Cysteine and histidine-rich protein 1

Overview
NameCysteine and histidine-rich protein 1
Smed IDSMED30009538
Length (bp)1189
Neoblast Clusters

Zeng et. al., 2018




 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30009538

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
reproductive organSMED30009538SMESG000001532.1 Contig51422newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30009538SMESG000001532.1 Contig51422uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
testisSMED30009538SMESG000001532.1 PL06004B1E04ncbi_smed_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
testis primordiumSMED30009538SMESG000001532.1 Contig3922_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism juvenile cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Cysteine and histidine-rich protein 1 vs. Ensembl Human
Match: CYHR1 (cysteine and histidine rich 1 [Source:HGNC Symbol;Acc:HGNC:17806])

HSP 1 Score: 82.4185 bits (202), Expect = 1.172e-16
Identity = 64/221 (28.96%), Postives = 99/221 (44.80%), Query Frame = 2
Query:  212 IKNIVACSACF-LSLIPMKECSNGHLICQSCYLILR-----QFERPQCPVCRIGL-HSEPKKGLVAEKIMSELPESCIHCGIVLCRKDLNNHQLSDCPKRRVNCNYCHLGCTWIGNAEESFSHHLQCKVSKDTS--ISEIADYVARKEQSWNEIFQSFFSVL--RRLESTDPQYRTVALSFIKSTSDTFT---FRSDQFHCNQSRWSLEVRFYQINDSEEN 832
            + +++ C+ C  L    + +C+NGHL+C  C++ L      + E+  CP CR  +  S   + L  EK +SELP  C  C     R  L  HQ  +C  R   C Y  +GC W G   E   H   C     T   + EI D + +  +   +++ S FS+L   ++  T+ Q+R         T D  T   + + +F      W L+ R   +NDSE N
Sbjct:  105 LYSVLCCTVCLDLPKASVYQCTNGHLMCAGCFIHLLADARLKEEQATCPNCRCEISKSLCCRNLAVEKAVSELPSECGFCLRQFPRSLLERHQKEECQDRVTQCKYKRIGCPWHGPFHELTVHEAACAHPTKTGSELMEILDGMDQSHRKEMQLYNSIFSLLSFEKIGYTEVQFRPY------RTDDFITRLYYETPRFTVLNQTWVLKAR---VNDSERN 316          
BLAST of Cysteine and histidine-rich protein 1 vs. Ensembl Human
Match: CYHR1 (cysteine and histidine rich 1 [Source:HGNC Symbol;Acc:HGNC:17806])

HSP 1 Score: 79.337 bits (194), Expect = 2.521e-16
Identity = 62/208 (29.81%), Postives = 92/208 (44.23%), Query Frame = 2
Query:  248 SLIPMKECSNGHLICQSCYLILR-----QFERPQCPVCRIGL-HSEPKKGLVAEKIMSELPESCIHCGIVLCRKDLNNHQLSDCPKRRVNCNYCHLGCTWIGNAEESFSHHLQCKVSKDTS--ISEIADYVARKEQSWNEIFQSFFSVL--RRLESTDPQYRTVALSFIKSTSDTFT---FRSDQFHCNQSRWSLEVRFYQINDSEEN 832
            + +   EC+NGHL+C  C++ L      + E+  CP CR  +  S   + L  EK +SELP  C  C     R  L  HQ  +C  R   C Y  +GC W G   E   H   C     T   + EI D + +  +   +++ S FS+L   ++  T+ Q+R         T D  T   + + +F      W L+ R   +NDSE N
Sbjct:   25 AAVSTAECTNGHLMCAGCFIHLLADARLKEEQATCPNCRCEISKSLCCRNLAVEKAVSELPSECGFCLRQFPRSLLERHQKEECQDRVTQCKYKRIGCPWHGPFHELTVHEAACAHPTKTGSELMEILDGMDQSHRKEMQLYNSIFSLLSFEKIGYTEVQFRPY------RTDDFITRLYYETPRFTVLNQTWVLKAR---VNDSERN 223          
BLAST of Cysteine and histidine-rich protein 1 vs. Ensembl Human
Match: CYHR1 (cysteine and histidine rich 1 [Source:HGNC Symbol;Acc:HGNC:17806])

HSP 1 Score: 78.9518 bits (193), Expect = 1.420e-15
Identity = 61/201 (30.35%), Postives = 89/201 (44.28%), Query Frame = 2
Query:  269 CSNGHLICQSCYLILR-----QFERPQCPVCRIGL-HSEPKKGLVAEKIMSELPESCIHCGIVLCRKDLNNHQLSDCPKRRVNCNYCHLGCTWIGNAEESFSHHLQCKVSKDTS--ISEIADYVARKEQSWNEIFQSFFSVL--RRLESTDPQYRTVALSFIKSTSDTFT---FRSDQFHCNQSRWSLEVRFYQINDSEEN 832
            C+NGHL+C  C++ L      + E+  CP CR  +  S   + L  EK +SELP  C  C     R  L  HQ  +C  R   C Y  +GC W G   E   H   C     T   + EI D + +  +   +++ S FS+L   ++  T+ Q+R         T D  T   + + +F      W L+ R   +NDSE N
Sbjct:   83 CTNGHLMCAGCFIHLLADARLKEEQATCPNCRCEISKSLCCRNLAVEKAVSELPSECGFCLRQFPRSLLERHQKEECQDRVTQCKYKRIGCPWHGPFHELTVHEAACAHPTKTGSELMEILDGMDQSHRKEMQLYNSIFSLLSFEKIGYTEVQFRPY------RTDDFITRLYYETPRFTVLNQTWVLKAR---VNDSERN 274          
BLAST of Cysteine and histidine-rich protein 1 vs. Ensembl Fly
Match: CG32486 (gene:FBgn0266918 transcript:FBtr0073004)

HSP 1 Score: 73.1738 bits (178), Expect = 7.366e-14
Identity = 42/127 (33.07%), Postives = 56/127 (44.09%), Query Frame = 2
Query:  212 IKNIVACSACF-LSLIPMKECSNGHLICQSCYLILRQFER-----PQCPVCRIGL-HSEPKKGLVAEKIMSELPESCIHCGIVLCRKDLNNHQLSDCPKRRVNCNYCHLGCTWIGNAEESFSHHLQC 571
            I N + C+ C  L    M +C  GHL+C +C+  L    R       CP CR+ +  S   + L  EK  SELP  C  C      K L  H+  +C +R   C Y  +GC W G   E+  H   C
Sbjct:  107 ISNALCCAVCLDLPKTAMYQCQMGHLMCAACFTHLLADGRLRDQIATCPNCRVEISKSTASRNLAVEKAASELPSECQFCNKEFPYKSLERHEQHECQERPTKCKYHRIGCQWRGPYHETNEHERNC 233          
BLAST of Cysteine and histidine-rich protein 1 vs. Ensembl Fly
Match: sinah (gene:FBgn0259794 transcript:FBtr0301683)

HSP 1 Score: 51.6026 bits (122), Expect = 6.408e-7
Identity = 36/118 (30.51%), Postives = 54/118 (45.76%), Query Frame = 2
Query:  221 IVACSACFLSLIP-MKECSNGHLICQSCYLILRQFERPQCPVCRIGLHSEPKKGLVAEKIMSELPESCIH----CGIVLCRKDLNNHQLSDCPKRRVNCNYCHLGCTWIGNAEESFSH 559
            ++ C  CF  ++P + +C  GHLIC +C   L       CPVCR+ + +   + L  EK+ S+L   C H    C   L   +   H+  DC  R   C Y    C+W G   + + H
Sbjct:  103 LLECPVCFGYIMPPIMQCPRGHLICSTCRSKLT-----ICPVCRVFMTN--IRSLAMEKVASKLIFPCKHSHFGCRARLSYAEKTKHE-EDCECRPYFCPYPDDKCSWQGPLRDVYQH 212          
BLAST of Cysteine and histidine-rich protein 1 vs. Ensembl Zebrafish
Match: cyhr1 (cysteine/histidine-rich 1 [Source:NCBI gene;Acc:767773])

