G  C  +++  T   I     ++ ++  K  +   +A++CP CGI +    GCDW+ C VC  EIC+ T+  RWGP G GD S GC+C ++    CHP C NCH
Sbjct:  508 FCKECLRSVILMSE--DPQVACPYRDESYACDCVLQEREIRALVSVDDYQHWLQRGLSVAESRCEGSYHCATADCPGWCVYEDTVNTFHCPVCKKQNCLLCKAIHE-GMNCKQYQDDLTARAINDSAARRTRDLLKTLVNSGEAMHCPQCGIIVQKKEGCDWLRCTVCHTEICWVTRGPRWGPKGPGDISGGCRCNVNK-QRCHPKCQNCH 714          
BLAST of RanBP-type and C3HC4-type zinc finger containing 1 vs. UniProt/SwissProt
Match: sp|Q9BYM8|HOIL1_HUMAN (RanBP-type and C3HC4-type zinc finger-containing protein 1 OS=Homo sapiens OX=9606 GN=RBCK1 PE=1 SV=2)

HSP 1 Score: 93.2041 bits (230), Expect = 4.992e-20
Identity = 70/214 (32.71%), Postives = 114/214 (53.27%), Query Frame = 2
Query:  164 INKFCRNCLREHIKICKMYPVKLSC-FLENETTSNFELSDYICYQILSKKDHAAYNRLRVDHRVIKIPNLHRCYNLNCSGTVRLSDS-RQIICNLCKVLNCYDCKAVHEKGETCNTWKEKNTTEIQFRIEQQLQNEE---KIRKNQAIYCPSCGIFIGFMGGCDWICCPVCKHEICFRTKMSRWGPGGRGDTSDGCKCKIDGVTLCHPNCNNCH 790
            ++ FCR CL+  I+  +    ++SC F++N  + + +L +     +L+ +D+  +  L +     +    + C   +C G     D   +  C +C  +NC  CKA+HE+   C  ++E      Q  +  +   E     +++ +A+ CP C I +    GCDWI C VC  EIC+ TK  RWGPGG GDTS GC+C+++G+  CHP+C NCH
Sbjct:  301 LHTFCRECLQGTIRNSQE--AEVSCPFIDNTYSCSGKLLEREIKALLTPEDYQRFLDLGISIAENRSAFSYHCKTPDCKGWCFFEDDVNEFTCPVCFHVNCLLCKAIHEQM-NCKEYQEDLALRAQNDVAARQTTEMLKVMLQQGEAMRCPQCQIVVQKKDGCDWIRCTVCHTEICWVTKGPRWGPGGPGDTSGGCRCRVNGIP-CHPSCQNCH 510          
BLAST of RanBP-type and C3HC4-type zinc finger containing 1 vs. UniProt/SwissProt
Match: sp|Q9WUB0|HOIL1_MOUSE (RanBP-type and C3HC4-type zinc finger-containing protein 1 OS=Mus musculus OX=10090 GN=Rbck1 PE=1 SV=2)

HSP 1 Score: 90.8929 bits (224), Expect = 3.080e-19
Identity = 69/214 (32.24%), Postives = 113/214 (52.80%), Query Frame = 2
Query:  164 INKFCRNCLREHIKICKMYPVKLSC-FLENETTSNFELSDYICYQILSKKDHAAYNRLRVDHRVIKIPNLHRCYNLNCSGTVRLSDS-RQIICNLCKVLNCYDCKAVHEKGETCNTWKEKNTTEIQFRIEQQLQNEE---KIRKNQAIYCPSCGIFIGFMGGCDWICCPVCKHEICFRTKMSRWGPGGRGDTSDGCKCKIDGVTLCHPNCNNCH 790
            ++ FCR CL+  I+  +    +++C F+++  +   +L +     +LS +D+  +  L V     +    + C   +C G     D   +  C +C  +NC  CKA+HE    C  +++      Q  +  +   E     +++ +A++CP C I +    GCDWI C VC  EIC+ TK  RWGPGG GDTS GC+C+++G+  CHP+C NCH
Sbjct:  299 LHTFCRECLQGTIRNSQE--AEVACPFIDSTYSCPGKLLEREIRALLSPEDYQRFLDLGVSIAENRSTLSYHCKTPDCRGWCFFEDDVNEFTCPVCTRVNCLLCKAIHEHM-NCREYQDDLALRAQNDVAARQTTEMLKVMLQQGEAMHCPQCRIVVQKKDGCDWIRCTVCHTEICWVTKGPRWGPGGPGDTSGGCRCRVNGIP-CHPSCQNCH 508          
BLAST of RanBP-type and C3HC4-type zinc finger containing 1 vs. TrEMBL
Match: A0A1I8HCV6 (RING-type domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 133.65 bits (335), Expect = 7.554e-34
Identity = 75/212 (35.38%), Postives = 115/212 (54.25%), Query Frame = 2
Query:  167 NKFCRNCLREHIKICKMYPVKLSCFLENETTSNFELSDYICYQILSKKDHAAYNRLRVDHRVIKIPNLHRCYNLNCSGTVRLS-DSRQIICNLCKVLNCYDCKAVHEKGETCNTWKEKNTTEIQFRIEQQL---QNEEKIRKNQAIYCPSCGIFIGFMGGCDWICCPVCKHEICFRTKMSRWGPGGRGDTSDGCKCKIDGVTLCHPNCNNCH 790
            ++ CR CLR+H+      PV+       +T ++ E +     Q+L+ ++     RL +      IPN   C   NC   V L+ D     C LC + NC  C+A H  G +C  ++ +   + +   E QL     E+ ++  +A+ CP+C +F+    GCDW+ C +C+ EIC+ T+  RWGPGG+GDTS GCKC+++G  LCHP C NCH
Sbjct:   52 HEVCRECLRQHLLHADSMPVRCPHDQCQQTVTDSEAN-----QLLTSQEFDRLQRLGLRQAEAVIPNTFHCVAPNCDAFVELAEDVNSFECMLCGLHNCVTCRASH-PGVSCRRYQNQLRIDAKNNKEAQLNLTHLEKMVKSGEAMNCPNCQVFLQKKEGCDWLACSMCQTEICWATRGPRWGPGGKGDTSGGCKCRLNG-RLCHPECQNCH 256          
BLAST of RanBP-type and C3HC4-type zinc finger containing 1 vs. TrEMBL
Match: A0A182G687 (Uncharacterized protein OS=Aedes albopictus OX=7160 PE=4 SV=1)

