NADH-cytochrome b5 reductase

Overview
NameNADH-cytochrome b5 reductase
Smed IDSMED30009541
Length (bp)1136
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of NADH-cytochrome b5 reductase (SMED30009541) t-SNE clustered cells

Violin plots show distribution of expression levels for NADH-cytochrome b5 reductase (SMED30009541) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of NADH-cytochrome b5 reductase (SMED30009541) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for NADH-cytochrome b5 reductase (SMED30009541) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30009541

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
Smed sexual biotypeSMED30009541h1SMcG0017200 Contig42953newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009541h1SMcG0017200 Contig42953uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
pharynxSMED30009541h1SMcG0017200 dd_Smed_v4_1468_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30009541h1SMcG0017200 dd_Smed_v4_1468_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior sideSMED30009541h1SMcG0017200 dd_Smed_v4_1468_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior muscle cellSMED30009541h1SMcG0017200 dd_Smed_v4_1468_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of NADH-cytochrome b5 reductase vs. Ensembl Human
Match: CYB5R3 (cytochrome b5 reductase 3 [Source:HGNC Symbol;Acc:HGNC:2873])

HSP 1 Score: 357.066 bits (915), Expect = 8.726e-123
Identity = 172/276 (62.32%), Postives = 221/276 (80.07%), Query Frame = 2
Query:  140 IFSSKKKKVTLIDSSVKYPLKLVDKEIISHDTTKFRFMLPSPDHILGLPIGQHIYLSYKIDGQIVVRPYTPVTNDKVKGYMDLVIKVYRKNANPKFPDGGKMSQYLENMEIGDYIDVRGPSGLLIYKGKGSFHIRADKKSTPILQNVQKVNMIAGGTGITPMLQLIRAVFNDPNDNTKLNLLYANQTXXXXXXXXXXXXXXXKHPKRFSLWYTVDRSKENWQYSTGFISDAMIKDHMFPPADDTMVFMCGPPPMINFACIPNLDKLGYNPKLRFSY 967
            +F      +TL    +KYPL+L+D+EIISHDT +FRF LPSP HILGLP+GQHIYLS +IDG +VVRPYTP+++D  KG++DLVIKVY K+ +PKFP GGKMSQYLE+M+IGD I+ RGPSGLL+Y+GKG F IR DKKS PI++ V+ V MIAGGTGITPMLQ+IRA+  DP+D+T  +LL+ANQTE DILLR ELE+LR+KH  RF LWYT+DR+ E W Y  GF+++ MI+DH+ PP ++ +V MCGPPPMI +AC+PNLD +G+  +  F +
Sbjct:    3 LFQRSTPAITLESPDIKYPLRLIDREIISHDTRRFRFALPSPQHILGLPVGQHIYLSARIDGNLVVRPYTPISSDDDKGFVDLVIKVYFKDTHPKFPAGGKMSQYLESMQIGDTIEFRGPSGLLVYQGKGKFAIRPDKKSNPIIRTVKSVGMIAGGTGITPMLQVIRAIMKDPDDHTVCHLLFANQTEKDILLRPELEELRNKHSARFKLWYTLDRAPEAWDYGQGFVNEEMIRDHLPPPEEEPLVLMCGPPPMIQYACLPNLDHVGHPTERCFVF 278          
BLAST of NADH-cytochrome b5 reductase vs. Ensembl Human
Match: CYB5R3 (cytochrome b5 reductase 3 [Source:HGNC Symbol;Acc:HGNC:2873])

HSP 1 Score: 357.066 bits (915), Expect = 8.726e-123
Identity = 172/276 (62.32%), Postives = 221/276 (80.07%), Query Frame = 2
Query:  140 IFSSKKKKVTLIDSSVKYPLKLVDKEIISHDTTKFRFMLPSPDHILGLPIGQHIYLSYKIDGQIVVRPYTPVTNDKVKGYMDLVIKVYRKNANPKFPDGGKMSQYLENMEIGDYIDVRGPSGLLIYKGKGSFHIRADKKSTPILQNVQKVNMIAGGTGITPMLQLIRAVFNDPNDNTKLNLLYANQTXXXXXXXXXXXXXXXKHPKRFSLWYTVDRSKENWQYSTGFISDAMIKDHMFPPADDTMVFMCGPPPMINFACIPNLDKLGYNPKLRFSY 967
            +F      +TL    +KYPL+L+D+EIISHDT +FRF LPSP HILGLP+GQHIYLS +IDG +VVRPYTP+++D  KG++DLVIKVY K+ +PKFP GGKMSQYLE+M+IGD I+ RGPSGLL+Y+GKG F IR DKKS PI++ V+ V MIAGGTGITPMLQ+IRA+  DP+D+T  +LL+ANQTE DILLR ELE+LR+KH  RF LWYT+DR+ E W Y  GF+++ MI+DH+ PP ++ +V MCGPPPMI +AC+PNLD +G+  +  F +
Sbjct:    3 LFQRSTPAITLESPDIKYPLRLIDREIISHDTRRFRFALPSPQHILGLPVGQHIYLSARIDGNLVVRPYTPISSDDDKGFVDLVIKVYFKDTHPKFPAGGKMSQYLESMQIGDTIEFRGPSGLLVYQGKGKFAIRPDKKSNPIIRTVKSVGMIAGGTGITPMLQVIRAIMKDPDDHTVCHLLFANQTEKDILLRPELEELRNKHSARFKLWYTLDRAPEAWDYGQGFVNEEMIRDHLPPPEEEPLVLMCGPPPMIQYACLPNLDHVGHPTERCFVF 278          
BLAST of NADH-cytochrome b5 reductase vs. Ensembl Human
Match: CYB5R3 (cytochrome b5 reductase 3 [Source:HGNC Symbol;Acc:HGNC:2873])

HSP 1 Score: 357.066 bits (915), Expect = 8.726e-123
Identity = 172/276 (62.32%), Postives = 221/276 (80.07%), Query Frame = 2
Query:  140 IFSSKKKKVTLIDSSVKYPLKLVDKEIISHDTTKFRFMLPSPDHILGLPIGQHIYLSYKIDGQIVVRPYTPVTNDKVKGYMDLVIKVYRKNANPKFPDGGKMSQYLENMEIGDYIDVRGPSGLLIYKGKGSFHIRADKKSTPILQNVQKVNMIAGGTGITPMLQLIRAVFNDPNDNTKLNLLYANQTXXXXXXXXXXXXXXXKHPKRFSLWYTVDRSKENWQYSTGFISDAMIKDHMFPPADDTMVFMCGPPPMINFACIPNLDKLGYNPKLRFSY 967
            +F      +TL    +KYPL+L+D+EIISHDT +FRF LPSP HILGLP+GQHIYLS +IDG +VVRPYTP+++D  KG++DLVIKVY K+ +PKFP GGKMSQYLE+M+IGD I+ RGPSGLL+Y+GKG F IR DKKS PI++ V+ V MIAGGTGITPMLQ+IRA+  DP+D+T  +LL+ANQTE DILLR ELE+LR+KH  RF LWYT+DR+ E W Y  GF+++ MI+DH+ PP ++ +V MCGPPPMI +AC+PNLD +G+  +  F +
Sbjct:    3 LFQRSTPAITLESPDIKYPLRLIDREIISHDTRRFRFALPSPQHILGLPVGQHIYLSARIDGNLVVRPYTPISSDDDKGFVDLVIKVYFKDTHPKFPAGGKMSQYLESMQIGDTIEFRGPSGLLVYQGKGKFAIRPDKKSNPIIRTVKSVGMIAGGTGITPMLQVIRAIMKDPDDHTVCHLLFANQTEKDILLRPELEELRNKHSARFKLWYTLDRAPEAWDYGQGFVNEEMIRDHLPPPEEEPLVLMCGPPPMIQYACLPNLDHVGHPTERCFVF 278          
BLAST of NADH-cytochrome b5 reductase vs. Ensembl Human
Match: CYB5R3 (cytochrome b5 reductase 3 [Source:HGNC Symbol;Acc:HGNC:2873])

HSP 1 Score: 357.451 bits (916), Expect = 1.456e-122
Identity = 173/279 (62.01%), Postives = 222/279 (79.57%), Query Frame = 2
Query:  131 LYYIFSSKKKKVTLIDSSVKYPLKLVDKEIISHDTTKFRFMLPSPDHILGLPIGQHIYLSYKIDGQIVVRPYTPVTNDKVKGYMDLVIKVYRKNANPKFPDGGKMSQYLENMEIGDYIDVRGPSGLLIYKGKGSFHIRADKKSTPILQNVQKVNMIAGGTGITPMLQLIRAVFNDPNDNTKLNLLYANQTXXXXXXXXXXXXXXXKHPKRFSLWYTVDRSKENWQYSTGFISDAMIKDHMFPPADDTMVFMCGPPPMINFACIPNLDKLGYNPKLRFSY 967
            L  +F      +TL    +KYPL+L+D+EIISHDT +FRF LPSP HILGLP+GQHIYLS +IDG +VVRPYTP+++D  KG++DLVIKVY K+ +PKFP GGKMSQYLE+M+IGD I+ RGPSGLL+Y+GKG F IR DKKS PI++ V+ V MIAGGTGITPMLQ+IRA+  DP+D+T  +LL+ANQTE DILLR ELE+LR+KH  RF LWYT+DR+ E W Y  GF+++ MI+DH+ PP ++ +V MCGPPPMI +AC+PNLD +G+  +  F +
Sbjct:   23 LMKLFQRSTPAITLESPDIKYPLRLIDREIISHDTRRFRFALPSPQHILGLPVGQHIYLSARIDGNLVVRPYTPISSDDDKGFVDLVIKVYFKDTHPKFPAGGKMSQYLESMQIGDTIEFRGPSGLLVYQGKGKFAIRPDKKSNPIIRTVKSVGMIAGGTGITPMLQVIRAIMKDPDDHTVCHLLFANQTEKDILLRPELEELRNKHSARFKLWYTLDRAPEAWDYGQGFVNEEMIRDHLPPPEEEPLVLMCGPPPMIQYACLPNLDHVGHPTERCFVF 301          
BLAST of NADH-cytochrome b5 reductase vs. Ensembl Human
Match: CYB5R3 (cytochrome b5 reductase 3 [Source:HGNC Symbol;Acc:HGNC:2873])

HSP 1 Score: 357.836 bits (917), Expect = 3.071e-122
Identity = 173/279 (62.01%), Postives = 222/279 (79.57%), Query Frame = 2
Query:  131 LYYIFSSKKKKVTLIDSSVKYPLKLVDKEIISHDTTKFRFMLPSPDHILGLPIGQHIYLSYKIDGQIVVRPYTPVTNDKVKGYMDLVIKVYRKNANPKFPDGGKMSQYLENMEIGDYIDVRGPSGLLIYKGKGSFHIRADKKSTPILQNVQKVNMIAGGTGITPMLQLIRAVFNDPNDNTKLNLLYANQTXXXXXXXXXXXXXXXKHPKRFSLWYTVDRSKENWQYSTGFISDAMIKDHMFPPADDTMVFMCGPPPMINFACIPNLDKLGYNPKLRFSY 967
            L  +F      +TL    +KYPL+L+D+EIISHDT +FRF LPSP HILGLP+GQHIYLS +IDG +VVRPYTP+++D  KG++DLVIKVY K+ +PKFP GGKMSQYLE+M+IGD I+ RGPSGLL+Y+GKG F IR DKKS PI++ V+ V MIAGGTGITPMLQ+IRA+  DP+D+T  +LL+ANQTE DILLR ELE+LR+KH  RF LWYT+DR+ E W Y  GF+++ MI+DH+ PP ++ +V MCGPPPMI +AC+PNLD +G+  +  F +
Sbjct:   56 LMKLFQRSTPAITLESPDIKYPLRLIDREIISHDTRRFRFALPSPQHILGLPVGQHIYLSARIDGNLVVRPYTPISSDDDKGFVDLVIKVYFKDTHPKFPAGGKMSQYLESMQIGDTIEFRGPSGLLVYQGKGKFAIRPDKKSNPIIRTVKSVGMIAGGTGITPMLQVIRAIMKDPDDHTVCHLLFANQTEKDILLRPELEELRNKHSARFKLWYTLDRAPEAWDYGQGFVNEEMIRDHLPPPEEEPLVLMCGPPPMIQYACLPNLDHVGHPTERCFVF 334          
BLAST of NADH-cytochrome b5 reductase vs. Ensembl Celegans
Match: hpo-19 (NADH-cytochrome b5 reductase [Source:UniProtKB/TrEMBL;Acc:O16521])

HSP 1 Score: 355.525 bits (911), Expect = 3.675e-122
Identity = 181/303 (59.74%), Postives = 231/303 (76.24%), Query Frame = 2
Query:   89 LAIGFGVVAVSSVALY----------YIFSSKKKKVTLIDSSVKYPLKLVDKEIISHDTTKFRFMLPSPDHILGLPIGQHIYLSYKIDGQIVVRPYTPVTNDKVKGYMDLVIKVYRKNANPKFPDGGKMSQYLENMEIGDYIDVRGPSGLLIYKGKGSFHIRADKKSTPILQNVQKVNMIAGGTGITPMLQLIRAVFNDPNDNTKLNLLYANQTXXXXXXXXXXXXXXXKHPKRFSLWYTVDRSKENWQYSTGFISDAMIKDHMFPPADDTMVFMCGPPPMINFACIPNLDKLGYNPKLRFSY 967
            L I  GVV VSS+A+Y          +    K KK TL+D SVKYPL L++K  ISHDT KFRF LPS DHILGLPIGQH+YL+  IDG+I+VRPYTPV++D+  G++DL++KVY KN N KFP+GGKMSQ+LE+++IGD I+ RGP G ++YKG G F I+ADKK+ P  +  + ++MIAGGTGITPMLQ+I A+  DP D T++ LL+ANQTEDDIL R EL+DL  +HP RF +WYTVDR    W YS+GFI+D+MIK+++FPP DD+ V +CGPPPMINFACIPNL+KL Y+P  R  +
Sbjct:    7 LIITGGVVVVSSIAIYIYLKATNTCPFSLCKKSKKRTLVDDSVKYPLPLIEKFEISHDTRKFRFGLPSKDHILGLPIGQHVYLTANIDGKIIVRPYTPVSSDEDLGFVDLMVKVYFKNTNEKFPEGGKMSQHLESLKIGDTINFRGPQGNIVYKGHGLFSIKADKKAEPKNRVFKHLSMIAGGTGITPMLQVIAAILRDPTDTTQIRLLFANQTEDDILCRQELDDLAKEHPTRFRVWYTVDRPPVMWSYSSGFINDSMIKENLFPPGDDSAVLLCGPPPMINFACIPNLEKLEYDPANRLLF 309          
BLAST of NADH-cytochrome b5 reductase vs. Ensembl Celegans
Match: hpo-19 (NADH-cytochrome b5 reductase [Source:UniProtKB/TrEMBL;Acc:O16521])

HSP 1 Score: 355.525 bits (911), Expect = 3.675e-122
Identity = 181/303 (59.74%), Postives = 231/303 (76.24%), Query Frame = 2
Query:   89 LAIGFGVVAVSSVALY----------YIFSSKKKKVTLIDSSVKYPLKLVDKEIISHDTTKFRFMLPSPDHILGLPIGQHIYLSYKIDGQIVVRPYTPVTNDKVKGYMDLVIKVYRKNANPKFPDGGKMSQYLENMEIGDYIDVRGPSGLLIYKGKGSFHIRADKKSTPILQNVQKVNMIAGGTGITPMLQLIRAVFNDPNDNTKLNLLYANQTXXXXXXXXXXXXXXXKHPKRFSLWYTVDRSKENWQYSTGFISDAMIKDHMFPPADDTMVFMCGPPPMINFACIPNLDKLGYNPKLRFSY 967
            L I  GVV VSS+A+Y          +    K KK TL+D SVKYPL L++K  ISHDT KFRF LPS DHILGLPIGQH+YL+  IDG+I+VRPYTPV++D+  G++DL++KVY KN N KFP+GGKMSQ+LE+++IGD I+ RGP G ++YKG G F I+ADKK+ P  +  + ++MIAGGTGITPMLQ+I A+  DP D T++ LL+ANQTEDDIL R EL+DL  +HP RF +WYTVDR    W YS+GFI+D+MIK+++FPP DD+ V +CGPPPMINFACIPNL+KL Y+P  R  +
Sbjct:    7 LIITGGVVVVSSIAIYIYLKATNTCPFSLCKKSKKRTLVDDSVKYPLPLIEKFEISHDTRKFRFGLPSKDHILGLPIGQHVYLTANIDGKIIVRPYTPVSSDEDLGFVDLMVKVYFKNTNEKFPEGGKMSQHLESLKIGDTINFRGPQGNIVYKGHGLFSIKADKKAEPKNRVFKHLSMIAGGTGITPMLQVIAAILRDPTDTTQIRLLFANQTEDDILCRQELDDLAKEHPTRFRVWYTVDRPPVMWSYSSGFINDSMIKENLFPPGDDSAVLLCGPPPMINFACIPNLEKLEYDPANRLLF 309          
BLAST of NADH-cytochrome b5 reductase vs. Ensembl Celegans
Match: T05H4.4 (NADH-cytochrome b5 reductase [Source:UniProtKB/TrEMBL;Acc:O16522])

HSP 1 Score: 330.102 bits (845), Expect = 2.885e-112
Identity = 168/292 (57.53%), Postives = 222/292 (76.03%), Query Frame = 2
Query:   89 LAIGFGVVAVSSVALYY----IFSSKKKKVTLIDSSVKYPLKLVDKEIISHDTTKFRFMLPSPDHILGLPIGQHIYLSYKIDGQIVVRPYTPVTNDKVKGYMDLVIKVYRKNANPKFPDGGKMSQYLENMEIGDYIDVRGPSGLLIYKGKGSFHIRADKKSTPILQNVQKVNMIAGGTGITPMLQLIRAVFNDPNDNTKLNLLYANQTXXXXXXXXXXXXXXXKHPKRFSLWYTVDRSKENWQYSTGFISDAMIKDHMFPPADDTMVFMCGPPPMINFACIPNLDKLGYNPK 952
            LAI  GVV +SSV+L+     + + KK K TL D SVKY L L++K  ISH+T KFRF LPS DHILGLPIG H+YLS  I G+++VR YTPV+ D   GY+DL++KVY KN + +FPDGGKMSQ+LE+++IGD +  RGP G +IYKG G F +R DKK+ P  +  + ++MIAGGTGITPMLQ+I A+  DP D T++ LL+ANQTEDDIL R EL++L +KHP RF +WYTV ++ ++W+YSTG I++ MIK+H+FP  +++ V +CGPP MIN ACIPNLDKLG+N +
Sbjct:    7 LAITGGVVLISSVSLFLYLRQLRAEKKSKRTLEDDSVKYLLPLIEKFEISHNTRKFRFGLPSKDHILGLPIGHHVYLSANIGGKLIVRSYTPVSCDLDLGYVDLMVKVYFKNTHERFPDGGKMSQHLESLKIGDTVSFRGPHGSIIYKGSGLFTVRMDKKAEPKNRFFKHLSMIAGGTGITPMLQVIAAILRDPIDATQIRLLFANQTEDDILCRKELDELAEKHPTRFRVWYTVSKASKDWRYSTGHINEEMIKEHLFPSNEESAVLLCGPPAMINCACIPNLDKLGHNSE 298          
BLAST of NADH-cytochrome b5 reductase vs. Ensembl Celegans
Match: Y52B11A.3 (pep chromosome:WBcel235:I:10972023:10980111:1 gene:WBGene00013123.1 transcript:Y52B11A.3b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y52B11A.3)