HSP 1 Score: 84.3445 bits (207), Expect = 1.566e-17
Identity = 73/280 (26.07%), Postives = 125/280 (44.64%), Query Frame = 2
Query:  218 NIVACSACF-LSLIPMKECSNGHLICQSCYLILR-----QFERPQCPVCRIGL-HSEPKKGLVAEKIMSELPESCIHCGIVLCRKDLNNHQLSDCPKRRVNCNYCHLGCTWIGNAEESFSHHLQCKVSKDTSIS--EIADYVARKEQSWNEIFQSFFSVL--RRLESTDPQYRTVALSFIKSTSDTFT---FRSDQFHCNQSRWSLEVRFYQINDSEEN---YVSDDIGYRFTKENGVGNSRRHYGFVLMSIKTDDNVKVYLRPQLNFTKFTIRGQVTEF 1006
            +++ C+ C  L    + +C+NGHL+C  C++ L      + E+  CP CR  +  S   + L  EK +SELP  C +C     R  L+ HQ  +C  R   C Y  +GC W G   E  +H  +C     T +    I D + +  +   +++ S FS+L   ++  T+ Q+R         T D  T   + + +F      W L+ R   +NDSE N        + ++   ++ V NS     F+L+    +D   + ++P +    F+     TE+
Sbjct:   85 SVLCCTVCLDLPKASVYQCTNGHLMCAGCFIHLLADSRLKEEQATCPNCRCEISKSLCCRNLAVEKAVSELPSECSYCLKQFPRSGLDRHQTEECQDRVTQCKYKRIGCPWQGPFHELSAHEAECCHPSKTGMELMGILDEMDQSHRRELQLYNSIFSLLCFEKIGFTEVQFRPY------RTDDFITRLYYETPRFTVLNQTWVLKAR---VNDSERNPNLSCKRTLAFQLILKSKV-NSALECSFLLLKGPYED---IKIKPVIQHHVFSNDANETEY 351          
BLAST of Cysteine and histidine-rich protein 1 vs. Ensembl Xenopus
Match: cntn2 (contactin 2 [Source:Xenbase;Acc:XB-GENE-6070188])

HSP 1 Score: 79.337 bits (194), Expect = 5.474e-16
Identity = 73/262 (27.86%), Postives = 112/262 (42.75%), Query Frame = 2
Query:  269 CSNGHLICQSCYLILR-----QFERPQCPVCRIGL-HSEPKKGLVAEKIMSELPESCIHCGIVLCRKDLNNHQLSDCPKRRVNCNYCHLGCTWIGNAEESFSHHLQC--KVSKDTSISEIADYVARKEQSWNEIFQSFFSVL--RRLESTDPQYRTVALSFIKSTSDTFT---FRSDQFHCNQSRWSLEVRFYQINDSEEN---YVSDDIGYRFTKENGVGNSRRHYGFVLMSIKTDDNVKVYLRPQLNFTKFTIRGQVTEF 1006
            C+NGHL+C  C++ L      + E+  CP CR  +  S   + L  EK +SELP  C  C     R  L  H+  +C  R   C Y  +GC W G   E   H  +C         + EI D + +  +   +++ S FS+L   ++  T+ Q+R         T D  T   + + +F      W L+ R   INDSE N        + ++   ++ V NS     F+L+    DD   V + P +    FT     TE+
Sbjct:   30 CTNGHLMCAGCFIHLLADARLKEEQATCPNCRCEISKSLCCRNLAVEKAVSELPSECGFCLKQFPRSLLERHKKDECQDRVTQCKYKRIGCPWQGPFHELTVHESECCHPTKTGNELMEILDEMDQTHKKEMQLYNSIFSLLSFEKIGYTEVQFRPY------RTDDFITRLYYETPRFTVLNQTWVLKAR---INDSERNPNLSCKRTLSFQLILKSKV-NSPMECSFLLLKGPYDD---VKIHPVIYHFVFTNENNETEY 278          
BLAST of Cysteine and histidine-rich protein 1 vs. Ensembl Mouse
Match: Cyhr1 (cysteine and histidine rich 1 [Source:MGI Symbol;Acc:MGI:1859320])

HSP 1 Score: 79.7221 bits (195), Expect = 3.748e-16
Identity = 62/220 (28.18%), Postives = 96/220 (43.64%), Query Frame = 2
Query:  212 IKNIVACSACFLSLIPMKECSNGHLICQSCYLILR-----QFERPQCPVCRIGL-HSEPKKGLVAEKIMSELPESCIHCGIVLCRKDLNNHQLSDCPKRRVNCNYCHLGCTWIGNAEESFSHHLQCKVSKDTS--ISEIADYVARKEQSWNEIFQSFFSVL--RRLESTDPQYRTVALSFIKSTSDTFT---FRSDQFHCNQSRWSLEVRFYQINDSEEN 832
            + ++V       + +   +C+NGHL+C  C++ L      + E+  CP CR  +  S   + L  EK +SELP  C  C     R  L  HQ  +C  R   C Y  +GC W G   E   H   C     T   + EI D + +  +   +++ S FS+L   ++  T+ Q+R         T D  T   + + +F      W L+ R   +NDSE N
Sbjct:   13 LSHLVLAGVSLHAAVSSVQCTNGHLMCAGCFIHLLADARLKEEQATCPNCRCEISKSLCCRNLAVEKAVSELPSECGFCLRQFPRSLLERHQKEECQDRVTQCKYKRIGCPWHGPFHELTVHEAACAHPTKTGNELMEILDEMDQSHRKEMQLYNSIFSLLSFEKIGYTEVQFRPY------RTDDFITRLYYETPRFTVLNQTWVLKAR---VNDSERN 223          
BLAST of Cysteine and histidine-rich protein 1 vs. Ensembl Mouse
Match: Cyhr1 (cysteine and histidine rich 1 [Source:MGI Symbol;Acc:MGI:1859320])

HSP 1 Score: 71.633 bits (174), Expect = 1.282e-13
Identity = 49/160 (30.63%), Postives = 74/160 (46.25%), Query Frame = 2
Query:  218 NIVACSACF-LSLIPMKECSNGHLICQSCYLILR-----QFERPQCPVCRIGL-HSEPKKGLVAEKIMSELPESCIHCGIVLCRKDLNNHQLSDCPKRRVNCNYCHLGCTWIGNAEESFSHHLQCKVSKDTS--ISEIADYVARKEQSWNEIFQSFFSVL 670
            +++ C+ C  L    + +C+NGHL+C  C++ L      + E+  CP CR  +  S   + L  EK +SELP  C  C     R  L  HQ  +C  R   C Y  +GC W G   E   H   C     T   + EI D + +  +   +++ S FS+L
Sbjct:  102 SVLCCTVCLDLPKASVYQCTNGHLMCAGCFIHLLADARLKEEQATCPNCRCEISKSLCCRNLAVEKAVSELPSECGFCLRQFPRSLLERHQKEECQDRVTQCKYKRIGCPWHGPFHELTVHEAACAHPTKTGNELMEILDEMDQSHRKEMQLYNSIFSLL 261          
BLAST of Cysteine and histidine-rich protein 1 vs. Ensembl Mouse
Match: Cyhr1 (cysteine and histidine rich 1 [Source:MGI Symbol;Acc:MGI:1859320])

HSP 1 Score: 71.2478 bits (173), Expect = 4.423e-13
Identity = 49/160 (30.63%), Postives = 74/160 (46.25%), Query Frame = 2
Query:  218 NIVACSACF-LSLIPMKECSNGHLICQSCYLILR-----QFERPQCPVCRIGL-HSEPKKGLVAEKIMSELPESCIHCGIVLCRKDLNNHQLSDCPKRRVNCNYCHLGCTWIGNAEESFSHHLQCKVSKDTS--ISEIADYVARKEQSWNEIFQSFFSVL 670
            +++ C+ C  L    + +C+NGHL+C  C++ L      + E+  CP CR  +  S   + L  EK +SELP  C  C     R  L  HQ  +C  R   C Y  +GC W G   E   H   C     T   + EI D + +  +   +++ S FS+L
Sbjct:  102 SVLCCTVCLDLPKASVYQCTNGHLMCAGCFIHLLADARLKEEQATCPNCRCEISKSLCCRNLAVEKAVSELPSECGFCLRQFPRSLLERHQKEECQDRVTQCKYKRIGCPWHGPFHELTVHEAACAHPTKTGNELMEILDEMDQSHRKEMQLYNSIFSLL 261          
BLAST of Cysteine and histidine-rich protein 1 vs. UniProt/SwissProt
Match: sp|Q08CH8|CYHR1_DANRE (Cysteine and histidine-rich protein 1 OS=Danio rerio OX=7955 GN=cyhr1 PE=2 SV=1)