HSP 1 Score: 136.732 bits (343), Expect = 2.826e-32
Identity = 67/213 (31.46%), Postives = 111/213 (52.11%), Query Frame = 2
Query:  164 INKFCRNCLREHIKICKMYPVKLSCFLENETTSNFELSDYICYQILSKKDHAAYNRLRVDHRVIKIPNLHRCYNLNCSG-TVRLSDSRQIICNLCKVLNCYDCKAVHEKGETCNTWKEKNTTEIQFRIEQQLQN---EEKIRKNQAIYCPSCGIFIGFMGGCDWICCPVCKHEICFRTKMSRWGPGGRGDTSDGCKCKIDGVTLCHPNCNNCH 790
            ++ FC+ CL   I  C+   +K   +++   + +  +       +++K  + A+    +     K+ N   C   NC G  +   D  Q  C +C ++NC  C+A+H+ G  C  ++++  ++    IE +      +E + +  AI CP+C + I    GCDW+ C +CK EIC+ T+  RWGPGG+GDTS GC+C +DG   CHP C  CH
Sbjct: 1624 LHSFCKECLVNTINYCEEAEIKCP-YMDTTYSCDSTIQQREIKALVTKDMYEAHLAKSIRQAESKLDNTFHCETPNCRGWCIYEDDVNQFKCPVCTIVNCLTCRAIHD-GLDCKQYQDRLNSDCDTNIEARRTKAVLQEMVDRGDAIVCPTCQVVIMKKWGCDWLKCSMCKTEICWVTRGPRWGPGGKGDTSGGCRCGVDGKK-CHPKCKYCH 1833          
BLAST of RanBP-type and C3HC4-type zinc finger containing 1 vs. TrEMBL
Match: W5JD78 (Ubiquitin conjugating enzyme 7 interacting protein OS=Anopheles darlingi OX=43151 GN=AND_007582 PE=4 SV=1)

HSP 1 Score: 136.732 bits (343), Expect = 3.520e-32
Identity = 70/217 (32.26%), Postives = 111/217 (51.15%), Query Frame = 2
Query:  179 RNCLREHIKICKMYPVKLSCFLENETTSNFELSDYICYQIL---------SKKDHAAYNRLRVDHRVIKIPNLHRCYNLNCSGTVRLSDS-RQIICNLCKVLNCYDCKAVHEKGETCNTWKEKNTTEIQFRIEQQLQN---EEKIRKNQAIYCPSCGIFIGFMGGCDWICCPVCKHEICFRTKMSRWGPGGRGDTSDGCKCKIDGVTLCHPNCNNCH 790
            R+CL    K C +  ++ S   E E    +  + Y C  ++         SK+ + A+    +     KI N   C   NC G     D+  Q  C +C ++NC  C+ +H+ G  C  ++++  ++    IE +      +E I K  A+ CP+C + +    GCDW+ C +CK EIC+ T+ +RWGP G+GDTS GC+C ++G+  CHP CN CH
Sbjct: 1763 RDCLHSFCKQCLISTIQYSD--EAEIRCPYSDAVYSCESVIQQREIKALVSKELYEAHLAKSIQQAESKIDNTFHCRTPNCRGWCIYEDNVNQFKCPVCTIVNCLTCRVIHD-GLDCKQYQDRMNSDCDTNIEARRTKAMLQEMIEKGDALNCPTCQVIVMKKWGCDWLKCSMCKTEICWVTRGARWGPAGKGDTSGGCRCGVNGIK-CHPKCNYCH 1975          
BLAST of RanBP-type and C3HC4-type zinc finger containing 1 vs. TrEMBL
Match: A0A267FR05 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig021711g1 PE=4 SV=1)

HSP 1 Score: 134.035 bits (336), Expect = 5.186e-32
Identity = 75/212 (35.38%), Postives = 115/212 (54.25%), Query Frame = 2
Query:  167 NKFCRNCLREHIKICKMYPVKLSCFLENETTSNFELSDYICYQILSKKDHAAYNRLRVDHRVIKIPNLHRCYNLNCSGTVRLS-DSRQIICNLCKVLNCYDCKAVHEKGETCNTWKEKNTTEIQFRIEQQL---QNEEKIRKNQAIYCPSCGIFIGFMGGCDWICCPVCKHEICFRTKMSRWGPGGRGDTSDGCKCKIDGVTLCHPNCNNCH 790
            ++ CR CLR+H+      PV+       +T ++ E +     Q+L+ ++     RL +      IPN   C   NC   V L+ D     C LC + NC  C+A H  G +C  ++ +   + +   E QL     E+ ++  +A+ CP+C +F+    GCDW+ C +C+ EIC+ T+  RWGPGG+GDTS GCKC+++G  LCHP C NCH
Sbjct:  312 HEVCRECLRQHLLHADSMPVRCPHDQCQQTVTDSEAN-----QLLTSQEFDRLQRLGLRQAEAVIPNTFHCVAPNCDAFVELAEDVNSFECMLCGLHNCVTCRASH-PGVSCRRYQNQLRIDAKNNKEAQLNLTHLEKMVKSGEAMNCPNCQVFLQKKEGCDWLACSMCQTEICWATRGPRWGPGGKGDTSGGCKCRLNG-RLCHPECQNCH 516          
BLAST of RanBP-type and C3HC4-type zinc finger containing 1 vs. TrEMBL
Match: A0A267DZB2 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig017341g1 PE=4 SV=1)

