slc40a-1

Overview
Nameslc40a-1 (AKN21679.1)
Smed IDSMED30009534
Length (bp)1173
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of slc40a-1 (SMED30009534) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for slc40a-1 (SMED30009534) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30009534

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30009534SMESG000016854.1 dd_Smed_v4_9732_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30009534SMESG000016854.1 dd_Smed_v4_9732_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30009534SMESG000016854.1 dd_Smed_v4_9732_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009534SMESG000016854.1 Contig29580newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30009534SMESG000016854.1 Contig29580uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
epidermisSMED30009534SMESG000016854.1 dd_Smed_v4_9732_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of slc40a-1 vs. Ensembl Human
Match: SLC40A1 (solute carrier family 40 member 1 [Source:HGNC Symbol;Acc:HGNC:10909])

HSP 1 Score: 166.007 bits (419), Expect = 1.943e-45
Identity = 134/380 (35.26%), Postives = 200/380 (52.63%), Query Frame = 3
Query:   42 KFSAMTSRFRLLDLCSKIVAPVIIGQIIYFAGKPIAAIVFSIQXXXXXXXXXXXXKIIYNRMPRLHYRE-------DLSNLMRKATDETAPLPENEVTG--STNIPELPKVEIPSSYYSWYKCL-IFFEGWIVYFQGNLKFAGLAMALLYMTVLGFDAVTIGYAISQGVSESMLSYFNXXXXXXXXXXXXXFPKIMKKTNIIFTGIIALSLQLIGLIPCLISVWAPGSPFDLNY-------------------------------NGTNLVNV---TDGSVLPIAXXXXXXXXXXXXXXXXXXRIGLWMFDLTISQLLVEVVLEINRGKVNGVQNSLNMLFEMIKFTLVLVFPLPYQFGILVLLSVGAIGISNALYLVYA 1049
            K + M +  R +D  + I+AP+ +GQI+ F    I     S   LV++ +   LL  +Y + P L  +        +L  L      E  PL    + G   +NI EL   + P+      +    F +GW+ Y+   +  AG+ +A LYMTVLGFD +T GYA +QG+S S+LS     +AITGI+G + F  + +K  ++ TG+I+   QL  LI C+ISV+ PGSP DL+                                NG+N  N+   T    +PI      IS+ LLF G+I +RIGLW FDLT++QLL E V+E  RG +NGVQNS+N L +++ F +V++ P P  FG+LVL+SV  + + + +Y  +A
Sbjct:  169 KLANMNATIRRIDQLTNILAPMAVGQIMTFGSPVIGCGFISGWNLVSMCVEYVLLWKVYQKTPALAVKAGLKEEETELKQLNLHKDTEPKPLEGTHLMGVKDSNIHELEHEQEPTCASQMAEPFRTFRDGWVSYYNQPVFLAGMGLAFLYMTVLGFDCITTGYAYTQGLSGSILSILMGASAITGIMGTVAFTWLRRKCGLVRTGLISGLAQLSCLILCVISVFMPGSPLDLSVSPFEDIRSRFIQGESITPTKIPEITTEIYMSNGSNSANIVPETSPESVPI------ISVSLLFAGVIAARIGLWSFDLTVTQLLQENVIESERGIINGVQNSMNYLLDLLHFIMVILAPNPEAFGLLVLISVSFVAMGHIMYFRFA 542          
BLAST of slc40a-1 vs. Ensembl Celegans
Match: fpn-1.2 (Solute carrier family 40 protein [Source:UniProtKB/TrEMBL;Acc:O44607])

HSP 1 Score: 98.2117 bits (243), Expect = 3.914e-22
Identity = 89/363 (24.52%), Postives = 160/363 (44.08%), Query Frame = 3
Query:   48 SAMTSRFRLLDLCSKIVAPVIIGQIIYFAGKPIAAIVFSIQXXXXXXXXXXXXKIIYNRMPRLHYREDLSNLMRKATDETAPLPENEVTGSTNIPELPKVEIPSSYYSWYKCLIFFEGWIVYFQGNLKFAGLAMALLYMTVLGFDAVTIGYAISQGVSESMLSYFNXXXXXXXXXXXXXFPKIMKKTNIIFTGIIALSLQLIGLIPCLISVWAPGSPFDL------------------NYNGTNLVNV----------TDGSVLPIAXXXXXXXXXXXXXXXXXXRIGLWMFDLTISQLLVEVVLEINRGKVNGVQNSLNMLFEMIKFTLVLVFPLPYQFGILVLLSVGAIGISNALYLVYAI 1052
            S M +    LD C+ ++AP++ G ++ + G      +F I  LV++   T  L+ IY   P L  ++D      K  +   P   + +  S       ++  P+++                           M+LL+MTV+GFD + +GY  S G+ E ++  F +  ++T I+GA  +    K+ ++  +G++ L +Q    +  +ISV+ PGSP +L                  +++G N  N+          +DG  L         SI +    I  +R GLW  DL I+ ++   + E  R  V G+ N+L   F ++K  LV++ PLP  F I + +S G +   +  ++ Y +
Sbjct:  155 SNMNATLLTLDQCTNVIAPLVTGALVTWVGLRETVGIFGIASLVSMASKTIFLRAIYISNPLLQVKKD------KKDEALDPFANSRLKESVVYTYWCQISFPAAF--------------------------GMSLLFMTVMGFDGLAVGYGSSVGLPEFVIGAFRSYGSVTAILGAFSYAFFEKRYSVATSGLLGLVVQQFFAVLAVISVFLPGSPMNLGGYFGNFTMGTWWHDMVHSFDGNNATNLDPHVDWKHFSSDGVSLA--------SIFVFLIAIASARYGLWCLDLAITHIMQVTIPERERNTVFGMHNALCQTFSVLKDVLVIILPLPATFAICIFISYGFVSCGHMFFIYYLV 477          
BLAST of slc40a-1 vs. Ensembl Celegans
Match: fpn-1.1 (Solute carrier family 40 protein [Source:UniProtKB/TrEMBL;Acc:Q8IA95])

HSP 1 Score: 75.0998 bits (183), Expect = 1.774e-14
Identity = 78/265 (29.43%), Postives = 124/265 (46.79%), Query Frame = 3
Query:  255 SNLMRKATDETAPLP--ENEVTGSTNIPELPKVEIPSSYYSWYKCLIFFEGWIVYFQGNLKFAGLAMALLYMTVLGFDAVTIGYAISQGVSESMLSYFNXXXXXXXXXXXXXFPKIMKKTNIIFTGIIALSLQLIGLIPCLISVWAPGSPFDLN-YNGTNLVNVTDGSVL------------PIAXXXXXXXXXXXXXXXXXXRIGLWMFDLTISQLLVEVVLEINRGKVNGVQNSLNMLFEMIKFTLVLVFPLPYQFGILVLLS 1004
            S ++R+  +ET  L    +E+TG   +  L  V++ S                 YF+     AG  ++LLYMTVLGFD +   Y    G+S S +       +  G+IG   F  + K+  +++T +I L  Q I +  C +SV  PGS  D++ Y     V+     VL             ++    ++ + L F GI  +R GLW+ D  I+Q+  E + E  R     VQ +LN +F ++K  +V++FP    FG+L L S
Sbjct:  194 SMILRRLYNETPQLKTRASEITGDEELRGLKGVKLNSITQ--------------YFKQQSWTAGFGLSLLYMTVLGFDNLAASYGQKHGLSASYIGVLRGFGSALGVIGTFSFQFVAKRFGLLWTVMIGLVWQNIFIEMCGVSVLLPGSSMDVSGYIANTSVSEWSKEVLSRVSNPEPQNVPSVSFYDVALPVNLFFIGISFARFGLWLADPAITQIQQETIPESQRYMAFTVQIALNEVFSILKDIIVIMFPFTPLFGVLTLGS 444          
BLAST of slc40a-1 vs. Ensembl Celegans
Match: fpn-1.1 (Solute carrier family 40 protein [Source:UniProtKB/TrEMBL;Acc:Q8IA95])