HSP 1 Score: 84.3445 bits (207), Expect = 1.185e-16
Identity = 73/280 (26.07%), Postives = 125/280 (44.64%), Query Frame = 2
Query:  218 NIVACSACF-LSLIPMKECSNGHLICQSCYLILR-----QFERPQCPVCRIGL-HSEPKKGLVAEKIMSELPESCIHCGIVLCRKDLNNHQLSDCPKRRVNCNYCHLGCTWIGNAEESFSHHLQCKVSKDTSIS--EIADYVARKEQSWNEIFQSFFSVL--RRLESTDPQYRTVALSFIKSTSDTFT---FRSDQFHCNQSRWSLEVRFYQINDSEEN---YVSDDIGYRFTKENGVGNSRRHYGFVLMSIKTDDNVKVYLRPQLNFTKFTIRGQVTEF 1006
            +++ C+ C  L    + +C+NGHL+C  C++ L      + E+  CP CR  +  S   + L  EK +SELP  C +C     R  L+ HQ  +C  R   C Y  +GC W G   E  +H  +C     T +    I D + +  +   +++ S FS+L   ++  T+ Q+R         T D  T   + + +F      W L+ R   +NDSE N        + ++   ++ V NS     F+L+    +D   + ++P +    F+     TE+
Sbjct:   78 SVLCCTVCLDLPKASVYQCTNGHLMCAGCFIHLLADSRLKEEQATCPNCRCEISKSLCCRNLAVEKAVSELPSECSYCLKQFPRSGLDRHQTEECQDRVTQCKYKRIGCPWQGPFHELSAHEAECCHPSKTGMELMGILDEMDQSHRRELQLYNSIFSLLCFEKIGFTEVQFRPY------RTDDFITRLYYETPRFTVLNQTWVLKAR---VNDSERNPNLSCKRTLAFQLILKSKV-NSALECSFLLLKGPYED---IKIKPVIQHHVFSNDANETEY 344          
BLAST of Cysteine and histidine-rich protein 1 vs. UniProt/SwissProt
Match: sp|Q2TAD9|CYR1B_XENLA (Cysteine and histidine-rich protein 1-B OS=Xenopus laevis OX=8355 GN=cyhr1-b PE=2 SV=2)

HSP 1 Score: 82.4185 bits (202), Expect = 5.130e-16
Identity = 75/280 (26.79%), Postives = 121/280 (43.21%), Query Frame = 2
Query:  218 NIVACSACF-LSLIPMKECSNGHLICQSCYLILR-----QFERPQCPVCRIGL-HSEPKKGLVAEKIMSELPESCIHCGIVLCRKDLNNHQLSDCPKRRVNCNYCHLGCTWIGNAEESFSHHLQC--KVSKDTSISEIADYVARKEQSWNEIFQSFFSVL--RRLESTDPQYRTVALSFIKSTSDTFT---FRSDQFHCNQSRWSLEVRFYQINDSEEN---YVSDDIGYRFTKENGVGNSRRHYGFVLMSIKTDDNVKVYLRPQLNFTKFTIRGQVTEF 1006
            +++ C+ C  L    + +C+NGHL+C  C++ L      + E+  CP CR  +  S   + L  EK +SELP  C  C     R  L  H+  +C  R   C Y  +GC W G   E   H  +C         + EI D + +  +   +++ S FS+L   ++  T+ Q+R         T D  T   + + +F      W L+ R   +NDSE N        + ++   ++ V NS     F+L+    DD   V + P +    FT     TE+
Sbjct:   68 SVLCCAVCLDLPKASVYQCTNGHLMCAGCFIHLLADARLKEEQATCPNCRCEISKSLCCRNLAVEKAISELPSDCGFCLKQFPRSLLERHKKEECQDRVTQCKYKRIGCPWQGPYHELTVHESECCHPTKTGNELMEILDEMDQTHKKEMQLYNSIFSLLSFEKIGYTEVQFRPY------RTDDFITRLYYETPRFTVLNQTWVLKAR---VNDSERNPNLSCKRTLSFQLILKSKV-NSPMECSFLLLKGPYDD---VKIHPVIYQFVFTNENNETEY 334          
BLAST of Cysteine and histidine-rich protein 1 vs. UniProt/SwissProt
Match: sp|Q6GNX1|CYR1A_XENLA (Cysteine and histidine-rich protein 1-A OS=Xenopus laevis OX=8355 GN=cyhr1-a PE=2 SV=2)

HSP 1 Score: 82.4185 bits (202), Expect = 5.178e-16
Identity = 74/280 (26.43%), Postives = 121/280 (43.21%), Query Frame = 2
Query:  218 NIVACSACF-LSLIPMKECSNGHLICQSCYLILR-----QFERPQCPVCRIGL-HSEPKKGLVAEKIMSELPESCIHCGIVLCRKDLNNHQLSDCPKRRVNCNYCHLGCTWIGNAEESFSHHLQC--KVSKDTSISEIADYVARKEQSWNEIFQSFFSVL--RRLESTDPQYRTVALSFIKSTSDTFT---FRSDQFHCNQSRWSLEVRFYQINDSEEN---YVSDDIGYRFTKENGVGNSRRHYGFVLMSIKTDDNVKVYLRPQLNFTKFTIRGQVTEF 1006
            +++ C+ C  L    + +C+NGHL+C  C++ L      + E+  CP CR  +  S   + L  EK +SELP  C  C     R  L  H+  +C  R   C Y  +GC W G   E   H  +C         + EI D + +  +   +++ S FS+L   ++  T+ Q+R         T D  T   + + +F      W L+ R   +NDSE N        + ++   ++ + NS     F+L+    DD   V + P +    FT     TE+
Sbjct:   68 SVLCCTVCLDLPKASVYQCTNGHLMCAGCFIHLLADSRLKEEQATCPNCRCEISKSLCCRNLAVEKAVSELPSDCGFCLKQFPRSLLERHKKEECQDRVTQCKYKRIGCPWEGPYHELTVHESECCHPTKTGNELMEILDEMDQTHKKEMQLYNSIFSLLSFEKIGYTEVQFRPY------RTDDFITRLYYETPRFTVLNQTWVLKAR---VNDSERNPNLSCKRTLSFQLILKSKI-NSPMECSFLLLKGPYDD---VKIHPVIYHFVFTNENNETEY 334          
BLAST of Cysteine and histidine-rich protein 1 vs. UniProt/SwissProt
Match: sp|Q7YR89|CYHR1_BOVIN (Cysteine and histidine-rich protein 1 OS=Bos taurus OX=9913 GN=CYHR1 PE=2 SV=2)