HSP 1 Score: 134.035 bits (336), Expect = 5.291e-32
Identity = 75/212 (35.38%), Postives = 115/212 (54.25%), Query Frame = 2
Query:  167 NKFCRNCLREHIKICKMYPVKLSCFLENETTSNFELSDYICYQILSKKDHAAYNRLRVDHRVIKIPNLHRCYNLNCSGTVRLS-DSRQIICNLCKVLNCYDCKAVHEKGETCNTWKEKNTTEIQFRIEQQL---QNEEKIRKNQAIYCPSCGIFIGFMGGCDWICCPVCKHEICFRTKMSRWGPGGRGDTSDGCKCKIDGVTLCHPNCNNCH 790
            ++ CR CLR+H+      PV+       +T ++ E +     Q+L+ ++     RL +      IPN   C   NC   V L+ D     C LC + NC  C+A H  G +C  ++ +   + +   E QL     E+ ++  +A+ CP+C +F+    GCDW+ C +C+ EIC+ T+  RWGPGG+GDTS GCKC+++G  LCHP C NCH
Sbjct:  312 HEVCRECLRQHLLHADSMPVRCPHDQCQQTVTDSEAN-----QLLTSQEFDRLQRLGLRQAEAVIPNTFHCVAPNCDAFVELAEDVNSFECMLCGLHNCVTCRASH-PGVSCRRYQNQLRIDAKNNKEAQLNLTHLEKMVKSGEAMNCPNCQVFLQKKEGCDWLACSMCQTEICWATRGPRWGPGGKGDTSGGCKCRLNG-RLCHPECQNCH 516          
BLAST of RanBP-type and C3HC4-type zinc finger containing 1 vs. Ensembl Cavefish
Match: rbck1 (RANBP2-type and C3HC4-type zinc finger containing 1 [Source:NCBI gene;Acc:103044240])

HSP 1 Score: 129.413 bits (324), Expect = 9.552e-34
Identity = 76/221 (34.39%), Postives = 115/221 (52.04%), Query Frame = 2
Query:  164 INKFCRNCLREHIKICKMYPVKLSCFLENETTSNFELSDYICYQILSKKDHAAYNRLRVDHRVIKIPNLHRCYNLNCSGT-VRLSDSRQIICNLCKVLNCYDCKAVHEKGETCNTWKEKNTTEIQFRIEQQLQNEEKIRKN-----------QAIYCPSCGIFIGFMGGCDWICCPVCKHEICFRTKMSRWGPGGRGDTSDGCKCKIDGVTLCHPNCNNCH 790
            ++ FCR CL++ I  C    V+   + ++E    + L D     +LS +++  +  LR+     +  N + C   +C G  +   D  + IC+ C   NC  CKA+H         K+ N  E Q  +  + +N+   +K            +A+YCP C + +    GCDWICC +CK EIC+ TK +RWGP G GDTS GC+C+++GV LCHP C NCH
Sbjct:  308 LHSFCRECLKQTIVNCTDAEVQCP-YRDDEYACAYTLQDREIKTLLSAEEYQKFEELRLSIAESRSENSYHCKTPDCGGWCIFEDDVNEFICDSCGEKNCLLCKAIH---------KDMNCKEYQDDLRIRAENDTAAKKTTEMLEMLVTNGEAMYCPKCKVIVQKKDGCDWICCLMCKTEICWVTKQARWGPLGNGDTSGGCRCRVNGV-LCHPRCQNCH 517          
BLAST of RanBP-type and C3HC4-type zinc finger containing 1 vs. Ensembl Cavefish
Match: rbck1 (RANBP2-type and C3HC4-type zinc finger containing 1 [Source:NCBI gene;Acc:103044240])

HSP 1 Score: 129.413 bits (324), Expect = 1.106e-33
Identity = 76/221 (34.39%), Postives = 115/221 (52.04%), Query Frame = 2
Query:  164 INKFCRNCLREHIKICKMYPVKLSCFLENETTSNFELSDYICYQILSKKDHAAYNRLRVDHRVIKIPNLHRCYNLNCSGT-VRLSDSRQIICNLCKVLNCYDCKAVHEKGETCNTWKEKNTTEIQFRIEQQLQNEEKIRKN-----------QAIYCPSCGIFIGFMGGCDWICCPVCKHEICFRTKMSRWGPGGRGDTSDGCKCKIDGVTLCHPNCNNCH 790
            ++ FCR CL++ I  C    V+   + ++E    + L D     +LS +++  +  LR+     +  N + C   +C G  +   D  + IC+ C   NC  CKA+H         K+ N  E Q  +  + +N+   +K            +A+YCP C + +    GCDWICC +CK EIC+ TK +RWGP G GDTS GC+C+++GV LCHP C NCH
Sbjct:  324 LHSFCRECLKQTIVNCTDAEVQCP-YRDDEYACAYTLQDREIKTLLSAEEYQKFEELRLSIAESRSENSYHCKTPDCGGWCIFEDDVNEFICDSCGEKNCLLCKAIH---------KDMNCKEYQDDLRIRAENDTAAKKTTEMLEMLVTNGEAMYCPKCKVIVQKKDGCDWICCLMCKTEICWVTKQARWGPLGNGDTSGGCRCRVNGV-LCHPRCQNCH 533          
BLAST of RanBP-type and C3HC4-type zinc finger containing 1 vs. Ensembl Cavefish
Match: rbck1 (RANBP2-type and C3HC4-type zinc finger containing 1 [Source:NCBI gene;Acc:103044240])

HSP 1 Score: 129.028 bits (323), Expect = 1.627e-33
Identity = 76/221 (34.39%), Postives = 115/221 (52.04%), Query Frame = 2
Query:  164 INKFCRNCLREHIKICKMYPVKLSCFLENETTSNFELSDYICYQILSKKDHAAYNRLRVDHRVIKIPNLHRCYNLNCSGT-VRLSDSRQIICNLCKVLNCYDCKAVHEKGETCNTWKEKNTTEIQFRIEQQLQNEEKIRKN-----------QAIYCPSCGIFIGFMGGCDWICCPVCKHEICFRTKMSRWGPGGRGDTSDGCKCKIDGVTLCHPNCNNCH 790
            ++ FCR CL++ I  C    V+   + ++E    + L D     +LS +++  +  LR+     +  N + C   +C G  +   D  + IC+ C   NC  CKA+H         K+ N  E Q  +  + +N+   +K            +A+YCP C + +    GCDWICC +CK EIC+ TK +RWGP G GDTS GC+C+++GV LCHP C NCH
Sbjct:  338 LHSFCRECLKQTIVNCTDAEVQCP-YRDDEYACAYTLQDREIKTLLSAEEYQKFEELRLSIAESRSENSYHCKTPDCGGWCIFEDDVNEFICDSCGEKNCLLCKAIH---------KDMNCKEYQDDLRIRAENDTAAKKTTEMLEMLVTNGEAMYCPKCKVIVQKKDGCDWICCLMCKTEICWVTKQARWGPLGNGDTSGGCRCRVNGV-LCHPRCQNCH 547          
BLAST of RanBP-type and C3HC4-type zinc finger containing 1 vs. Ensembl Cavefish
Match: shrprbck1r (ranBP-type and C3HC4-type zinc finger-containing protein 1-like [Source:NCBI gene;Acc:103029459])