HSP 1 Score: 75.0998 bits (183), Expect = 1.774e-14
Identity = 78/265 (29.43%), Postives = 124/265 (46.79%), Query Frame = 3
Query:  255 SNLMRKATDETAPLP--ENEVTGSTNIPELPKVEIPSSYYSWYKCLIFFEGWIVYFQGNLKFAGLAMALLYMTVLGFDAVTIGYAISQGVSESMLSYFNXXXXXXXXXXXXXFPKIMKKTNIIFTGIIALSLQLIGLIPCLISVWAPGSPFDLN-YNGTNLVNVTDGSVL------------PIAXXXXXXXXXXXXXXXXXXRIGLWMFDLTISQLLVEVVLEINRGKVNGVQNSLNMLFEMIKFTLVLVFPLPYQFGILVLLS 1004
            S ++R+  +ET  L    +E+TG   +  L  V++ S                 YF+     AG  ++LLYMTVLGFD +   Y    G+S S +       +  G+IG   F  + K+  +++T +I L  Q I +  C +SV  PGS  D++ Y     V+     VL             ++    ++ + L F GI  +R GLW+ D  I+Q+  E + E  R     VQ +LN +F ++K  +V++FP    FG+L L S
Sbjct:  194 SMILRRLYNETPQLKTRASEITGDEELRGLKGVKLNSITQ--------------YFKQQSWTAGFGLSLLYMTVLGFDNLAASYGQKHGLSASYIGVLRGFGSALGVIGTFSFQFVAKRFGLLWTVMIGLVWQNIFIEMCGVSVLLPGSSMDVSGYIANTSVSEWSKEVLSRVSNPEPQNVPSVSFYDVALPVNLFFIGISFARFGLWLADPAITQIQQETIPESQRYMAFTVQIALNEVFSILKDIIVIMFPFTPLFGVLTLGS 444          
BLAST of slc40a-1 vs. Ensembl Zebrafish
Match: slc40a1 (solute carrier family 40 member 1 [Source:NCBI gene;Acc:58153])

HSP 1 Score: 160.614 bits (405), Expect = 1.021e-43
Identity = 128/373 (34.32%), Postives = 203/373 (54.42%), Query Frame = 3
Query:   42 KFSAMTSRFRLLDLCSKIVAPVIIGQIIYFAGKPIAAIVFSIQXXXXXXXXXXXXKIIYNRMPRLHYR--------EDLS--NLMRKATDETAPLPENEVTGSTNIPELPKVEIPSSYYSWYKCLIFFEGWIVYFQGNLKFAGLAMALLYMTVLGFDAVTIGYAISQGVSESMLSYFNXXXXXXXXXXXXXFPKIMKKTNIIFTGIIALSLQLIGLIPCLISVWAPGSPFDLNYNGTNLV---------------------------NVTDGSVLPIAXXXXXXXXXXXXXXXXXXRIGLWMFDLTISQLLVEVVLEINRGKVNGVQNSLNMLFEMIKFTLVLVFPLPYQFGILVLLSVGAIGISNALYLVYA 1049
            K + M +  R++D  + I+AP+++GQI+ F    I     S   L ++ L  FLL  +Y + P L ++        ++L   N+ ++  +  +P+  +++   T   E  K +    Y        F +GW+ Y+  ++ FAG+++A LYMTVLGFD +T GYA +QG++ S+LS     +A++GI G + F  I KK  +I TG IA   QL  L  C+ SV+APGSPFDL+ +    V                           NVT     P     S +S+ LLF G+I +R+GLW FDLT++QL+ E V+E  RG +NGVQNS+N L +++ F +V++ P P  FG+LV++SV  + + + +Y  +A
Sbjct:  166 KLADMNATVRIIDQLTNILAPMLVGQIMAFGSHFIGCGFISGWNLFSMCLEYFLLWKVYQKTPALAFKAGQKDSDDQELKHLNIQKEIGNTESPVEASQLM--TESSETKK-DTGCCYQMAEPIRTFKDGWVAYYNQSIFFAGMSLAFLYMTVLGFDCITTGYAYTQGLNGSVLSLLMGASAVSGICGTVAFTWIRKKCGLIRTGFIAGVTQLSCLTLCVASVFAPGSPFDLSVSPFEEVLRHLFGDSGSLRESPTFIPTTEPPIQANVTVFEEAP--PVESYMSVGLLFAGVIAARVGLWSFDLTVTQLIQENVIESERGVINGVQNSMNYLLDLLHFIMVILAPNPEAFGLLVIISVSFVAMGHMMYFRFA 533          
BLAST of slc40a-1 vs. Ensembl Zebrafish
Match: si:ch211-254p10.2 (si:ch211-254p10.2 [Source:ZFIN;Acc:ZDB-GENE-100922-17])

HSP 1 Score: 98.5969 bits (244), Expect = 2.024e-22
Identity = 77/248 (31.05%), Postives = 127/248 (51.21%), Query Frame = 3
Query:   42 KFSAMTSRFRLLDLCSKIVAPVIIGQIIYFAGKPIAAIVFSIQXXXXXXXXXXXXKIIYNRMPRLHYR----EDLSNLMRKATDET---------APLPENEVTGSTNIPELPKVEIPSSYYSWYKCL-IFFEGWIVYFQGNLKFAGLAMALLYMTVLGFDAVTIGYAISQGVSESMLSYFNXXXXXXXXXXXXXFPKIMKKTNIIFTGIIALSLQLIGLIPCLISVWAPGSPFDLNYNGTNLVNVTD 743
              + M +  R +D  + I+AP+ +GQ++  A   +         +V+L +    L  +Y  +P L  +    E  S L +K              AP    E +   ++ E+ +  IP         L    EGW  Y++  +  AGL +A LY TVLGFD +T GYA +QG+S S+LS     +A+ G++G ++F K+ K   ++ TG+I+ +L ++ L+ C+ SV+APGSP DL+    N+ NV+D
Sbjct:  132 HLAGMNATMRRIDQVTNILAPLAVGQVMTLASNVVGCGFILGWNVVSLIVEFIFLSRVYRIVPALSVKPPAMEHQSYLEKKRERRCLKGRTSSCPAPAISEETSSGLHLQEMTR--IPMCIQRLRGLLSTCQEGWRAYYRQPVFLAGLGLAFLYTTVLGFDCITTGYAYTQGISGSLLSILMGVSAVAGLLGTVLFTKLRKAFGLVNTGVISSALHMLCLLLCVCSVFAPGSPIDLSV--LNIGNVSD 375          
BLAST of slc40a-1 vs. Ensembl Zebrafish
Match: si:ch211-254p10.2 (si:ch211-254p10.2 [Source:ZFIN;Acc:ZDB-GENE-100922-17])

HSP 1 Score: 96.6709 bits (239), Expect = 9.416e-22
Identity = 77/244 (31.56%), Postives = 126/244 (51.64%), Query Frame = 3
Query:   54 MTSRFRLLDLCSKIVAPVIIGQIIYFAGKPIAAIVFSIQXXXXXXXXXXXXKIIYNRMPRLHYR----EDLSNLMRKATDET---------APLPENEVTGSTNIPELPKVEIPSSYYSWYKCL-IFFEGWIVYFQGNLKFAGLAMALLYMTVLGFDAVTIGYAISQGVSESMLSYFNXXXXXXXXXXXXXFPKIMKKTNIIFTGIIALSLQLIGLIPCLISVWAPGSPFDLNYNGTNLVNVTD 743
            M +  R +D  + I+AP+ +GQ++  A   +         +V+L +    L  +Y  +P L  +    E  S L +K              AP    E +   ++ E+ +  IP         L    EGW  Y++  +  AGL +A LY TVLGFD +T GYA +QG+S S+LS     +A+ G++G ++F K+ K   ++ TG+I+ +L ++ L+ C+ SV+APGSP DL+    N+ NV+D
Sbjct:    1 MNATMRRIDQVTNILAPLAVGQVMTLASNVVGCGFILGWNVVSLIVEFIFLSRVYRIVPALSVKPPAMEHQSYLEKKRERRCLKGRTSSCPAPAISEETSSGLHLQEMTR--IPMCIQRLRGLLSTCQEGWRAYYRQPVFLAGLGLAFLYTTVLGFDCITTGYAYTQGISGSLLSILMGVSAVAGLLGTVLFTKLRKAFGLVNTGVISSALHMLCLLLCVCSVFAPGSPIDLSV--LNIGNVSD 240          

HSP 2 Score: 82.8037 bits (203), Expect = 5.814e-17
Identity = 40/83 (48.19%), Postives = 56/83 (67.47%), Query Frame = 3
Query:  819 RIGLWMFDLTISQLLVEVVLEINRGKVNGVQNSLNMLFEMIKFTLVLVFPLPYQFGILVLLSVGAIGISNALYLVYAISQKCK 1067
            R+GLW FDLT++QLL E + E  RG VNGVQ+S+N L +++ F +V+  P P  FGILV++SV  I   + +Y +YA   K K
Sbjct:  305 RVGLWSFDLTVTQLLQESICESERGVVNGVQSSMNYLMDLLHFLMVIAAPQPQHFGILVIISVLFIFTGHTMYFLYARKAKRK 387          
BLAST of slc40a-1 vs. Ensembl Xenopus
Match: slc40a1 (solute carrier family 40 (iron-regulated transporter), member 1 [Source:NCBI gene;Acc:100036732])