HSP 1 Score: 60.077 bits (144), Expect = 1.067e-9
Identity = 50/183 (27.32%), Postives = 89/183 (48.63%), Query Frame = 2
Query:  200 KLVDKEIISHDTTKFRFMLPSPDHILGLPIGQHIYL----------SYK---IDG-QIVVRPYTPVTN-DKVKGYMDLVIKVYRKNANPKFPDGGKMSQYLENMEIGDYIDVRGPSGLLIYKGKGSFHIRADKKSTPILQNVQKVNMIAGGTGITPMLQLI-RAVFNDPNDNTKLNLLYANQT 700
            +++D+  ++HDT  F   LP       +PIG H+ +          S+K   I G  ++ RPYTP++N D  K  +D +IK+Y           G  +  LEN++IG  +++  P G              ++      +N Q++ ++A G+GITPM+ ++ + +    N N+K+  L  N+T
Sbjct:  255 EIIDRYRLNHDTLIFSLQLPE-HTTYRIPIGHHVSIKIRKGSMGKFSWKFFLIFGYSVLYRPYTPISNPDPQK--IDFMIKIY---------SNGICTPSLENLKIGGELEISDPIG--------------ERNFAEWTENAQELILLAAGSGITPMIDIMEKRIQKTENSNSKVYFLMFNKT 411          
BLAST of NADH-cytochrome b5 reductase vs. Ensembl Celegans
Match: Y52B11A.3 (pep chromosome:WBcel235:I:10970493:10980111:1 gene:WBGene00013123.1 transcript:Y52B11A.3a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y52B11A.3)

HSP 1 Score: 60.077 bits (144), Expect = 1.250e-9
Identity = 51/184 (27.72%), Postives = 91/184 (49.46%), Query Frame = 2
Query:  200 KLVDKEIISHDTTKFRFMLPSPDHIL-GLPIGQHIYL----------SYK---IDG-QIVVRPYTPVTN-DKVKGYMDLVIKVYRKNANPKFPDGGKMSQYLENMEIGDYIDVRGPSGLLIYKGKGSFHIRADKKSTPILQNVQKVNMIAGGTGITPMLQLI-RAVFNDPNDNTKLNLLYANQT 700
            +++D+  ++HDT  F   LP  +H    +PIG H+ +          S+K   I G  ++ RPYTP++N D  K  +D +IK+Y           G  +  LEN++IG  +++  P G              ++      +N Q++ ++A G+GITPM+ ++ + +    N N+K+  L  N+T
Sbjct:  291 EIIDRYRLNHDTLIFSLQLP--EHTTYRIPIGHHVSIKIRKGSMGKFSWKFFLIFGYSVLYRPYTPISNPDPQK--IDFMIKIY---------SNGICTPSLENLKIGGELEISDPIG--------------ERNFAEWTENAQELILLAAGSGITPMIDIMEKRIQKTENSNSKVYFLMFNKT 447          
BLAST of NADH-cytochrome b5 reductase vs. Ensembl Fly
Match: CG5946 (gene:FBgn0036211 transcript:FBtr0076079)

HSP 1 Score: 327.02 bits (837), Expect = 1.025e-110
Identity = 164/307 (53.42%), Postives = 220/307 (71.66%), Query Frame = 2
Query:   83 IPLAIGFGVVAVSSVALYYIFSSKKKK-----------VTLIDSSVKYPLKLVDKEIISHDTTKFRFMLPSPDHILGLPIGQHIYLSYKIDGQIVVRPYTPVTNDKVKGYMDLVIKVYRKNANPKFPDGGKMSQYLENMEIGDYIDVRGPSGLLIYKGKGSFHIRADKKSTPILQNVQKVNMIAGGTGITPMLQLIRAVFNDPN-DNTKLNLLYANQTXXXXXXXXXXXXXXXKHPKRFSLWYTVDRSKENWQYSTGFISDAMIKDHMFPPADDTMVFMCGPPPMINFACIPNLDKLGYNPKLRFSY 967
            +PLA+G   V   ++ ++Y+ + K  K            TL+D + KY L L++KE +SHDT +FRF LPS  H+LGLP+GQHI+L   ID ++++RPYTP+++D+  GY+DLV+KVY K+++PKFP GGKM+Q+LE +E+GD I  RGPSG L Y G G+F I+  +K  P     ++VNMIAGGTGITPMLQL R V    + D T+L LL+ANQ+E DILLR EL++L  KHP +F +WYTVD++ E WQYS GFI++ MI  H+ P  DDT+V +CGPPPMINFAC P LDKLGY+P  RF+Y
Sbjct:    7 VPLAVGVVAVLAGALIVHYLLNKKSTKPRREPNRTARLRTLVDPNDKYLLPLIEKENLSHDTRRFRFGLPSKQHVLGLPVGQHIHLIATIDNELIIRPYTPISSDEDVGYVDLVVKVYFKDSHPKFPAGGKMTQHLEQLELGDKISFRGPSGRLQYLGNGTFSIKKLRKDPPKHVTAKRVNMIAGGTGITPMLQLAREVLKRSDKDKTELALLFANQSEKDILLRAELDELAQKHPDQFKIWYTVDKANEGWQYSVGFINEEMIAAHLLPAKDDTIVLLCGPPPMINFACNPALDKLGYHPDTRFAY 313          
BLAST of NADH-cytochrome b5 reductase vs. Ensembl Fly
Match: CG5946 (gene:FBgn0036211 transcript:FBtr0076078)

HSP 1 Score: 327.02 bits (837), Expect = 1.085e-110
Identity = 164/307 (53.42%), Postives = 220/307 (71.66%), Query Frame = 2
Query:   83 IPLAIGFGVVAVSSVALYYIFSSKKKK-----------VTLIDSSVKYPLKLVDKEIISHDTTKFRFMLPSPDHILGLPIGQHIYLSYKIDGQIVVRPYTPVTNDKVKGYMDLVIKVYRKNANPKFPDGGKMSQYLENMEIGDYIDVRGPSGLLIYKGKGSFHIRADKKSTPILQNVQKVNMIAGGTGITPMLQLIRAVFNDPN-DNTKLNLLYANQTXXXXXXXXXXXXXXXKHPKRFSLWYTVDRSKENWQYSTGFISDAMIKDHMFPPADDTMVFMCGPPPMINFACIPNLDKLGYNPKLRFSY 967
            +PLA+G   V   ++ ++Y+ + K  K            TL+D + KY L L++KE +SHDT +FRF LPS  H+LGLP+GQHI+L   ID ++++RPYTP+++D+  GY+DLV+KVY K+++PKFP GGKM+Q+LE +E+GD I  RGPSG L Y G G+F I+  +K  P     ++VNMIAGGTGITPMLQL R V    + D T+L LL+ANQ+E DILLR EL++L  KHP +F +WYTVD++ E WQYS GFI++ MI  H+ P  DDT+V +CGPPPMINFAC P LDKLGY+P  RF+Y
Sbjct:   10 VPLAVGVVAVLAGALIVHYLLNKKSTKPRREPNRTARLRTLVDPNDKYLLPLIEKENLSHDTRRFRFGLPSKQHVLGLPVGQHIHLIATIDNELIIRPYTPISSDEDVGYVDLVVKVYFKDSHPKFPAGGKMTQHLEQLELGDKISFRGPSGRLQYLGNGTFSIKKLRKDPPKHVTAKRVNMIAGGTGITPMLQLAREVLKRSDKDKTELALLFANQSEKDILLRAELDELAQKHPDQFKIWYTVDKANEGWQYSVGFINEEMIAAHLLPAKDDTIVLLCGPPPMINFACNPALDKLGYHPDTRFAY 316          
BLAST of NADH-cytochrome b5 reductase vs. Ensembl Fly
Match: CG5946 (gene:FBgn0036211 transcript:FBtr0302136)

HSP 1 Score: 327.02 bits (837), Expect = 1.085e-110
Identity = 164/307 (53.42%), Postives = 220/307 (71.66%), Query Frame = 2
Query:   83 IPLAIGFGVVAVSSVALYYIFSSKKKK-----------VTLIDSSVKYPLKLVDKEIISHDTTKFRFMLPSPDHILGLPIGQHIYLSYKIDGQIVVRPYTPVTNDKVKGYMDLVIKVYRKNANPKFPDGGKMSQYLENMEIGDYIDVRGPSGLLIYKGKGSFHIRADKKSTPILQNVQKVNMIAGGTGITPMLQLIRAVFNDPN-DNTKLNLLYANQTXXXXXXXXXXXXXXXKHPKRFSLWYTVDRSKENWQYSTGFISDAMIKDHMFPPADDTMVFMCGPPPMINFACIPNLDKLGYNPKLRFSY 967
            +PLA+G   V   ++ ++Y+ + K  K            TL+D + KY L L++KE +SHDT +FRF LPS  H+LGLP+GQHI+L   ID ++++RPYTP+++D+  GY+DLV+KVY K+++PKFP GGKM+Q+LE +E+GD I  RGPSG L Y G G+F I+  +K  P     ++VNMIAGGTGITPMLQL R V    + D T+L LL+ANQ+E DILLR EL++L  KHP +F +WYTVD++ E WQYS GFI++ MI  H+ P  DDT+V +CGPPPMINFAC P LDKLGY+P  RF+Y
Sbjct:   10 VPLAVGVVAVLAGALIVHYLLNKKSTKPRREPNRTARLRTLVDPNDKYLLPLIEKENLSHDTRRFRFGLPSKQHVLGLPVGQHIHLIATIDNELIIRPYTPISSDEDVGYVDLVVKVYFKDSHPKFPAGGKMTQHLEQLELGDKISFRGPSGRLQYLGNGTFSIKKLRKDPPKHVTAKRVNMIAGGTGITPMLQLAREVLKRSDKDKTELALLFANQSEKDILLRAELDELAQKHPDQFKIWYTVDKANEGWQYSVGFINEEMIAAHLLPAKDDTIVLLCGPPPMINFACNPALDKLGYHPDTRFAY 316          
BLAST of NADH-cytochrome b5 reductase vs. Ensembl Fly
Match: CG5946 (gene:FBgn0036211 transcript:FBtr0110869)

HSP 1 Score: 318.161 bits (814), Expect = 2.902e-107
Identity = 155/307 (50.49%), Postives = 220/307 (71.66%), Query Frame = 2
Query:   83 IPLAIGFGVVAVSSVALYYIFSSKKKK-----------VTLIDSSVKYPLKLVDKEIISHDTTKFRFMLPSPDHILGLPIGQHIYLSYKIDGQIVVRPYTPVTNDKVKGYMDLVIKVYRKNANPKFPDGGKMSQYLENMEIGDYIDVRGPSGLLIYKGKGSFHIRADKKSTPILQNVQKVNMIAGGTGITPMLQLIRAVFNDPN-DNTKLNLLYANQTXXXXXXXXXXXXXXXKHPKRFSLWYTVDRSKENWQYSTGFISDAMIKDHMFPPADDTMVFMCGPPPMINFACIPNLDKLGYNPKLRFSY 967
            +PLA+G   V   ++ ++Y+ + K  K            TL+D + KY L L++KE +SHDT +FRF LPS  H+LGLP+GQHI+L   ID ++++RPYTP+++D+  GY+DLV+KVY K+++PKFP GGKM+Q+LE +E+GD I  RGPSG L Y G G+F I+  +K  P     ++VNMIAGGTGITPMLQL R V    + D T+L LL+ANQ+E DILLR EL++L  KHP +F +WYTVD++ E W Y+TG ++D M++ H++PP +DT+  +CGPPPM+N+ CIP L++LG+  + RFSY
Sbjct:   10 VPLAVGVVAVLAGALIVHYLLNKKSTKPRREPNRTARLRTLVDPNDKYLLPLIEKENLSHDTRRFRFGLPSKQHVLGLPVGQHIHLIATIDNELIIRPYTPISSDEDVGYVDLVVKVYFKDSHPKFPAGGKMTQHLEQLELGDKISFRGPSGRLQYLGNGTFSIKKLRKDPPKHVTAKRVNMIAGGTGITPMLQLAREVLKRSDKDKTELALLFANQSEKDILLRAELDELAQKHPDQFKIWYTVDKANEAWSYNTGHVNDDMMQQHLYPPGEDTLCLLCGPPPMVNYTCIPGLERLGHRAEQRFSY 316          
BLAST of NADH-cytochrome b5 reductase vs. Ensembl Fly
Match: CG5946 (gene:FBgn0036211 transcript:FBtr0110868)

HSP 1 Score: 317.775 bits (813), Expect = 3.640e-107
Identity = 155/307 (50.49%), Postives = 220/307 (71.66%), Query Frame = 2
Query:   83 IPLAIGFGVVAVSSVALYYIFSSKKKK-----------VTLIDSSVKYPLKLVDKEIISHDTTKFRFMLPSPDHILGLPIGQHIYLSYKIDGQIVVRPYTPVTNDKVKGYMDLVIKVYRKNANPKFPDGGKMSQYLENMEIGDYIDVRGPSGLLIYKGKGSFHIRADKKSTPILQNVQKVNMIAGGTGITPMLQLIRAVFNDPN-DNTKLNLLYANQTXXXXXXXXXXXXXXXKHPKRFSLWYTVDRSKENWQYSTGFISDAMIKDHMFPPADDTMVFMCGPPPMINFACIPNLDKLGYNPKLRFSY 967
            +PLA+G   V   ++ ++Y+ + K  K            TL+D + KY L L++KE +SHDT +FRF LPS  H+LGLP+GQHI+L   ID ++++RPYTP+++D+  GY+DLV+KVY K+++PKFP GGKM+Q+LE +E+GD I  RGPSG L Y G G+F I+  +K  P     ++VNMIAGGTGITPMLQL R V    + D T+L LL+ANQ+E DILLR EL++L  KHP +F +WYTVD++ E W Y+TG ++D M++ H++PP +DT+  +CGPPPM+N+ CIP L++LG+  + RFSY
Sbjct:    7 VPLAVGVVAVLAGALIVHYLLNKKSTKPRREPNRTARLRTLVDPNDKYLLPLIEKENLSHDTRRFRFGLPSKQHVLGLPVGQHIHLIATIDNELIIRPYTPISSDEDVGYVDLVVKVYFKDSHPKFPAGGKMTQHLEQLELGDKISFRGPSGRLQYLGNGTFSIKKLRKDPPKHVTAKRVNMIAGGTGITPMLQLAREVLKRSDKDKTELALLFANQSEKDILLRAELDELAQKHPDQFKIWYTVDKANEAWSYNTGHVNDDMMQQHLYPPGEDTLCLLCGPPPMVNYTCIPGLERLGHRAEQRFSY 313          
BLAST of NADH-cytochrome b5 reductase vs. Ensembl Zebrafish
Match: cyb5r1 (cytochrome b5 reductase 1 [Source:ZFIN;Acc:ZDB-GENE-030131-8497])

HSP 1 Score: 365.155 bits (936), Expect = 5.788e-126
Identity = 179/294 (60.88%), Postives = 232/294 (78.91%), Query Frame = 2
Query:   95 IGFGVVAVSSVAL--YYIFSSKKK-KVTLIDSSVKYPLKLVDKEIISHDTTKFRFMLPSPDHILGLPIGQHIYLSYKIDGQIVVRPYTPVTNDKVKGYMDLVIKVYRKNANPKFPDGGKMSQYLENMEIGDYIDVRGPSGLLIYKGKGSFHIRADKKSTPILQNVQKVNMIAGGTGITPMLQLIRAVFNDPNDNTKLNLLYANQTXXXXXXXXXXXXXXXKHPKRFSLWYTVDRSKENWQYSTGFISDAMIKDHMFPPADDTMVFMCGPPPMINFACIPNLDKLGYNPKLRFSY 967
            +  GVV VS+  L  YY F+ K+K  +TLID S KY L+LVDKEIISHDT +FRF LPSP+H+LGLP+G+H+YLS +IDG ++VRPYTPV++D  KG++DLV+K+Y ++ +PKFP+GGKMSQYLE++ IGD ID RGP GLL YKG G   I+ADKK+    + V+ + +IAGGTGITPMLQLIR +  +PND T  +LL+ANQT+ DILL+DELE+++ +H  RF LW+TVDR+  +W+YS GFIS  MI+DH+ PP+DD+M+ MCGPPPMI FAC PNLDKLGY    RF+Y
Sbjct:    1 VTVGVVLVSTAGLLGYYYFNRKRKILITLIDPSEKYKLRLVDKEIISHDTRRFRFALPSPEHVLGLPVGKHVYLSARIDGNLIVRPYTPVSSDDDKGFVDLVVKIYFRDVHPKFPEGGKMSQYLESLRIGDVIDFRGPGGLLEYKGAGRLDIQADKKAPAETKTVKSLGLIAGGTGITPMLQLIRDITKNPNDTTTCSLLFANQTKKDILLKDELEEIQARHSDRFKLWFTVDRAPADWEYSQGFISAEMIQDHLPPPSDDSMILMCGPPPMIQFACNPNLDKLGYRQSQRFAY 294          
BLAST of NADH-cytochrome b5 reductase vs. Ensembl Zebrafish
Match: cyb5r1 (cytochrome b5 reductase 1 [Source:ZFIN;Acc:ZDB-GENE-030131-8497])

HSP 1 Score: 359.762 bits (922), Expect = 1.197e-123
Identity = 173/279 (62.01%), Postives = 224/279 (80.29%), Query Frame = 2
Query:  134 YYIFSSKKK-KVTLIDSSVKYPLKLVDKEIISHDTTKFRFMLPSPDHILGLPIGQHIYLSYKIDGQIVVRPYTPVTNDKVKGYMDLVIKVYRKNANPKFPDGGKMSQYLENMEIGDYIDVRGPSGLLIYKGKGSFHIRADKKSTPILQNVQKVNMIAGGTGITPMLQLIRAVFNDPNDNTKLNLLYANQTXXXXXXXXXXXXXXXKHPKRFSLWYTVDRSKENWQYSTGFISDAMIKDHMFPPADDTMVFMCGPPPMINFACIPNLDKLGYNPKLRFSY 967
            YY F+ K+K  +TLID S KY L+LVDKEIISHDT +FRF LPSP+H+LGLP+G+H+YLS +IDG ++VRPYTPV++D  KG++DLV+K+Y ++ +PKFP+GGKMSQYLE++ IGD ID RGP GLL YKG G   I+ADKK+    + V+ + +IAGGTGITPMLQLIR +  +PND T  +LL+ANQT+ DILL+DELE+++ +H  RF LW+TVDR+  +W+YS GFIS  MI+DH+ PP+DD+M+ MCGPPPMI FAC PNLDKLGY    RF+Y
Sbjct:   26 YYYFNRKRKILITLIDPSEKYKLRLVDKEIISHDTRRFRFALPSPEHVLGLPVGKHVYLSARIDGNLIVRPYTPVSSDDDKGFVDLVVKIYFRDVHPKFPEGGKMSQYLESLRIGDVIDFRGPGGLLEYKGAGRLDIQADKKAPAETKTVKSLGLIAGGTGITPMLQLIRDITKNPNDTTTCSLLFANQTKKDILLKDELEEIQARHSDRFKLWFTVDRAPADWEYSQGFISAEMIQDHLPPPSDDSMILMCGPPPMIQFACNPNLDKLGYRQSQRFAY 304          
BLAST of NADH-cytochrome b5 reductase vs. Ensembl Zebrafish
Match: cyb5r3 (cytochrome b5 reductase 3 [Source:ZFIN;Acc:ZDB-GENE-030131-3281])