HSP 1 Score: 77.411 bits (189), Expect = 1.593e-15
Identity = 66/212 (31.13%), Postives = 107/212 (50.47%), Query Frame = 2
Query:  173 FCRNCLREHIKICKMYPVKLSCFLENETTS-NFELSDYICYQILSKKDHAAYNRLRVDHRVIKIPNLHRCYNLNCSGTVRLSDSRQII-CNLCKVLNCYDCKAVHEKGETCNTWKE----KNTTEIQFRIEQQLQNEEKIRKNQAIYCPSCGIFIGFMGGCDWICCPVCKHEICFRTKMSRWGPGGRGDTSDGCKCKIDGVTLCHPNCNNCH 790
            FCR CLR  I + +    +++C   +E  + +  L +     ++S +++  + +  +     +    + C   +C G     D+     C +C   NC  CKA+HE G  C  +++    +   +   R  + L  +  +R  +A++CP CGI +    GCDW+ C VC  EIC+ T+  RWGPGG GDTS GC+C ++    CHP C NCH
Sbjct:  519 FCRECLRSVILLSE--DPQVACPYRDEAYACDCVLQEREIRALVSGEEYERWLQRGLSVAESRCEGSYHCATTDCPGWCVYEDTVNTFHCPVCTKHNCLLCKAIHE-GMNCKQYQDDLAARAINDTAARRTRDLL-KTLVRSGEAMHCPQCGIIVQKKEGCDWLRCTVCHTEICWVTRGPRWGPGGPGDTSGGCRCNVNK-QRCHPKCQNCH 725          
BLAST of RanBP-type and C3HC4-type zinc finger containing 1 vs. Ensembl Cavefish
Match: shrprbck1r (ranBP-type and C3HC4-type zinc finger-containing protein 1-like [Source:NCBI gene;Acc:103029459])

HSP 1 Score: 72.4034 bits (176), Expect = 7.536e-14
Identity = 52/187 (27.81%), Postives = 90/187 (48.13%), Query Frame = 2
Query:  173 FCRNCLREHIKICKMYPVKLSCFLENETTS-NFELSDYICYQILSKKDHAAYNRLRVDHRVIKIPNLHRCYNLNCSGTVRLSDSRQII-CNLCKVLNCYDCKAVHEKGETCNTWKE----KNTTEIQFRIEQQLQNEEKIRKNQAIYCPSCGIFIGFMGGCDWICCPVCKHEICFRTKMSRWGPGGR 715
            FCR CLR  I + +    +++C   +E  + +  L +     ++S +++  + +  +     +    + C   +C G     D+     C +C   NC  CKA+HE G  C  +++    +   +   R  + L  +  +R  +A++CP CGI +    GCDW+ C VC  EIC+ T+  RWGPG R
Sbjct:  490 FCRECLRSVILLSE--DPQVACPYRDEAYACDCVLQEREIRALVSGEEYERWLQRGLSVAESRCEGSYHCATTDCPGWCVYEDTVNTFHCPVCTKHNCLLCKAIHE-GMNCKQYQDDLAARAINDTAARRTRDLL-KTLVRSGEAMHCPQCGIIVQKKEGCDWLRCTVCHTEICWVTRGPRWGPGVR 672          
BLAST of RanBP-type and C3HC4-type zinc finger containing 1 vs. Ensembl Sea Lamprey
Match: RBCK1 (RANBP2-type and C3HC4-type zinc finger containing 1 [Source:HGNC Symbol;Acc:HGNC:15864])

HSP 1 Score: 112.079 bits (279), Expect = 3.047e-28
Identity = 67/214 (31.31%), Postives = 114/214 (53.27%), Query Frame = 2
Query:  164 INKFCRNCLREHIKICKMYPVKLSCF-LENETTSNFELSDYICYQILSKKDHAAYNRLRVDHRVIKIPNLHRCYNLNCSGTVRLSDS-RQIICNLCKVLNCYDCKAVHEKGETCNTWKEK---NTTEIQFRIEQQLQNEEKIRKNQAIYCPSCGIFIGFMGGCDWICCPVCKHEICFRTKMSRWGPGGRGDTSDGCKCKIDGVTLCHPNCNNCH 790
            ++ FC++CL   I  C+    +++C   + E +  F+L       ++S+ ++  +    +     +  + + C   +C G     D     +C +CK  NC  CKA+HE G  C  +++     +   Q  ++  L  +  ++   A++CP+C + +    GCDWICC +CK EIC+ TK +RWGP G GDTS GC+C+I+   +CHP+C NCH
Sbjct:  311 LHNFCKDCLHGTIVNCE--DAEVTCPNQDGEISCEFKLHQREIKALVSEVEYCRFLGKGLAIAENRSADSYHCVTADCLGWCFYEDMVNDFLCPICKKSNCLTCKAIHE-GMDCQEYQDDLKLRSDNDQAAMQTNLMLQTMVQTGDAMHCPTCKVIVQKKDGCDWICCSICKTEICWVTKGARWGPNGTGDTSGGCQCRIND-RMCHPDCMNCH 520          
BLAST of RanBP-type and C3HC4-type zinc finger containing 1 vs. Ensembl Nematostella
Match: EDO39228 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SAP2])