HSP 1 Score: 150.214 bits (378), Expect = 9.335e-40
Identity = 125/383 (32.64%), Postives = 201/383 (52.48%), Query Frame = 3
Query:   42 KFSAMTSRFRLLDLCSKIVAPVIIGQIIYFAGKPIAAIVFSIQXXXXXXXXXXXXKIIYNRMPRLHYR-----EDL-------------SNLMRKATDETAPLPENEVTGSTNIPELPKVEIPSSYYSWYKCLIFFEGWIVYFQGNLKFAGLAMALLYMTVLGFDAVTIGYAISQGVSESMLSYFNXXXXXXXXXXXXXFPKIMKKTNIIFTGIIALSLQLIGLIPCLISVWAPGSPFDLN--------------------------YNGTNLVNVTDGSVLPIAXXXXXX---XXXXXXXXXXXXRIGLWMFDLTISQLLVEVVLEINRGKVNGVQNSLNMLFEMIKFTLVLVFPLPYQFGILVLLSVGAIGISNALYLVYA 1049
            + + M +  R +D  + I+AP+ +GQI+ F    I     +   ++++ +  FLL  +Y + P L  +     ED              +N   K T++   + E  V    N  E    E  +  +       F +GW+ Y+  ++ +AG+ +A LYMTVLGFD +T GYA +QG+S S+LS     +A++GIIG + F  + KK  +I TG I+   QL  LI C ISV+ PGS  DL+                          Y  T++ N+ + +    + + +S+   S+ LLF G+I +R+GLW FDLT++QL+ E V+E  RG +NGVQNS+N L +++ F +V++ P P  FG+LVL+SV  + + + +Y  YA
Sbjct:  168 RLADMNATVRRIDQLTNILAPLAVGQIMTFGSPVIGCGFIAGWNMLSMCVEYFLLWKVYQKTPALAIKSGKKDEDQELKQLNIQVIDTNTNNNEKPTEDVLLMGEKVVAVVDNQKEPSCTERMTEPFR-----TFRDGWVAYYNQSVFWAGMGLAFLYMTVLGFDCITTGYAYTQGLSGSVLSILMGASAVSGIIGTVAFTWLRKKCGLIRTGFISGVAQLSSLILCAISVFMPGSALDLSVSPFADISTRFLEGEPLPTVSPVPEVYLTTDIQNLINNATSQFSDSEASVPLISVSLLFAGVIAARVGLWSFDLTVTQLIQENVIESERGIINGVQNSMNYLLDLLHFIMVILGPNPEAFGLLVLISVSFVAMGHIMYFRYA 545          
BLAST of slc40a-1 vs. Ensembl Xenopus
Match: ENSXETT00000025371.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:9:39503308:39523316:1 gene:ENSXETG00000014425.1 transcript:ENSXETT00000025371.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 146.747 bits (369), Expect = 1.000e-38
Identity = 127/381 (33.33%), Postives = 191/381 (50.13%), Query Frame = 3
Query:   48 SAMTSRFRLLDLCSKIVAPVIIGQIIYFAGKPIAAIVFSIQXXXXXXXXXXXXKIIYNRMPRLHYREDLSNLMRKATDETAPLPENEVTGSTNIPELPKVEIPSSYYSWYKCLI--------------------FFEGWIVYFQGNLKFAGLAMALLYMTVLGFDAVTIGYAISQGVSESMLSYFNXXXXXXXXXXXXXFPKIMKKTNIIFTGIIALSLQLIGLIPCLISVWAPGSPFDLNYNGTNLVNVTDGSVLP---------------------------IAXXXXXXXXXXXXXXXXXXRIGLWMFDLTISQLLVEVVLEINRGKVNGVQNSLNMLFEMIKFTLVLVFPLPYQFGILVLLSVGAIGISNALYLVYA 1049
            + M +  R +D  + I+AP+ +GQI+ FA         S   L+++    FLL+ +Y+  P L               +T    EN      N+ E       S Y+ +Y  L+                    F +GWI+Y++     AGLA++ LYMTVLGFD+VT+GYA +QG+S S+LS     +AI GI+G + F    K+  +I TG I+   QL  L  C++SV+ PG    LN   T+  NV++  ++                            ++      S+ILLFTG+I SR GLW FDLT++QL+ E   E  RG +NGVQ+S+N L +M+ F +V++ P P  FG+LVL+SV  + + + LY  YA
Sbjct:  159 AGMNATIRRIDQVTNILAPMAVGQIMTFASLETGCGFVSAWNLMSVCAEYFLLRKLYDMTPEL-------------ASKTPQQEENMEMKQRNVQEYE-----SKYFFFYTILMWKLMMHITSCASECVKPFKTFQDGWILYYKQPFFLAGLALSFLYMTVLGFDSVTVGYAYTQGLSSSVLSILTGVSAIVGILGTMAFTWFQKRCGLIQTGGISGIGQLSSLTLCVVSVFMPGGS--LNLFNTSYANVSNNEIIEEYSISTYVPYTVLLEANITENSSSVSSVSMKEDLSSVILLFTGVIASRAGLWSFDLTVTQLIQENAKESERGIINGVQDSMNCLLDMLHFVMVIMAPNPESFGLLVLISVSFVAMGHMLYYCYA 519          
BLAST of slc40a-1 vs. Ensembl Xenopus
Match: ENSXETT00000025368.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:9:39503522:39523316:1 gene:ENSXETG00000014425.1 transcript:ENSXETT00000025368.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 146.747 bits (369), Expect = 1.179e-38
Identity = 127/381 (33.33%), Postives = 191/381 (50.13%), Query Frame = 3
Query:   48 SAMTSRFRLLDLCSKIVAPVIIGQIIYFAGKPIAAIVFSIQXXXXXXXXXXXXKIIYNRMPRLHYREDLSNLMRKATDETAPLPENEVTGSTNIPELPKVEIPSSYYSWYKCLI--------------------FFEGWIVYFQGNLKFAGLAMALLYMTVLGFDAVTIGYAISQGVSESMLSYFNXXXXXXXXXXXXXFPKIMKKTNIIFTGIIALSLQLIGLIPCLISVWAPGSPFDLNYNGTNLVNVTDGSVLP---------------------------IAXXXXXXXXXXXXXXXXXXRIGLWMFDLTISQLLVEVVLEINRGKVNGVQNSLNMLFEMIKFTLVLVFPLPYQFGILVLLSVGAIGISNALYLVYA 1049
            + M +  R +D  + I+AP+ +GQI+ FA         S   L+++    FLL+ +Y+  P L               +T    EN      N+ E       S Y+ +Y  L+                    F +GWI+Y++     AGLA++ LYMTVLGFD+VT+GYA +QG+S S+LS     +AI GI+G + F    K+  +I TG I+   QL  L  C++SV+ PG    LN   T+  NV++  ++                            ++      S+ILLFTG+I SR GLW FDLT++QL+ E   E  RG +NGVQ+S+N L +M+ F +V++ P P  FG+LVL+SV  + + + LY  YA
Sbjct:  156 AGMNATIRRIDQVTNILAPMAVGQIMTFASLETGCGFVSAWNLMSVCAEYFLLRKLYDMTPEL-------------ASKTPQQEENMEMKQRNVQEYE-----SKYFFFYTILMWKLMMHITSCASECVKPFKTFQDGWILYYKQPFFLAGLALSFLYMTVLGFDSVTVGYAYTQGLSSSVLSILTGVSAIVGILGTMAFTWFQKRCGLIQTGGISGIGQLSSLTLCVVSVFMPGGS--LNLFNTSYANVSNNEIIEEYSISTYVPYTVLLEANITENSSSVSSVSMKEDLSSVILLFTGVIASRAGLWSFDLTVTQLIQENAKESERGIINGVQDSMNCLLDMLHFVMVIMAPNPESFGLLVLISVSFVAMGHMLYYCYA 516          
BLAST of slc40a-1 vs. Ensembl Xenopus
Match: cul4a (cullin 4A [Source:Xenbase;Acc:XB-GENE-1014775])

