Peptidase_M43 domain-containing protein

Overview
NamePeptidase_M43 domain-containing protein
Smed IDSMED30009546
Length (bp)990
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Peptidase_M43 domain-containing protein (SMED30009546) t-SNE clustered cells

Violin plots show distribution of expression levels for Peptidase_M43 domain-containing protein (SMED30009546) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Peptidase_M43 domain-containing protein (SMED30009546) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Peptidase_M43 domain-containing protein (SMED30009546) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30009546

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30009546SMESG000019773.1 dd_Smed_v4_855_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30009546SMESG000019773.1 dd_Smed_v4_855_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30009546SMESG000019773.1 dd_Smed_v4_855_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30009546SMESG000019773.1 dd_Smed_v4_855_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30009546SMESG000019773.1 dd_Smed_v6_855_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30009546SMESG000019773.1 OX_Smed_1.0.03919ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30009546SMESG000019773.1 dd_Smed_v4_855_0_1dd_Smed_v4PMID:30962434
Cote et al., 2019
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Peptidase_M43 domain-containing protein vs. TrEMBL
Match: A0A433QY88 (Uncharacterized protein OS=Jimgerdemannia flammicorona OX=994334 GN=BC938DRAFT_478572 PE=4 SV=1)

HSP 1 Score: 59.3066 bits (142), Expect = 8.764e-8
Identity = 24/47 (51.06%), Postives = 29/47 (61.70%), Query Frame = 1
Query:  727 NRRTENVWYGTAPACSGSCPQGQTLIRTDKSGDGHTCWTGHKALCQR 867
            N      W GTAP C+GSCP+G T I     GDG  CWTG+K LC++
Sbjct:   23 NGECSRYWSGTAPFCAGSCPEGYTEITRSSCGDGACCWTGYKVLCEK 69          
BLAST of Peptidase_M43 domain-containing protein vs. TrEMBL
Match: A0A2A6BVN9 (Uncharacterized protein OS=Pristionchus pacificus OX=54126 GN=PRIPAC_49186 PE=4 SV=1)

HSP 1 Score: 57.3806 bits (137), Expect = 4.490e-7
Identity = 24/46 (52.17%), Postives = 27/46 (58.70%), Query Frame = 1
Query:  736 TENVWYGTAPAC-SGSCPQGQTLIRTDKSGDGHTCWTGHKALCQRV 870
            T   WYGTAP C    CP G T ++ D  GDG TCW G K LC+ V
Sbjct:   25 TTYAWYGTAPFCFPEDCPDGWTFVKNDDKGDGSTCWIGEKTLCKFV 70          
BLAST of Peptidase_M43 domain-containing protein vs. TrEMBL
Match: A0A4X3PKU5 (Uncharacterized protein OS=Pristionchus pacificus OX=54126 GN=WBGene00281063 PE=4 SV=1)

HSP 1 Score: 57.3806 bits (137), Expect = 4.490e-7
Identity = 24/46 (52.17%), Postives = 27/46 (58.70%), Query Frame = 1
Query:  736 TENVWYGTAPAC-SGSCPQGQTLIRTDKSGDGHTCWTGHKALCQRV 870
            T   WYGTAP C    CP G T ++ D  GDG TCW G K LC+ V
Sbjct:   25 TTYAWYGTAPFCFPEDCPDGWTFVKNDDKGDGSTCWIGEKTLCKFV 70          
BLAST of Peptidase_M43 domain-containing protein vs. TrEMBL
Match: S7RWA5 (Uncharacterized protein OS=Gloeophyllum trabeum (strain ATCC 11539 / FP-39264 / Madison 617) OX=670483 GN=GLOTRDRAFT_127937 PE=4 SV=1)

HSP 1 Score: 55.0694 bits (131), Expect = 3.883e-6
Identity = 21/44 (47.73%), Postives = 28/44 (63.64%), Query Frame = 1
Query:  748 WYGTAPACSGSCPQGQTLIRTDKSGDGHTCWTGHKALCQRVYFI 879
            W GT+P C+GSCP+G T   T   GDG  CWTG+K +  R+  +
Sbjct:   44 WSGTSPFCAGSCPEGYTDTATSSCGDGACCWTGYKNVVMRIKLV 87          
BLAST of Peptidase_M43 domain-containing protein vs. TrEMBL
Match: A0A1C7MHJ3 (Uncharacterized protein OS=Grifola frondosa OX=5627 GN=A0H81_02939 PE=4 SV=1)