HSP 1 Score: 358.221 bits (918), Expect = 3.566e-123
Identity = 179/280 (63.93%), Postives = 222/280 (79.29%), Query Frame = 2
Query:  131 LYYIFSSKKK-KVTLIDSSVKYPLKLVDKEIISHDTTKFRFMLPSPDHILGLPIGQHIYLSYKIDGQIVVRPYTPVTNDKVKGYMDLVIKVYRKNANPKFPDGGKMSQYLENMEIGDYIDVRGPSGLLIYKGKGSFHIRADKKSTPILQNVQKVNMIAGGTGITPMLQLIRAVFNDPNDNTKLNLLYANQTXXXXXXXXXXXXXXXKHPKRFSLWYTVDRSKENWQYSTGFISDAMIKDHMFPPADDTMVFMCGPPPMINFACIPNLDKLGYNPKLRFSY 967
            L  +F  K +  +TL D  VKYPL+LVDKEIISHDT +FRF L SPDH+LGLPIGQHIYLS KIDG +VVRPYTPV++D  KG++DLV+K+Y KN +PKFPDGGKMSQYLE++ IGD ID RGPSGLL+YKGKGSF IR DKKS  +++  + V MIAGGTGITPMLQ+I+AV  DP D+T   LL+ANQTE DILLR ELE++   HP RF LWYTVDR+ + W+YS GFI++ M++ H+  P ++T+V MCGPPPMI FAC P+LDK+G++   RF +
Sbjct:   19 LRRLFGFKSRPAITLEDPDVKYPLRLVDKEIISHDTRRFRFALKSPDHVLGLPIGQHIYLSAKIDGNLVVRPYTPVSSDDDKGFVDLVVKIYYKNIHPKFPDGGKMSQYLESLRIGDTIDFRGPSGLLVYKGKGSFAIRPDKKSDAVIKTAKHVGMIAGGTGITPMLQIIQAVMKDPKDDTVCYLLFANQTEKDILLRPELEEIMANHPTRFKLWYTVDRAPDGWEYSQGFINEDMVRKHLPSPGNETLVLMCGPPPMIQFACNPSLDKVGHSNDRRFMF 298          
BLAST of NADH-cytochrome b5 reductase vs. Ensembl Zebrafish
Match: cyb5r2 (cytochrome b5 reductase 2 [Source:NCBI gene;Acc:751641])

HSP 1 Score: 325.865 bits (834), Expect = 2.782e-110
Identity = 168/307 (54.72%), Postives = 220/307 (71.66%), Query Frame = 2
Query:   74 LMVIPLAIGFGVVAVSSVALYYIFS---------SKKKKVTLIDSSVKYPLKLVDKEIISHDTTKFRFMLPSPDHILGLPIGQHIYLSYKIDGQIVVRPYTPVTNDKVKGYMDLVIKVYRKNANPKFPDGGKMSQYLENMEIGDYIDVRGPSGLLIYKGKGSFHIRADKKSTPILQNVQKVNMIAGGTGITPMLQLIRAVFNDPNDNTKLNLLYANQTXXXXXXXXXXXXXXXKHPKRFSLWYTVDRSKENWQYSTGFISDAMIKDHMFPPADDTMVFMCGPPPMINFACIPNLDKLGYNPKLRFSY 967
            ++  P+ IG  +V ++ + L+   +           K    L D SVKYPL L++KE I+HDT +FRF LPS  H+LGLPIGQHIYLS K++G +VVR YTPV++D+ +GY+DLV+KVY KN +P +PDGGKMSQYL+NM+IGD ID RGP+GLL+Y GKG F IR DKKS   ++  + V MIAGGTGITPMLQLIR++  D  D T  +L++ANQTE DILLR+EL+++   HP +  LWYT+DR  E W+YS GF++ AM+KDH+ P   D +V MCGPP MI  AC+PNL KLGY  +  F+Y
Sbjct:    3 ILTAPVLIGVSIVVITVLYLFLKPAGSNSTPPKPQNKIPKALQDPSVKYPLPLIEKEEINHDTKRFRFGLPSSSHVLGLPIGQHIYLSAKVNGSLVVRAYTPVSSDQDQGYVDLVVKVYYKNTHPSYPDGGKMSQYLDNMKIGDTIDFRGPNGLLVYNGKGKFAIRPDKKSEAEVRKFKHVAMIAGGTGITPMLQLIRSITADSFDETVCSLIFANQTEKDILLRNELDEVHRNHPSKLKLWYTLDRPSEGWKYSEGFVNAAMMKDHLPPADSDVLVVMCGPPAMIEKACLPNLLKLGYKKENIFAY 309          
BLAST of NADH-cytochrome b5 reductase vs. Ensembl Zebrafish
Match: cyb5r2 (cytochrome b5 reductase 2 [Source:NCBI gene;Acc:751641])

HSP 1 Score: 324.324 bits (830), Expect = 1.185e-109
Identity = 168/303 (55.45%), Postives = 218/303 (71.95%), Query Frame = 2
Query:   86 PLAIGFGVVAVSSVALYYIFS---------SKKKKVTLIDSSVKYPLKLVDKEIISHDTTKFRFMLPSPDHILGLPIGQHIYLSYKIDGQIVVRPYTPVTNDKVKGYMDLVIKVYRKNANPKFPDGGKMSQYLENMEIGDYIDVRGPSGLLIYKGKGSFHIRADKKSTPILQNVQKVNMIAGGTGITPMLQLIRAVFNDPNDNTKLNLLYANQTXXXXXXXXXXXXXXXKHPKRFSLWYTVDRSKENWQYSTGFISDAMIKDHMFPPADDTMVFMCGPPPMINFACIPNLDKLGYNPKLRFSY 967
            P+ IG  +V ++ + L+   +           K    L D SVKYPL L++KE I+HDT +FRF LPS  H+LGLPIGQHIYLS K++G +VVR YTPV++D+ +GY+DLV+KVY KN +P +PDGGKMSQYL+NM+IGD ID RGP+GLL+Y GKG F IR DKKS   ++  + V MIAGGTGITPMLQLIR++  D  D T  +L++ANQTE DILLR+EL+++   HP +  LWYT+DR  E W+YS GF++ AM+KDH+ P   D +V MCGPP MI  AC+PNL KLGY  +  F+Y
Sbjct:    8 PVLIGVSIVVITVLYLFLKPAGSNSTPPKPQNKIPKALQDPSVKYPLPLIEKEEINHDTKRFRFGLPSSSHVLGLPIGQHIYLSAKVNGSLVVRAYTPVSSDQDQGYVDLVVKVYYKNTHPSYPDGGKMSQYLDNMKIGDTIDFRGPNGLLVYNGKGKFAIRPDKKSEAEVRKFKHVAMIAGGTGITPMLQLIRSITADSFDETVCSLIFANQTEKDILLRNELDEVHRNHPSKLKLWYTLDRPSEGWKYSEGFVNAAMMKDHLPPADSDVLVVMCGPPAMIEKACLPNLLKLGYKKENIFAY 310          
BLAST of NADH-cytochrome b5 reductase vs. Ensembl Xenopus
Match: cyb5r2 (cytochrome b5 reductase 2 [Source:NCBI gene;Acc:595026])

HSP 1 Score: 352.058 bits (902), Expect = 1.896e-120
Identity = 175/303 (57.76%), Postives = 233/303 (76.90%), Query Frame = 2
Query:   59 MSTKALMVIPLAIGFGVVAVSSVALYYIFSSKKKKVTLIDSSVKYPLKLVDKEIISHDTTKFRFMLPSPDHILGLPIGQHIYLSYKIDGQIVVRPYTPVTNDKVKGYMDLVIKVYRKNANPKFPDGGKMSQYLENMEIGDYIDVRGPSGLLIYKGKGSFHIRADKKSTPILQNVQKVNMIAGGTGITPMLQLIRAVFNDPNDNTKLNLLYANQTXXXXXXXXXXXXXXXKHPKRFSLWYTVDRSKENWQYSTGFISDAMIKDHMFPPADDTMVFMCGPPPMINFACIPNLDKLGYNPKLRFSY 967
            +ST + M++ LA+  GV  +  +       +KK  +TL+D + KYPL L++K+ ISHDT KFRF LPS +H+LGLP+GQH+YLS KI+G +VVR YTPV++D+VKG++DL++KVY KN +PKFP+GGKMSQ+L++++IG+ ID RGP+GLL+YK KG F IR DKKS P L+  + V M+AGGTGITPMLQLIR +  DPNDNTK +L++ANQTEDDILLR ELE +   HP++F LWYT+DR  + W+Y  GF++  MIK+H+ PP++D +V MCGPPPMI FAC  NL KLGY    RF+Y
Sbjct:    3 ISTDSNMLVALAV-IGVTVLLFLIKALGSQAKKAPLTLLDPNAKYPLPLIEKQEISHDTKKFRFGLPSQEHVLGLPVGQHVYLSAKINGSLVVRAYTPVSSDEVKGHVDLIVKVYYKNVHPKFPEGGKMSQHLDSLKIGETIDFRGPNGLLVYKEKGKFAIRPDKKSEPKLKVAKHVGMLAGGTGITPMLQLIRQITQDPNDNTKCSLIFANQTEDDILLRYELETVAKSHPEQFKLWYTLDRPPQGWKYGAGFVTADMIKEHLPPPSEDVVVLMCGPPPMIQFACQDNLTKLGYPEAGRFAY 304          
BLAST of NADH-cytochrome b5 reductase vs. Ensembl Xenopus
Match: cyb5r2 (cytochrome b5 reductase 2 [Source:NCBI gene;Acc:595026])

HSP 1 Score: 352.058 bits (902), Expect = 1.896e-120
Identity = 175/303 (57.76%), Postives = 233/303 (76.90%), Query Frame = 2
Query:   59 MSTKALMVIPLAIGFGVVAVSSVALYYIFSSKKKKVTLIDSSVKYPLKLVDKEIISHDTTKFRFMLPSPDHILGLPIGQHIYLSYKIDGQIVVRPYTPVTNDKVKGYMDLVIKVYRKNANPKFPDGGKMSQYLENMEIGDYIDVRGPSGLLIYKGKGSFHIRADKKSTPILQNVQKVNMIAGGTGITPMLQLIRAVFNDPNDNTKLNLLYANQTXXXXXXXXXXXXXXXKHPKRFSLWYTVDRSKENWQYSTGFISDAMIKDHMFPPADDTMVFMCGPPPMINFACIPNLDKLGYNPKLRFSY 967
            +ST + M++ LA+  GV  +  +       +KK  +TL+D + KYPL L++K+ ISHDT KFRF LPS +H+LGLP+GQH+YLS KI+G +VVR YTPV++D+VKG++DL++KVY KN +PKFP+GGKMSQ+L++++IG+ ID RGP+GLL+YK KG F IR DKKS P L+  + V M+AGGTGITPMLQLIR +  DPNDNTK +L++ANQTEDDILLR ELE +   HP++F LWYT+DR  + W+Y  GF++  MIK+H+ PP++D +V MCGPPPMI FAC  NL KLGY    RF+Y
Sbjct:    3 ISTDSNMLVALAV-IGVTVLLFLIKALGSQAKKAPLTLLDPNAKYPLPLIEKQEISHDTKKFRFGLPSQEHVLGLPVGQHVYLSAKINGSLVVRAYTPVSSDEVKGHVDLIVKVYYKNVHPKFPEGGKMSQHLDSLKIGETIDFRGPNGLLVYKEKGKFAIRPDKKSEPKLKVAKHVGMLAGGTGITPMLQLIRQITQDPNDNTKCSLIFANQTEDDILLRYELETVAKSHPEQFKLWYTLDRPPQGWKYGAGFVTADMIKEHLPPPSEDVVVLMCGPPPMIQFACQDNLTKLGYPEAGRFAY 304          
BLAST of NADH-cytochrome b5 reductase vs. Ensembl Xenopus
Match: cyb5r2 (cytochrome b5 reductase 2 [Source:NCBI gene;Acc:595026])

HSP 1 Score: 350.132 bits (897), Expect = 1.155e-119
Identity = 174/303 (57.43%), Postives = 231/303 (76.24%), Query Frame = 2
Query:   59 MSTKALMVIPLAIGFGVVAVSSVALYYIFSSKKKKVTLIDSSVKYPLKLVDKEIISHDTTKFRFMLPSPDHILGLPIGQHIYLSYKIDGQIVVRPYTPVTNDKVKGYMDLVIKVYRKNANPKFPDGGKMSQYLENMEIGDYIDVRGPSGLLIYKGKGSFHIRADKKSTPILQNVQKVNMIAGGTGITPMLQLIRAVFNDPNDNTKLNLLYANQTXXXXXXXXXXXXXXXKHPKRFSLWYTVDRSKENWQYSTGFISDAMIKDHMFPPADDTMVFMCGPPPMINFACIPNLDKLGYNPKLRFSY 967
            M   + M++ LA+  GV  +  +       +KK  +TL+D + KYPL L++K+ ISHDT KFRF LPS +H+LGLP+GQH+YLS KI+G +VVR YTPV++D+VKG++DL++KVY KN +PKFP+GGKMSQ+L++++IG+ ID RGP+GLL+YK KG F IR DKKS P L+  + V M+AGGTGITPMLQLIR +  DPNDNTK +L++ANQTEDDILLR ELE +   HP++F LWYT+DR  + W+Y  GF++  MIK+H+ PP++D +V MCGPPPMI FAC  NL KLGY    RF+Y
Sbjct:    1 MEIDSNMLVALAV-IGVTVLLFLIKALGSQAKKAPLTLLDPNAKYPLPLIEKQEISHDTKKFRFGLPSQEHVLGLPVGQHVYLSAKINGSLVVRAYTPVSSDEVKGHVDLIVKVYYKNVHPKFPEGGKMSQHLDSLKIGETIDFRGPNGLLVYKEKGKFAIRPDKKSEPKLKVAKHVGMLAGGTGITPMLQLIRQITQDPNDNTKCSLIFANQTEDDILLRYELETVAKSHPEQFKLWYTLDRPPQGWKYGAGFVTADMIKEHLPPPSEDVVVLMCGPPPMIQFACQDNLTKLGYPEAGRFAY 302          
BLAST of NADH-cytochrome b5 reductase vs. Ensembl Xenopus
Match: cyb5r2 (cytochrome b5 reductase 2 [Source:NCBI gene;Acc:595026])

HSP 1 Score: 348.977 bits (894), Expect = 2.684e-119
Identity = 173/297 (58.25%), Postives = 229/297 (77.10%), Query Frame = 2
Query:   77 MVIPLAIGFGVVAVSSVALYYIFSSKKKKVTLIDSSVKYPLKLVDKEIISHDTTKFRFMLPSPDHILGLPIGQHIYLSYKIDGQIVVRPYTPVTNDKVKGYMDLVIKVYRKNANPKFPDGGKMSQYLENMEIGDYIDVRGPSGLLIYKGKGSFHIRADKKSTPILQNVQKVNMIAGGTGITPMLQLIRAVFNDPNDNTKLNLLYANQTXXXXXXXXXXXXXXXKHPKRFSLWYTVDRSKENWQYSTGFISDAMIKDHMFPPADDTMVFMCGPPPMINFACIPNLDKLGYNPKLRFSY 967
            M++ LA+  GV  +  +       +KK  +TL+D + KYPL L++K+ ISHDT KFRF LPS +H+LGLP+GQH+YLS KI+G +VVR YTPV++D+VKG++DL++KVY KN +PKFP+GGKMSQ+L++++IG+ ID RGP+GLL+YK KG F IR DKKS P L+  + V M+AGGTGITPMLQLIR +  DPNDNTK +L++ANQTEDDILLR ELE +   HP++F LWYT+DR  + W+Y  GF++  MIK+H+ PP++D +V MCGPPPMI FAC  NL KLGY    RF+Y
Sbjct:    9 MLVALAV-IGVTVLLFLIKALGSQAKKAPLTLLDPNAKYPLPLIEKQEISHDTKKFRFGLPSQEHVLGLPVGQHVYLSAKINGSLVVRAYTPVSSDEVKGHVDLIVKVYYKNVHPKFPEGGKMSQHLDSLKIGETIDFRGPNGLLVYKEKGKFAIRPDKKSEPKLKVAKHVGMLAGGTGITPMLQLIRQITQDPNDNTKCSLIFANQTEDDILLRYELETVAKSHPEQFKLWYTLDRPPQGWKYGAGFVTADMIKEHLPPPSEDVVVLMCGPPPMIQFACQDNLTKLGYPEAGRFAY 304          
BLAST of NADH-cytochrome b5 reductase vs. Ensembl Xenopus
Match: cyb5r2 (cytochrome b5 reductase 2 [Source:NCBI gene;Acc:595026])

HSP 1 Score: 348.977 bits (894), Expect = 2.951e-119
Identity = 173/297 (58.25%), Postives = 229/297 (77.10%), Query Frame = 2
Query:   77 MVIPLAIGFGVVAVSSVALYYIFSSKKKKVTLIDSSVKYPLKLVDKEIISHDTTKFRFMLPSPDHILGLPIGQHIYLSYKIDGQIVVRPYTPVTNDKVKGYMDLVIKVYRKNANPKFPDGGKMSQYLENMEIGDYIDVRGPSGLLIYKGKGSFHIRADKKSTPILQNVQKVNMIAGGTGITPMLQLIRAVFNDPNDNTKLNLLYANQTXXXXXXXXXXXXXXXKHPKRFSLWYTVDRSKENWQYSTGFISDAMIKDHMFPPADDTMVFMCGPPPMINFACIPNLDKLGYNPKLRFSY 967
            M++ LA+  GV  +  +       +KK  +TL+D + KYPL L++K+ ISHDT KFRF LPS +H+LGLP+GQH+YLS KI+G +VVR YTPV++D+VKG++DL++KVY KN +PKFP+GGKMSQ+L++++IG+ ID RGP+GLL+YK KG F IR DKKS P L+  + V M+AGGTGITPMLQLIR +  DPNDNTK +L++ANQTEDDILLR ELE +   HP++F LWYT+DR  + W+Y  GF++  MIK+H+ PP++D +V MCGPPPMI FAC  NL KLGY    RF+Y
Sbjct:    7 MLVALAV-IGVTVLLFLIKALGSQAKKAPLTLLDPNAKYPLPLIEKQEISHDTKKFRFGLPSQEHVLGLPVGQHVYLSAKINGSLVVRAYTPVSSDEVKGHVDLIVKVYYKNVHPKFPEGGKMSQHLDSLKIGETIDFRGPNGLLVYKEKGKFAIRPDKKSEPKLKVAKHVGMLAGGTGITPMLQLIRQITQDPNDNTKCSLIFANQTEDDILLRYELETVAKSHPEQFKLWYTLDRPPQGWKYGAGFVTADMIKEHLPPPSEDVVVLMCGPPPMIQFACQDNLTKLGYPEAGRFAY 302          
BLAST of NADH-cytochrome b5 reductase vs. Ensembl Mouse
Match: Cyb5r3 (cytochrome b5 reductase 3 [Source:MGI Symbol;Acc:MGI:94893])