HSP 1 Score: 80.1073 bits (196), Expect = 1.745e-15
Identity = 61/202 (30.20%), Postives = 90/202 (44.55%), Query Frame = 2
Query:  266 ECSNGHLICQSCYLILR-----QFERPQCPVCRIGL-HSEPKKGLVAEKIMSELPESCIHCGIVLCRKDLNNHQLSDCPKRRVNCNYCHLGCTWIGNAEESFSHHLQCKVSKDTS--ISEIADYVARKEQSWNEIFQSFFSVL--RRLESTDPQYRTVALSFIKSTSDTFT---FRSDQFHCNQSRWSLEVRFYQINDSEEN 832
            +C+NGHL+C  C++ L      + E+  CP CR  +  S   + L  EK +SELP  C  C     R  L  HQ  +C  R   C Y  +GC W G   E   H   C     T   + EI D + +  +   +++ S FS+L   ++  T+ Q+R         T D  T   + + +F      W L+ R   +NDSE N
Sbjct:   31 QCTNGHLMCAGCFIHLLADARLKEEQATCPNCRCEISKSLCCRNLAVEKAVSELPSECGFCLCQFPRSILERHQKEECQDRVTQCKYKRIGCPWHGPFHELTVHEAACAHPTKTGNELMEILDEMDQSHRKEMQLYNSIFSLLSFEKIGYTEVQFRPY------RTDDFITRLYYETPRFTVLNQTWVLKAR---VNDSERN 223          
BLAST of Cysteine and histidine-rich protein 1 vs. UniProt/SwissProt
Match: sp|Q5BK76|CYHR1_RAT (Cysteine and histidine-rich protein 1 OS=Rattus norvegicus OX=10116 GN=Cyhr1 PE=2 SV=2)

HSP 1 Score: 80.1073 bits (196), Expect = 1.830e-15
Identity = 62/221 (28.05%), Postives = 97/221 (43.89%), Query Frame = 2
Query:  209 SIKNIVACSACFLSLIPMKECSNGHLICQSCYLILR-----QFERPQCPVCRIGL-HSEPKKGLVAEKIMSELPESCIHCGIVLCRKDLNNHQLSDCPKRRVNCNYCHLGCTWIGNAEESFSHHLQCKVSKDTS--ISEIADYVARKEQSWNEIFQSFFSVL--RRLESTDPQYRTVALSFIKSTSDTFT---FRSDQFHCNQSRWSLEVRFYQINDSEEN 832
            ++ ++V       + +   +C+NGHL+C  C++ L      + E+  CP CR  +  S   + L  EK +SELP  C  C     R  L  HQ  +C  R   C Y  +GC W G   E   H   C     T   + EI D + +  +   +++ S FS+L   ++  T+ Q+R         T D  T   + + +F      W L+ R   +NDSE N
Sbjct:   12 ALSHLVLAGVSLHAAVSSVQCTNGHLMCAGCFIHLLADARLKEEQATCPNCRCEISKSLCCRNLAVEKAVSELPSECGFCLRQFPRSLLERHQKEECQDRVTQCKYKRIGCPWHGPFHELTVHEAACAHPTKTGNELMEILDEMDQSHRKEMQLYNSIFSLLSFEKIGYTEVQFRPY------RTDDFITRLYYETPRFTVLNQTWVLKAR---VNDSERN 223          
BLAST of Cysteine and histidine-rich protein 1 vs. TrEMBL
Match: A0A1W6I183 (Cysteine/histidine-rich 1b (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 553.132 bits (1424), Expect = 0.000e+0
Identity = 268/272 (98.53%), Postives = 269/272 (98.90%), Query Frame = 2
Query:   23 TDLALELNNAEQSSVDDLSSGNFNLSSKQIPLECPQKISNDSIIVNNFNFGNDIDYLKQVLLSIKNIVACSACFLSLIPMKECSNGHLICQSCYLILRQFERPQCPVCRIGLHSEPKKGLVAEKIMSELPESCIHCGIVLCRKDLNNHQLSDCPKRRVNCNYCHLGCTWIGNAEESFSHHLQCKVSKDTSISEIADYVARKEQSWNEIFQSFFSVLRRLESTDPQYRTVALSFIKSTSDTFTFRSDQFHCNQSRWSLEVRFYQINDSEENYV 838
            TDLALELNNAEQSSVDDLSSGNFNLSSKQIPLECPQKISNDSIIVNNFNFGNDIDYLKQVLLSIKNIVACSACFLSLIPMKECSNGHLICQSCYLILRQFERPQCPVCRIGLHSEPKKGLVAEKIMSELPESCIHCGIVLCRKDLNNHQLSDCPKRRVNCNYCHLGCTWIGNAEESFSHHLQCKVSKDTSISEIADYVARKEQSWNEIFQSFFSVLRRLESTDPQYRTVALSFIKSTSDTFTFRSDQF CNQSRWSL VRFY INDS+ENYV
Sbjct:    1 TDLALELNNAEQSSVDDLSSGNFNLSSKQIPLECPQKISNDSIIVNNFNFGNDIDYLKQVLLSIKNIVACSACFLSLIPMKECSNGHLICQSCYLILRQFERPQCPVCRIGLHSEPKKGLVAEKIMSELPESCIHCGIVLCRKDLNNHQLSDCPKRRVNCNYCHLGCTWIGNAEESFSHHLQCKVSKDTSISEIADYVARKEQSWNEIFQSFFSVLRRLESTDPQYRTVALSFIKSTSDTFTFRSDQFXCNQSRWSLXVRFYXINDSKENYV 272          
BLAST of Cysteine and histidine-rich protein 1 vs. TrEMBL
Match: A0A0R3WIL0 (TRAF-type domain-containing protein OS=Hydatigena taeniaeformis OX=6205 GN=TTAC_LOCUS443 PE=4 SV=1)

HSP 1 Score: 202.986 bits (515), Expect = 7.880e-57
Identity = 109/286 (38.11%), Postives = 165/286 (57.69%), Query Frame = 2
Query:   38 ELNNAEQSSVD---DLSSGNFNLSSKQIPLEC-PQKISNDSIIVNNFNFGNDIDYLKQVLLSIKNIVACSACFLSLIPMKECSNGHLICQSCYLILRQFERPQCPVCRIGLHSEPKKGLVAEKIMSELPESCIHCGIVLCRKDLNNHQLSDCPKRRVNCNYCHLGCTWIGNAEESFSHHLQCKVSK-------DTSISEIADYVARKEQSWNEIFQSFFSVLRRLESTDPQYRTVALSFIKSTSDTFTFRSDQFHCNQSRWSLEVRFYQINDSEE---NYVSDDIG 853
            E+NN  Q  V    DL+  +  +++  I +   P K  N  +        ND+++   V+ SI+ +++C ACF S   MKEC+NGHL+C +C+L LRQ + PQCP CR  L+ + ++ L A+K++SELP+ C+ CG ++  KDL  H+L+ CPKRRV+C    LGCTW G+AEE   H+  C+V +       + S+S +     R+EQ   E+F  F +V R LE  + Q   V LS  + T     F+SDQFH +QSRW+L++     +D  E   N V+ ++G
Sbjct:    7 EMNNNSQEEVPTPLDLTVNSSTIATTDITVATSPAKAQNSQL--------NDLNH---VIQSIREVISCCACFNSDFGMKECANGHLLCHTCFLTLRQDDHPQCPTCRAVLYPDSRRALTAQKVLSELPDVCLECGQMMLHKDLVGHKLNACPKRRVSCGLAPLGCTWCGSAEEYHGHYEDCEVRRCLQERPLEESLSNVLARFRRREQMVREMFTCFSAVFRHLEGFELQSVCVPLSLARVTPGRLVFKSDQFHGSQSRWTLKLMVRFDDDGAEEIANPVASNVG 281          
BLAST of Cysteine and histidine-rich protein 1 vs. TrEMBL
Match: A0A5J4N8T4 (TRAF-type domain-containing protein OS=Paragonimus westermani OX=34504 GN=DEA37_0004658 PE=4 SV=1)