HSP 1 Score: 56.225 bits (134), Expect = 9.871e-6
Identity = 22/38 (57.89%), Postives = 28/38 (73.68%), Query Frame = 1
Query:  748 WYGTAPACSGSCPQGQTLIRTDKSGDGHTCWTGHKALC 861
            WYGTAP C+G CP G+T + TD SGDG +C +G+K  C
Sbjct:  119 WYGTAPICAGECPPGKTQVTTDGSGDGASCVSGNKVFC 156          
BLAST of Peptidase_M43 domain-containing protein vs. Planmine SMEST
Match: SMESG000019773.1 (SMESG000019773.1)

HSP 1 Score: 452.595 bits (1163), Expect = 1.627e-162
Identity = 227/227 (100.00%), Postives = 227/227 (100.00%), Query Frame = 1
Query:  199 MATSHSSITRSYLAMKXXXXXXXXXXAFTVYAERPKQCVFPFTYKGRTFEDCTDVNADFLWCSPTKEYSGTSIPCNSEEEQQRLKRDNYYKLFKILEEQEEHIKKLEASHSTNTKCSNCKEEADAIVKSLGALSSIASDHLRKITALKDKFEKKQKFADALLTKVQQINELALRANNRRTENVWYGTAPACSGSCPQGQTLIRTDKSGDGHTCWTGHKALCQRVYFI 879
            MATSHSSITRSYLAMKLHLIILLLCIAFTVYAERPKQCVFPFTYKGRTFEDCTDVNADFLWCSPTKEYSGTSIPCNSEEEQQRLKRDNYYKLFKILEEQEEHIKKLEASHSTNTKCSNCKEEADAIVKSLGALSSIASDHLRKITALKDKFEKKQKFADALLTKVQQINELALRANNRRTENVWYGTAPACSGSCPQGQTLIRTDKSGDGHTCWTGHKALCQRVYFI
Sbjct:    1 MATSHSSITRSYLAMKLHLIILLLCIAFTVYAERPKQCVFPFTYKGRTFEDCTDVNADFLWCSPTKEYSGTSIPCNSEEEQQRLKRDNYYKLFKILEEQEEHIKKLEASHSTNTKCSNCKEEADAIVKSLGALSSIASDHLRKITALKDKFEKKQKFADALLTKVQQINELALRANNRRTENVWYGTAPACSGSCPQGQTLIRTDKSGDGHTCWTGHKALCQRVYFI 227          
BLAST of Peptidase_M43 domain-containing protein vs. Planmine SMEST
Match: SMESG000019773.1 (SMESG000019773.1)

HSP 1 Score: 422.165 bits (1084), Expect = 1.393e-150
Identity = 201/201 (100.00%), Postives = 201/201 (100.00%), Query Frame = 1
Query:  277 AFTVYAERPKQCVFPFTYKGRTFEDCTDVNADFLWCSPTKEYSGTSIPCNSEEEQQRLKRDNYYKLFKILEEQEEHIKKLEASHSTNTKCSNCKEEADAIVKSLGALSSIASDHLRKITALKDKFEKKQKFADALLTKVQQINELALRANNRRTENVWYGTAPACSGSCPQGQTLIRTDKSGDGHTCWTGHKALCQRVYFI 879
            AFTVYAERPKQCVFPFTYKGRTFEDCTDVNADFLWCSPTKEYSGTSIPCNSEEEQQRLKRDNYYKLFKILEEQEEHIKKLEASHSTNTKCSNCKEEADAIVKSLGALSSIASDHLRKITALKDKFEKKQKFADALLTKVQQINELALRANNRRTENVWYGTAPACSGSCPQGQTLIRTDKSGDGHTCWTGHKALCQRVYFI
Sbjct:   13 AFTVYAERPKQCVFPFTYKGRTFEDCTDVNADFLWCSPTKEYSGTSIPCNSEEEQQRLKRDNYYKLFKILEEQEEHIKKLEASHSTNTKCSNCKEEADAIVKSLGALSSIASDHLRKITALKDKFEKKQKFADALLTKVQQINELALRANNRRTENVWYGTAPACSGSCPQGQTLIRTDKSGDGHTCWTGHKALCQRVYFI 213          
BLAST of Peptidase_M43 domain-containing protein vs. Planmine SMEST
Match: SMESG000034284.1 (SMESG000034284.1)