HSP 1 Score: 351.673 bits (901), Expect = 7.615e-121
Identity = 169/276 (61.23%), Postives = 223/276 (80.80%), Query Frame = 2
Query:  140 IFSSKKKKVTLIDSSVKYPLKLVDKEIISHDTTKFRFMLPSPDHILGLPIGQHIYLSYKIDGQIVVRPYTPVTNDKVKGYMDLVIKVYRKNANPKFPDGGKMSQYLENMEIGDYIDVRGPSGLLIYKGKGSFHIRADKKSTPILQNVQKVNMIAGGTGITPMLQLIRAVFNDPNDNTKLNLLYANQTXXXXXXXXXXXXXXXKHPKRFSLWYTVDRSKENWQYSTGFISDAMIKDHMFPPADDTMVFMCGPPPMINFACIPNLDKLGYNPKLRFSY 967
            +F      +TL +  +KYPL+L+DKE+IS DT +FRF LPSP HILGLPIGQHIYLS +IDG +V+RPYTPV++D  KG++DLV+KVY K+ +PKFP GGKMSQYLENM+IGD I+ RGP+GLL+Y+GKG F IRADKKS P+++ V+ V MIAGGTGITPMLQ+IRAV  DPND+T   LL+ANQ+E DILLR ELE+LR++H  RF LWYTVD++ + W YS GF+++ MI+DH+  P ++ ++ MCGPPPMI FAC+PNL+++G+  +  F++
Sbjct:    3 LFQRSTPAITLENPDIKYPLRLIDKEVISPDTRRFRFALPSPQHILGLPIGQHIYLSTRIDGNLVIRPYTPVSSDDDKGFVDLVVKVYFKDTHPKFPAGGKMSQYLENMKIGDTIEFRGPNGLLVYQGKGKFAIRADKKSNPVVRTVKSVGMIAGGTGITPMLQVIRAVLKDPNDHTVCYLLFANQSEKDILLRPELEELRNEHSARFKLWYTVDKAPDAWDYSQGFVNEEMIRDHLPTPGEEPLILMCGPPPMIQFACLPNLERVGHPKERCFTF 278          
BLAST of NADH-cytochrome b5 reductase vs. Ensembl Mouse
Match: Cyb5r3 (cytochrome b5 reductase 3 [Source:MGI Symbol;Acc:MGI:94893])

HSP 1 Score: 351.673 bits (901), Expect = 1.721e-120
Identity = 173/291 (59.45%), Postives = 228/291 (78.35%), Query Frame = 2
Query:  110 VAVSSVALYY-----IFSSKKKKVTLIDSSVKYPLKLVDKEIISHDTTKFRFMLPSPDHILGLPIGQHIYLSYKIDGQIVVRPYTPVTNDKVKGYMDLVIKVYRKNANPKFPDGGKMSQYLENMEIGDYIDVRGPSGLLIYKGKGSFHIRADKKSTPILQNVQKVNMIAGGTGITPMLQLIRAVFNDPNDNTKLNLLYANQTXXXXXXXXXXXXXXXKHPKRFSLWYTVDRSKENWQYSTGFISDAMIKDHMFPPADDTMVFMCGPPPMINFACIPNLDKLGYNPKLRFSY 967
            V +S V   Y     +F      +TL +  +KYPL+L+DKE+IS DT +FRF LPSP HILGLPIGQHIYLS +IDG +V+RPYTPV++D  KG++DLV+KVY K+ +PKFP GGKMSQYLENM+IGD I+ RGP+GLL+Y+GKG F IRADKKS P+++ V+ V MIAGGTGITPMLQ+IRAV  DPND+T   LL+ANQ+E DILLR ELE+LR++H  RF LWYTVD++ + W YS GF+++ MI+DH+  P ++ ++ MCGPPPMI FAC+PNL+++G+  +  F++
Sbjct:   11 VVLSPVWFIYSLFMKLFQRSTPAITLENPDIKYPLRLIDKEVISPDTRRFRFALPSPQHILGLPIGQHIYLSTRIDGNLVIRPYTPVSSDDDKGFVDLVVKVYFKDTHPKFPAGGKMSQYLENMKIGDTIEFRGPNGLLVYQGKGKFAIRADKKSNPVVRTVKSVGMIAGGTGITPMLQVIRAVLKDPNDHTVCYLLFANQSEKDILLRPELEELRNEHSARFKLWYTVDKAPDAWDYSQGFVNEEMIRDHLPTPGEEPLILMCGPPPMIQFACLPNLERVGHPKERCFTF 301          
BLAST of NADH-cytochrome b5 reductase vs. Ensembl Mouse
Match: Cyb5r1 (cytochrome b5 reductase 1 [Source:MGI Symbol;Acc:MGI:1919267])

HSP 1 Score: 335.88 bits (860), Expect = 3.739e-114
Identity = 160/278 (57.55%), Postives = 221/278 (79.50%), Query Frame = 2
Query:  134 YYIFSSKKKKVTLIDSSVKYPLKLVDKEIISHDTTKFRFMLPSPDHILGLPIGQHIYLSYKIDGQIVVRPYTPVTNDKVKGYMDLVIKVYRKNANPKFPDGGKMSQYLENMEIGDYIDVRGPSGLLIYKGKGSFHIRADKKSTPILQNVQKVNMIAGGTGITPMLQLIRAVFNDPNDNTKLNLLYANQTXXXXXXXXXXXXXXXKHPKRFSLWYTVDRSKENWQYSTGFISDAMIKDHMFPPADDTMVFMCGPPPMINFACIPNLDKLGYNPKLRFSY 967
            Y +  S++ +VTL D   KY L+L+DK  +SH+T +FRF LP+  HILGLP+G+H+YLS +IDG +V+RPYTPVT+D+ +GY+DLVIKVY K  +PKFP+GGKMSQYL++++IGD ++ RGPSGLL Y GKG+F+I+ +KKS P L+  +K+ MIAGGTGITPMLQLIRA+   P D T+  LL+ANQTE DI+LR++LE+L+ ++P RF LW+T+D   E+W YS GF++  MI++H+  PA+D ++ +CGPPPM+  AC PNLDKLGY+ K+RF+Y
Sbjct:   28 YLVRRSRRPQVTLQDPDEKYLLRLLDKTTVSHNTRRFRFALPTAHHILGLPVGKHVYLSARIDGSLVIRPYTPVTSDEDQGYVDLVIKVYLKGVHPKFPEGGKMSQYLDSLKIGDMVEFRGPSGLLSYAGKGNFNIQPNKKSPPELRVAKKLGMIAGGTGITPMLQLIRAILKVPEDPTQCFLLFANQTERDIILREDLEELQAQYPNRFKLWFTLDSPPEDWTYSKGFVTADMIQEHLPAPAEDVLLLLCGPPPMVQLACHPNLDKLGYSQKMRFTY 305          
BLAST of NADH-cytochrome b5 reductase vs. Ensembl Mouse
Match: Cyb5r2 (cytochrome b5 reductase 2 [Source:MGI Symbol;Acc:MGI:2444415])

HSP 1 Score: 301.597 bits (771), Expect = 3.220e-101
Identity = 147/272 (54.04%), Postives = 207/272 (76.10%), Query Frame = 2
Query:  152 KKKKVTLIDSSVKYPLKLVDKEIISHDTTKFRFMLPSPDHILGLPIGQHIYLSYKIDGQIVVRPYTPVTNDKVKGYMDLVIKVYRKNANPKFPDGGKMSQYLENMEIGDYIDVRGPSGLLIYKGKGSFHIRADKKSTPILQNVQKVNMIAGGTGITPMLQLIRAVFNDPNDNTKLNLLYANQTXXXXXXXXXXXXXXXKHPKRFSLWYTVDRSKENWQYSTGFISDAMIKDHMFPPADDTMVFMCGPPPMINFACIPNLDKLGYNPKLRFSY 967
            KK  +TL D   KYPL L++KE ISH+T +FRF LPSPDH+LGLP+G +++L  +I+ ++V+R YTPV++D  +G++DL+IK+Y KN +PK+P+GGKM+QYLENM+IGD I  RGP+G L Y   G+  I+A+K S P  + V  + MIAGGTGITPMLQLIR +  D +D T+++LL+ANQTE+DILLR ELE++   H K+F+LWYT+DR   +W+YS+GF+S  MIK+H+ PP +DT++ +CGPPP+I  A  P+L++L Y   + F Y
Sbjct:    5 KKDLITLQDPEAKYPLPLIEKEQISHNTRRFRFGLPSPDHVLGLPVGNYVHLLAQINNELVIRAYTPVSSDDDQGFVDLIIKIYFKNVHPKYPEGGKMTQYLENMKIGDTILFRGPTGRLFYNEPGTLLIKANKTSEPEKKLVHHLGMIAGGTGITPMLQLIRHITKDTSDETRMSLLFANQTEEDILLRKELEEVATTHHKQFNLWYTLDRPPSDWKYSSGFVSADMIKEHLPPPGEDTLILVCGPPPLIQAAAHPSLEQLSYTKDMIFIY 276          
BLAST of NADH-cytochrome b5 reductase vs. Ensembl Mouse
Match: Cyb5r2 (cytochrome b5 reductase 2 [Source:MGI Symbol;Acc:MGI:2444415])

HSP 1 Score: 291.582 bits (745), Expect = 5.868e-97
Identity = 147/288 (51.04%), Postives = 207/288 (71.88%), Query Frame = 2
Query:  152 KKKKVTLIDSSVKYPLKLVDKEIISHDTTKFRFMLPSPDHILGLPIGQHIYLSYKIDGQIVVRPYTPVTNDKVKGYMDLVIKVYRKNANPKFPDGGKMSQYLENMEIGDYIDVRGPSGLLIYKGK----------------GSFHIRADKKSTPILQNVQKVNMIAGGTGITPMLQLIRAVFNDPNDNTKLNLLYANQTXXXXXXXXXXXXXXXKHPKRFSLWYTVDRSKENWQYSTGFISDAMIKDHMFPPADDTMVFMCGPPPMINFACIPNLDKLGYNPKLRFSY 967
            KK  +TL D   KYPL L++KE ISH+T +FRF LPSPDH+LGLP+G +++L  +I+ ++V+R YTPV++D  +G++DL+IK+Y KN +PK+P+GGKM+QYLENM+IGD I  RGP+G L Y                   G+  I+A+K S P  + V  + MIAGGTGITPMLQLIR +  D +D T+++LL+ANQTE+DILLR ELE++   H K+F+LWYT+DR   +W+YS+GF+S  MIK+H+ PP +DT++ +CGPPP+I  A  P+L++L Y   + F Y
Sbjct:    5 KKDLITLQDPEAKYPLPLIEKEQISHNTRRFRFGLPSPDHVLGLPVGNYVHLLAQINNELVIRAYTPVSSDDDQGFVDLIIKIYFKNVHPKYPEGGKMTQYLENMKIGDTILFRGPTGRLFYNEPGCQTRAAEVKNIFIFLGTLLIKANKTSEPEKKLVHHLGMIAGGTGITPMLQLIRHITKDTSDETRMSLLFANQTEEDILLRKELEEVATTHHKQFNLWYTLDRPPSDWKYSSGFVSADMIKEHLPPPGEDTLILVCGPPPLIQAAAHPSLEQLSYTKDMIFIY 292          
BLAST of NADH-cytochrome b5 reductase vs. UniProt/SwissProt
Match: sp|P20070|NB5R3_RAT (NADH-cytochrome b5 reductase 3 OS=Rattus norvegicus OX=10116 GN=Cyb5r3 PE=1 SV=2)

HSP 1 Score: 361.688 bits (927), Expect = 1.248e-123
Identity = 177/291 (60.82%), Postives = 230/291 (79.04%), Query Frame = 2
Query:  110 VAVSSVALYY-----IFSSKKKKVTLIDSSVKYPLKLVDKEIISHDTTKFRFMLPSPDHILGLPIGQHIYLSYKIDGQIVVRPYTPVTNDKVKGYMDLVIKVYRKNANPKFPDGGKMSQYLENMEIGDYIDVRGPSGLLIYKGKGSFHIRADKKSTPILQNVQKVNMIAGGTGITPMLQLIRAVFNDPNDNTKLNLLYANQTXXXXXXXXXXXXXXXKHPKRFSLWYTVDRSKENWQYSTGFISDAMIKDHMFPPADDTMVFMCGPPPMINFACIPNLDKLGYNPKLRFSY 967
            V +S V   Y     +F      +TL +  +KYPL+L+DKEIISHDT +FRF LPSP HILGLPIGQHIYLS +IDG +V+RPYTPV++D  KG++DLV+KVY K+ +PKFP GGKMSQYLENM IGD I+ RGP+GLL+Y+GKG F IRADKKS P+++ V+ V MIAGGTGITPMLQ+IRAV  DPND+T   LL+ANQ+E DILLR ELE+LR++H  RF LWYTVD++ + W YS GF+++ MI+DH+ PP ++T++ MCGPPPMI FAC+PNL+++G+  +  F++
Sbjct:   11 VVLSPVWFVYSLFMKLFQRSSPAITLENPDIKYPLRLIDKEIISHDTRRFRFALPSPQHILGLPIGQHIYLSTRIDGNLVIRPYTPVSSDDDKGFVDLVVKVYFKDTHPKFPAGGKMSQYLENMNIGDTIEFRGPNGLLVYQGKGKFAIRADKKSNPVVRTVKSVGMIAGGTGITPMLQVIRAVLKDPNDHTVCYLLFANQSEKDILLRPELEELRNEHSSRFKLWYTVDKAPDAWDYSQGFVNEEMIRDHLPPPGEETLILMCGPPPMIQFACLPNLERVGHPKERCFTF 301          
BLAST of NADH-cytochrome b5 reductase vs. UniProt/SwissProt
Match: sp|P07514|NB5R3_BOVIN (NADH-cytochrome b5 reductase 3 OS=Bos taurus OX=9913 GN=CYB5R3 PE=1 SV=3)

HSP 1 Score: 359.762 bits (922), Expect = 8.798e-123
Identity = 175/294 (59.52%), Postives = 232/294 (78.91%), Query Frame = 2
Query:  101 FGVVAVSSVALYY-----IFSSKKKKVTLIDSSVKYPLKLVDKEIISHDTTKFRFMLPSPDHILGLPIGQHIYLSYKIDGQIVVRPYTPVTNDKVKGYMDLVIKVYRKNANPKFPDGGKMSQYLENMEIGDYIDVRGPSGLLIYKGKGSFHIRADKKSTPILQNVQKVNMIAGGTGITPMLQLIRAVFNDPNDNTKLNLLYANQTXXXXXXXXXXXXXXXKHPKRFSLWYTVDRSKENWQYSTGFISDAMIKDHMFPPADDTMVFMCGPPPMINFACIPNLDKLGYNPKLRFSY 967
             G V +S V   Y     +F      +TL +  +KYPL+L+DKE+ISHDT +FRF LPSP+HILGLP+GQHIYLS +IDG +V+RPYTPV++D  KG++DLVIKVY K+ +PKFP GGKMSQYLE+M+IGD I+ RGP+GLL+Y+GKG F IR DKKS P+++ V+ V MIAGGTGITPMLQ+IRA+  DP+D+T  +LL+ANQTE DILLR ELE+LR++H  RF LWYTVD++ E W YS GF+++ MI+DH+ PP ++ +V MCGPPPMI +AC+PNLD++G+  +  F++
Sbjct:    8 LGHVVLSPVWFLYSLIMKLFQRSTPAITLENPDIKYPLRLIDKEVISHDTRRFRFALPSPEHILGLPVGQHIYLSARIDGNLVIRPYTPVSSDDDKGFVDLVIKVYFKDTHPKFPAGGKMSQYLESMKIGDTIEFRGPNGLLVYQGKGKFAIRPDKKSDPVIKTVKSVGMIAGGTGITPMLQVIRAIMKDPDDHTVCHLLFANQTEKDILLRPELEELRNEHSARFKLWYTVDKAPEAWDYSQGFVNEEMIRDHLPPPEEEPLVLMCGPPPMIQYACLPNLDRVGHPKERCFAF 301          
BLAST of NADH-cytochrome b5 reductase vs. UniProt/SwissProt
Match: sp|P00387|NB5R3_HUMAN (NADH-cytochrome b5 reductase 3 OS=Homo sapiens OX=9606 GN=CYB5R3 PE=1 SV=3)

HSP 1 Score: 357.451 bits (916), Expect = 6.992e-122
Identity = 173/279 (62.01%), Postives = 222/279 (79.57%), Query Frame = 2
Query:  131 LYYIFSSKKKKVTLIDSSVKYPLKLVDKEIISHDTTKFRFMLPSPDHILGLPIGQHIYLSYKIDGQIVVRPYTPVTNDKVKGYMDLVIKVYRKNANPKFPDGGKMSQYLENMEIGDYIDVRGPSGLLIYKGKGSFHIRADKKSTPILQNVQKVNMIAGGTGITPMLQLIRAVFNDPNDNTKLNLLYANQTXXXXXXXXXXXXXXXKHPKRFSLWYTVDRSKENWQYSTGFISDAMIKDHMFPPADDTMVFMCGPPPMINFACIPNLDKLGYNPKLRFSY 967
            L  +F      +TL    +KYPL+L+D+EIISHDT +FRF LPSP HILGLP+GQHIYLS +IDG +VVRPYTP+++D  KG++DLVIKVY K+ +PKFP GGKMSQYLE+M+IGD I+ RGPSGLL+Y+GKG F IR DKKS PI++ V+ V MIAGGTGITPMLQ+IRA+  DP+D+T  +LL+ANQTE DILLR ELE+LR+KH  RF LWYT+DR+ E W Y  GF+++ MI+DH+ PP ++ +V MCGPPPMI +AC+PNLD +G+  +  F +
Sbjct:   23 LMKLFQRSTPAITLESPDIKYPLRLIDREIISHDTRRFRFALPSPQHILGLPVGQHIYLSARIDGNLVVRPYTPISSDDDKGFVDLVIKVYFKDTHPKFPAGGKMSQYLESMQIGDTIEFRGPSGLLVYQGKGKFAIRPDKKSNPIIRTVKSVGMIAGGTGITPMLQVIRAIMKDPDDHTVCHLLFANQTEKDILLRPELEELRNKHSARFKLWYTLDRAPEAWDYGQGFVNEEMIRDHLPPPEEEPLVLMCGPPPMIQYACLPNLDHVGHPTERCFVF 301          
BLAST of NADH-cytochrome b5 reductase vs. UniProt/SwissProt
Match: sp|Q60HG4|NB5R3_MACFA (NADH-cytochrome b5 reductase 3 OS=Macaca fascicularis OX=9541 GN=CYB5R3 PE=2 SV=3)