HSP 1 Score: 144.821 bits (364), Expect = 4.707e-38
Identity = 123/364 (33.79%), Postives = 191/364 (52.47%), Query Frame = 3
Query:   42 KFSAMTSRFRLLDLCSKIVAPVIIGQIIYFAGKPIAAIVFSIQXXXXXXXXXXXXKIIYNRMPRL----------HYREDLSNLMRKATDETAPLPENEVTGSTNIPELPKVEIPSSYYSWYKCLIFFEGWIVYFQGNLKFAGLAMALLYMTVLGFDAVTIGYAISQGVSESMLSYFNXXXXXXXXXXXXXFPKIMKKTNIIFTGIIALSLQLIGLIPCLISVWAPGSPFDL----------NYNGTN----LVNVTDGSVLPIAXXXXXXXXXXXXXXXXXXRIGLWMFDLTISQLLVEVVLEINRGKVNGVQNSLNMLFEMIKFTLVLVFPLPYQFGILVLLSVGAIGISNALYLVYAISQK 1061
              + M +  R +D    I AP+ +GQ++ +A   +         LV+L +    L  +Y  +P+L          HY E    L+    +           G+ N   + ++          +  I  +GW  Y++ ++  AGL +A LY TVLGFD +T GYA +QG+S S+LS   A +AI+G++G  +F ++ +   ++ TGII+  L +  L+ C+ SV+APGSPFDL          + + TN    L N+  G         S ISIILLF G+I +RIGLW FDLT++QLL E + E  RG VNGVQ+S+N L +++ F +V++ P P QFG+LV++S   +   + +Y  Y    K
Sbjct:  141 HLAGMNATVRRMDQIINIFAPLSVGQVMTWASNVVGCGFILGWNLVSLLVEFIFLSKVYQMVPQLAIKPQQPIGEHYIERQLELLNVQGNFQLNTEVRAHMGTYNSETMKEITWSCKVRRMLR--ICTDGWKSYYRQSVFLAGLGLAFLYTTVLGFDCITTGYAYTQGISGSLLSLLMAVSAISGLMGTFLFTRLRRHYGLMVTGIISSCLHVCCLMLCVFSVFAPGSPFDLGIFSVLMDRSSIHWTNNTVLLENIHTGD-----HPDSYISIILLFLGVILARIGLWSFDLTVTQLLQENIPESERGVVNGVQSSMNYLMDLVHFIMVILAPQPQQFGLLVIISTLFVIAGHTMYFSYTRKYK 497          
BLAST of slc40a-1 vs. Ensembl Xenopus
Match: cul4a (cullin 4A [Source:Xenbase;Acc:XB-GENE-1014775])

HSP 1 Score: 142.51 bits (358), Expect = 2.821e-37
Identity = 126/357 (35.29%), Postives = 192/357 (53.78%), Query Frame = 3
Query:   42 KFSAMTSRFRLLDLCSKIVAPVIIGQIIYFAGKPIAAIVFSIQXXXXXXXXXXXXKIIYNRMPRLHYREDLSNLMRKATDETAPLPENEVTGSTNIPELPKVE--IPSSYYSWYKCL-IFFEGWIVYFQGNLKFAGLAMALLYMTVLGFDAVTIGYAISQGVSESMLSYFNXXXXXXXXXXXXXFPKIMKKTNIIFTGIIALSLQLIGLIPCLISVWAPGSPFDL----------NYNGTN----LVNVTDGSVLPIAXXXXXXXXXXXXXXXXXXRIGLWMFDLTISQLLVEVVLEINRGKVNGVQNSLNMLFEMIKFTLVLVFPLPYQFGILVLLSVGAIGISNALYLVYAISQK 1061
              + M +  R +D    I AP+ +GQ++ +A   +         LV+L +    L  +Y  +P+L            A     P+ E+ +       EL  V+     S  S  + L I  +GW  Y++ ++  AGL +A LY TVLGFD +T GYA +QG+S S+LS   A +AI+G++G  +F ++ +   ++ TGII+  L +  L+ C+ SV+APGSPFDL          + + TN    L N+  G         S ISIILLF G+I +RIGLW FDLT++QLL E + E  RG VNGVQ+S+N L +++ F +V++ P P QFG+LV++S   +   + +Y  Y    K
Sbjct:  141 HLAGMNATVRRMDQIINIFAPLSVGQVMTWASNVVGCGFILGWNLVSLLVEFIFLSKVYQMVPQL------------AIKPQQPIGEHYIERQL---ELLNVQGNFQRSKGSLRRMLRICTDGWKSYYRQSVFLAGLGLAFLYTTVLGFDCITTGYAYTQGISGSLLSLLMAVSAISGLMGTFLFTRLRRHYGLMVTGIISSCLHVCCLMLCVFSVFAPGSPFDLGIFSVLMDRSSIHWTNNTVLLENIHTGD-----HPDSYISIILLFLGVILARIGLWSFDLTVTQLLQENIPESERGVVNGVQSSMNYLMDLVHFIMVILAPQPQQFGLLVIISTLFVIAGHTMYFSYTRKYK 477          
BLAST of slc40a-1 vs. Ensembl Mouse
Match: Slc40a1 (solute carrier family 40 (iron-regulated transporter), member 1 [Source:MGI Symbol;Acc:MGI:1315204])

HSP 1 Score: 164.081 bits (414), Expect = 6.160e-45
Identity = 131/377 (34.75%), Postives = 200/377 (53.05%), Query Frame = 3
Query:   42 KFSAMTSRFRLLDLCSKIVAPVIIGQIIYFAGKPIAAIVFSIQXXXXXXXXXXXXKIIYNRMPRLHYR-------EDLSNLMRKATDETAPLPENEVTG--STNIPELPKVEIPSSYYSWYKCL-IFFEGWIVYFQGNLKFAGLAMALLYMTVLGFDAVTIGYAISQGVSESMLSYFNXXXXXXXXXXXXXFPKIMKKTNIIFTGIIALSLQLIGLIPCLISVWAPGSPFDLN-------------------------------YNGTNLVNVTDGSVLPIAXXXXXXXXXXXXXXXXXXRIGLWMFDLTISQLLVEVVLEINRGKVNGVQNSLNMLFEMIKFTLVLVFPLPYQFGILVLLSVGAIGISNALYLVYA 1049
            + + M +  R +D  + I+AP+ +GQI+ F    I     S   LV++ +  FLL  +Y + P L  +        +L  L      E  PL    + G   +NI EL   + P+      +    F +GW+ Y+   +  AG+ +A LYMTVLGFD +T GYA +QG+S S+LS     +AITGI+G + F  + +K  ++ TG+ +   QL  LI C+ISV+ PGSP DL+                                + +N+ NV + S  PI      +S+ LLF G+I +RIGLW FDLT++QLL E V+E  RG +NGVQNS+N L +++ F +V++ P P  FG+LVL+SV  + + + +Y  +A
Sbjct:  169 RLADMNATIRRIDQLTNILAPMAVGQIMTFGSPVIGCGFISGWNLVSMCVEYFLLWKVYQKTPALAVKAALKVEESELKQLTSPKDTEPKPLEGTHLMGEKDSNIRELECEQEPTCASQMAEPFRTFRDGWVSYYNQPVFLAGMGLAFLYMTVLGFDCITTGYAYTQGLSGSILSILMGASAITGIMGTVAFTWLRRKCGLVRTGLFSGLAQLSCLILCVISVFMPGSPLDLSVSPFEDIRSRFVNVEPVSPTTKIPETVFTTEMHMSNMSNVHEMSTKPIP----IVSVSLLFAGVIAARIGLWSFDLTVTQLLQENVIESERGIINGVQNSMNYLLDLLHFIMVILAPNPEAFGLLVLISVSFVAMGHLMYFRFA 541          
BLAST of slc40a-1 vs. UniProt/SwissProt
Match: sp|Q9NP59|S40A1_HUMAN (Solute carrier family 40 member 1 OS=Homo sapiens OX=9606 GN=SLC40A1 PE=1 SV=1)

HSP 1 Score: 166.007 bits (419), Expect = 9.333e-45
Identity = 134/380 (35.26%), Postives = 200/380 (52.63%), Query Frame = 3
Query:   42 KFSAMTSRFRLLDLCSKIVAPVIIGQIIYFAGKPIAAIVFSIQXXXXXXXXXXXXKIIYNRMPRLHYRE-------DLSNLMRKATDETAPLPENEVTG--STNIPELPKVEIPSSYYSWYKCL-IFFEGWIVYFQGNLKFAGLAMALLYMTVLGFDAVTIGYAISQGVSESMLSYFNXXXXXXXXXXXXXFPKIMKKTNIIFTGIIALSLQLIGLIPCLISVWAPGSPFDLNY-------------------------------NGTNLVNV---TDGSVLPIAXXXXXXXXXXXXXXXXXXRIGLWMFDLTISQLLVEVVLEINRGKVNGVQNSLNMLFEMIKFTLVLVFPLPYQFGILVLLSVGAIGISNALYLVYA 1049
            K + M +  R +D  + I+AP+ +GQI+ F    I     S   LV++ +   LL  +Y + P L  +        +L  L      E  PL    + G   +NI EL   + P+      +    F +GW+ Y+   +  AG+ +A LYMTVLGFD +T GYA +QG+S S+LS     +AITGI+G + F  + +K  ++ TG+I+   QL  LI C+ISV+ PGSP DL+                                NG+N  N+   T    +PI      IS+ LLF G+I +RIGLW FDLT++QLL E V+E  RG +NGVQNS+N L +++ F +V++ P P  FG+LVL+SV  + + + +Y  +A
Sbjct:  169 KLANMNATIRRIDQLTNILAPMAVGQIMTFGSPVIGCGFISGWNLVSMCVEYVLLWKVYQKTPALAVKAGLKEEETELKQLNLHKDTEPKPLEGTHLMGVKDSNIHELEHEQEPTCASQMAEPFRTFRDGWVSYYNQPVFLAGMGLAFLYMTVLGFDCITTGYAYTQGLSGSILSILMGASAITGIMGTVAFTWLRRKCGLVRTGLISGLAQLSCLILCVISVFMPGSPLDLSVSPFEDIRSRFIQGESITPTKIPEITTEIYMSNGSNSANIVPETSPESVPI------ISVSLLFAGVIAARIGLWSFDLTVTQLLQENVIESERGIINGVQNSMNYLLDLLHFIMVILAPNPEAFGLLVLISVSFVAMGHIMYFRFA 542          
BLAST of slc40a-1 vs. UniProt/SwissProt
Match: sp|Q9JHI9|S40A1_MOUSE (Solute carrier family 40 member 1 OS=Mus musculus OX=10090 GN=Slc40a1 PE=1 SV=1)