HSP 1 Score: 120.553 bits (301), Expect = 6.866e-33
Identity = 73/217 (33.64%), Postives = 112/217 (51.61%), Query Frame = 2
Query:  164 INKFCRNCLREHIKICKMYPVKLSCFLENETTSNFELSDYICYQILSKKDHAAYNRLRVDHRVIKIPNLHRCYNLNCSGTVRLSDSRQII-CNLCKVLNCYDCKAVHEKGETCNTWKEKNTTEIQFRI-------EQQLQNEEKIRKNQAIYCPSCGIFIGFMGGCDWICCPVCKHEICFRTKMSRWGPGGRGDTSDGCKCKIDGVTLCHPNCNNCH 790
            +++FC +CLREHI+ C    V+   + + +   +F ++      +LS++D   +    +     +  N   C   NC G     D+     C +C  +NC  CKA+H     C  +++    +IQ R        + QL  E+ I+K  A+ CP C I +    GCDW+ C +C+ EIC+ T+  RWGP G GDT+ GCKC++ G   CHPNC NCH
Sbjct:   31 LHRFCIDCLREHIRNCTDPEVQCP-YQDEQFACHFIITAQEIKALLSEEDFNKFLNRSLATAESQAANSFHCKTPNCPGWCLYEDNVNTFHCEVCSKVNCLTCKAIHFPEMNCREYQQ----DIQRRALNDDAAKQTQLYLEDMIKKGDAMRCPQCQIILLKKDGCDWMRCSMCRMEICWATRGPRWGPQGVGDTTAGCKCRVGGRK-CHPNCRNCH 241          
BLAST of RanBP-type and C3HC4-type zinc finger containing 1 vs. Ensembl Nematostella
Match: EDO31527 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SXP1])

HSP 1 Score: 46.2098 bits (108), Expect = 5.776e-6
Identity = 54/216 (25.00%), Postives = 89/216 (41.20%), Query Frame = 2
Query:  167 NKFCRNCLREHI--KICKMYPVKLSCFLENETTSNFELSDYICYQILSKKDHAAYNRLRVDHRVIKIPNLHRCYNLNCSGTVRLSDSRQ-------------------------IICNLCKVLNCYDCKAVHEKGETCNTWKEKNTTEIQFRIEQQLQNEEKIRKNQAIYCPSCGIFIGFMGGCDWICCPVCKHEICFRTKMSRWGPGGRGDTSDG 733
             K C+ CLR HI  K+ +   V++ C  EN    +  LS+ +  +I  ++    Y + +VD    + PN       NC+   R    ++                         I+C  CK + C+DC A    G +C  + + +T+    RI    +N   + +N A  CP C ++I  + GCD + C  C+ + C+R      G    GD  D 
Sbjct:   28 GKTCKECLRYHIEEKVTQGI-VQIICPFEN---CDGVLSETVIKEISDEEIWKKYVKFKVD----RDPNSSVKTCPNCAMVFRKQPLKEQDQQNVCATKSKKKEKKEQISKDCKIVCEECKFVWCFDCHAPWHYGISCEKFCKGDTS---LRI--WARNRGALTRN-ATQCPKCRVYIQRISGCDSMACSRCQTQFCYRCGRHFRGNRFLGDHHDA 229          
BLAST of RanBP-type and C3HC4-type zinc finger containing 1 vs. Ensembl Medaka
Match: rbck1 (ranBP-type and C3HC4-type zinc finger-containing protein 1 [Source:NCBI gene;Acc:101166217])

HSP 1 Score: 114.39 bits (285), Expect = 2.381e-28
Identity = 73/213 (34.27%), Postives = 113/213 (53.05%), Query Frame = 2
Query:  164 INKFCRNCLREHIKICKMYPVKLSCFLENETTSNFELSDYICYQILSKKDHAAYNRLRVDHRVIKIPNLHRCYNLNCSGTVRLSDS-RQIICNLCKVLNCYDCKAVHEKGETCNTWKEKNTTEIQ-FRIEQQLQN--EEKIRKNQAIYCPSCGIFIGFMGGCDWICCPVCKHEICFRTKMSRWGPGGRGDTSDGCKCKIDGVTLCHPNCNNCH 790
            ++ FCR CL   I+       ++SC  + E+    +L D    ++L++++H  +  LR+     +  +   C   NC G     D   +  C+LC  +NC  C+A+H K   C  +++      Q  +  QQ +   E  ++  +A+ CP C I +    GCDWICC +CK EIC+ TK +RWGP G GDTS GC+C+++    CHPNC NCH
Sbjct:  314 LHTFCRECLIGTIR--NSNNAEVSCPDDCES----KLLDREIKELLTEEEHQRFLELRLSIAESRSEHSFHCQTPNCRGWCIYEDEVNEFHCDLCLEVNCLLCRAIH-KDMNCKDYQDDLRIRAQNDKAAQQTKQMLESMLQNGEAMNCPRCAIIVQKKDGCDWICCLMCKTEICWVTKQARWGPNGPGDTSGGCRCRVNNQP-CHPNCQNCH 518          
BLAST of RanBP-type and C3HC4-type zinc finger containing 1 vs. Ensembl Medaka
Match: shrprbck1r (ranBP-type and C3HC4-type zinc finger-containing protein 1 [Source:NCBI gene;Acc:101169745])

HSP 1 Score: 100.908 bits (250), Expect = 1.874e-23
Identity = 66/220 (30.00%), Postives = 107/220 (48.64%), Query Frame = 2
Query:  173 FCRNCLREHIKICKMYPVKLSCFLENETTS-NFELSDYICYQILSKKDHAAYNRLRVDHRVIKIPNLHRCYNLNCSGTVRLSDSRQII-CNLCKVLNCYDCKAVHEKGETCNTWKE------------KNTTEIQFRIEQQLQNEEKIRKNQAIYCPSCGIFIGFMGGCDWICCPVCKHEICFRTKMSRWGPGGRGDTSDGCKCKIDGVTLCHPNCNNCH 790
            FCR CLR  I + +    ++SC   ++  S +  L +     ++S +++  + +  +     +    + C   +C G     D+  +  C +C+  NC  CKA+HE G  C  +++            + TT +   +         ++  +A+YCP CGI +    GCDW+ C VC  EIC+ T+  RWGP G GDTS GC+C ++    CHP C NCH
Sbjct:  503 FCRECLRSVIMLSEE--PEVSCPYRDDAYSCDGVLQEREIKALVSAEEYERWLQRGLSMAESRCEGSYHCATPDCLGWCVYEDTVNVFHCPVCRKHNCLICKAIHE-GMNCKQYQDDLAVRAINDSAARRTTHLLMTL---------VQSGEAMYCPQCGIIVQKRDGCDWLRCTVCHIEICWVTRGPRWGPKGPGDTSGGCRCNVNNQK-CHPKCQNCH 709          
BLAST of RanBP-type and C3HC4-type zinc finger containing 1 vs. Planmine SMEST
Match: SMESG000038116.1 (SMESG000038116.1)