HSP 1 Score: 356.681 bits (914), Expect = 1.233e-121
Identity = 174/294 (59.18%), Postives = 229/294 (77.89%), Query Frame = 2
Query:  101 FGVVAVSSVALYY-----IFSSKKKKVTLIDSSVKYPLKLVDKEIISHDTTKFRFMLPSPDHILGLPIGQHIYLSYKIDGQIVVRPYTPVTNDKVKGYMDLVIKVYRKNANPKFPDGGKMSQYLENMEIGDYIDVRGPSGLLIYKGKGSFHIRADKKSTPILQNVQKVNMIAGGTGITPMLQLIRAVFNDPNDNTKLNLLYANQTXXXXXXXXXXXXXXXKHPKRFSLWYTVDRSKENWQYSTGFISDAMIKDHMFPPADDTMVFMCGPPPMINFACIPNLDKLGYNPKLRFSY 967
             G V +S V   Y     +F      +TL    +KY L+L+D+EIISHDT +FRF LPSP HILGLP+GQHIYLS +IDG +V+RPYTPV++D  KG++DLVIKVY K+ +PKFP GGKMSQYLE+M+IGD I+ RGP+GLL+Y+GKG F IR DKKS P+++ V+ V MIAGGTGITPMLQ+IRA+  DP+D+T  +LL+ANQTE DILLR ELE+LR++H  RF LWYT+DR+ E W YS GF+++ MI+DH+ PP ++ +V MCGPPPMI +AC+PNLD++G+  +  F++
Sbjct:    8 LGHVVLSPVWFLYSLLMKLFRCSTPAITLESPDIKYSLRLIDREIISHDTRRFRFALPSPQHILGLPVGQHIYLSARIDGNLVIRPYTPVSSDDDKGFVDLVIKVYFKDTHPKFPAGGKMSQYLESMQIGDTIEFRGPNGLLVYQGKGKFAIRPDKKSNPVIKTVKSVGMIAGGTGITPMLQVIRAIMKDPDDHTVCHLLFANQTEKDILLRPELEELRNEHSARFKLWYTLDRAPEAWDYSQGFVNEEMIRDHLPPPEEEPLVLMCGPPPMIQYACLPNLDRVGHPKERCFAF 301          
BLAST of NADH-cytochrome b5 reductase vs. UniProt/SwissProt
Match: sp|P83686|NB5R3_PIG (NADH-cytochrome b5 reductase 3 (Fragment) OS=Sus scrofa OX=9823 GN=CYB5R3 PE=1 SV=1)

HSP 1 Score: 355.14 bits (910), Expect = 1.887e-121
Identity = 167/268 (62.31%), Postives = 225/268 (83.96%), Query Frame = 2
Query:  164 VTLIDSSVKYPLKLVDKEIISHDTTKFRFMLPSPDHILGLPIGQHIYLSYKIDGQIVVRPYTPVTNDKVKGYMDLVIKVYRKNANPKFPDGGKMSQYLENMEIGDYIDVRGPSGLLIYKGKGSFHIRADKKSTPILQNVQKVNMIAGGTGITPMLQLIRAVFNDPNDNTKLNLLYANQTXXXXXXXXXXXXXXXKHPKRFSLWYTVDRSKENWQYSTGFISDAMIKDHMFPPADDTMVFMCGPPPMINFACIPNLDKLGYNPKLRFSY 967
            +TL +  +KYPL+L+DKE+++HDT +FRF LPSP+HILGLP+GQHIYLS +IDG +V+RPYTPV++D  KG++DLVIKVY K+ +PKFP GGKMSQYLE+M+IGD I+ RGP+GLL+Y+GKG F IR DKKS+P+++ V+ V MIAGGTGITPMLQ+IRA+  DP+D+T  +LL+ANQTE DILLR ELE+LR++H  RF LWYTVDR+ E W YS GF+++ MI+DH+ PP ++ +V MCGPPPMI +AC+PNL+++G+  +  F++
Sbjct:    5 ITLENPDIKYPLRLIDKEVVNHDTRRFRFALPSPEHILGLPVGQHIYLSARIDGNLVIRPYTPVSSDDDKGFVDLVIKVYFKDTHPKFPAGGKMSQYLESMKIGDTIEFRGPNGLLVYQGKGKFAIRPDKKSSPVIKTVKSVGMIAGGTGITPMLQVIRAIMKDPDDHTVCHLLFANQTEKDILLRPELEELRNEHSARFKLWYTVDRAPEAWDYSQGFVNEEMIRDHLPPPEEEPLVLMCGPPPMIQYACLPNLERVGHPKERCFAF 272          
BLAST of NADH-cytochrome b5 reductase vs. TrEMBL
Match: A0A1S3H921 (NADH-cytochrome b5 reductase OS=Lingula unguis OX=7574 GN=LOC106153265 PE=3 SV=1)

HSP 1 Score: 394.045 bits (1011), Expect = 9.781e-134
Identity = 200/301 (66.45%), Postives = 239/301 (79.40%), Query Frame = 2
Query:   74 LMVIPLAIGFGVVAVSSV-ALYYIFSSKKKK--VTLIDSSVKYPLKLVDKEIISHDTTKFRFMLPSPDHILGLPIGQHIYLSYKIDGQIVVRPYTPVTNDKVKGYMDLVIKVYRKNANPKFPDGGKMSQYLENMEIGDYIDVRGPSGLLIYKGKGSFHIRADKKSTPILQNVQKVNMIAGGTGITPMLQLIRAVFNDPNDNTKLNLLYANQTXXXXXXXXXXXXXXXKHPKRFSLWYTVDRSKENWQYSTGFISDAMIKDHMFPPADDTMVFMCGPPPMINFACIPNLDKLGYNPKLRFSY 967
            ++ IP+ IG GVVAV++V A  ++FS KKKK  VTL +  VKY LKL+DKEIISHDT +FRF LPSPDH+LGLP+GQHIYLS +IDG +V+RPYTPV++D  KG+MDLV+KVY K+ +PKFPDGGKMSQYLENM IGDYI+VRGP+GLL+Y G+G F IR DKKS P     + V MIAGGTGITPMLQL+R VF DP D T L LL+ANQTE DILLR ELE++ ++HP RF LWYT+DR +E W YS+GFI   MIK H+  P +DT +FMCGPPPMI FAC PNLDKLGY    RF+Y
Sbjct:    7 VLTIPVLIGLGVVAVTAVLAKVFLFSDKKKKAPVTLENPEVKYKLKLIDKEIISHDTRRFRFALPSPDHVLGLPVGQHIYLSARIDGSLVIRPYTPVSSDDDKGFMDLVVKVYFKDVHPKFPDGGKMSQYLENMAIGDYIEVRGPNGLLVYDGRGQFSIRPDKKSPPQKVKAKNVGMIAGGTGITPMLQLVRQVFKDPEDKTNLMLLFANQTEKDILLRPELEEIAEQHPDRFKLWYTLDRPEEGWAYSSGFIDADMIKGHLPTPGEDTYIFMCGPPPMIRFACEPNLDKLGYPQNKRFAY 307          
BLAST of NADH-cytochrome b5 reductase vs. TrEMBL
Match: K1R6L5 (NADH-cytochrome b5 reductase OS=Crassostrea gigas OX=29159 GN=CGI_10027360 PE=3 SV=1)

HSP 1 Score: 394.045 bits (1011), Expect = 1.015e-133
Identity = 202/307 (65.80%), Postives = 242/307 (78.83%), Query Frame = 2
Query:   59 MSTKALMVIPLAIGFGVVAVSSV-ALYYIFSSKKKK---VTLIDSSVKYPLKLVDKEIISHDTTKFRFMLPSPDHILGLPIGQHIYLSYKIDGQIVVRPYTPVTNDKVKGYMDLVIKVYRKNANPKFPDGGKMSQYLENMEIGDYIDVRGPSGLLIYKGKGSFHIRADKKSTPILQNVQKVNMIAGGTGITPMLQLIRAVFNDPNDNTKLNLLYANQTXXXXXXXXXXXXXXXKHPKRFSLWYTVDRSKENWQYSTGFISDAMIKDHMFPPADDTMVFMCGPPPMINFACIPNLDKLGYNPKLRFSY 967
            MS    + +P+ IG GVVAV+++ A  ++F +KKK    +TL D + KYPLKLVDKE +SHDT KFRF LPSP+HILGLP+GQHIYL+ +IDGQ+V+RPYTPVT+D  KGYMDLV   Y KN +PKFP+GGKMSQYLENM IGD+IDVRGP+GLL+Y+GKG F +R DKKS P     + V MIAGGTGITPMLQL+R V  DP D T L LL+ANQTEDDILLR ELED++  HP RF LWYT+DR  E W+YS GF+SD MIK H+ PP+ DT++ MCGPPPMINFAC PNLDKLGY+ K RF+Y
Sbjct:    1 MSRATAIGLPVLIGVGVVAVTAILAKIFLFGNKKKTKSPITLQDPNTKYPLKLVDKEEVSHDTRKFRFALPSPEHILGLPVGQHIYLTARIDGQLVIRPYTPVTSDDDKGYMDLV---YFKNVHPKFPEGGKMSQYLENMSIGDFIDVRGPNGLLVYEGKGVFKVRPDKKSPPETVTARNVGMIAGGTGITPMLQLVREVLKDPEDKTNLFLLFANQTEDDILLRTELEDIQAIHPDRFQLWYTIDRPTEGWKYSKGFVSDEMIKHHLPPPSSDTVILMCGPPPMINFACQPNLDKLGYSQKSRFAY 304          
BLAST of NADH-cytochrome b5 reductase vs. TrEMBL
Match: A0A1S3HBR6 (NADH-cytochrome b5 reductase OS=Lingula unguis OX=7574 GN=LOC106153265 PE=3 SV=1)

HSP 1 Score: 394.045 bits (1011), Expect = 1.026e-133
Identity = 203/306 (66.34%), Postives = 241/306 (78.76%), Query Frame = 2
Query:   62 STKALM-VIPLAIGFGVVAVSSV-ALYYIFSSKKKK--VTLIDSSVKYPLKLVDKEIISHDTTKFRFMLPSPDHILGLPIGQHIYLSYKIDGQIVVRPYTPVTNDKVKGYMDLVIKVYRKNANPKFPDGGKMSQYLENMEIGDYIDVRGPSGLLIYKGKGSFHIRADKKSTPILQNVQKVNMIAGGTGITPMLQLIRAVFNDPNDNTKLNLLYANQTXXXXXXXXXXXXXXXKHPKRFSLWYTVDRSKENWQYSTGFISDAMIKDHMFPPADDTMVFMCGPPPMINFACIPNLDKLGYNPKLRFSY 967
            ST  L+  IP+ IG GVVAV++V A  ++FS KKKK  VTL +  VKY LKL+DKEIISHDT +FRF LPSPDH+LGLP+GQHIYLS +IDG +V+RPYTPV++D  KG+MDLV+KVY K+ +PKFPDGGKMSQYLENM IGDYI+VRGP+GLL+Y G+G F IR DKKS P     + V MIAGGTGITPMLQL+R VF DP D T L LL+ANQTE DILLR ELE++ ++HP RF LWYT+DR +E W YS+GFI   MIK H+  P +DT +FMCGPPPMI FAC PNLDKLGY    RF+Y
Sbjct:    4 STDVLVRTIPVLIGLGVVAVTAVLAKVFLFSDKKKKAPVTLENPEVKYKLKLIDKEIISHDTRRFRFALPSPDHVLGLPVGQHIYLSARIDGSLVIRPYTPVSSDDDKGFMDLVVKVYFKDVHPKFPDGGKMSQYLENMAIGDYIEVRGPNGLLVYDGRGQFSIRPDKKSPPQKVKAKNVGMIAGGTGITPMLQLVRQVFKDPEDKTNLMLLFANQTEKDILLRPELEEIAEQHPDRFKLWYTLDRPEEGWAYSSGFIDADMIKGHLPTPGEDTYIFMCGPPPMIRFACEPNLDKLGYPQNKRFAY 309          
BLAST of NADH-cytochrome b5 reductase vs. TrEMBL
Match: A0A0B7B258 (NADH-cytochrome b5 reductase OS=Arion vulgaris OX=1028688 GN=ORF157502 PE=3 SV=1)

HSP 1 Score: 392.119 bits (1006), Expect = 5.917e-133
Identity = 194/304 (63.82%), Postives = 249/304 (81.91%), Query Frame = 2
Query:   74 LMVIPLAIGFGVVAVSSVA----LYYIFSSKKK--KVTLIDSSVKYPLKLVDKEIISHDTTKFRFMLPSPDHILGLPIGQHIYLSYKIDGQIVVRPYTPVTNDKVKGYMDLVIKVYRKNANPKFPDGGKMSQYLENMEIGDYIDVRGPSGLLIYKGKGSFHIRADKKSTPILQNVQKVNMIAGGTGITPMLQLIRAVFNDPNDNTKLNLLYANQTXXXXXXXXXXXXXXXKHPKRFSLWYTVDRSKENWQYSTGFISDAMIKDHMFPPADDTMVFMCGPPPMINFACIPNLDKLGYNPKLRFSY 967
            L+++P+ IG GVVAV+++     L  +F+ KKK   +TL D ++KY LKLVDKE+ISHDT KFRF LP+PDHILGLP+GQHIYL+ +IDGQ+V+RPYTPV++D  KG++DLV+KVY KN NP+FPDGGKMSQYLEN++IGDYIDVRGP+GLL Y G G+  IR DKK+ P ++   K+ MIAGGTGITPMLQL+R VF DP+D T L L++ANQTE DILLR ELE +++ +P RF LWYT+DR +  W+YS+GFI+D +IK+H+ PP+ D++V MCGPPPMINFACIPNL+KLGY P+ RFS+
Sbjct:    8 LLMVPILIGVGVVAVTAILAKIFLPSLFAGKKKGPPITLKDPTLKYSLKLVDKEVISHDTRKFRFALPTPDHILGLPVGQHIYLTARIDGQLVIRPYTPVSSDDDKGFVDLVVKVYFKNVNPRFPDGGKMSQYLENLDIGDYIDVRGPNGLLQYVGPGTLKIRLDKKAEPQIKKASKIGMIAGGTGITPMLQLVRQVFKDPDDKTNLWLIFANQTESDILLRPELESIQNDYPNRFHLWYTLDRPESGWKYSSGFINDEVIKNHLPPPSPDSVVLMCGPPPMINFACIPNLEKLGYKPESRFSF 311          
BLAST of NADH-cytochrome b5 reductase vs. TrEMBL
Match: A0A3S1A3M6 (NADH-cytochrome b5 reductase OS=Elysia chlorotica OX=188477 GN=EGW08_010313 PE=3 SV=1)

HSP 1 Score: 389.423 bits (999), Expect = 7.619e-132
Identity = 196/286 (68.53%), Postives = 233/286 (81.47%), Query Frame = 2
Query:  116 VSSVALYYIFSSKKKKV--TLIDSSVKYPLKLVDKEIISHDTTKFRFMLPSPDHILGLPIGQHIYLSYKIDGQIVVRPYTPVTNDKVKGYMDLVIKVYRKNANPKFPDGGKMSQYLENMEIGDYIDVRGPSGLLIYKGKGSFHIRADKKSTPILQNVQKVNMIAGGTGITPMLQLIRAVFNDPNDNTKLNLLYANQTXXXXXXXXXXXXXXXKHPKRFSLWYTVDRSKENWQYSTGFISDAMIKDHMFPPADDTMVFMCGPPPMINFACIPNLDKLGYNPKLRFSY 967
            ++ + L  +F  KKK    TL D++VKYPLKLVDKE +SHDT +FRF LPS +HILGLP+GQHIYL+ +IDGQ+V+RPYTPV++D  KG+MDLVIKVY KN +PKFP+GGKMSQYLENM+IGDYIDVRGP+GLL Y GKGSF IRADKK+ P ++   KV MIAGGTGITPMLQL R VF DP DNT+L LL+ANQTEDDILLR ELEDL+   P RF LWYT+DR   NW+YS+GF++D M++ HM PP  DT+V MCGPPPMINFAC PNL+KLGY P  RF+Y
Sbjct:   26 LAKIFLPGLFGGKKKGAPTTLKDATVKYPLKLVDKENLSHDTRRFRFALPSAEHILGLPVGQHIYLTARIDGQLVIRPYTPVSSDDDKGFMDLVIKVYFKNVHPKFPEGGKMSQYLENMDIGDYIDVRGPNGLLQYTGKGSFSIRADKKAEPEVKKASKVGMIAGGTGITPMLQLARQVFKDPQDNTELWLLFANQTEDDILLRQELEDLQSAQPTRFHLWYTLDRPGPNWKYSSGFVNDEMLRGHMPPPGPDTLVLMCGPPPMINFACTPNLEKLGYKPDARFAY 311          
BLAST of NADH-cytochrome b5 reductase vs. Ensembl Cavefish
Match: cyb5r1 (NADH-cytochrome b5 reductase 3 [Source:NCBI gene;Acc:103045443])

HSP 1 Score: 374.015 bits (959), Expect = 2.179e-129
Identity = 182/300 (60.67%), Postives = 239/300 (79.67%), Query Frame = 2
Query:   77 MVIPLAIGFGVVAVSSVA-LYYIFSSKKKK--VTLIDSSVKYPLKLVDKEIISHDTTKFRFMLPSPDHILGLPIGQHIYLSYKIDGQIVVRPYTPVTNDKVKGYMDLVIKVYRKNANPKFPDGGKMSQYLENMEIGDYIDVRGPSGLLIYKGKGSFHIRADKKSTPILQNVQKVNMIAGGTGITPMLQLIRAVFNDPNDNTKLNLLYANQTXXXXXXXXXXXXXXXKHPKRFSLWYTVDRSKENWQYSTGFISDAMIKDHMFPPADDTMVFMCGPPPMINFACIPNLDKLGYNPKLRFSY 967
            M   +A+  GV+ VS+VA L Y F  +KKK  +TL+D S KY L+L+DKE+ISHDT KFRF LPSP+HILGLP+G+H+YLS +IDG +VVRPYTPV++D  KG +DLV+K+Y KN NPKFP+GGKMSQYLE++++GD +D RGP GLL YKG G   ++ADKKS P ++    + +IAGGTGITPMLQLIR +  +P+D T  +LL+ANQTE DILLRDELE+++ +HP++F LW+TVDR+ E+W+YS GFIS +MI++H+ PP+D+ ++ MCGPPPMI FAC PNLDKLGY    RF+Y
Sbjct:    5 MTTTVAVTAGVLVVSTVAVLGYFFLGRKKKAPITLVDPSEKYKLRLIDKEVISHDTRKFRFALPSPEHILGLPVGKHVYLSARIDGNLVVRPYTPVSSDDDKGCVDLVVKIYFKNVNPKFPEGGKMSQYLESLKLGDVVDFRGPGGLLEYKGNGQVAVQADKKSEPEMKKAATLGLIAGGTGITPMLQLIRDIMKNPSDKTTCSLLFANQTEKDILLRDELEEIQARHPEKFKLWFTVDRAPEDWEYSEGFISASMIQEHLPPPSDECIILMCGPPPMIQFACNPNLDKLGYGQSQRFTY 304          
BLAST of NADH-cytochrome b5 reductase vs. Ensembl Cavefish
Match: cyb5r1 (NADH-cytochrome b5 reductase 3 [Source:NCBI gene;Acc:103045443])