HSP 1 Score: 164.081 bits (414), Expect = 4.309e-44
Identity = 131/377 (34.75%), Postives = 200/377 (53.05%), Query Frame = 3
Query:   42 KFSAMTSRFRLLDLCSKIVAPVIIGQIIYFAGKPIAAIVFSIQXXXXXXXXXXXXKIIYNRMPRLHYR-------EDLSNLMRKATDETAPLPENEVTG--STNIPELPKVEIPSSYYSWYKCL-IFFEGWIVYFQGNLKFAGLAMALLYMTVLGFDAVTIGYAISQGVSESMLSYFNXXXXXXXXXXXXXFPKIMKKTNIIFTGIIALSLQLIGLIPCLISVWAPGSPFDLN-------------------------------YNGTNLVNVTDGSVLPIAXXXXXXXXXXXXXXXXXXRIGLWMFDLTISQLLVEVVLEINRGKVNGVQNSLNMLFEMIKFTLVLVFPLPYQFGILVLLSVGAIGISNALYLVYA 1049
            + + M +  R +D  + I+AP+ +GQI+ F    I     S   LV++ +  FLL  +Y + P L  +        +L  L      E  PL    + G   +NI EL   + P+      +    F +GW+ Y+   +  AG+ +A LYMTVLGFD +T GYA +QG+S S+LS     +AITGI+G + F  + +K  ++ TG+ +   QL  LI C+ISV+ PGSP DL+                                + +N+ NV + S  PI      +S+ LLF G+I +RIGLW FDLT++QLL E V+E  RG +NGVQNS+N L +++ F +V++ P P  FG+LVL+SV  + + + +Y  +A
Sbjct:  169 RLADMNATIRRIDQLTNILAPMAVGQIMTFGSPVIGCGFISGWNLVSMCVEYFLLWKVYQKTPALAVKAALKVEESELKQLTSPKDTEPKPLEGTHLMGEKDSNIRELECEQEPTCASQMAEPFRTFRDGWVSYYNQPVFLAGMGLAFLYMTVLGFDCITTGYAYTQGLSGSILSILMGASAITGIMGTVAFTWLRRKCGLVRTGLFSGLAQLSCLILCVISVFMPGSPLDLSVSPFEDIRSRFVNVEPVSPTTKIPETVFTTEMHMSNMSNVHEMSTKPIP----IVSVSLLFAGVIAARIGLWSFDLTVTQLLQENVIESERGIINGVQNSMNYLLDLLHFIMVILAPNPEAFGLLVLISVSFVAMGHLMYFRFA 541          
BLAST of slc40a-1 vs. UniProt/SwissProt
Match: sp|Q9I9R3|S40A1_DANRE (Solute carrier family 40 member 1 OS=Danio rerio OX=7955 GN=slc40a1 PE=2 SV=2)

HSP 1 Score: 163.696 bits (413), Expect = 4.935e-44
Identity = 127/373 (34.05%), Postives = 204/373 (54.69%), Query Frame = 3
Query:   42 KFSAMTSRFRLLDLCSKIVAPVIIGQIIYFAGKPIAAIVFSIQXXXXXXXXXXXXKIIYNRMPRLHYR--------EDLS--NLMRKATDETAPLPENEVTGSTNIPELPKVEIPSSYYSWYKCLIFFEGWIVYFQGNLKFAGLAMALLYMTVLGFDAVTIGYAISQGVSESMLSYFNXXXXXXXXXXXXXFPKIMKKTNIIFTGIIALSLQLIGLIPCLISVWAPGSPFDLNYNGTNLV---------------------------NVTDGSVLPIAXXXXXXXXXXXXXXXXXXRIGLWMFDLTISQLLVEVVLEINRGKVNGVQNSLNMLFEMIKFTLVLVFPLPYQFGILVLLSVGAIGISNALYLVYA 1049
            K + M +  R++D  + I+AP+++GQI+ F    I     S   L ++ L  FLL  +Y + P L ++        ++L   N+ ++  +  +P+  +++   ++    PK +    Y        F +GW+ Y+  ++ FAG+++A LYMTVLGFD +T GYA +QG++ S+LS     +A++GI G + F  I KK  +I TG IA   QL  L  C+ SV+APGSPFDL+ +    V                           NVT     P     S +S+ LLF G+I +R+GLW FDLT++QL+ E V+E  RG +NGVQNS+N L +++ F +V++ P P  FG+LV++SV  + + + +Y  +A
Sbjct:  166 KLADMNATVRIIDQLTNILAPMLVGQIMAFGSHFIGCGFISGWNLFSMCLEYFLLWKVYQKTPALAFKAGQKDSDDQELKHLNIQKEIGNTESPVEASQLMTESS---EPKKDTGCCYQMAEPIRTFKDGWVAYYNQSIFFAGMSLAFLYMTVLGFDCITTGYAYTQGLNGSVLSLLMGASAVSGICGTVAFTWIRKKCGLIRTGFIAGVTQLSCLTLCVASVFAPGSPFDLSVSPFEEVLRHLFGDSGSLRESPTFIPTTEPPIQANVTVFEEAP--PVESYMSVGLLFAGVIAARVGLWSFDLTVTQLIQENVIESERGVINGVQNSMNYLLDLLHFIMVILAPNPEAFGLLVIISVSFVAMGHMMYFRFA 533          
BLAST of slc40a-1 vs. UniProt/SwissProt
Match: sp|Q923U9|S40A1_RAT (Solute carrier family 40 member 1 OS=Rattus norvegicus OX=10116 GN=Slc40a1 PE=2 SV=2)

HSP 1 Score: 159.073 bits (401), Expect = 2.962e-42
Identity = 129/373 (34.58%), Postives = 198/373 (53.08%), Query Frame = 3
Query:   42 KFSAMTSRFRLLDLCSKIVAPVIIGQIIYFAGKPIAAIVFSIQXXXXXXXXXXXXKIIYNRMPRLHYR-------EDLSNLMRKATDETAPLPENEVTG--STNIPELPKVEIPSSYYSWYKCL-IFFEGWIVYFQGNLKFAGLAMALLYMTVLGFDAVTIGYAISQGVSESMLSYFNXXXXXXXXXXXXXFPKIMKKTNIIFTGIIALSLQLIGLIPCLISVWAPGSPFDLNYNG---------------------------TNLVNVTDGSVLPIAXXXXXXXXXXXXXXXXXXRIGLWMFDLTISQLLVEVVLEINRGKVNGVQNSLNMLFEMIKFTLVLVFPLPYQFGILVLLSVGAIGISNALYLVYA 1049
            + + M +  R +D  + I+AP+ +GQI+ F    I     S   LV++ +  FLL  +Y + P L  +        +L  L      E  PL    + G   +NI EL   + P+      +    F +GW+ Y+   +  AG+ +A LYMTVLGFD +T GYA +QG+S S+LS     +AITGI+G + F  + +K  ++ TG+ +   QL  LI C+ISV+ PGSP DL+ +                            +N+ NV +        +   IS+ LLF G+I +RIGLW FDLT++QLL E V+E  RG +NGVQNS+N L +++ F +V++ P P  FG+LVL+SV  + + + +Y  +A
Sbjct:  169 RLADMNATIRRIDQLTNILAPMAVGQIMTFGSPVIGCGFISGWNLVSMCVEYFLLWKVYQKTPALAVKAALKVEESELKQLTSPKDTEPKPLEGTHLMGEKDSNIRELECEQEPTCASQIAEPFRTFRDGWVSYYNQPVFLAGMGLAFLYMTVLGFDCITTGYAYTQGLSGSILSVLMGASAITGIMGTVAFTWLRRKCGLVRTGLFSGLAQLSCLILCVISVFMPGSPLDLSVSPFEDIRSRFIHEEAVSSTTKIPETEMLMSNVSNVVNTVHEMSTKSVPIISVSLLFAGVIAARIGLWSFDLTVTQLLQENVIESERGIINGVQNSMNYLLDLLHFIMVILAPNPEAFGLLVLISVSFVAMGHLMYFRFA 541          
BLAST of slc40a-1 vs. UniProt/SwissProt
Match: sp|O80905|S40A1_ARATH (Solute carrier family 40 member 1 OS=Arabidopsis thaliana OX=3702 GN=IREG1 PE=3 SV=1)