HSP 1 Score: 202.216 bits (513), Expect = 4.275e-56
Identity = 98/228 (42.98%), Postives = 146/228 (64.04%), Query Frame = 2
Query:  197 QVLLSIKNIVACSACFLSLIPMKECSNGHLICQSCYLILRQFERPQCPVCRIGLHSEPKKGLVAEKIMSELPESCIHCGIVLCRKDLNNHQLSDCPKRRVNCNYCHLGCTWIGNAEESFSHHLQCKVSK---DTSISEIADYVA----RKEQSWNEIFQSFFSVLRRLESTDPQYRTVALSFIKSTSDTFTFRSDQFHCNQSRWSLEVRF---YQINDSEENYVSDDI 850
            ++L SI+ +++C AC+ S   MKEC+NGHLICQ+C+L LRQ ERPQCP CR  L+S+ ++ LVA+K++SELP+ C  C   +  K L NH+L+ CPKR+V C    LGC W G A++  +H+  C + K   D  +    D++     ++EQ+  E F  F +VLR+LES + Q  TV L+ + +   T  +RSD FH NQSRW+ E+      Q++ +EEN +SD++
Sbjct:  100 RILRSIREVISCCACYSSDTIMKECTNGHLICQNCFLTLRQDERPQCPTCRANLYSDSRRALVAQKVLSELPDCCTDCNAQMLHKSLPNHRLNYCPKRKVACGLSVLGCEWTGWADQYDAHYSDCNLKKQLTDQPVGSNIDWLVNRFRKREQTMRETFHCFSNVLRQLESHELQTVTVTLANVSTNEHTLQYRSDHFHVNQSRWTAEITMKSPTQLHITEENPISDNV 327          
BLAST of Cysteine and histidine-rich protein 1 vs. TrEMBL
Match: A0A0R3WFD7 (Uncharacterized protein OS=Taenia asiatica OX=60517 GN=TASK_LOCUS9581 PE=4 SV=1)

HSP 1 Score: 200.675 bits (509), Expect = 6.268e-56
Identity = 110/275 (40.00%), Postives = 156/275 (56.73%), Query Frame = 2
Query:   35 LELNNAEQSSVDDLSSGNFNLSSKQI-PLECPQKISNDSIIVNNFNFGNDIDYLKQVLLSIKNIVACSACFLSLIPMKECSNGHLICQSCYLILRQFERPQCPVCRIGLHSEPKKGLVAEKIMSELPESCIHCGIVLCRKDLNNHQLSDCPKRRVNCNYCHLGCTWIGNAEESFSHHLQCKVSK-------DTSISEIADYVARKEQSWNEIFQSFFSVLRRLESTDPQYRTVALSFIKSTSDTFTFRSDQFHCNQSRWSLE--VRFYQINDSEE 829
            +E NN  Q  V        N S+  I     P KI    +        ND+++   V+ SI+ +++C ACF S   MKEC+NGHL+C +C+L LRQ + PQCP CR  L+ + ++ L A+K++SELP+ C+ CG V+  KDL  H+L+ CPKRRV+C    LGCTW G+AEE   H+  C+V +       + S+S +     R+EQ   E+F  F +V R LE  + Q   V LS  + T     F+SDQFH +QSRW+L+  VRF   +  EE
Sbjct:    6 VETNNNSQEEVSTPLDLTVNSSASGIVTAASPAKIQPSQL--------NDLNH---VIQSIREVISCCACFNSDFGMKECANGHLLCHTCFLTLRQDDHPQCPTCRAVLYPDSRRALTAQKVLSELPDVCLECGQVMLHKDLVGHKLNTCPKRRVSCGLAPLGCTWCGSAEEYHGHYEDCEVRRCLQERPLEESLSNVLARFRRREQMLREMFTCFSAVFRHLEGFELQSVCVPLSLARVTPGRLVFKSDQFHGSQSRWTLKLMVRFDDDDGVEE 269          
BLAST of Cysteine and histidine-rich protein 1 vs. TrEMBL
Match: A0A0X3NQE0 (Cysteine and histidine-rich protein 1 OS=Schistocephalus solidus OX=70667 GN=CYHR1 PE=4 SV=1)

HSP 1 Score: 201.445 bits (511), Expect = 1.419e-55
Identity = 103/233 (44.21%), Postives = 139/233 (59.66%), Query Frame = 2
Query:  173 GNDIDYLKQVLLSIKNIVACSACFLSLIPMKECSNGHLICQSCYLILRQFERPQCPVCRIGLHSEPKKGLVAEKIMSELPESCIHCGIVLCRKDLNNHQLSDCPKRRVNCNYCHLGCTWIGNAEESFSHHLQCKVSK---DTSISE----IADYVARKEQSWNEIFQSFFSVLRRLESTDPQYRTVALSFIKSTSDTFTFRSDQFHCNQSRWSLEVRFYQINDSEENYVSDDI 850
            G   DY   VL SI+ +++C ACF S   MKECSNGHL+C +C+L LRQ E PQCP CR  L+ + ++ L+A+K++SELP+ C  C + +  KDL+ H+L+DC KRRV C    LGC W G A+E   H+ +C V K   D  I E    +     ++EQS  E FQ F +V R LE  + Q  +V LS ++        RSDQFH NQSRW+LE+ F    D EE  V + +
Sbjct:   82 GATEDY-AAVLQSIREVISCCACFSSEFSMKECSNGHLLCHTCFLTLRQDEHPQCPTCRANLYPDTRRALIAQKVLSELPDVCSACNLTMLHKDLHGHKLNDCSKRRVACGLAPLGCPWCGQADEYRQHYAECFVRKILVDRPIEENLENVLSRFRKREQSLRETFQCFSTVFRHLEGHELQTVSVTLSPLRVNQGKMVMRSDQFHANQSRWTLELSF----DFEEPQVGEAL 309          
BLAST of Cysteine and histidine-rich protein 1 vs. Ensembl Cavefish
Match: cyhr1 (cysteine and histidine rich 1 [Source:NCBI gene;Acc:103031594])

HSP 1 Score: 87.8113 bits (216), Expect = 8.714e-19
Identity = 76/280 (27.14%), Postives = 126/280 (45.00%), Query Frame = 2
Query:  218 NIVACSACF-LSLIPMKECSNGHLICQSCYLILR-----QFERPQCPVCRIGL-HSEPKKGLVAEKIMSELPESCIHCGIVLCRKDLNNHQLSDCPKRRVNCNYCHLGCTWIGNAEESFSHHLQCKVSKDTSIS--EIADYVARKEQSWNEIFQSFFSVL--RRLESTDPQYRTVALSFIKSTSDTFT---FRSDQFHCNQSRWSLEVRFYQINDSEEN---YVSDDIGYRFTKENGVGNSRRHYGFVLMSIKTDDNVKVYLRPQLNFTKFTIRGQVTEF 1006
            +++ C+ C  L    + +C+NGHL+C  C++ L      + E+  CP CR  +  S   + L  EK +SELP  C +C     R  L++HQ  +C  R   C Y  +GC W G   E  +H + C     T I    I D + +  +   +++ S FS+L   ++  T+ Q+R         T D  T   + + +F      W L+ R   +NDSE N        + ++   ++ V NS     F+L+    DD   V ++P +    F+     TE+
Sbjct:   86 SVLCCTVCLDLPKASVYQCTNGHLMCAGCFIHLLADARLKEEQATCPNCRCEISKSLCCRNLAVEKAVSELPSDCSYCLKQFPRSSLDHHQTEECQDRLTQCKYKRIGCPWQGPFHELCAHEVDCCHPSKTGIELMGILDEMDQSHRRELQLYNSIFSLLSFEKIGFTEVQFRPY------RTDDFITRLYYETPRFTVLNQTWVLKAR---VNDSERNPNLSCKRTLSFQLILKSKV-NSALECSFLLLKGPYDD---VKIKPVIQHHVFSNDANETEY 352          
BLAST of Cysteine and histidine-rich protein 1 vs. Ensembl Cavefish
Match: cyhr1 (cysteine and histidine rich 1 [Source:NCBI gene;Acc:103031594])