HSP 1 Score: 373.244 bits (957), Expect = 1.048e-128
Identity = 182/301 (60.47%), Postives = 239/301 (79.40%), Query Frame = 2
Query:   74 LMVIPLAIGFGVVAVSSVA-LYYIFSSKKKK--VTLIDSSVKYPLKLVDKEIISHDTTKFRFMLPSPDHILGLPIGQHIYLSYKIDGQIVVRPYTPVTNDKVKGYMDLVIKVYRKNANPKFPDGGKMSQYLENMEIGDYIDVRGPSGLLIYKGKGSFHIRADKKSTPILQNVQKVNMIAGGTGITPMLQLIRAVFNDPNDNTKLNLLYANQTXXXXXXXXXXXXXXXKHPKRFSLWYTVDRSKENWQYSTGFISDAMIKDHMFPPADDTMVFMCGPPPMINFACIPNLDKLGYNPKLRFSY 967
            L    +A+  GV+ VS+VA L Y F  +KKK  +TL+D S KY L+L+DKE+ISHDT KFRF LPSP+HILGLP+G+H+YLS +IDG +VVRPYTPV++D  KG +DLV+K+Y KN NPKFP+GGKMSQYLE++++GD +D RGP GLL YKG G   ++ADKKS P ++    + +IAGGTGITPMLQLIR +  +P+D T  +LL+ANQTE DILLRDELE+++ +HP++F LW+TVDR+ E+W+YS GFIS +MI++H+ PP+D+ ++ MCGPPPMI FAC PNLDKLGY    RF+Y
Sbjct:   28 LQTTTVAVTAGVLVVSTVAVLGYFFLGRKKKAPITLVDPSEKYKLRLIDKEVISHDTRKFRFALPSPEHILGLPVGKHVYLSARIDGNLVVRPYTPVSSDDDKGCVDLVVKIYFKNVNPKFPEGGKMSQYLESLKLGDVVDFRGPGGLLEYKGNGQVAVQADKKSEPEMKKAATLGLIAGGTGITPMLQLIRDIMKNPSDKTTCSLLFANQTEKDILLRDELEEIQARHPEKFKLWFTVDRAPEDWEYSEGFISASMIQEHLPPPSDECIILMCGPPPMIQFACNPNLDKLGYGQSQRFTY 328          
BLAST of NADH-cytochrome b5 reductase vs. Ensembl Cavefish
Match: cyb5r3 (NADH-cytochrome b5 reductase 3 [Source:NCBI gene;Acc:103021355])

HSP 1 Score: 354.755 bits (909), Expect = 7.802e-122
Identity = 168/273 (61.54%), Postives = 222/273 (81.32%), Query Frame = 2
Query:  149 SKKKKVTLIDSSVKYPLKLVDKEIISHDTTKFRFMLPSPDHILGLPIGQHIYLSYKIDGQIVVRPYTPVTNDKVKGYMDLVIKVYRKNANPKFPDGGKMSQYLENMEIGDYIDVRGPSGLLIYKGKGSFHIRADKKSTPILQNVQKVNMIAGGTGITPMLQLIRAVFNDPNDNTKLNLLYANQTXXXXXXXXXXXXXXXKHPKRFSLWYTVDRSKENWQYSTGFISDAMIKDHMFPPADDTMVFMCGPPPMINFACIPNLDKLGYNPKLRFSY 967
             ++  +TL D ++KY L+L+DKEIISHDT KFRF L SP+H+LGLP+GQHIYLS KIDG +VVRPYTPV++D  KG++DLV+K+Y KN +PKFP+GGKMSQYL+++ IGD ID RGPSGLL+Y+GKG+  IR DKK+ P ++  +++ MIAGGTGITPMLQ+IRA+  DP+D T   LL+ANQTE DILLR ELE+++  +P RF LWYT+D+  + W+YS GFIS+ M++ H+  PADDT++ MCGPPPMI FAC PNLDK+G++P  RF++
Sbjct:   26 GRRPAITLEDPNIKYALRLIDKEIISHDTRKFRFALKSPEHVLGLPVGQHIYLSAKIDGNLVVRPYTPVSSDDDKGFVDLVVKIYYKNTHPKFPEGGKMSQYLDSLRIGDTIDFRGPSGLLVYQGKGNCAIRPDKKAPPEIKKAKQIGMIAGGTGITPMLQIIRAIMKDPSDKTVCYLLFANQTEKDILLRPELEEIQANYPDRFHLWYTLDKVPDEWEYSQGFISEQMVRSHLPAPADDTLILMCGPPPMIQFACNPNLDKVGHSPSRRFAF 298          
BLAST of NADH-cytochrome b5 reductase vs. Ensembl Cavefish
Match: cyb5r2 (NADH-cytochrome b5 reductase 2-like [Source:NCBI gene;Acc:103022560])

HSP 1 Score: 335.495 bits (859), Expect = 4.811e-114
Identity = 172/305 (56.39%), Postives = 224/305 (73.44%), Query Frame = 2
Query:   80 VIPLAIGFGVVAVSSVALYYIF----SSKKKKV-----TLIDSSVKYPLKLVDKEIISHDTTKFRFMLPSPDHILGLPIGQHIYLSYKIDGQIVVRPYTPVTNDKVKGYMDLVIKVYRKNANPKFPDGGKMSQYLENMEIGDYIDVRGPSGLLIYKGKGSFHIRADKKSTPILQNVQKVNMIAGGTGITPMLQLIRAVFNDPNDNTKLNLLYANQTXXXXXXXXXXXXXXXKHPKRFSLWYTVDRSKENWQYSTGFISDAMIKDHMFPPADDTMVFMCGPPPMINFACIPNLDKLGYNPKLRFSY 967
            ++ L +  G+ AV +  L++      S+ KKK      TL   +VKYPL L +KE ISHDT +FRF LPS  H+LGLPIGQH+YLS K+ G +VVR YTPV++D+ +G++DLV+KVY KN +P +P GGKMSQYL +++IGD ID RGP+GLL+Y G G F IR DKKS   ++  + V MIAGGTGITPMLQLIR++  DP DNTK +L++ANQTE DILLR ELE++   HP +F+LWYT+D+  + W+YSTGFI  AMIK+H+ P A+D +V MCGPPPMI  AC+PNL KLGY  +  F+Y
Sbjct:    4 ILTLPVVIGLFAVLATVLFFFLNAGSSTGKKKQSRFPKTLQGPTVKYPLTLTEKEEISHDTKRFRFSLPSSVHVLGLPIGQHVYLSAKVGGSLVVRAYTPVSSDEDQGFVDLVVKVYFKNTHPSYPGGGKMSQYLNDLKIGDTIDFRGPNGLLVYNGNGQFAIRPDKKSDAKVRKFRHVGMIAGGTGITPMLQLIRSITADPTDNTKCSLIFANQTEKDILLRKELEEVLKNHPDKFNLWYTLDKPPQGWKYSTGFIDAAMIKEHLPPAANDVLVVMCGPPPMIQNACLPNLTKLGYKEENTFAY 308          
BLAST of NADH-cytochrome b5 reductase vs. Ensembl Cavefish
Match: cyb5r4 (cytochrome b5 reductase 4 [Source:NCBI gene;Acc:553685])

HSP 1 Score: 96.2857 bits (238), Expect = 2.766e-21
Identity = 77/246 (31.30%), Postives = 119/246 (48.37%), Query Frame = 2
Query:  203 LVDKEIISHDTTKFRFMLPSPDHILGLPIGQHIYLSYKIDGQIVVRPYTPV--------TNDKVKGYMDLVIKVYRKNANPKFPDGGKMSQYLENMEIGDYIDVRGPSGLLIYKGKGSFHIRADKKSTPILQNVQKVNMIAGGTGITPMLQLIRAVFNDPNDNTKLNLLYANQTXXXXXXXXXXXXXXXKHPKRFSLWYTVDRSKENWQYSTGFISDAMIKDHMFPPADD-TMVFMCGPPPMINFA 913
            LV K+ ++HDT  F F LP   H + +P+G+H+YL   I G  +V+PYTPV         ++     +  +IKVY        PD G  + YL+N++IG  + +  P         GSF +R+       L++V  + ++A GTG TPM +L+     D     K  L++ N+ E DIL   ELE L  +  +R  + Y +     +W    G I  AM++  +  P D   +V +CGP      A
Sbjct:  345 LVSKKEVTHDTQLFCFQLPPGTH-MHIPMGRHVYLKASIQGSDIVKPYTPVDEVLRPPKNSNTTSTNIYFMIKVY--------PD-GVFTPYLDNLDIGASVSISSPD--------GSFTVRS-------LRDVTHLYLLAAGTGFTPMARLLHLALQDLPTIRKTKLMFFNRQERDILWHSELEQLCSEE-ERCQIEYVLSEPAGSWTGRRGRIEAAMLQGFLERPGDSKCLVCVCGPTGFTELA 564          
BLAST of NADH-cytochrome b5 reductase vs. Ensembl Sea Lamprey
Match: cyb5r1 (cytochrome b5 reductase 1 [Source:ZFIN;Acc:ZDB-GENE-030131-8497])

HSP 1 Score: 363.229 bits (931), Expect = 8.434e-126
Identity = 176/297 (59.26%), Postives = 234/297 (78.79%), Query Frame = 2
Query:   89 LAIGFGVVAVSS--VALYYIFSSKKKK--VTLIDSSVKYPLKLVDKEIISHDTTKFRFMLPSPDHILGLPIGQHIYLSYKIDGQIVVRPYTPVTNDKVKGYMDLVIKVYRKNANPKFPDGGKMSQYLENMEIGDYIDVRGPSGLLIYKGKGSFHIRADKKSTPILQNVQKVNMIAGGTGITPMLQLIRAVFNDPNDNTKLNLLYANQTXXXXXXXXXXXXXXXKHPKRFSLWYTVDRSKENWQYSTGFISDAMIKDHMFPPADDTMVFMCGPPPMINFACIPNLDKLGYNPKLRFSY 967
            + +  GV+A+++  V  Y +++++K+K  V L D ++KYPL+LVDKEIISHDT +FRF LP+P HILGLP+GQHIYLS  IDG +VVRPYTPV++D  KGY+DLV+KVY K  +PKFP+GGKMSQYL+++ +GD I+ RGPSGLL+Y G G F IR DKKS P ++ V KV MIAGGTGITPMLQL+R V    +D+T  +L++ANQTE DILLRDELE+++ +HP +F+LW+T+D + E+W +  GF++  MI+DH+ PPADD ++ MCGPPPMI FAC P+LDKL Y   +RFSY
Sbjct:    9 VVVALGVIALTTAGVVAYTLWNARKRKSPVLLKDPAIKYPLRLVDKEIISHDTRRFRFALPTPRHILGLPVGQHIYLSATIDGNLVVRPYTPVSSDDNKGYVDLVVKVYLKGVHPKFPEGGKMSQYLDSLPLGDAIEFRGPSGLLVYNGNGEFAIRPDKKSEPKIKKVTKVGMIAGGTGITPMLQLVRQVMKSSDDHTTCSLIFANQTEKDILLRDELEEIQARHPNKFNLWFTLDTATEDWDFGKGFVTAEMIRDHLPPPADDVLILMCGPPPMIQFACYPSLDKLEYTQAMRFSY 305          
BLAST of NADH-cytochrome b5 reductase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006153.1 (pep scaffold:Pmarinus_7.0:GL478151:4458:23451:1 gene:ENSPMAG00000005555.1 transcript:ENSPMAT00000006153.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 74.7146 bits (182), Expect = 1.799e-15
Identity = 70/261 (26.82%), Postives = 124/261 (47.51%), Query Frame = 2
Query:  212 KEIISHDTTKFRFMLPSPDHILGLPIGQHIYLSYKIDGQIVVRPYTPVTND---------KVKGYMDLVIKVYRKNANPKFPDGGKMSQYLENMEIGDYIDVRGPSGLLIYKGKGSFHIRADKKSTPILQNVQKVNMIAGGTGITPMLQLIR-AVFNDPNDNTKLNLLYANQTXXXXXXXXXXXXXXXKHPKRFSLWYTVDRSKENWQYSTGFISDAMIKDHMFPPADDT------MVFMCGPPPMINFACIPNLDKLGYN 946
            +  ++HDT      LP   H +GL +G H+YL   + G  + R YTPV            ++   +  +IKVY        P+ G ++  L  +  GD +        L+  G G+F  RA       +  V ++++IA GTG+TPM++L+  AV +D     K+ L++ N++ +DIL + ++++L D+   RF + Y +    + W    G IS  ++ + + P +         +  +CG  P    A +  LD+LG+ 
Sbjct:   56 RSTVTHDTVLLCVRLPPGTH-MGLALGHHVYLQAPVQGVDITRAYTPVLPSLTAPWEVVPRLSTLLHFMIKVY--------PN-GTLTPVLGCLGPGDAV--------LVGDGAGTFR-RAQ------VAGVSQLSLIAAGTGLTPMVRLLAYAVVSD--HIRKIELVFFNKSPEDILWKQQIDELCDRD-SRFQVHYVLSEVSDRWHGRIGRISRTLLSELLAPVSSGVGERRRRLACVCGAAPFTELA-VSILDELGFE 287          
BLAST of NADH-cytochrome b5 reductase vs. Ensembl Yeast
Match: CBR1 (Cytochrome b reductase; not essential for viability; also detected in mitochondria; mutation in conserved NADH binding domain of the human ortholog results in type I methemoglobinemia [Source:SGD;Acc:S000001305])

HSP 1 Score: 142.51 bits (358), Expect = 2.305e-40
Identity = 89/238 (37.39%), Postives = 143/238 (60.08%), Query Frame = 2
Query:  203 LVDKEIISHDTTKFRFMLPSPDHILGLPIGQHIYLSYKIDGQIVVRPYTPVTND-KVKGYMDLVIKVYRKNANPKFPDGGKMSQYLENMEIGDYIDVRGPSGLLIYKGKGSFHIRADKKSTPILQNVQKVNMIAGGTGITPMLQLIRAVFNDPNDNTKLNLLYANQTXXXXXXXXXXXXXXXKHPKRFSLWYTVDR-SKENWQYSTGFISDAMIKDHMFPPA--DDTMVFMCGPPPMI 904
            LV+K I++H+T+ ++F LP  D +LGLPIGQHI +   I+G+ + R YTP + D   KG  +L++K Y           G +S+ +  ++IGD I ++GP        +G++H   + +S         + MIAGGTGI PM Q+++A+  DP+D TK++L++ N  E+DILL+ ELE L    P +F + Y +D   +E+W    G+I+  +IK+H+ P A  D+  + +CGPP M+
Sbjct:   45 LVEKTILTHNTSMYKFGLPHADDVLGLPIGQHIVIKANINGKDITRSYTPTSLDGDTKGNFELLVKSYPT---------GNVSKMIGELKIGDSIQIKGP--------RGNYHYERNCRS--------HLGMIAGGTGIAPMYQIMKAIAMDPHDTTKVSLVFGNVHEEDILLKKELEALVAMKPSQFKIVYYLDSPDREDWTGGVGYITKDVIKEHL-PAATMDNVQILICGPPAMV 256          
BLAST of NADH-cytochrome b5 reductase vs. Ensembl Yeast
Match: MCR1 (Mitochondrial NADH-cytochrome b5 reductase; involved in ergosterol biosynthesis [Source:SGD;Acc:S000001633])

HSP 1 Score: 131.724 bits (330), Expect = 5.156e-36
Identity = 92/285 (32.28%), Postives = 153/285 (53.68%), Query Frame = 2
Query:   89 LAIGFGVVAVSSVALYY---------IFSSKKKKVTLIDSSVKYPLKLVDKEIISHDTTKFRFMLPSPDHILGLPIGQHIYLSYKI-DGQIVVRPYTPVTNDKVKGYMDLVIKVYRKNANPKFPDGGKMSQYLENMEIGDYIDVRGPSGLLIYKGKGSFHIRADKKSTPILQNVQKVNMIAGGTGITPMLQLIRAVFNDPNDNTKLNLLYANQTXXXXXXXXXXXXXXXKHPKRFSLWYTVDRSKENWQY--STGFISDAMIKDHMFPPADDTMVFMCGPPPMIN 907
            L I  G VA+++   +Y         +F+   K     D  +  P+  +++E  SHDT +F F LP+ D  +GL +   ++  +    G  VVRPYTPV++   KG+  LV+K Y         +GGKM+ +L  ++  D +  +GP  ++ +K + +                + + ++  GTGI P+ QL   +  +PND TK+NLLY N+T  DILLR EL+ L++K+P +F++ Y VD  +++  +     FIS   I++H+  P + T +F+CGPPP +N
Sbjct:   13 LPIALGTVAIAAATAFYFANRNQHSFVFNESNKVFKGDDKWIDLPISKIEEE--SHDTRRFTFKLPTEDSEMGLVLASALFAKFVTPKGSNVVRPYTPVSDLSQKGHFQLVVKHY---------EGGKMTSHLFGLKPNDTVSFKGP--IMKWKWQPN--------------QFKSITLLGAGTGINPLYQLAHHIVENPNDKTKVNLLYGNKTPQDILLRKELDALKEKYPDKFNVTYFVDDKQDDQDFDGEISFISKDFIQEHVPGPKESTHLFVCGPPPFMN 270          
BLAST of NADH-cytochrome b5 reductase vs. Ensembl Yeast
Match: PGA3 (Putative cytochrome b5 reductase, localized to the plasma membrane; may be involved in regulation of lifespan; required for maturation of Gas1p and Pho8p, proposed to be involved in protein trafficking; PGA3 has a paralog, AIM33, that arose from the whole genome duplication [Source:SGD;Acc:S000004594])

HSP 1 Score: 129.413 bits (324), Expect = 4.533e-35
Identity = 95/291 (32.65%), Postives = 155/291 (53.26%), Query Frame = 2
Query:   59 MSTKALMVIPLAIGFGVVAVSSVALYYIFSSKKKKVTLIDSSVKYP-----LKLVDKEIISHDTTKFRFMLPSPDHILGLPIGQHIYLSYKIDGQIVVRPYTPVTNDKVKGYMDLVIKVYRKNANPKFPDGGKMSQYLENMEIGDYIDVRGPSGLLIYKGKGSFHIRADKKSTPILQNVQKVNMIAGGTGITPMLQLIRAVFNDPNDNTKLNLLYANQTXXXXXXXXXXXXXXXKHPKRFSLWYTVDRSKENWQYSTGFISDAMIKDHMFPPADDTMVFMCGPPPMINFAC 916
            MS +  ++  L I F ++ V +      +S+ K++ +L      YP     L+L D+ IIS +T  +RF L +    L +P G H+ +   IDG+  VR Y P+++    GY+DLV+K Y           GK+S+Y   +  GD +D +GP G L Y+   S H+                 ++AGG+GITP+LQ++  +   P D TK++LLYAN+TE+DILL+DEL+++ +K+P  F + Y V    + W    G+I+   +  ++   ++D  + +CGP  M N A 
Sbjct:   36 MSGELKILWSLPILFMIIFVRA------YSAYKRRRSL------YPDRWTSLELEDQTIISKNTALYRFKLKTRLESLDIPAGHHVAVRVPIDGKQEVRYYNPISSKLESGYLDLVVKAYVD---------GKVSKYFAGLNSGDTVDFKGPIGTLNYEPNSSKHL----------------GIVAGGSGITPVLQILNEIITVPEDLTKVSLLYANETENDILLKDELDEMAEKYP-HFQVHYVVHYPSDRWTGDVGYITKDQMNRYLPEYSEDNRLLICGPDGMNNLAL 288          
BLAST of NADH-cytochrome b5 reductase vs. Ensembl Yeast
Match: AIM33 (Protein of unknown function, highly conserved across species; homolog of human CYB5R4; null mutant displays reduced frequency of mitochondrial genome loss; AIM33 has a paralog, PGA3, that arose from the whole genome duplication [Source:SGD;Acc:S000004552])