HSP 1 Score: 90.1225 bits (222), Expect = 3.036e-18
Identity = 87/342 (25.44%), Postives = 154/342 (45.03%), Query Frame = 3
Query:   45 FSAMTSRFRLLDLCSKIVAPVIIGQIIYFAGKPIAAIVFSIQXXXXXXXXXXXXKIIYNRMP---RLHYREDLSNLMRKATDETAPL-----PENEVTGSTNIPELPKVEIPSSYYSWYKCLIFFEGWIVYFQGNLKFAGLAMALLYMTVLGFDAVTIGYAISQGVSESMLSYFNXXXXXXXXXXXXXFPKIMKKTNIIFTGIIALSLQLIGLIPCLISVWAPGSPFDLNYNGTNLVNVTDGSVLPIAXXXXXXXXXXXXXXXXXXRIGLWMFDLTISQLLVEVVLEINRGKVNGVQNSLNMLFEMIKFTLVLVFPLPYQFGILVLLSVGAIGISNALYLVY 1046
             + M S  R +DL SK+++PVI G II F     +AI F+    +T  +  +L   +Y+ +P   R + R  L +  ++     AP+     P  E   + N P    + +     S      F   W +YF   +   G+++ALL+ TVL F  +       +G+   ++      +A  G+   L++P +  + + + TG+ +   Q   L+ C+ S+W                     S + +AG ++S             R+GLWMFDL + Q + ++V E +R  V GVQNSL    +++ + L ++   P  F IL L+S   + ++  LY ++
Sbjct:  182 LTKMNSVIRGIDLSSKLLSPVITGLIISFVSLKASAITFAAWATITAWVEYWLFISVYSGVPAITRSNERRILRSRTKQVEGRDAPVSVSIVPGTEEGYTGNPPSRTGILVILDRMSKSS---FVGAWRIYFNQEVVLPGVSLALLFFTVLSFGTLMTATLQWEGIPTYIIGIGRGISATVGLAATLVYPLMQSRLSTLRTGLWSFWSQWSCLLVCVGSIWVKKDKI--------------ASYMLMAGVAAS-------------RLGLWMFDLAVIQQMQDLVSESDRCVVGGVQNSLQSALDLMAYLLGIIVSNPKDFWILTLISFSTVSLAGMLYTIH 493          
BLAST of slc40a-1 vs. TrEMBL
Match: A0A0H3YJL2 (Solute carrier family 40 protein (Fragment) OS=Schmidtea mediterranea OX=79327 GN=slc40a-1 PE=2 SV=1)

HSP 1 Score: 595.504 bits (1534), Expect = 0.000e+0
Identity = 344/345 (99.71%), Postives = 344/345 (99.71%), Query Frame = 3
Query:   48 SAMTSRFRLLDLCSKIVAPVIIGQIIYFAGKPIAAIVFSIQXXXXXXXXXXXXKIIYNRMPRLHYREDLSNLMRKATDETAPLPENEVTGSTNIPELPKVEIPSSYYSWYKCLIFFEGWIVYFQGNLKFAGLAMALLYMTVLGFDAVTIGYAISQGVSESMLSYFNXXXXXXXXXXXXXFPKIMKKTNIIFTGIIALSLQLIGLIPCLISVWAPGSPFDLNYNGTNLVNVTDGSVLPIAXXXXXXXXXXXXXXXXXXRIGLWMFDLTISQLLVEVVLEINRGKVNGVQNSLNMLFEMIKFTLVLVFPLPYQFGILVLLSVGAIGISNALYLVYAISQKCKIDSQL 1082
            S MTSRFRLLDLCSKIVAPVIIGQIIYFAGKPIAAIVFSIQVLVTLGLFTFLLKIIYNRMPRLHYREDLSNLMRKATDETAPLPENEVTGSTNIPELPKVEIPSSYYSWYKCLIFFEGWIVYFQGNLKFAGLAMALLYMTVLGFDAVTIGYAISQGVSESMLSYFNAGAAITGIIGALIFPKIMKKTNIIFTGIIALSLQLIGLIPCLISVWAPGSPFDLNYNGTNLVNVTDGSVLPIAGTSSSISIILLFTGIIGSRIGLWMFDLTISQLLVEVVLEINRGKVNGVQNSLNMLFEMIKFTLVLVFPLPYQFGILVLLSVGAIGISNALYLVYAISQKCKIDSQL
Sbjct:  186 STMTSRFRLLDLCSKIVAPVIIGQIIYFAGKPIAAIVFSIQVLVTLGLFTFLLKIIYNRMPRLHYREDLSNLMRKATDETAPLPENEVTGSTNIPELPKVEIPSSYYSWYKCLIFFEGWIVYFQGNLKFAGLAMALLYMTVLGFDAVTIGYAISQGVSESMLSYFNAGAAITGIIGALIFPKIMKKTNIIFTGIIALSLQLIGLIPCLISVWAPGSPFDLNYNGTNLVNVTDGSVLPIAGTSSSISIILLFTGIIGSRIGLWMFDLTISQLLVEVVLEINRGKVNGVQNSLNMLFEMIKFTLVLVFPLPYQFGILVLLSVGAIGISNALYLVYAISQKCKIDSQL 530          
BLAST of slc40a-1 vs. TrEMBL
Match: A0A2C9K739 (Solute carrier family 40 protein OS=Biomphalaria glabrata OX=6526 GN=106053919 PE=3 SV=1)

HSP 1 Score: 176.407 bits (446), Expect = 3.476e-46
Identity = 139/389 (35.73%), Postives = 209/389 (53.73%), Query Frame = 3
Query:   42 KFSAMTSRFRLLDLCSKIVAPVIIGQIIYFAGKPIAAIVFSIQXXXXXXXXXXXXKIIYNRMPRLHYREDL----------SNLMRK--ATDETAPLPE--------------------NEVTGSTNIPELP----KVEIPSSYYSWYKCL-IFFEGWIVYFQGNLKFAGLAMALLYMTVLGFDAVTIGYAISQGVSESMLSYFNXXXXXXXXXXXXXFPKIMKKTNIIFTGIIALSLQLIGLIPCLISVWAPGSPFDL----NYNGTNLVNVTD--------GSVLPIAXXXXXXXXXXX----XXXXXXXRIGLWMFDLTISQLLVEVVLEINRGKVNGVQNSLNMLFEMIKFTLVLVFPLPYQFGILVLLSVGAIGISNALYLVYA 1049
            + + MT+  R +DL ++I+AP+  G I+  AG    AI        ++ +  + L  +YN +P L  +++L           NL+++  A D+  PL E                    NE   +  I   P    KV+   ++   +  L   + GW VY   +++ AGLA+A LYMTVLGFD+VT+GYA +QGVSE ++    A AA  GI G  ++P + ++  +  TGI  LSLQ+  L+ C++SVW PGS FDL    N N TN + ++          S +P +  + S+S  +       GII +R GLW+ DLT+SQL +E V E  RGKVNGVQ+SLN L +M+K+ +V++ P  +QFG+LV +S G I I    +L YA
Sbjct:  158 RLATMTAALRRIDLSTQILAPMATGFIMALAGVEFGAIFIGAWNFGSVFIEYYFLWKVYNTVPALMKKKNLKKSQVATELKENLVKEKDAFDQGRPLEECMTLQDKDNLDTTDDEKKEENEALNNQEISVTPETEKKVKKKCTFTRLFNSLERLYLGWPVYVSYDIRNAGLALACLYMTVLGFDSVTVGYAKTQGVSELLVGIMMALAASFGIFGTFMYPYMRRRLGLARTGIFGLSLQITCLVLCVVSVWMPGSKFDLFLDTNLNATNAMELSCIENSTLDVNSTIPCSKETLSLSENVSIWMLLAGIITARFGLWVADLTVSQLFMESVAEKERGKVNGVQSSLNQLMDMLKYLMVVLAPHEHQFGLLVHISFGFICIG---WLFYA 543          
BLAST of slc40a-1 vs. TrEMBL
Match: A0A2C9K780 (Solute carrier family 40 protein OS=Biomphalaria glabrata OX=6526 GN=106053919 PE=3 SV=1)