HSP 1 Score: 448.743 bits (1153), Expect = 2.033e-161
Identity = 233/234 (99.57%), Postives = 234/234 (100.00%), Query Frame = 2
Query:   89 MELENIKQLXXXXXXXXXXXXIEGRINKFCRNCLREHIKICKMYPVKLSCFLENETTSNFELSDYICYQILSKKDHAAYNRLRVDHRVIKIPNLHRCYNLNCSGTVRLSDSRQIICNLCKVLNCYDCKAVHEKGETCNTWKEKNTTEIQFRIEQQLQNEEKIRKNQAIYCPSCGIFIGFMGGCDWICCPVCKHEICFRTKMSRWGPGGRGDTSDGCKCKIDGVTLCHPNCNNCH 790
            MELENIKQLCTTCCKYSKTCKIEGRINKFCRNCLREHIKICKMYPVKLSCFLENETTSNFELSDYICYQILSKKDHAAYNRLRVDHRVIKIPNLHRCYNLNCSGTVRLSDSRQIICNLCKVLNCYDCKAVHEKGETCNTWKEKNTTEIQFRIEQQLQNEEKIRKNQAIYCPSCGIFIGF+GGCDWICCPVCKHEICFRTKMSRWGPGGRGDTSDGCKCKIDGVTLCHPNCNNCH
Sbjct:    1 MELENIKQLCTTCCKYSKTCKIEGRINKFCRNCLREHIKICKMYPVKLSCFLENETTSNFELSDYICYQILSKKDHAAYNRLRVDHRVIKIPNLHRCYNLNCSGTVRLSDSRQIICNLCKVLNCYDCKAVHEKGETCNTWKEKNTTEIQFRIEQQLQNEEKIRKNQAIYCPSCGIFIGFIGGCDWICCPVCKHEICFRTKMSRWGPGGRGDTSDGCKCKIDGVTLCHPNCNNCH 234          
BLAST of RanBP-type and C3HC4-type zinc finger containing 1 vs. Planmine SMEST
Match: SMESG000038117.1 (SMESG000038117.1)

HSP 1 Score: 144.821 bits (364), Expect = 6.593e-42
Identity = 81/214 (37.85%), Postives = 117/214 (54.67%), Query Frame = 2
Query:  176 CRNCLREHIKICK---------MYPVKLSCFLENETTSNFELSDYICYQILSKKDHAAYNRLRVDHRVIKIPNLHRCYNLNCSGTVRLSDSRQIICNLCKVLNCYDCKAVHEKGETCNTWKEKNTTEIQFRIEQQLQNEEKIRKNQAIYCPSCGIFIGFMGGCDWICCPVCKHEICFRTKMSRWGPGGRGDTSDGCKCKIDGVTLCHPNCNNCH 790
            CR+CL +HI +           ++P+ L C           + D  C+ IL K++H A+NR R+  R +   NL+ CY  NC  +++ + + Q  C  C  +NCY C AVH++ +TC  W   N   I+ R   +L NE+KI K + + CP C IF     GCD + C  C  +ICF TK +RWGP G GD S GCKC ++G+  C+ NC +CH
Sbjct:   38 CRSCLEQHILLTTYPPRCPFMYVFPLLLPC--------PCIIQDNQCFDILEKENHVAFNRKRLMRRYMNEDNLYPCYGENCKFSIKRNGNNQQECVRCGTINCYICGAVHKQHQTCEMWAADNPEIIKGRNLLKLYNEDKITKGEGMCCPKCKIFFEVTQGCDAVRCAFCLLDICFLTKQARWGPQGFGDISGGCKCMVNGIK-CNENCKSCH 242          
BLAST of RanBP-type and C3HC4-type zinc finger containing 1 vs. Planmine SMEST
Match: SMESG000044481.1 (SMESG000044481.1)

HSP 1 Score: 118.627 bits (296), Expect = 4.557e-32
Identity = 67/210 (31.90%), Postives = 110/210 (52.38%), Query Frame = 2
Query:  167 NKFCRNCLREHIKICKMYPVKLSCFLENETTSNFELSDYICYQILSKKDHAAYNRLRVDHRVIKIPNLHRCYNLNCSGTVR--LSDSRQIICNLCKVLNCYDCKAVHEKGETCNTWKEKNTTEIQFRIEQQLQNEEKIRKNQAIYCPSCGIFIGFMGGCDWICCPVCKHEICFRTKMSRWGPGGRGDTSDGCKCKIDGVTLCHPNCNNCH 790
            ++ C +C   + +  +++P  L C + +++ S+    +Y  + +  + D   Y  +R  +++IK  N ++CYN +C+   +   S+    IC+ C    C  C+A+H   ETC+ W+  N   ++ R       + +++    + C  CG FI  +  CD I CP CK  +CF+ KM RWGP G GD S GC+C  DG T CHP C  CH
Sbjct:   20 HEICHSCFGNYFQAVRIHP--LPCPVCSKSLSD----EYCEFNLGQRVDD--YREVRAHYQLIKDKNKYQCYNEDCTEIFQNDGSEIESFICSGCNKKTCLKCRALHTANETCDDWERNNEGLVKSRKYMAKDMKRQVKCGHGMTCEDCGCFIIKLENCDGILCPRCKLPLCFKKKMRRWGPKGVGDLSGGCRCYWDGKTPCHPRCKGCH 221          
BLAST of RanBP-type and C3HC4-type zinc finger containing 1 vs. Planmine SMEST
Match: SMESG000002192.1 (SMESG000002192.1)