HSP 1 Score: 84.3445 bits (207), Expect = 5.365e-18
Identity = 73/262 (27.86%), Postives = 117/262 (44.66%), Query Frame = 2
Query:  269 CSNGHLICQSCYLILR-----QFERPQCPVCRIGL-HSEPKKGLVAEKIMSELPESCIHCGIVLCRKDLNNHQLSDCPKRRVNCNYCHLGCTWIGNAEESFSHHLQCKVSKDTSIS--EIADYVARKEQSWNEIFQSFFSVL--RRLESTDPQYRTVALSFIKSTSDTFT---FRSDQFHCNQSRWSLEVRFYQINDSEEN---YVSDDIGYRFTKENGVGNSRRHYGFVLMSIKTDDNVKVYLRPQLNFTKFTIRGQVTEF 1006
            C+NGHL+C  C++ L      + E+  CP CR  +  S   + L  EK +SELP  C +C     R  L++HQ  +C  R   C Y  +GC W G   E  +H + C     T I    I D + +  +   +++ S FS+L   ++  T+ Q+R         T D  T   + + +F      W L+ R   +NDSE N        + ++   ++ V NS     F+L+    DD   V ++P +    F+     TE+
Sbjct:   15 CTNGHLMCAGCFIHLLADARLKEEQATCPNCRCEISKSLCCRNLAVEKAVSELPSDCSYCLKQFPRSSLDHHQTEECQDRLTQCKYKRIGCPWQGPFHELCAHEVDCCHPSKTGIELMGILDEMDQSHRRELQLYNSIFSLLSFEKIGFTEVQFRPY------RTDDFITRLYYETPRFTVLNQTWVLKAR---VNDSERNPNLSCKRTLSFQLILKSKV-NSALECSFLLLKGPYDD---VKIKPVIQHHVFSNDANETEY 263          
BLAST of Cysteine and histidine-rich protein 1 vs. Ensembl Sea Lamprey
Match: cyhr1 (cysteine/histidine-rich 1 [Source:NCBI gene;Acc:767773])

HSP 1 Score: 74.3294 bits (181), Expect = 2.559e-15
Identity = 71/265 (26.79%), Postives = 118/265 (44.53%), Query Frame = 2
Query:  266 ECSNGHLICQSCYLILR-----QFERPQCPVCRIGL-HSEPKKGLVAEKIMSELPESCIHCGIVLCRKDLNNHQLSDCPKRRV-NCNYCHLGCTWIGNAEESFSHHLQCKVSKDTS--ISEIADYVARKEQSWNEIFQSFFSV--LRRLESTDPQYRTVALSFIKSTSDTFT---FRSDQFHCNQSRWSLEVRFYQINDSEEN---YVSDDIGYRFTKENGVGNSRRHYGFVLMSIKTDDNVKVYLRPQLNFTKFTIRGQVTEFF 1009
            +CSNGHL+C  C++ L      + E+  CP CR  +  S   + L  EK +SELP  C  C     R  L +HQ   C    + NC Y  +GC W G   E  +H  +C   K T   +  + D + +  +   ++F   F++  L ++  T+ Q+R         T D  T   + + +F+     W L+ R   +NDSE N        + ++   ++ + +S     F+L+    DD     + P +++  FT  G  TE+ 
Sbjct:    1 QCSNGHLMCAGCFIHLLADARLKEEQATCPNCRCEISKSLCCRNLAVEKAVSELPAECGFCLHQFPRSCLEHHQKELCNHFLLTNCRYQRIGCPWQGPFHEISAHEAECCHPKKTGSELMGVLDEMDQNHKKEMQLFNDIFTLLSLEKIGYTEVQFRPY------RTDDFITRLYYETPRFNILNQTWVLKGR---VNDSERNPNLSCKRALSFQLNLKSKL-SSPMECAFLLLRGPYDD---ARVTPVVHYFTFTNEGNETEYL 252          
BLAST of Cysteine and histidine-rich protein 1 vs. Ensembl Nematostella
Match: EDO46014 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRI7])

HSP 1 Score: 53.9138 bits (128), Expect = 3.108e-8
Identity = 34/109 (31.19%), Postives = 48/109 (44.04%), Query Frame = 2
Query:  323 ERPQCPVCRIGL-HSEPKKGLVAEKIMSELPESCIHCGIVLCRKDLNNHQLSDCPKRRVNCNYCHLGCTWIGNAEESFSHHLQCKVSKDTSISEIADYVARKEQSWNEI 646
            E+  CP CRI +  +   + L  EK +SELP +C  C     R   + H+  +C  R V C Y  LGC W G   E   H   C     T +  +    A  E++  E+
Sbjct:   18 EQATCPSCRIDISRNNCSRNLAVEKAVSELPTACQFCDNEFPRSIASIHEREECSDRLVRCKYKRLGCPWQGPHHELALHEGACPHPGKTGLELMEALNAIDEKNEMEL 126          
BLAST of Cysteine and histidine-rich protein 1 vs. Ensembl Nematostella
Match: EDO32849 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7STV3])

HSP 1 Score: 49.2914 bits (116), Expect = 1.485e-6
Identity = 36/127 (28.35%), Postives = 50/127 (39.37%), Query Frame = 2
Query:  227 ACSACFLSLIPMKECSNGHLICQSCYLILRQFERPQCPVCRIGLHSE-PKKGLVAEKIMSELPESCIH-------------------------------CGIVLCRKDLNNHQLSDCPKRRVNCNYC 511
             C   F+S + +KEC  GH +CQ CY  + +   P+CP C   L  + P      E  M+ELP  CI+                               CG    R+    H   DCPK+ ++C YC
Sbjct:   57 VCEDIFVSPVQIKEC--GHRLCQHCYKTIWRSPEPKCPKCSGDLDDKIPDVDQAFENDMNELPCRCINHEWGCKVEVPFTQMITHKGECEYSDILCDNDCGAKFQRRFKQKHLDKDCPKKIISCPYC 181          
BLAST of Cysteine and histidine-rich protein 1 vs. Ensembl Medaka
Match: cyhr1 (cysteine and histidine rich 1 [Source:NCBI gene;Acc:101156262])

HSP 1 Score: 80.8777 bits (198), Expect = 2.271e-16
Identity = 72/273 (26.37%), Postives = 119/273 (43.59%), Query Frame = 2
Query:  218 NIVACSACF-LSLIPMKECSNGHLICQSCYLILR-----QFERPQCPVCRIGLHSEPK-KGLVAEKIMSELPESCIHCGIVLCRKDLNNHQLSDCPKRRVNCNYCHLGCTWIGNAEESFSHHLQCKVSKDTSISEIADYVARKEQSW---NEIFQSFFSVL--RRLESTDPQYRTVALSFIKSTSDTFT---FRSDQFHCNQSRWSLEVRFYQINDSEEN---YVSDDIGYRFTKENGVGNSRRHYGFVLMSIKTDDNVKVYLRPQLNFTKFT 982
            +++ C+ C  L    + +C+NGHL+C  C++ L      + E+  CP CR  +      + L  EK +SELP  C  C     R  L  HQ  +C  R   C Y  +GC W G   E  +H  +C     T  +E+   +   +QS     +++ S F +L   ++  T+ Q+R         T D  T   + + +F      W L+ R   +NDSE N        + ++   ++ V NS     F+L+    DD   V ++P +    F+
Sbjct:   93 SVLCCTVCLDLPKASVYQCTNGHLMCAGCFIHLLADSRLKEEQATCPNCRCEISKNLCCRNLAVEKAVSELPTDCTFCLKQFPRSSLERHQKEECQDRVTQCKYKRIGCPWQGPFHELPAHESECSHPTKTG-TELMGILGEMDQSHRRDTQLYNSIFGLLCYEKIGFTEVQFRPY------RTDDFITRLYYETPRFTVLNQTWVLKAR---VNDSERNPNLSCKRTLSFQLILKSKV-NSALECSFLLLKGPYDD---VRIKPVIYHHSFS 351          
BLAST of Cysteine and histidine-rich protein 1 vs. Ensembl Medaka
Match: cyhr1 (cysteine and histidine rich 1 [Source:NCBI gene;Acc:101156262])