HSP 1 Score: 176.792 bits (447), Expect = 3.576e-46
Identity = 139/389 (35.73%), Postives = 209/389 (53.73%), Query Frame = 3
Query:   42 KFSAMTSRFRLLDLCSKIVAPVIIGQIIYFAGKPIAAIVFSIQXXXXXXXXXXXXKIIYNRMPRLHYREDL----------SNLMRK--ATDETAPLPE--------------------NEVTGSTNIPELP----KVEIPSSYYSWYKCL-IFFEGWIVYFQGNLKFAGLAMALLYMTVLGFDAVTIGYAISQGVSESMLSYFNXXXXXXXXXXXXXFPKIMKKTNIIFTGIIALSLQLIGLIPCLISVWAPGSPFDL----NYNGTNLVNVTD--------GSVLPIAXXXXXXXXXXX----XXXXXXXRIGLWMFDLTISQLLVEVVLEINRGKVNGVQNSLNMLFEMIKFTLVLVFPLPYQFGILVLLSVGAIGISNALYLVYA 1049
            + + MT+  R +DL ++I+AP+  G I+  AG    AI        ++ +  + L  +YN +P L  +++L           NL+++  A D+  PL E                    NE   +  I   P    KV+   ++   +  L   + GW VY   +++ AGLA+A LYMTVLGFD+VT+GYA +QGVSE ++    A AA  GI G  ++P + ++  +  TGI  LSLQ+  L+ C++SVW PGS FDL    N N TN + ++          S +P +  + S+S  +       GII +R GLW+ DLT+SQL +E V E  RGKVNGVQ+SLN L +M+K+ +V++ P  +QFG+LV +S G I I    +L YA
Sbjct:  175 RLATMTAALRRIDLSTQILAPMATGFIMALAGVEFGAIFIGAWNFGSVFIEYYFLWKVYNTVPALMKKKNLKKSQVATELKENLVKEKDAFDQGRPLEECMTLQDKDNLDTTDDEKKEENEALNNQEISVTPETEKKVKKKCTFTRLFNSLERLYLGWPVYVSYDIRNAGLALACLYMTVLGFDSVTVGYAKTQGVSELLVGIMMALAASFGIFGTFMYPYMRRRLGLARTGIFGLSLQITCLVLCVVSVWMPGSKFDLFLDTNLNATNAMELSCIENSTLDVNSTIPCSKETLSLSENVSIWMLLAGIITARFGLWVADLTVSQLFMESVAEKERGKVNGVQSSLNQLMDMLKYLMVVLAPHEHQFGLLVHISFGFICIG---WLFYA 560          
BLAST of slc40a-1 vs. TrEMBL
Match: A0A2C9K741 (Solute carrier family 40 protein OS=Biomphalaria glabrata OX=6526 GN=106053919 PE=3 SV=1)

HSP 1 Score: 176.407 bits (446), Expect = 4.512e-46
Identity = 139/389 (35.73%), Postives = 209/389 (53.73%), Query Frame = 3
Query:   42 KFSAMTSRFRLLDLCSKIVAPVIIGQIIYFAGKPIAAIVFSIQXXXXXXXXXXXXKIIYNRMPRLHYREDL----------SNLMRK--ATDETAPLPE--------------------NEVTGSTNIPELP----KVEIPSSYYSWYKCL-IFFEGWIVYFQGNLKFAGLAMALLYMTVLGFDAVTIGYAISQGVSESMLSYFNXXXXXXXXXXXXXFPKIMKKTNIIFTGIIALSLQLIGLIPCLISVWAPGSPFDL----NYNGTNLVNVTD--------GSVLPIAXXXXXXXXXXX----XXXXXXXRIGLWMFDLTISQLLVEVVLEINRGKVNGVQNSLNMLFEMIKFTLVLVFPLPYQFGILVLLSVGAIGISNALYLVYA 1049
            + + MT+  R +DL ++I+AP+  G I+  AG    AI        ++ +  + L  +YN +P L  +++L           NL+++  A D+  PL E                    NE   +  I   P    KV+   ++   +  L   + GW VY   +++ AGLA+A LYMTVLGFD+VT+GYA +QGVSE ++    A AA  GI G  ++P + ++  +  TGI  LSLQ+  L+ C++SVW PGS FDL    N N TN + ++          S +P +  + S+S  +       GII +R GLW+ DLT+SQL +E V E  RGKVNGVQ+SLN L +M+K+ +V++ P  +QFG+LV +S G I I    +L YA
Sbjct:  172 RLATMTAALRRIDLSTQILAPMATGFIMALAGVEFGAIFIGAWNFGSVFIEYYFLWKVYNTVPALMKKKNLKKSQVATELKENLVKEKDAFDQGRPLEECMTLQDKDNLDTTDDEKKEENEALNNQEISVTPETEKKVKKKCTFTRLFNSLERLYLGWPVYVSYDIRNAGLALACLYMTVLGFDSVTVGYAKTQGVSELLVGIMMALAASFGIFGTFMYPYMRRRLGLARTGIFGLSLQITCLVLCVVSVWMPGSKFDLFLDTNLNATNAMELSCIENSTLDVNSTIPCSKETLSLSENVSIWMLLAGIITARFGLWVADLTVSQLFMESVAEKERGKVNGVQSSLNQLMDMLKYLMVVLAPHEHQFGLLVHISFGFICIG---WLFYA 557          
BLAST of slc40a-1 vs. TrEMBL
Match: T1JCZ3 (Solute carrier family 40 protein OS=Strigamia maritima OX=126957 PE=3 SV=1)

HSP 1 Score: 172.17 bits (435), Expect = 3.778e-45
Identity = 131/345 (37.97%), Postives = 190/345 (55.07%), Query Frame = 3
Query:   54 MTSRFRLLDLCSKIVAPVIIGQIIYFAGKPIAAIVFSIQXXXXXXXXXXXXKIIYNRMPRLHYREDLSNLMRKATDETAPLPENEVTGSTNIPELPKVEIPSSYYSWYKCLIFFEGWIVYFQGNLKFAGLAMALLYMTVLGFDAVTIGYAISQGVSESMLSYFNXXXXXXXXXXXXXFPKIMKKTNIIFTGIIALSLQLIGLIPCLISVWAPGSPFDLNY-----NGTNLVNVTDGSVLPIAXXXXXXXXXXXXXXXXXXRIGLWMFDLTISQLLVEVVLEINRGKVNGVQNSLNMLFEMIKFTLVLVFPLPYQFGILVLLSVGAIGISNALYLVYAISQKCKID 1073
            M +  R +DL S I AP+I GQ++ +    I AI  ++  LV++ +  FL+  +Y   P L  ++      ++     + L  N V  +    E       S+ ++      FF GW +YFQ N+ FAGL +A LYMTVLGFD++T GYA  QGVS ++L   +A  A+ GI+G L++P++  +  I  TG+    +++  L  C++SVW PGSPF+  Y         + N T      I    S  SI LL TGI+ +R GLWM DLT++QLL E V E  RG VNGVQNS+NM+  M+KF LV+ FP    FG L+++S   I I   LY +Y+   +  I 
Sbjct:  131 MNAMARRIDLTSLICAPIITGQLMTYTSMVITAIFIAVWNLVSMFVEFFLISKLYYSTPALATKKSFK---KRVASFASSLSRNAVVQAQIRAEDDN---SSNLFA-----SFFNGWKLYFQQNVVFAGLGLACLYMTVLGFDSITQGYANQQGVSAAVLGGISAVGAVVGILGTLVYPRLRDRIGIERTGLYGFFMEVACLTLCIVSVWMPGSPFEAVYWCYDKKTFEMQNSTSVIKEEIKKDESYTSIALLMTGIVTARFGLWMADLTVNQLLQEEVAEEYRGAVNGVQNSINMVMNMLKFILVVSFPCHQTFGYLIIVSFAFICIGWFLYCIYSYKMRGHIS 464          
BLAST of slc40a-1 vs. Ensembl Cavefish
Match: slc40a1 (solute carrier family 40 member 1 [Source:NCBI gene;Acc:103025312])

HSP 1 Score: 160.999 bits (406), Expect = 6.416e-44
Identity = 123/375 (32.80%), Postives = 202/375 (53.87%), Query Frame = 3
Query:   42 KFSAMTSRFRLLDLCSKIVAPVIIGQIIYFAGKPIAAIVFSIQXXXXXXXXXXXXKIIYNRMPRLHYR--------EDLS--NLMRKATDETAPLPENEVTGSTNIPELPKVEIPSSYYSWYK-CLIFFEGWIVYFQGNLKFAGLAMALLYMTVLGFDAVTIGYAISQGVSESMLSYFNXXXXXXXXXXXXXFPKIMKKTNIIFTGIIALSLQLIGLIPCLISVWAPGSPFDLNYNG--------------------TNLVNVTDGSVLPIAXXXXXX--------XXXXXXXXXXXXRIGLWMFDLTISQLLVEVVLEINRGKVNGVQNSLNMLFEMIKFTLVLVFPLPYQFGILVLLSVGAIGISNALYLVYA 1049
              + M +  R++D  + I+AP+++GQI+ F    +     +   L ++ L  FLL  +Y + P L  +        ++L   N+ ++      P+  +++   + + +  K E P   Y   +    F +GW+ Y+  N+ FAG+++A LYMTVLGFD +T GYA +QG++ S+LS     +A+ GI G + F  + KK  +I TG IA   QL  L+ C+ SV+APGSPFDL+ +                      +L+     +VL I+   S          S+ LLF G+I +R+GLW FDLT++QL+ E V E  RG +NGVQNS+N L +++ F +V++ P    FG+LV++SV  + + + +Y  +A
Sbjct:  166 SLADMNATVRIIDQLTNILAPMLVGQIMAFGSHFMGCGFIAGWNLCSMCLEYFLLWKVYQKTPALAIKAGQKVTDSQELKQLNIQKELELTDGPVEGSQLMNESAVVKSDKEENPGCCYQMSEPVRTFRDGWVAYYNQNIFFAGMSLAFLYMTVLGFDCITTGYAYTQGLNGSILSLLMGASAVAGICGTVAFTWVRKKCGLIRTGFIAGMAQLSCLMLCVASVFAPGSPFDLSVSPFQSMVRHLLGDQAPLPEATMASLIATEAPAVLNISTMISEEVPHIESYLSVSLLFAGVIAARVGLWSFDLTVTQLIQENVAEAERGVINGVQNSMNYLLDLLHFVMVILAPNQEAFGLLVIISVSFVAMGHMMYFRFA 540          
BLAST of slc40a-1 vs. Ensembl Sea Lamprey
Match: slc40a1 (solute carrier family 40 member 1 [Source:NCBI gene;Acc:58153])