HSP 1 Score: 112.849 bits (281), Expect = 6.266e-30
Identity = 68/205 (33.17%), Postives = 107/205 (52.20%), Query Frame = 2
Query:  176 CRNCLREHIKICKMYPVKLSCFLENETTSNFELSDYICYQILSKKDHAAYNRLRVDHRVIKIPNLHRCYNLNCSG-TVRLSDSRQIICNLCKVLNCYDCKAVHEKGETCNTWKEKNTTEIQFRIEQQLQNEEKIRKNQAIYCPSCGIFIGFMGGCDWICCPVCKHEICFRTKMSRWGPGGRGDTSDGCKCKIDGVTLCHPNCNNC 787
            C+ C R++  +   YP + S  L+        L+D    + LS K+ + Y + +     +   ++ RC + NC G T  +S   +  C+ C+ +NC  CKA+H   ETC+ W+  N   I  R +++     KI+  Q ++C +CG+F    GGC  I CP CK  +C  T+ +R+GP GR DTS GC C  +    CHP+C +C
Sbjct:   23 CKECFRQNFTLYPNYPQECSSCLK-------ILTDEFVLKNLSDKEASRYLKSKSILNRMMDKSVIRCLDSNCDGETGNISQDSRYCCSKCQQINCLSCKAIHNDKETCSQWQANNQELINDRKKREADVNAKIKSQQGMHCVNCGLFCQRDGGCFGIKCPQCKTYLCIITQKARYGPQGRDDTSGGCMC--NSPNQCHPDCGSC 218          
BLAST of RanBP-type and C3HC4-type zinc finger containing 1 vs. Planmine SMEST
Match: SMESG000003670.1 (SMESG000003670.1)