HSP 1 Score: 70.8626 bits (172), Expect = 1.846e-13
Identity = 46/191 (24.08%), Postives = 89/191 (46.60%), Query Frame = 1
Query:  292 AERPKQCVFPFTYKGRTFEDCTDVNADFLWCSPTKEYSGTSIPCNSEEEQQRLKRDNYYKLFKILEEQEEHIKKLEAS-HSTNTKCSNCKEEADAIVKSLGALSSIASDHLRKITALKDKFEKKQKFADAL------------LTKVQQINELALRANNRRTENVWYGTAPACSGSCPQGQTLIRTDKSGD 825
              +P  C FPF YKG T+ +C   ++ + WCS  + Y+GT   C  E++  ++   ++Y+L K  +E    + KL+ + ++ N +CS C E    I  ++   S+I  D  +++  L+ +  K +K  D +             T ++ I  +++ A+  + +N W       S   P     + +D+  D
Sbjct:   20 VNKPATCTFPFQYKGATYNECIKFDSQYYWCSVYEIYNGTFAYC-QEDKTDQITDQHFYELMKKSQEAVSRLDKLQQNLNNKNGQCSQCIEIMKTISTAITDQSAIYMDQNKRLLGLRAQHSKLEKVVDQIKQHYQKRRCKQSPTGIEYIGRVSMTASGFQCQN-W-------SSQFPNKHEYVESDRYSD 201          
BLAST of Peptidase_M43 domain-containing protein vs. Planmine SMEST
Match: SMESG000028600.1 (SMESG000028600.1)

HSP 1 Score: 63.5438 bits (153), Expect = 3.373e-11
Identity = 44/138 (31.88%), Postives = 61/138 (44.20%), Query Frame = 1
Query:  289 YAERPKQCVFPFTYKGRTFEDCTDVNADFLWCSPTKEYSGTSIPCNSEEEQQRLKRDNYYKLFKILEEQEEHIKKLEASHSTNTKCSNCKEEADAIVKSLGALSSIASDHLRKITALKDKFEKKQKFADALLTKVQQI 702
            Y + PK CVFPF Y+GR ++DC   +A   WCS   EY G    CN+ E   +     +    K L E  E +K    S  +   C  C  +      S+  LS I+ D+ R I  L +   + + F DAL      I
Sbjct:   21 YKQHPK-CVFPFKYQGRVYDDCVVKDAGAPWCSEDAEYKGLFHYCNNNEGDTQESNGAFLSAQKKLAENSEILKN--KSFISGDSCETCGTQFYITESSMTQLSKISDDNNRHIDYLLNV--ENENFKDALGISFNDI 153          
The following BLAST results are available for this feature:
BLAST of Peptidase_M43 domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Peptidase_M43 domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Peptidase_M43 domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Peptidase_M43 domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Peptidase_M43 domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Peptidase_M43 domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Peptidase_M43 domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Peptidase_M43 domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A433QY888.764e-851.06Uncharacterized protein OS=Jimgerdemannia flammico... [more]
A0A2A6BVN94.490e-752.17Uncharacterized protein OS=Pristionchus pacificus ... [more]
A0A4X3PKU54.490e-752.17Uncharacterized protein OS=Pristionchus pacificus ... [more]
S7RWA53.883e-647.73Uncharacterized protein OS=Gloeophyllum trabeum (s... [more]
A0A1C7MHJ39.871e-657.89Uncharacterized protein OS=Grifola frondosa OX=562... [more]
back to top
BLAST of Peptidase_M43 domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Peptidase_M43 domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Peptidase_M43 domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Peptidase_M43 domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Peptidase_M43 domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Peptidase_M43 domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000019773.11.627e-162100.00SMESG000019773.1[more]
SMESG000019773.11.393e-150100.00SMESG000019773.1[more]
SMESG000034284.11.846e-1324.08SMESG000034284.1[more]
SMESG000028600.13.373e-1131.88SMESG000028600.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30009546 ID=SMED30009546|Name=Peptidase_M43 domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=990bp
ATTATTATTATTATTATTATTATAATTATTATTTTTAATTACAACTATCT
ATATGTAAGCTTACATAAGTGTTTACAAATTGAAATCCACAAATAAAGGG
AACATATGTCAAATTAGTTTTCCCTTCTACGGCTGGCAAATAAAGCGCTC
CTTGCGATGTTTGCGCACTGTGATTAGCCACCTTAACTGCCTATATAAAT
GGCCACGAGCCACTCTTCAATAACAAGAAGCTATTTAGCAATGAAGTTGC
ATTTAATTATTTTGTTATTATGCATTGCATTCACGGTCTACGCTGAGAGA
CCAAAACAATGTGTTTTCCCATTTACTTACAAAGGCAGAACATTTGAAGA
CTGCACTGATGTGAATGCTGATTTTCTCTGGTGTTCCCCAACGAAAGAGT
ATTCCGGAACTTCTATTCCTTGTAACTCTGAAGAAGAACAACAACGACTG
AAACGAGATAATTATTACAAGCTTTTCAAAATTTTGGAGGAGCAAGAAGA
GCATATCAAGAAGCTAGAGGCCTCACATAGCACAAACACAAAATGTTCTA
ACTGCAAGGAGGAAGCCGACGCGATTGTCAAAAGCCTTGGAGCTTTGTCG
AGTATTGCATCAGATCATTTAAGGAAAATCACGGCGTTGAAAGATAAATT
TGAAAAGAAACAAAAATTTGCCGATGCATTGTTGACAAAAGTACAACAAA
TTAATGAACTTGCTTTGAGAGCCAATAATAGACGCACTGAAAATGTTTGG
TATGGAACTGCCCCGGCATGTTCCGGCTCGTGTCCTCAAGGACAAACGCT
GATAAGGACTGACAAATCTGGGGACGGCCATACTTGCTGGACTGGACATA
AGGCCCTTTGCCAACGTGTTTATTTTATATAGACAAGCAAATCTTTGTGT
TGACATGTAAATAACCCCTTGAATACGTTTCACTTGTGTTTTCAAACGAA
TACGATTGTTATTAAATACAAAATGTTGTCTTAAAAAAAA
back to top