HSP 1 Score: 79.7221 bits (195), Expect = 2.367e-16
Identity = 70/259 (27.03%), Postives = 112/259 (43.24%), Query Frame = 2
Query:  257 PMKECSNGHLICQSCYLILR-----QFERPQCPVCRIGLHSEPK-KGLVAEKIMSELPESCIHCGIVLCRKDLNNHQLSDCPKRRVNCNYCHLGCTWIGNAEESFSHHLQCKVSKDTSISEIADYVARKEQSW---NEIFQSFFSVL--RRLESTDPQYRTVALSFIKSTSDTFT---FRSDQFHCNQSRWSLEVRFYQINDSEEN---YVSDDIGYRFTKENGVGNSRRHYGFVLMSIKTDDNVKVYLRPQLNFTKFT 982
            P  +C+NGHL+C  C++ L      + E+  CP CR  +      + L  EK +SELP  C  C     R  L  HQ  +C  R   C Y  +GC W G   E  +H  +C     T  +E+   +   +QS     +++ S F +L   ++  T+ Q+R         T D  T   + + +F      W L+ R   +NDSE N        + ++   ++ V NS     F+L+    DD   V ++P +    F+
Sbjct:   10 PQGQCTNGHLMCAGCFIHLLADSRLKEEQATCPNCRCEISKNLCCRNLAVEKAVSELPTDCTFCLKQFPRSSLERHQKEECQDRVTQCKYKRIGCPWQGPFHELPAHESECSHPTKTG-TELMGILGEMDQSHRRDTQLYNSIFGLLCYEKIGFTEVQFRPY------RTDDFITRLYYETPRFTVLNQTWVLKAR---VNDSERNPNLSCKRTLSFQLILKSKV-NSALECSFLLLKGPYDD---VRIKPVIYHHSFS 254          
BLAST of Cysteine and histidine-rich protein 1 vs. Planmine SMEST
Match: SMESG000001532.1 (SMESG000001532.1)

HSP 1 Score: 754.207 bits (1946), Expect = 0.000e+0
Identity = 364/364 (100.00%), Postives = 364/364 (100.00%), Query Frame = 2
Query:   14 MDETDLALELNNAEQSSVDDLSSGNFNLSSKQIPLECPQKISNDSIIVNNFNFGNDIDYLKQVLLSIKNIVACSACFLSLIPMKECSNGHLICQSCYLILRQFERPQCPVCRIGLHSEPKKGLVAEKIMSELPESCIHCGIVLCRKDLNNHQLSDCPKRRVNCNYCHLGCTWIGNAEESFSHHLQCKVSKDTSISEIADYVARKEQSWNEIFQSFFSVLRRLESTDPQYRTVALSFIKSTSDTFTFRSDQFHCNQSRWSLEVRFYQINDSEENYVSDDIGYRFTKENGVGNSRRHYGFVLMSIKTDDNVKVYLRPQLNFTKFTIRGQVTEFFTASNVEIKLNPRNCHIIHVEIGIIRKTEETDD 1105
            MDETDLALELNNAEQSSVDDLSSGNFNLSSKQIPLECPQKISNDSIIVNNFNFGNDIDYLKQVLLSIKNIVACSACFLSLIPMKECSNGHLICQSCYLILRQFERPQCPVCRIGLHSEPKKGLVAEKIMSELPESCIHCGIVLCRKDLNNHQLSDCPKRRVNCNYCHLGCTWIGNAEESFSHHLQCKVSKDTSISEIADYVARKEQSWNEIFQSFFSVLRRLESTDPQYRTVALSFIKSTSDTFTFRSDQFHCNQSRWSLEVRFYQINDSEENYVSDDIGYRFTKENGVGNSRRHYGFVLMSIKTDDNVKVYLRPQLNFTKFTIRGQVTEFFTASNVEIKLNPRNCHIIHVEIGIIRKTEETDD
Sbjct:    1 MDETDLALELNNAEQSSVDDLSSGNFNLSSKQIPLECPQKISNDSIIVNNFNFGNDIDYLKQVLLSIKNIVACSACFLSLIPMKECSNGHLICQSCYLILRQFERPQCPVCRIGLHSEPKKGLVAEKIMSELPESCIHCGIVLCRKDLNNHQLSDCPKRRVNCNYCHLGCTWIGNAEESFSHHLQCKVSKDTSISEIADYVARKEQSWNEIFQSFFSVLRRLESTDPQYRTVALSFIKSTSDTFTFRSDQFHCNQSRWSLEVRFYQINDSEENYVSDDIGYRFTKENGVGNSRRHYGFVLMSIKTDDNVKVYLRPQLNFTKFTIRGQVTEFFTASNVEIKLNPRNCHIIHVEIGIIRKTEETDD 364          
BLAST of Cysteine and histidine-rich protein 1 vs. Planmine SMEST
Match: SMESG000023276.1 (SMESG000023276.1)

HSP 1 Score: 107.457 bits (267), Expect = 5.155e-25
Identity = 80/270 (29.63%), Postives = 130/270 (48.15%), Query Frame = 2
Query:  212 IKNIVACSACFLSLIPMKECSNGHLICQSCYLILRQFERP-QCPVCRIGLHSEPKKGLVAEKIMSELPESCIHCGIVLCRKDLNNHQLSDCPKRRVNCNYCHLGCTWIGNAEESFSHHLQCKVSKDT--SISEIA-DYVARKEQSWNEIFQSFFSVLR--RLESTDPQYRTVALSFIKSTSD---TFTFRSDQFH-----CNQSRWSLEVRFYQINDSEENYVSDDIGYRFTKENGVGNSRRHYGFVLMSIKTDDNVKVYLRPQLNFTKF 979
            +KN+++CS C        +C NGHLIC +C   L+Q      CPVCRI L     + L+AE++ SELP  C  C  V+  K +  H+  +C KR V C Y   GC WIG  E S  H  +C +S  T   + EI  + +AR  QS     Q + +++   R+++   +      +  KS S+      F+S         CN   + L++   ++N++E     + + Y    EN    ++ +  F L+SIK ++ V + ++  L+   F
Sbjct:   95 MKNLLSCSICLEVSSYSNQCPNGHLICITCSGRLQQTPGDLNCPVCRISLKQGLHRSLLAEQLTSELPAECKFCDTVMAVKYIKKHETDECTKRMVPCKYKMFGCNWIGIEELSKDHEDECSISNKTVGMLREIVNENIARDLQSLQSPLQLWKAIISKLRVQAVGSRMLIRQTTLNKSNSEDANQTVFKSPMIRIPFTCCNLHGFYLDMYVTKMNETE----PEKLHYVLRSEN---RTKINLMFYLLSIKINETVNLDVQDSLHSHHF 357          
BLAST of Cysteine and histidine-rich protein 1 vs. Planmine SMEST
Match: SMESG000067104.1 (SMESG000067104.1)