HSP 1 Score: 111.309 bits (277), Expect = 5.008e-29
Identity = 67/177 (37.85%), Postives = 99/177 (55.93%), Query Frame = 2
Query:  272 LSDYICYQILSKKDHAAYNRLR--VDHRVIKIPNLHRCYNLNCSGTVRLSDSRQII---CNLCKVLNCYDCKAVHEKGETCNTWKEKNTTEIQFRIEQQLQNEEKIRKNQAIYCPSCGIFIGFMGGCDWICCPVCKHEICFRTKMSRWGPGGRGDTSDGCKCKIDGVTLCHPNCNNC 787
            L+D  C + L+K +   Y R +  +D  V K   L++CY +NC G +R  +S ++    C  C  +NC  C+A+H K E+C  W++ N    Q R++++ +   K++ N A+YC  CG F   +GGC  + C VCK  +CF T+ +RWGP G GD S GCKC       CH NC  C
Sbjct:   47 LADKECIKYLNKGNRKKYLRHKSFIDDLVDKF--LYKCYKINCKGEIRYFESDRLNKFNCPECHQINCVRCEAIHGKDESCKIWRQNN----QDRVKERAERYGKLQNNCAMYCVRCGTFCERVGGCYGVKCGVCKTSLCFITQKARWGPEGYGDNSGGCKC--SARNKCHANCIGC 215          
The following BLAST results are available for this feature:
BLAST of RanBP-type and C3HC4-type zinc finger containing 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 4
Match NameE-valueIdentityDescription
RBCK16.272e-2132.71RANBP2-type and C3HC4-type zinc finger containing ... [more]
RBCK11.040e-2032.71RANBP2-type and C3HC4-type zinc finger containing ... [more]
RBCK12.650e-1932.54RANBP2-type and C3HC4-type zinc finger containing ... [more]
RBCK12.650e-1932.54RANBP2-type and C3HC4-type zinc finger containing ... [more]
back to top
BLAST of RanBP-type and C3HC4-type zinc finger containing 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of RanBP-type and C3HC4-type zinc finger containing 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 4
Match NameE-valueIdentityDescription
LUBEL2.315e-925.26gene:FBgn0031857 transcript:FBtr0331216[more]
LUBEL2.398e-925.26gene:FBgn0031857 transcript:FBtr0331220[more]
LUBEL2.398e-925.26gene:FBgn0031857 transcript:FBtr0331218[more]
LUBEL3.058e-925.26gene:FBgn0031857 transcript:FBtr0331221[more]
back to top
BLAST of RanBP-type and C3HC4-type zinc finger containing 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rbck15.590e-3235.05RanBP-type and C3HC4-type zinc finger containing 1... [more]
rbck15.590e-3235.05RanBP-type and C3HC4-type zinc finger containing 1... [more]
rbck13.640e-3035.63RanBP-type and C3HC4-type zinc finger containing 1... [more]
shrprbck1r5.519e-2230.81sharpin and rbck1 related [Source:NCBI gene;Acc:56... [more]
zmp:00000005241.013e-627.91zmp:0000000524 [Source:ZFIN;Acc:ZDB-GENE-130530-52... [more]
back to top
BLAST of RanBP-type and C3HC4-type zinc finger containing 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSXETT00000033448.12.979e-2831.78RanBP-type and C3HC4-type zinc finger containing 1... [more]
back to top
BLAST of RanBP-type and C3HC4-type zinc finger containing 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Rbck14.403e-2032.24RanBP-type and C3HC4-type zinc finger containing 1... [more]
Rbck14.403e-2032.24RanBP-type and C3HC4-type zinc finger containing 1... [more]
back to top
BLAST of RanBP-type and C3HC4-type zinc finger containing 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|E6ZIJ1|HOIL1_DICLA5.259e-2230.66RanBP-type and C3HC4-type zinc finger-containing p... [more]
sp|Q62921|HOIL1_RAT3.663e-2134.42RanBP-type and C3HC4-type zinc finger-containing p... [more]
sp|A9JTG5|HOIL1_DANRE4.167e-2130.81RanBP-type and C3HC4-type zinc finger-containing p... [more]
sp|Q9BYM8|HOIL1_HUMAN4.992e-2032.71RanBP-type and C3HC4-type zinc finger-containing p... [more]
sp|Q9WUB0|HOIL1_MOUSE3.080e-1932.24RanBP-type and C3HC4-type zinc finger-containing p... [more]
back to top
BLAST of RanBP-type and C3HC4-type zinc finger containing 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1I8HCV67.554e-3435.38RING-type domain-containing protein OS=Macrostomum... [more]
A0A182G6872.826e-3231.46Uncharacterized protein OS=Aedes albopictus OX=716... [more]
W5JD783.520e-3232.26Ubiquitin conjugating enzyme 7 interacting protein... [more]
A0A267FR055.186e-3235.38Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A267DZB25.291e-3235.38Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
back to top
BLAST of RanBP-type and C3HC4-type zinc finger containing 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rbck19.552e-3434.39RANBP2-type and C3HC4-type zinc finger containing ... [more]
rbck11.106e-3334.39RANBP2-type and C3HC4-type zinc finger containing ... [more]
rbck11.627e-3334.39RANBP2-type and C3HC4-type zinc finger containing ... [more]
shrprbck1r1.593e-1531.13ranBP-type and C3HC4-type zinc finger-containing p... [more]
shrprbck1r7.536e-1427.81ranBP-type and C3HC4-type zinc finger-containing p... [more]
back to top
BLAST of RanBP-type and C3HC4-type zinc finger containing 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
RBCK13.047e-2831.31RANBP2-type and C3HC4-type zinc finger containing ... [more]
back to top
BLAST of RanBP-type and C3HC4-type zinc finger containing 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of RanBP-type and C3HC4-type zinc finger containing 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO392286.866e-3333.64Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO315275.776e-625.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of RanBP-type and C3HC4-type zinc finger containing 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
rbck12.381e-2834.27ranBP-type and C3HC4-type zinc finger-containing p... [more]
shrprbck1r1.874e-2330.00ranBP-type and C3HC4-type zinc finger-containing p... [more]
back to top
BLAST of RanBP-type and C3HC4-type zinc finger containing 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000038116.12.033e-16199.57SMESG000038116.1[more]
SMESG000038117.16.593e-4237.85SMESG000038117.1[more]
SMESG000044481.14.557e-3231.90SMESG000044481.1[more]
SMESG000002192.16.266e-3033.17SMESG000002192.1[more]
SMESG000003670.15.008e-2937.85SMESG000003670.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30009549 ID=SMED30009549|Name=RanBP-type and C3HC4-type zinc finger containing 1|organism=Schmidtea mediterranea sexual|type=transcript|length=874bp
CTAAAATTAGATAACAAATAATATACGAAATGAAAACTATAAAAGTGTTT
GAATTGAACTTAACTATTTATAAAATATTTGATTTTCGATGGAATTGGAA
AATATAAAACAACTGTGTACAACTTGCTGCAAATATTCTAAAACTTGTAA
AATAGAAGGGAGGATTAACAAATTTTGCAGAAATTGCTTGAGAGAACATA
TCAAGATTTGTAAAATGTATCCTGTGAAATTATCATGTTTTTTGGAAAAT
GAAACTACAAGCAATTTTGAATTGAGCGATTATATTTGTTATCAGATTCT
TTCCAAGAAAGATCATGCTGCATATAATAGATTAAGAGTGGACCACCGAG
TCATTAAAATACCAAATTTGCATCGTTGCTATAACCTTAATTGTTCGGGT
ACAGTTAGACTTTCTGATTCACGTCAAATTATATGCAATCTTTGCAAAGT
TTTGAATTGCTACGATTGTAAAGCGGTGCACGAAAAGGGAGAAACGTGCA
ATACATGGAAAGAGAAAAACACAACAGAAATTCAGTTTAGAATTGAGCAA
CAGTTGCAAAATGAGGAAAAAATTCGAAAAAATCAAGCAATTTATTGCCC
AAGTTGTGGAATATTTATTGGATTTATGGGAGGCTGTGATTGGATTTGCT
GTCCCGTTTGTAAACATGAAATCTGTTTTAGAACCAAGATGAGCCGATGG
GGACCAGGGGGACGGGGTGATACATCTGATGGCTGTAAGTGTAAAATTGA
TGGGGTCACTCTGTGCCACCCAAATTGTAATAATTGCCATTAAGCTTCAC
GTTTTCATTTTGCTTCCTTCTATGATATTGTTACTTTGATTTTAATTTTA
ATAAATTGGCTTTACTTAAAAAAA
back to top

protein sequence of SMED30009549-orf-1

>SMED30009549-orf-1 ID=SMED30009549-orf-1|Name=SMED30009549-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=235bp
MELENIKQLCTTCCKYSKTCKIEGRINKFCRNCLREHIKICKMYPVKLSC
FLENETTSNFELSDYICYQILSKKDHAAYNRLRVDHRVIKIPNLHRCYNL
NCSGTVRLSDSRQIICNLCKVLNCYDCKAVHEKGETCNTWKEKNTTEIQF
RIEQQLQNEEKIRKNQAIYCPSCGIFIGFMGGCDWICCPVCKHEICFRTK
MSRWGPGGRGDTSDGCKCKIDGVTLCHPNCNNCH*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0016740transferase activity
GO:0008270zinc ion binding
GO:0046872metal ion binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000101muscle cell
PLANA:0000142posterior region of the whole animal
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR026261RBCK1/SHARPIN
Vocabulary: biological process
TermDefinition
GO:0048701embryonic cranial skeleton morphogenesis
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR026261RanBP-type and C3HC4-type zinc finger-containing protein 1/SHARPINPANTHERPTHR22770:SF35RANBP-TYPE AND C3HC4-TYPE ZINC FINGER-CONTAINING PROTEIN 1-RELATEDcoord: 19..234
NoneNo IPR availablePANTHERPTHR22770UBIQUITIN CONJUGATING ENZYME 7 INTERACTING PROTEIN-RELATEDcoord: 19..234
NoneNo IPR availablePROSITEPS51873TRIADcoord: 6..222
score: 15.292
NoneNo IPR availableSUPERFAMILYSSF57850RING/U-boxcoord: 152..208
NoneNo IPR availableSUPERFAMILYSSF57850RING/U-boxcoord: 79..143