HSP 1 Score: 114.775 bits (286), Expect = 9.403e-30
Identity = 76/243 (31.28%), Postives = 136/243 (55.97%), Query Frame = 2
Query:  197 LKLVDKEIISHDTTKFRFMLPSPDHILGLPIGQHIYLSYKIDGQIVVRPYTPVTNDKVKGYMDLVIKVYRKNANPKFPDGGKMSQYLENMEIGDYIDVRGPSGLLIYKGKGSFHIRADKKSTPILQNVQKVNMIAGGTGITPMLQLIRAVFNDPNDNTKLNLLYANQTXXXXXXXXXXXXXXXKHPKRFSLWYTVDRSKENWQYSTGFISDAMIKDHMFPPADDTMVFMCGPPPM----INFA 913
            L L  K  IS +T+ + F L  P   L +P+G H+ +   I+G+ +VR YTPV     +G+++LV+K Y+          G +S+Y + ++I  Y++ +GP G L Y          D+ +        ++ +IAGG+GITP+LQ+++ +   P D T ++L+YAN+TEDDIL++ +L+ +  ++P  F + Y + +    W    G+++   +K ++   A+D  + +CGPP M    +N+A
Sbjct:   75 LPLSKKTRISRNTSLYCFKLKYPFERLHIPMGYHLAVRVTINGERLVRYYTPVNVPNTEGHLELVVKTYKH---------GVVSKYFDKLKIRQYVEFKGPLGELEY----------DQDTA------TELGIIAGGSGITPVLQVLQEIIPSPEDLTHISLIYANETEDDILMKSQLDHMAKEYP-HFKVHYVIHKPNGKWNGDVGYVTLEEMKRYLPKQAEDHRLLICGPPKMNEMVLNYA 291          
BLAST of NADH-cytochrome b5 reductase vs. Ensembl Nematostella
Match: EDO39808 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S8X8])

HSP 1 Score: 320.472 bits (820), Expect = 1.077e-108
Identity = 160/296 (54.05%), Postives = 218/296 (73.65%), Query Frame = 2
Query:   86 PLAIGFGV-VAVSSVALYYIFS-SKKKKVTLIDSSVKYPLKLVDKEIISHDTTKFRFMLPSPDHILGLPIGQHIYLSYKIDGQIVVRPYTPVTNDKVKGYMDLVIKVYRKNANPKFPDGGKMSQYLENMEIGDYIDVRGPSGLLIYKGKGSFHIRADKKSTPILQNVQKVNMIAGGTGITPMLQLIRAVFNDPNDNTKLNLLYANQTXXXXXXXXXXXXXXXKHPKRFSLWYTVDRSKENWQYSTGFISDAMIKDHMFPPADDTMVFMCGPPPMINFACIPNLDKLGYNPKLRFSY 967
            PL IG G+ + V+++ L  + +   KK +  ++   K P KLVDK+I+SHDT +F F L SPDHILGLP+G H+YLS  ID + V+RPYTPVT+D  KG+ +LVIKVY KN +PKFP+GGKMSQYLE+++IGD +D+RGP+G LIYKG+G+  I+   +    L+  + + +IAGGTGITPMLQ+I+AV  D  D+T ++L++ANQTE DIL+R+ELE L  ++  +F LWYT+DR  E+W YS GFI + M+++HM P   DT + MCGPPPMINFACIPNL KLG+   + F +
Sbjct:    7 PLIIGAGLALVVAAIGLVVLLTKGAKKSLVALNPEKKIPFKLVDKKIVSHDTRRFIFQLQSPDHILGLPVGNHMYLSATIDDKPVIRPYTPVTSDDEKGFFELVIKVYFKNVHPKFPEGGKMSQYLESLKIGDTVDIRGPAGKLIYKGRGTISIKESIRKPEQLRKAKFLGLIAGGTGITPMLQIIKAVLKDSGDHTTVSLIFANQTERDILVREELEFLASQNSDQFKLWYTLDRPPEDWAYSGGFIDEKMLREHMPPAGPDTQILMCGPPPMINFACIPNLKKLGFTADMYFPF 302          
BLAST of NADH-cytochrome b5 reductase vs. Ensembl Nematostella
Match: EDO28600 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T611])

HSP 1 Score: 98.9821 bits (245), Expect = 1.527e-23
Identity = 69/231 (29.87%), Postives = 108/231 (46.75%), Query Frame = 2
Query:  179 SSVKYPL-KLVDKEIISHDTTKFRFMLPSPDHILGLPIGQHIYLSYKIDGQIVVRPYTPVTNDKVKGYMDLVIKVYRKNANPKFPDGGKMSQYLENMEIGDYIDVRGPSGLLIYKGKGSFHIRADKKSTPILQNVQKVNMIAGGTGITPMLQLIRAVFNDPNDNTKLNLLYANQTXXXXXXXXXXXXXXXKHPKRFSLWYTVDRSKENWQYSTGFI----SDAMIK--DHM 850
             + KY L KL     ++ D   F F +P     LGL  GQHI L  K+D Q + R YTPV+  K  G+  ++IK+Y+          GKMS  +   ++GD++D RGP G   Y              TP     +++ M+A GTGI PMLQ+I  + ++  D+T + LL++                  +H +   +   +D  K++W +   +I     DA +K  DH+
Sbjct:   66 CTSKYKLFKLASLRQVTSDAFLFHFTIPD-GRCLGLHAGQHIILRGKVDDQFITRQYTPVSPLKSSGFFAVLIKIYKD---------GKMSNCVSKWKVGDFVDWRGPFGQFTY--------------TP--NKFRRIFMLAAGTGIAPMLQVIGQILDNDKDDTMVKLLFS-----------------CRHYEEILMKDELDNRKDHWNFDVLYIISQEDDAQVKYGDHV 253          
BLAST of NADH-cytochrome b5 reductase vs. Ensembl Nematostella
Match: EDO26415 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A8DV49])

HSP 1 Score: 47.7506 bits (112), Expect = 2.903e-6
Identity = 42/152 (27.63%), Postives = 67/152 (44.08%), Query Frame = 2
Query:  191 YPLKLVDKEIISHDTTKFRFMLPSPDHILGLPIGQHIYLSYKIDGQIVVRPYTPV--------TNDKVKG-YMDLVIKVYRKNANPKFPDGGKMSQYLENMEIGDYIDVRGPSGLLIYKGKGSFHIRADKKSTPILQNVQKVNMIAGGTGIT 619
            +   L   E +SH+T    F LP P  ++ +P+G H+++   I G  + R YT V        T  + +G    L+IK+Y        PDG  ++  L+ + +GD +        LI    G F +         L   + V +IAGGTG +
Sbjct:  155 WECTLTSVEEVSHNTQLLGFELP-PGVLMRVPVGHHVHVKRNIQGMEITRSYTVVLPSLNIDRTEREYEGRRFYLMIKIY--------PDGA-LTPTLQQLAVGDKV--------LISDYSGDFQVSR-------LSVAKDVCLIAGGTGAS 281          
BLAST of NADH-cytochrome b5 reductase vs. Ensembl Medaka
Match: cyb5r3 (NADH-cytochrome b5 reductase 3-like [Source:NCBI gene;Acc:101175543])

HSP 1 Score: 340.887 bits (873), Expect = 4.835e-116
Identity = 168/310 (54.19%), Postives = 227/310 (73.23%), Query Frame = 2
Query:  104 GVVAVSSVALYYIFSSKKKKVTLIDSSVKYPLKLVDKEIISHDTTKFRFMLPSPDHILGLPIGQHIYLSYKIDGQIVVRPYTPVTNDKVKGYMDLVIKV----------------------YRKNANPKFPDGGKMSQYLENMEIGDYIDVRGPSGLLIYKGKGSFHIRADKKSTPILQNVQKVNMIAGGTGITPMLQLIRAVFNDPNDNTKLNLLYANQTXXXXXXXXXXXXXXXKHPKRFSLWYTVDRSKENWQYSTGFISDAMIKDHMFPPADDTMVFMCGPPPMINFACIPNLDKLGYNPKLRFSY 967
            G+ +V ++     FS ++  +TL D ++KY L+L+DKEI+SHDT +FRF LPSP+H+LGLP+GQHIYLS KIDG++VVRPYTPV++D  KG +DLV+KV                      Y K  NPKFP+GGKMSQYLE+++I D ID RGPSGLL+Y+G+G F ++ +KKS  + +  + V MIAGGTGITPMLQ+I A+  DP D T  +LL+ANQTE DILLR ELE+++ KHP RF LW+TVDR+  +W+YS GFI + M+++ + PP +DT++ MCGPPPMI FAC PNLDK+G++   RF++
Sbjct:   12 GLDSVINLIFRLFFSKRRPAITLEDPNIKYALRLIDKEIVSHDTRRFRFALPSPEHVLGLPVGQHIYLSAKIDGKLVVRPYTPVSSDDDKGSVDLVVKVRSPTVLLFTDVPAFDTPLCLQVYFKGINPKFPEGGKMSQYLESLKINDTIDFRGPSGLLVYRGRGVFDVQPEKKSPAVKKTAKHVGMIAGGTGITPMLQIITAIMKDPQDPTVCHLLFANQTEKDILLRPELEEIQVKHPDRFRLWFTVDRAPLDWEYSQGFIDEDMVRERLPPPGEDTLILMCGPPPMIQFACNPNLDKVGHSESRRFTF 321          
BLAST of NADH-cytochrome b5 reductase vs. Ensembl Medaka
Match: cyb5r3 (NADH-cytochrome b5 reductase 3-like [Source:NCBI gene;Acc:101175543])

HSP 1 Score: 313.923 bits (803), Expect = 3.924e-106
Identity = 156/288 (54.17%), Postives = 209/288 (72.57%), Query Frame = 2
Query:  104 GVVAVSSVALYYIFSSKKKKVTLIDSSVKYPLKLVDKEIISHDTTKFRFMLPSPDHILGLPIGQHIYLSYKIDGQIVVRPYTPVTNDKVKGYMDLVIKVYRKNANPKFPDGGKMSQYLENMEIGDYIDVRGPSGLLIYKGKGSFHIRADKKSTPILQNVQKVNMIAGGTGITPMLQLIRAVFNDPNDNTKLNLLYANQTXXXXXXXXXXXXXXXKHPKRFSLWYTVDRSKENWQYSTGFISDAMIKDHMFPPADDTMVFMCGPPPMINFACIPNLDKLGYNPKLRFSY 967
            G+ +V ++     FS ++  +TL D ++KY L+L+DKEI+SHDT +FRF LPSP+H+LGLP+GQHIYLS KIDG++VVRPYTPV++D  KG +DLV+KVY K  NPKFP+GGKMSQYLE+++I D ID RGPSGLL+Y+G+                            GITPMLQ+I A+  DP D T  +LL+ANQTE DILLR ELE+++ KHP RF LW+TVDR+  +W+YS GFI + M+++ + PP +DT++ MCGPPPMI FAC PNLDK+G++   RF++
Sbjct:   12 GLDSVINLIFRLFFSKRRPAITLEDPNIKYALRLIDKEIVSHDTRRFRFALPSPEHVLGLPVGQHIYLSAKIDGKLVVRPYTPVSSDDDKGSVDLVVKVYFKGINPKFPEGGKMSQYLESLKINDTIDFRGPSGLLVYRGR----------------------------GITPMLQIITAIMKDPQDPTVCHLLFANQTEKDILLRPELEEIQVKHPDRFRLWFTVDRAPLDWEYSQGFIDEDMVRERLPPPGEDTLILMCGPPPMIQFACNPNLDKVGHSESRRFTF 271          
BLAST of NADH-cytochrome b5 reductase vs. Ensembl Medaka
Match: cyb5r2 (NADH-cytochrome b5 reductase 2 [Source:NCBI gene;Acc:101158817])

HSP 1 Score: 306.99 bits (785), Expect = 7.675e-103
Identity = 155/272 (56.99%), Postives = 208/272 (76.47%), Query Frame = 2
Query:  155 KKKVTLIDSSVKYPLKLVDKEIISHDTTKFRFMLPSPDHILGLPIGQ-HIYLSYKIDGQIVVRPYTPVTNDKVKGYMDLVIKVYRKNANPKFPDGGKMSQYLENMEIGDYIDVRGPSGLLIYKGKGSFHIRADKKSTPILQNVQKVNMIAGGTGITPMLQLIRAVFNDPNDNTKLNLLYANQTXXXXXXXXXXXXXXXKHPKRFSLWYTVDRSKENWQYSTGFISDAMIKDHMFPPADDTMVFMCGPPPMINFACIPNLDKLGYNPKLRFSY 967
            K  +TL D ++KY L L+ KE IS DT KFRF LPS  H+LGLP+G  H+YLS K++G +VVRPYTPV+ D+ +G++DLV+KVY K  +P +PDGG+MSQYL+ M IGD ID RGP+GLL+Y+G G F IRA+KKS P ++  + V MIAGGTGITPMLQLIR + +DP D TK +L++ NQTE DILLR+EL+D++  HP +  LWYT+D+  + W+YS+GF++  MIKD++ PP+ D +V +CGP PMI  AC+PNL+KLG+  +  FSY
Sbjct:   40 KGPITLQDPTLKYRLPLISKEEISEDTKKFRFGLPSSFHVLGLPVGNDHVYLSAKVNGALVVRPYTPVSCDEDQGFVDLVVKVYYKGTHPTYPDGGQMSQYLDKMSIGDTIDFRGPNGLLVYQGNGRFSIRANKKSEPKVRRFRHVGMIAGGTGITPMLQLIRKITSDPKDTTKCSLIFGNQTEKDILLREELDDVQKNHPDQVKLWYTLDKPPQGWKYSSGFVTFDMIKDNIPPPSSDLLVVLCGPAPMIQNACLPNLEKLGHAQENIFSY 311          
BLAST of NADH-cytochrome b5 reductase vs. Ensembl Medaka
Match: cyb5r2 (NADH-cytochrome b5 reductase 2 [Source:NCBI gene;Acc:101158817])

HSP 1 Score: 287.345 bits (734), Expect = 2.820e-95
Identity = 147/271 (54.24%), Postives = 198/271 (73.06%), Query Frame = 2
Query:  155 KKKVTLIDSSVKYPLKLVDKEIISHDTTKFRFMLPSPDHILGLPIGQHIYLSYKIDGQIVVRPYTPVTNDKVKGYMDLVIKVYRKNANPKFPDGGKMSQYLENMEIGDYIDVRGPSGLLIYKGKGSFHIRADKKSTPILQNVQKVNMIAGGTGITPMLQLIRAVFNDPNDNTKLNLLYANQTXXXXXXXXXXXXXXXKHPKRFSLWYTVDRSKENWQYSTGFISDAMIKDHMFPPADDTMVFMCGPPPMINFACIPNLDKLGYNPKLRFSY 967
            K  +TL D ++KY L L+ KE IS DT KFRF LPS  H+LGLP+GQH+YLS K++G +VVRPYTPV+          +   +  + +P +PDGG+MSQYL+ M IGD ID RGP+GLL+Y+G G F IRA+KKS P ++  + V MIAGGTGITPMLQLIR + +DP D TK +L++ NQTE DILLR+EL+D++  HP +  LWYT+D+  + W+YS+GF++  MIKD++ PP+ D +V +CGP PMI  AC+PNL+KLG+  +  FSY
Sbjct:   40 KGPITLQDPTLKYRLPLISKEEISEDTKKFRFGLPSSFHVLGLPVGQHVYLSAKVNGALVVRPYTPVS----------LSSNHHHSTHPTYPDGGQMSQYLDKMSIGDTIDFRGPNGLLVYQGNGRFSIRANKKSEPKVRRFRHVGMIAGGTGITPMLQLIRKITSDPKDTTKCSLIFGNQTEKDILLREELDDVQKNHPDQVKLWYTLDKPPQGWKYSSGFVTFDMIKDNIPPPSSDLLVVLCGPAPMIQNACLPNLEKLGHAQENIFSY 300          
BLAST of NADH-cytochrome b5 reductase vs. Ensembl Medaka
Match: cyb5r3 (NADH-cytochrome b5 reductase 3-like [Source:NCBI gene;Acc:101175543])

HSP 1 Score: 276.944 bits (707), Expect = 3.273e-91
Identity = 138/229 (60.26%), Postives = 182/229 (79.48%), Query Frame = 2
Query:  104 GVVAVSSVALYYIFSSKKKKVTLIDSSVKYPLKLVDKEIISHDTTKFRFMLPSPDHILGLPIGQHIYLSYKIDGQIVVRPYTPVTNDKVKGYMDLVIKVYRKNANPKFPDGGKMSQYLENMEIGDYIDVRGPSGLLIYKGKGSFHIRADKKSTPILQNVQKVNMIAGGTGITPMLQLIRAVFNDPNDNTKLNLLYANQTXXXXXXXXXXXXXXXKHPKRFSLWYTVDRS 790
            G+ +V ++     FS ++  +TL D ++KY L+L+DKEI+SHDT +FRF LPSP+H+LGLP+GQHIYLS KIDG++VVRPYTPV++D  KG +DLV+KVY K  NPKFP+GGKMSQYLE+++I D ID RGPSGLL+Y+G+G F ++ +KKS  + +  + V MIAGGTGITPMLQ+I A+  DP D T  +LL+ANQTE DILLR ELE+++ KHP RF LW+TVDR+
Sbjct:   12 GLDSVINLIFRLFFSKRRPAITLEDPNIKYALRLIDKEIVSHDTRRFRFALPSPEHVLGLPVGQHIYLSAKIDGKLVVRPYTPVSSDDDKGSVDLVVKVYFKGINPKFPEGGKMSQYLESLKINDTIDFRGPSGLLVYRGRGVFDVQPEKKSPAVKKTAKHVGMIAGGTGITPMLQIITAIMKDPQDPTVCHLLFANQTEKDILLRPELEEIQVKHPDRFRLWFTVDRA 240          
BLAST of NADH-cytochrome b5 reductase vs. Planmine SMEST
Match: SMESG000061572.1 (SMESG000061572.1)

HSP 1 Score: 318.546 bits (815), Expect = 1.320e-109
Identity = 168/168 (100.00%), Postives = 168/168 (100.00%), Query Frame = 2
Query:  464 MEIGDYIDVRGPSGLLIYKGKGSFHIRADKKSTPILQNVQKVNMIAGGTGITPMLQLIRAVFNDPNDNTKLNLLYANQTXXXXXXXXXXXXXXXKHPKRFSLWYTVDRSKENWQYSTGFISDAMIKDHMFPPADDTMVFMCGPPPMINFACIPNLDKLGYNPKLRFSY 967
            MEIGDYIDVRGPSGLLIYKGKGSFHIRADKKSTPILQNVQKVNMIAGGTGITPMLQLIRAVFNDPNDNTKLNLLYANQTEDDILLRDELEDLRDKHPKRFSLWYTVDRSKENWQYSTGFISDAMIKDHMFPPADDTMVFMCGPPPMINFACIPNLDKLGYNPKLRFSY
Sbjct:    1 MEIGDYIDVRGPSGLLIYKGKGSFHIRADKKSTPILQNVQKVNMIAGGTGITPMLQLIRAVFNDPNDNTKLNLLYANQTEDDILLRDELEDLRDKHPKRFSLWYTVDRSKENWQYSTGFISDAMIKDHMFPPADDTMVFMCGPPPMINFACIPNLDKLGYNPKLRFSY 168          
BLAST of NADH-cytochrome b5 reductase vs. Planmine SMEST
Match: SMESG000061572.1 (SMESG000061572.1)