HSP 1 Score: 97.0561 bits (240), Expect = 1.017e-21
Identity = 46/129 (35.66%), Postives = 67/129 (51.94%), Query Frame = 2
Query:  212 IKNIVACSACFLSLIPMKECSNGHLICQSCYLILRQFERPQ---CPVCRIGLHSEPKKGLVAEKIMSELPESCIHCGIVLCRKDLNNHQLSDCPKRRVNCNYCHLGCTWIGNAEESFSHHLQCKVSKDT 589
            +K ++ CS C        +C NGHLIC +C L L+Q    +   CPVCR+ L    ++ L+AE+++SELP  C  C   +  + +  H+   CP R +NC Y   GC W G A++   H   C V   T
Sbjct:   72 MKKLLTCSVCLEVRKQANQCQNGHLICINCTLCLQQSSSSKEINCPVCRVPLTGYYQRSLLAEQLVSELPTKCRFCSTTMSVRQMQQHESEICPARTINCQYALFGCPWKGVAKQRKLHESLCNVGLST 200          
The following BLAST results are available for this feature:
BLAST of Cysteine and histidine-rich protein 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
CYHR11.172e-1628.96cysteine and histidine rich 1 [Source:HGNC Symbol;... [more]
CYHR12.521e-1629.81cysteine and histidine rich 1 [Source:HGNC Symbol;... [more]
CYHR11.420e-1530.35cysteine and histidine rich 1 [Source:HGNC Symbol;... [more]
back to top
BLAST of Cysteine and histidine-rich protein 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Cysteine and histidine-rich protein 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
CG324867.366e-1433.07gene:FBgn0266918 transcript:FBtr0073004[more]
sinah6.408e-730.51gene:FBgn0259794 transcript:FBtr0301683[more]
back to top
BLAST of Cysteine and histidine-rich protein 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
cyhr11.566e-1726.07cysteine/histidine-rich 1 [Source:NCBI gene;Acc:76... [more]
back to top
BLAST of Cysteine and histidine-rich protein 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
cntn25.474e-1627.86contactin 2 [Source:Xenbase;Acc:XB-GENE-6070188][more]
back to top
BLAST of Cysteine and histidine-rich protein 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Cyhr13.748e-1628.18cysteine and histidine rich 1 [Source:MGI Symbol;A... [more]
Cyhr11.282e-1330.63cysteine and histidine rich 1 [Source:MGI Symbol;A... [more]
Cyhr14.423e-1330.63cysteine and histidine rich 1 [Source:MGI Symbol;A... [more]
back to top
BLAST of Cysteine and histidine-rich protein 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q08CH8|CYHR1_DANRE1.185e-1626.07Cysteine and histidine-rich protein 1 OS=Danio rer... [more]
sp|Q2TAD9|CYR1B_XENLA5.130e-1626.79Cysteine and histidine-rich protein 1-B OS=Xenopus... [more]
sp|Q6GNX1|CYR1A_XENLA5.178e-1626.43Cysteine and histidine-rich protein 1-A OS=Xenopus... [more]
sp|Q7YR89|CYHR1_BOVIN1.745e-1530.20Cysteine and histidine-rich protein 1 OS=Bos tauru... [more]
sp|Q5BK76|CYHR1_RAT1.830e-1528.05Cysteine and histidine-rich protein 1 OS=Rattus no... [more]
back to top
BLAST of Cysteine and histidine-rich protein 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1W6I1830.000e+098.53Cysteine/histidine-rich 1b (Fragment) OS=Schmidtea... [more]
A0A0R3WIL07.880e-5738.11TRAF-type domain-containing protein OS=Hydatigena ... [more]
A0A5J4N8T44.275e-5642.98TRAF-type domain-containing protein OS=Paragonimus... [more]
A0A0R3WFD76.268e-5640.00Uncharacterized protein OS=Taenia asiatica OX=6051... [more]
A0A0X3NQE01.419e-5544.21Cysteine and histidine-rich protein 1 OS=Schistoce... [more]
back to top
BLAST of Cysteine and histidine-rich protein 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
cyhr18.714e-1927.14cysteine and histidine rich 1 [Source:NCBI gene;Ac... [more]
cyhr15.365e-1827.86cysteine and histidine rich 1 [Source:NCBI gene;Ac... [more]
back to top
BLAST of Cysteine and histidine-rich protein 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
cyhr12.559e-1526.79cysteine/histidine-rich 1 [Source:NCBI gene;Acc:76... [more]
back to top
BLAST of Cysteine and histidine-rich protein 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Cysteine and histidine-rich protein 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO460143.108e-831.19Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO328491.485e-628.35Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Cysteine and histidine-rich protein 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
cyhr12.271e-1626.37cysteine and histidine rich 1 [Source:NCBI gene;Ac... [more]
cyhr12.367e-1627.03cysteine and histidine rich 1 [Source:NCBI gene;Ac... [more]
back to top
BLAST of Cysteine and histidine-rich protein 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000001532.10.000e+0100.00SMESG000001532.1[more]
SMESG000023276.15.155e-2529.63SMESG000023276.1[more]
SMESG000067104.11.017e-2135.66SMESG000067104.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30009538 ID=SMED30009538|Name=Cysteine and histidine-rich protein 1|organism=Schmidtea mediterranea sexual|type=transcript|length=1189bp
ATTTGAATTTCAAATGGATGAAACGGATCTAGCTTTGGAGCTGAATAATG
CTGAACAGTCGAGCGTGGACGATTTGAGTTCCGGCAATTTTAATTTATCC
AGCAAACAAATACCCCTTGAATGTCCACAGAAAATCTCAAATGATTCCAT
AATCGTAAACAATTTCAATTTCGGAAACGACATTGACTATTTAAAACAAG
TCCTTCTTTCAATTAAGAACATTGTTGCGTGTAGTGCTTGTTTTCTGTCT
TTAATTCCAATGAAAGAATGTTCAAATGGACATTTGATTTGCCAATCATG
CTATTTAATTCTTCGCCAATTTGAAAGACCTCAGTGTCCGGTTTGTAGAA
TCGGGCTGCACTCTGAACCGAAAAAGGGCTTGGTCGCCGAAAAGATCATG
TCTGAACTACCAGAATCGTGCATCCACTGTGGAATAGTTTTATGTCGAAA
AGATCTAAACAATCATCAACTATCTGATTGTCCGAAACGACGGGTGAACT
GTAATTATTGTCATTTGGGTTGCACGTGGATTGGAAATGCCGAAGAATCG
TTTTCACATCATCTTCAGTGTAAAGTCAGCAAAGACACGAGTATCAGTGA
AATAGCGGATTATGTAGCTCGAAAGGAACAAAGCTGGAATGAAATATTCC
AAAGCTTTTTTAGTGTTTTAAGACGTCTAGAATCAACTGATCCGCAATAC
AGAACAGTTGCGTTAAGTTTCATTAAGTCTACATCTGATACTTTTACGTT
TCGTAGCGATCAGTTTCACTGCAATCAGTCCAGGTGGAGCCTAGAAGTTC
GATTTTATCAAATTAATGATTCAGAAGAAAACTATGTATCAGATGATATA
GGATATAGGTTCACCAAAGAAAATGGCGTTGGAAATTCACGGAGACATTA
TGGGTTTGTTTTGATGAGTATTAAGACTGATGATAATGTAAAGGTTTATC
TTCGTCCTCAATTAAATTTCACTAAATTTACAATACGTGGTCAAGTCACA
GAATTCTTTACTGCGAGTAATGTAGAAATAAAGTTGAATCCTCGTAATTG
TCATATAATACATGTAGAGATAGGTATTATCCGAAAAACCGAAGAAACAG
ATGATTGATAAAAAAGATATTAAGAGTTATGAATGATTGACATAAGGTAC
CTATTAAAATTGTTAATAAATAGTGAATTATCTCAAAAA
back to top

protein sequence of SMED30009538-orf-1

>SMED30009538-orf-1 ID=SMED30009538-orf-1|Name=SMED30009538-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=369bp
FEFQMDETDLALELNNAEQSSVDDLSSGNFNLSSKQIPLECPQKISNDSI
IVNNFNFGNDIDYLKQVLLSIKNIVACSACFLSLIPMKECSNGHLICQSC
YLILRQFERPQCPVCRIGLHSEPKKGLVAEKIMSELPESCIHCGIVLCRK
DLNNHQLSDCPKRRVNCNYCHLGCTWIGNAEESFSHHLQCKVSKDTSISE
IADYVARKEQSWNEIFQSFFSVLRRLESTDPQYRTVALSFIKSTSDTFTF
RSDQFHCNQSRWSLEVRFYQINDSEENYVSDDIGYRFTKENGVGNSRRHY
GFVLMSIKTDDNVKVYLRPQLNFTKFTIRGQVTEFFTASNVEIKLNPRNC
HIIHVEIGIIRKTEETDD*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000208testis
PLANA:0002089reproductive organ
PLANA:0003304testis primordium
Vocabulary: INTERPRO
TermDefinition
IPR039338CYHR1
IPR013083Znf_RING/FYVE/PHD
IPR001293Znf_TRAF
IPR008974TRAF-like
Vocabulary: molecular function
TermDefinition
GO:0008270zinc ion binding
GO:0005515protein binding
GO:0046872metal ion binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR013083Zinc finger, RING/FYVE/PHD-typeGENE3DG3DSA:3.30.40.10coord: 135..195
e-value: 2.8E-6
score: 29.5
IPR039338Cysteine and histidine-rich protein 1PANTHERPTHR23059FAMILY NOT NAMEDcoord: 69..297
IPR001293Zinc finger, TRAF-typePROSITEPS50145ZF_TRAFcoord: 136..175
score: 9.675
NoneNo IPR availableSUPERFAMILYSSF57850RING/U-boxcoord: 74..120
IPR008974TRAF-likeSUPERFAMILYSSF49599TRAF domain-likecoord: 137..202