protein sequence of SMED30009546-orf-1

>SMED30009546-orf-1 ID=SMED30009546-orf-1|Name=SMED30009546-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=124bp
FFLRQHFVFNNNRIRLKTQVKRIQGVIYMSTQRFACLYKINTLAKGLMSS
PASMAVPRFVSPYQRLSLRTRAGTCRGSSIPNIFSASIIGSQSKFINLLY
FCQQCIGKFLFLFKFIFQRRDFP*
back to top

protein sequence of SMED30009546-orf-2

>SMED30009546-orf-2 ID=SMED30009546-orf-2|Name=SMED30009546-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=228bp
MATSHSSITRSYLAMKLHLIILLLCIAFTVYAERPKQCVFPFTYKGRTFE
DCTDVNADFLWCSPTKEYSGTSIPCNSEEEQQRLKRDNYYKLFKILEEQE
EHIKKLEASHSTNTKCSNCKEEADAIVKSLGALSSIASDHLRKITALKDK
FEKKQKFADALLTKVQQINELALRANNRRTENVWYGTAPACSGSCPQGQT
LIRTDKSGDGHTCWTGHKALCQRVYFI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0006508proteolysis
GO:0007338single fertilization
GO:0048240sperm capacitation
Vocabulary: molecular function
TermDefinition
GO:0008237metallopeptidase activity
GO:0008201heparin binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000099neuron
PLANA:0000418head
PLANA:0000420parapharyngeal region
Vocabulary: INTERPRO
TermDefinition
IPR036943FN_type2_sf
IPR000562FN_type2_dom
IPR013806Kringle-like
Vocabulary: cellular component
TermDefinition
GO:0005576extracellular region
GO:0009986cell surface
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000562Fibronectin type II domainSMARTSM00059FN2_2coord: 31..68
e-value: 3.2E-5
score: 24.6
IPR000562Fibronectin type II domainPFAMPF00040fn2coord: 38..70
e-value: 1.6E-10
score: 41.1
IPR000562Fibronectin type II domainPROSITEPS51092FN2_2coord: 33..77
score: 11.913
IPR036943Fibronectin type II domain superfamilyGENE3DG3DSA:2.10.10.10coord: 36..75
e-value: 3.7E-11
score: 44.6
NoneNo IPR availablePANTHERPTHR35180:SF4coord: 156..221
NoneNo IPR availablePANTHERPTHR35180FAMILY NOT NAMEDcoord: 156..221
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..32
score: 0.892
NoneNo IPR availableTMHMMTMhelixcoord: 13..32
IPR013806Kringle-like foldSUPERFAMILYSSF57440Kringle-likecoord: 37..78