HSP 1 Score: 232.261 bits (591), Expect = 2.190e-76
Identity = 125/125 (100.00%), Postives = 125/125 (100.00%), Query Frame = 2
Query:  593 MIAGGTGITPMLQLIRAVFNDPNDNTKLNLLYANQTXXXXXXXXXXXXXXXKHPKRFSLWYTVDRSKENWQYSTGFISDAMIKDHMFPPADDTMVFMCGPPPMINFACIPNLDKLGYNPKLRFSY 967
            MIAGGTGITPMLQLIRAVFNDPNDNTKLNLLYANQTEDDILLRDELEDLRDKHPKRFSLWYTVDRSKENWQYSTGFISDAMIKDHMFPPADDTMVFMCGPPPMINFACIPNLDKLGYNPKLRFSY
Sbjct:    1 MIAGGTGITPMLQLIRAVFNDPNDNTKLNLLYANQTEDDILLRDELEDLRDKHPKRFSLWYTVDRSKENWQYSTGFISDAMIKDHMFPPADDTMVFMCGPPPMINFACIPNLDKLGYNPKLRFSY 125          
BLAST of NADH-cytochrome b5 reductase vs. Planmine SMEST
Match: SMESG000061559.1 (SMESG000061559.1)

HSP 1 Score: 226.868 bits (577), Expect = 5.611e-74
Identity = 116/125 (92.80%), Postives = 117/125 (93.60%), Query Frame = 2
Query:   59 MSTKALMVIPLAIGFGVVAVSSVALYYIFSSKKKKVTLIDSSVKYPLKLVDKEIISHDTTKFRFMLPSPDHILGLPIGQHIYLSYKIDGQIVVRPYTPVTNDKVKGYMDLVIKVYRKNANPKFPD 433
            MSTKALMVIPLAIGFGVVAVSSVALYYIFSSKKKKVTLIDSSVKYPLKLVDKEIISHDTTKFRFMLPSPDHILGLPIGQHIYLSYKIDGQIVVRPYTPVTNDKVKGYMDLVIKV       K+ D
Sbjct:    1 MSTKALMVIPLAIGFGVVAVSSVALYYIFSSKKKKVTLIDSSVKYPLKLVDKEIISHDTTKFRFMLPSPDHILGLPIGQHIYLSYKIDGQIVVRPYTPVTNDKVKGYMDLVIKVSENFIILKYLD 125          
BLAST of NADH-cytochrome b5 reductase vs. Planmine SMEST
Match: SMESG000061559.1 (SMESG000061559.1)

HSP 1 Score: 215.312 bits (547), Expect = 1.572e-69
Identity = 110/119 (92.44%), Postives = 111/119 (93.28%), Query Frame = 2
Query:   77 MVIPLAIGFGVVAVSSVALYYIFSSKKKKVTLIDSSVKYPLKLVDKEIISHDTTKFRFMLPSPDHILGLPIGQHIYLSYKIDGQIVVRPYTPVTNDKVKGYMDLVIKVYRKNANPKFPD 433
            MVIPLAIGFGVVAVSSVALYYIFSSKKKKVTLIDSSVKYPLKLVDKEIISHDTTKFRFMLPSPDHILGLPIGQHIYLSYKIDGQIVVRPYTPVTNDKVKGYMDLVIKV       K+ D
Sbjct:    1 MVIPLAIGFGVVAVSSVALYYIFSSKKKKVTLIDSSVKYPLKLVDKEIISHDTTKFRFMLPSPDHILGLPIGQHIYLSYKIDGQIVVRPYTPVTNDKVKGYMDLVIKVSENFIILKYLD 119          
BLAST of NADH-cytochrome b5 reductase vs. Planmine SMEST
Match: SMESG000051604.1 (SMESG000051604.1)

HSP 1 Score: 73.1738 bits (178), Expect = 7.221e-14
Identity = 58/213 (27.23%), Postives = 103/213 (48.36%), Query Frame = 2
Query:  275 LGLPIGQHIYLSYKIDGQIVVRPYTPVTND-------KVKGYMDLVIKVYRKNANPKFPDGGKMSQYLENMEIGDYIDVRGPSGLLIYKGKGSFHIRADKKSTPILQNVQKVNMIAGGTGITPMLQLIRAVFNDPNDNTKLNLLYANQTXXXXXXXXXXXXXXXKHPKRFSLWYTVDRSKENWQYSTGFISDAMIKDHMFPPADDTMVFMCGP 892
            +G+P+G H+ +   IDG  V RPYTPV          K K    L+IK Y           G +S ++ +++    + V  P+G   +K      + +     P   +++ +  IA G+GITPM++++ A  +  + N    LL+ N+T  DI+  +E   L   +P RFS  Y + +   +W+   G I++++I++ +     D    +CGP
Sbjct:  294 VGVPLGHHVIVQNIIDGYTVQRPYTPVCAISPDQNCYKSKKQFTLMIKSY---------PNGVLSSFMHSLDEDAPVMVSLPAGK--FKSPSWLFVDSLITKPPASSDIKSIVFIAAGSGITPMIRILLASLS--HGNIDCYLLFFNRTRFDIIYMNEFIALAQFYPTRFSASYILSQPDSDWKGFEGRITNSIIQNCLGDNLLDRFYMICGP 493          
The following BLAST results are available for this feature:
BLAST of NADH-cytochrome b5 reductase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CYB5R38.726e-12362.32cytochrome b5 reductase 3 [Source:HGNC Symbol;Acc:... [more]
CYB5R38.726e-12362.32cytochrome b5 reductase 3 [Source:HGNC Symbol;Acc:... [more]
CYB5R38.726e-12362.32cytochrome b5 reductase 3 [Source:HGNC Symbol;Acc:... [more]
CYB5R31.456e-12262.01cytochrome b5 reductase 3 [Source:HGNC Symbol;Acc:... [more]
CYB5R33.071e-12262.01cytochrome b5 reductase 3 [Source:HGNC Symbol;Acc:... [more]
back to top
BLAST of NADH-cytochrome b5 reductase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hpo-193.675e-12259.74NADH-cytochrome b5 reductase [Source:UniProtKB/Tr... [more]
hpo-193.675e-12259.74NADH-cytochrome b5 reductase [Source:UniProtKB/Tr... [more]
T05H4.42.885e-11257.53NADH-cytochrome b5 reductase [Source:UniProtKB/Tr... [more]
Y52B11A.31.067e-927.32pep chromosome:WBcel235:I:10972023:10980111:1 gene... [more]
Y52B11A.31.250e-927.72pep chromosome:WBcel235:I:10970493:10980111:1 gene... [more]
back to top
BLAST of NADH-cytochrome b5 reductase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG59461.025e-11053.42gene:FBgn0036211 transcript:FBtr0076079[more]
CG59461.085e-11053.42gene:FBgn0036211 transcript:FBtr0076078[more]
CG59461.085e-11053.42gene:FBgn0036211 transcript:FBtr0302136[more]
CG59462.902e-10750.49gene:FBgn0036211 transcript:FBtr0110869[more]
CG59463.640e-10750.49gene:FBgn0036211 transcript:FBtr0110868[more]
back to top
BLAST of NADH-cytochrome b5 reductase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cyb5r15.788e-12660.88cytochrome b5 reductase 1 [Source:ZFIN;Acc:ZDB-GEN... [more]
cyb5r11.197e-12362.01cytochrome b5 reductase 1 [Source:ZFIN;Acc:ZDB-GEN... [more]
cyb5r33.566e-12363.93cytochrome b5 reductase 3 [Source:ZFIN;Acc:ZDB-GEN... [more]
cyb5r22.782e-11054.72cytochrome b5 reductase 2 [Source:NCBI gene;Acc:75... [more]
cyb5r21.185e-10955.45cytochrome b5 reductase 2 [Source:NCBI gene;Acc:75... [more]
back to top
BLAST of NADH-cytochrome b5 reductase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cyb5r21.896e-12057.76cytochrome b5 reductase 2 [Source:NCBI gene;Acc:59... [more]
cyb5r21.896e-12057.76cytochrome b5 reductase 2 [Source:NCBI gene;Acc:59... [more]
cyb5r21.155e-11957.43cytochrome b5 reductase 2 [Source:NCBI gene;Acc:59... [more]
cyb5r22.684e-11958.25cytochrome b5 reductase 2 [Source:NCBI gene;Acc:59... [more]
cyb5r22.951e-11958.25cytochrome b5 reductase 2 [Source:NCBI gene;Acc:59... [more]
back to top
BLAST of NADH-cytochrome b5 reductase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Cyb5r37.615e-12161.23cytochrome b5 reductase 3 [Source:MGI Symbol;Acc:M... [more]
Cyb5r31.721e-12059.45cytochrome b5 reductase 3 [Source:MGI Symbol;Acc:M... [more]
Cyb5r13.739e-11457.55cytochrome b5 reductase 1 [Source:MGI Symbol;Acc:M... [more]
Cyb5r23.220e-10154.04cytochrome b5 reductase 2 [Source:MGI Symbol;Acc:M... [more]
Cyb5r25.868e-9751.04cytochrome b5 reductase 2 [Source:MGI Symbol;Acc:M... [more]
back to top
BLAST of NADH-cytochrome b5 reductase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P20070|NB5R3_RAT1.248e-12360.82NADH-cytochrome b5 reductase 3 OS=Rattus norvegicu... [more]
sp|P07514|NB5R3_BOVIN8.798e-12359.52NADH-cytochrome b5 reductase 3 OS=Bos taurus OX=99... [more]
sp|P00387|NB5R3_HUMAN6.992e-12262.01NADH-cytochrome b5 reductase 3 OS=Homo sapiens OX=... [more]
sp|Q60HG4|NB5R3_MACFA1.233e-12159.18NADH-cytochrome b5 reductase 3 OS=Macaca fascicula... [more]
sp|P83686|NB5R3_PIG1.887e-12162.31NADH-cytochrome b5 reductase 3 (Fragment) OS=Sus s... [more]
back to top
BLAST of NADH-cytochrome b5 reductase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3H9219.781e-13466.45NADH-cytochrome b5 reductase OS=Lingula unguis OX=... [more]
K1R6L51.015e-13365.80NADH-cytochrome b5 reductase OS=Crassostrea gigas ... [more]
A0A1S3HBR61.026e-13366.34NADH-cytochrome b5 reductase OS=Lingula unguis OX=... [more]
A0A0B7B2585.917e-13363.82NADH-cytochrome b5 reductase OS=Arion vulgaris OX=... [more]
A0A3S1A3M67.619e-13268.53NADH-cytochrome b5 reductase OS=Elysia chlorotica ... [more]
back to top
BLAST of NADH-cytochrome b5 reductase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cyb5r12.179e-12960.67NADH-cytochrome b5 reductase 3 [Source:NCBI gene;A... [more]
cyb5r11.048e-12860.47NADH-cytochrome b5 reductase 3 [Source:NCBI gene;A... [more]
cyb5r37.802e-12261.54NADH-cytochrome b5 reductase 3 [Source:NCBI gene;A... [more]
cyb5r24.811e-11456.39NADH-cytochrome b5 reductase 2-like [Source:NCBI g... [more]
cyb5r42.766e-2131.30cytochrome b5 reductase 4 [Source:NCBI gene;Acc:55... [more]
back to top
BLAST of NADH-cytochrome b5 reductase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
cyb5r18.434e-12659.26cytochrome b5 reductase 1 [Source:ZFIN;Acc:ZDB-GEN... [more]
ENSPMAT00000006153.11.799e-1526.82pep scaffold:Pmarinus_7.0:GL478151:4458:23451:1 ge... [more]
back to top
BLAST of NADH-cytochrome b5 reductase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 4
Match NameE-valueIdentityDescription
CBR12.305e-4037.39Cytochrome b reductase; not essential for viabilit... [more]
MCR15.156e-3632.28Mitochondrial NADH-cytochrome b5 reductase; involv... [more]
PGA34.533e-3532.65Putative cytochrome b5 reductase, localized to the... [more]
AIM339.403e-3031.28Protein of unknown function, highly conserved acro... [more]
back to top
BLAST of NADH-cytochrome b5 reductase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO398081.077e-10854.05Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO286001.527e-2329.87Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO264152.903e-627.63Predicted protein [Source:UniProtKB/TrEMBL;Acc:A8... [more]
back to top
BLAST of NADH-cytochrome b5 reductase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cyb5r34.835e-11654.19NADH-cytochrome b5 reductase 3-like [Source:NCBI g... [more]
cyb5r33.924e-10654.17NADH-cytochrome b5 reductase 3-like [Source:NCBI g... [more]
cyb5r27.675e-10356.99NADH-cytochrome b5 reductase 2 [Source:NCBI gene;A... [more]
cyb5r22.820e-9554.24NADH-cytochrome b5 reductase 2 [Source:NCBI gene;A... [more]
cyb5r33.273e-9160.26NADH-cytochrome b5 reductase 3-like [Source:NCBI g... [more]
back to top
BLAST of NADH-cytochrome b5 reductase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000061572.11.320e-109100.00SMESG000061572.1[more]
SMESG000061572.12.190e-76100.00SMESG000061572.1[more]
SMESG000061559.15.611e-7492.80SMESG000061559.1[more]
SMESG000061559.11.572e-6992.44SMESG000061559.1[more]
SMESG000051604.17.221e-1427.23SMESG000051604.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30009541 ID=SMED30009541|Name=NADH-cytochrome b5 reductase|organism=Schmidtea mediterranea sexual|type=transcript|length=1136bp
CTAATTACAAAATTTAATATATAATTTTAAAAATCTTTGTTGAATTTCAT
AATATTGCATGTCAACGAAAGCTTTAATGGTTATACCTCTTGCTATTGGT
TTTGGAGTTGTTGCTGTATCATCCGTAGCTTTGTATTATATTTTTTCGAG
CAAAAAGAAAAAAGTTACTTTAATTGATTCATCCGTCAAATATCCTTTAA
AGTTAGTAGACAAAGAAATAATTAGTCATGATACAACAAAGTTTCGTTTT
ATGTTACCGTCACCAGATCACATTTTAGGATTGCCAATAGGGCAGCACAT
TTACTTGAGCTACAAAATTGACGGCCAGATCGTTGTCAGGCCATACACCC
CCGTCACAAATGATAAAGTCAAGGGTTACATGGATTTGGTTATTAAAGTC
TATCGAAAAAACGCAAACCCAAAATTTCCAGATGGCGGGAAAATGAGTCA
GTATTTAGAGAACATGGAAATCGGGGATTATATTGATGTCCGGGGGCCAT
CTGGATTGTTAATTTATAAAGGCAAAGGAAGCTTTCATATTCGAGCAGAC
AAGAAAAGCACTCCCATTCTTCAGAATGTCCAAAAAGTCAATATGATTGC
AGGGGGGACAGGAATTACACCGATGCTTCAGTTAATTCGTGCAGTTTTTA
ATGACCCTAATGATAACACTAAGTTGAATCTTCTTTACGCAAATCAGACT
GAAGACGACATTTTATTACGAGATGAGCTAGAAGACCTCAGAGACAAACA
TCCGAAACGGTTTAGTCTATGGTACACGGTTGATAGATCCAAAGAAAATT
GGCAATACAGCACCGGATTCATTAGTGATGCAATGATCAAGGACCATATG
TTCCCTCCAGCTGACGACACTATGGTGTTTATGTGTGGCCCTCCTCCAAT
GATCAATTTTGCCTGCATTCCCAATCTCGACAAACTAGGATACAATCCGA
AATTGCGGTTCTCATATTAAAATATCAAATAGAATTCGATTTTCGCTTTC
AGCTTACTATTATTTGATAGGGCAGGCTTAATTATATTTTATGCTCATTT
AGCTCACGATGTTTCGATTTTTTGATAAGGCTTCATACCGGTCTATGTTA
TATTTGCTTAGTAAATTTTGATAGTTTGAAAAAAAA
back to top

protein sequence of SMED30009541-orf-1

>SMED30009541-orf-1 ID=SMED30009541-orf-1|Name=SMED30009541-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=304bp
MSTKALMVIPLAIGFGVVAVSSVALYYIFSSKKKKVTLIDSSVKYPLKLV
DKEIISHDTTKFRFMLPSPDHILGLPIGQHIYLSYKIDGQIVVRPYTPVT
NDKVKGYMDLVIKVYRKNANPKFPDGGKMSQYLENMEIGDYIDVRGPSGL
LIYKGKGSFHIRADKKSTPILQNVQKVNMIAGGTGITPMLQLIRAVFNDP
NDNTKLNLLYANQTEDDILLRDELEDLRDKHPKRFSLWYTVDRSKENWQY
STGFISDAMIKDHMFPPADDTMVFMCGPPPMINFACIPNLDKLGYNPKLR
FSY*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000101muscle cell
PLANA:0000142posterior region of the whole animal
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR039261FNR_nucleotide-bd
IPR001834CBR-like
IPR001709Flavoprot_Pyr_Nucl_cyt_Rdtase
IPR001433OxRdtase_FAD/NAD-bd
IPR008333Cbr1-like_FAD-bd_dom
IPR017927FAD-bd_FR_type
IPR017938Riboflavin_synthase-like_b-brl
Vocabulary: biological process
TermDefinition
GO:0055114oxidation-reduction process
Vocabulary: molecular function
TermDefinition
GO:0016491oxidoreductase activity
GO:0004128cytochrome-b5 reductase activity, acting on NAD(P)H
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001709Flavoprotein pyridine nucleotide cytochrome reductasePRINTSPR00371FPNCRcoord: 178..197
score: 39.54
coord: 216..227
score: 41.48
coord: 248..264
score: 17.78
coord: 272..280
score: 33.72
IPR001834NADH:cytochrome b5 reductase-likePRINTSPR00406CYTB5RDTASEcoord: 272..280
score: 55.32
coord: 216..227
score: 61.81
coord: 139..153
score: 45.69
coord: 178..197
score: 60.21
coord: 73..84
score: 62.5
coord: 94..101
score: 51.56
NoneNo IPR availableGENE3DG3DSA:2.40.30.10coord: 34..147
e-value: 1.9E-41
score: 142.6
NoneNo IPR availablePANTHERPTHR19370NADH-CYTOCHROME B5 REDUCTASEcoord: 12..303
NoneNo IPR availablePANTHERPTHR19370:SF74NADH-CYTOCHROME B5 REDUCTASE 1coord: 12..303
NoneNo IPR availableCDDcd06183cyt_b5_reduct_likecoord: 47..303
e-value: 8.60574E-120
score: 341.469
NoneNo IPR availableTMHMMTMhelixcoord: 7..29
IPR001433Oxidoreductase FAD/NAD(P)-bindingPFAMPF00175NAD_binding_1coord: 179..286
e-value: 1.1E-35
score: 122.5
IPR008333Flavoprotein pyridine nucleotide cytochrome reductase-like, FAD-binding domainPFAMPF00970FAD_binding_6coord: 47..153
e-value: 6.9E-33
score: 112.9
IPR039261Ferredoxin-NADP reductase (FNR), nucleotide-binding domainGENE3DG3DSA:3.40.50.80coord: 149..303
e-value: 5.7E-51
score: 174.2
IPR039261Ferredoxin-NADP reductase (FNR), nucleotide-binding domainSUPERFAMILYSSF52343Ferredoxin reductase-like, C-terminal NADP-linked domaincoord: 140..298
IPR017927FAD-binding domain, ferredoxin reductase-typePROSITEPS51384FAD_FRcoord: 42..154
score: 15.039
IPR017938Riboflavin synthase-like beta-barrelSUPERFAMILYSSF63380Riboflavin synthase domain-likecoord: 37..155