HSP 1 Score: 166.392 bits (420), Expect = 1.269e-46
Identity = 130/376 (34.57%), Postives = 206/376 (54.79%), Query Frame = 3
Query:   42 KFSAMTSRFRLLDLCSKIVAPVIIGQIIYFAGKPIAAIVFSIQXXXXXXXXXXXXKIIYNRMPRLHYREDLSNLMRKATDETAPLPENEVTGS-----TNIPELPKVEIPSSYYSWYKCL----IFFEGWIVYFQGNLKFAGLAMALLYMTVLGFDAVTIGYAISQGVSESMLSYFNXXXXXXXXXXXXXFPKIMKKTNIIFTGIIALSLQLIGLIPCLISVWAPGSPFDLN---------------------YNGTNLVNVTDGSVLP----------IAXXXXXXXXXXXXXXXXXXRIGLWMFDLTISQLLVEVVLEINRGKVNGVQNSLNMLFEMIKFTLVLVFPLPYQFGILVLLSVGAIGISNALYLVYA 1049
            + + M +  R +D  S ++AP+ +GQ++ FA   +A    ++  L ++ +  +LL+ +Y  +P L ++   +     +  E  PL   +VTG+     + I +  + E P+    W          + GW+ Y +  +  AG+ +A LYMTVLGFD +T GYA +QG+S S+L    A +A+ G++G ++F ++ +   ++ TG+++   QL  L  C +SV+APGSPFDL+                      NG++ V  T  S +            A   S +S+ LLFTG+I +RIGLW FDLT++QLL E V E  RG V+GVQ+SLN L +++ FT VL+ P P  FG+LVLLSV  +   +AL+L YA
Sbjct:  167 RLADMNAILRRIDQVSNVLAPLAVGQLVSFASSSVACAFVAVWNLGSMAVEYWLLRRVYLAVPALAHKAG-AEWPPASALEMQPLGA-DVTGAPAEAKSLIGKGAEEERPAPTSRWLHVTEPFRTLWRGWVTYRRQPVYLAGVGLACLYMTVLGFDCITTGYAYTQGISASLLGILIALSAVAGLLGTVVFTQLRRAVGLVRTGLLSGVAQLAALSLCAVSVFAPGSPFDLSISPFRSIGVGMAGDSTDALVQRNGSDFVASTMSSRVASNATWDDEPDFAPPDSYVSVALLFTGVIAARIGLWSFDLTVTQLLQETVAEHERGVVSGVQSSLNYLLDLLHFTAVLLAPEPPAFGLLVLLSVAFVVTGHALFLAYA 540          
BLAST of slc40a-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004589.1 (pep scaffold:Pmarinus_7.0:GL476518:262388:271296:1 gene:ENSPMAG00000004168.1 transcript:ENSPMAT00000004589.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 93.2041 bits (230), Expect = 1.856e-22
Identity = 71/199 (35.68%), Postives = 103/199 (51.76%), Query Frame = 3
Query:  399 GWIVYFQGNLKFAGLAMALLYMTVLGFDAVTIGYAISQGVSESMLSYFNXXXXXXXXXXXXXFPKIMKKTNIIFTGIIALSLQLIGLIPCLISVWAPGSPFDLN-------------------------------YNGTNLVNV-TDGSVLPIAXXXXXXXXXXXXXXXXXXRIGLWMFDLTISQLLVEVVLEINRGKV 899
            GW+ Y++ +    GL +A LYMTVLGFD +T GYA +QGVS S+LS     +A  G++G +++ +  ++  ++ TG +    Q+  L+ C++SV+APGSP DL                                 NGT   NV T+G+           SI L F G I SR+GLW FDL+++Q+  E V E  RG V
Sbjct:   11 GWVAYYRQSAFLPGLGLAFLYMTVLGFDGITTGYAYAQGVSTSVLSIMVGLSATLGLVGTVLYLRARRRCGLVRTGALFSLAQVCCLLLCVMSVFAPGSPLDLTAPLHKPRLVRLVRPPPPPPSLLVAEPTVAYEANGTWFQNVTTNGTATVQPQILDYTSISLFFAGAILSRVGLWGFDLSVTQIFQETVAESERGVV 209          
BLAST of slc40a-1 vs. Ensembl Nematostella
Match: EDO43654 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RY83])

HSP 1 Score: 92.4337 bits (228), Expect = 1.799e-20
Identity = 72/250 (28.80%), Postives = 127/250 (50.80%), Query Frame = 3
Query:   69 RLLDLCSKIVAPVIIGQIIYFAGKPIAAIVFSIQXXXXXXXXXXXXKIIYNRMPRLHYREDLSNLMRKATDETAPL-PENEVTGSTN----------------------IPELPKVEIPS-SYYSWYKCLIFFEG--WIVYFQGNLKFAGLAMALLYMTVLGFDAVTIGYAISQGVSESMLSYFNXXXXXXXXXXXXXFPKIMKKTNIIFTGIIALSLQLIGLIPCLISVWAPGSPFDLNYNGTNLVNVT 740
            R +DL  KI+AP ++GQ++ +  K    I+ +   ++++ +  F+L  +Y+ +P L +++    + +K T +  P   + E+ GS +                      +P+ P+   P        K  I      W VY +  +   G+A+A+LY TV+ F +VT GY  +Q +SES+LS      A+ GI    +FPK+     ++ +G+ ++S Q I ++ CL +V APGSPFDL    T+ V++T
Sbjct:  135 RRIDLVCKILAPALVGQVMTYVSKSAGVILIASWNVLSVFVEYFMLLRVYHSVPSLAHKK----IDKKLTQQENPQESQEEIRGSRDRLVFMETEGGDSEALVSRPGSALPQSPQTSRPKPGIIQRLKTRITTTKSVWQVYMRQEVARPGVALAILYFTVISFGSVTTGYLYTQNLSESLLSILRGVGALFGIAATFVFPKLRDSIGLVRSGLFSMSAQFICVLLCLGAVLAPGSPFDLET--TDFVSIT 378          

HSP 2 Score: 68.9366 bits (167), Expect = 8.552e-13
Identity = 31/66 (46.97%), Postives = 44/66 (66.67%), Query Frame = 3
Query:  819 RIGLWMFDLTISQLLVEVVLEINRGKVNGVQNSLNMLFEMIKFTLVLVFPLPYQFGILVLLSVGAI 1016
            R GLW+ DLT++QL  E+V E  RG+V  VQ SL  + +M  + LV+  PLP QFG + ++SV A+
Sbjct:  459 RFGLWLTDLTVTQLQQEIVAEEERGRVGAVQKSLCSMLDMAIYVLVISLPLPEQFGYMAIISVAAV 524          
BLAST of slc40a-1 vs. Ensembl Medaka
Match: slc40a1 (solute carrier family 40 member 1 [Source:NCBI gene;Acc:101158734])

HSP 1 Score: 166.777 bits (421), Expect = 4.993e-46
Identity = 129/369 (34.96%), Postives = 198/369 (53.66%), Query Frame = 3
Query:   42 KFSAMTSRFRLLDLCSKIVAPVIIGQIIYFAGKPIAAIVFSIQXXXXXXXXXXXXKIIYNRMPRL-----HYREDLSNLMRKATDETAPLPE-------NEVTGSTNIPELPKVEIPSSYYSWYKCLIFFEGWIVYFQGNLKFAGLAMALLYMTVLGFDAVTIGYAISQGVSESMLSYFNXXXXXXXXXXXXXFPKIMKKTNIIFTGIIALSLQLIGLIPCLISVWAPGSPFDLNYN------------------GTNLVNVTDGSVLPIAXX---XXXXXXXXXXXXXXXXRIGLWMFDLTISQLLVEVVLEINRGKVNGVQNSLNMLFEMIKFTLVLVFPLPYQFGILVLLSVGAIGISNALYLVYA 1049
            + + M +  R++D  + I+AP+++GQI+ F    +     S   L ++ +   LL  +Y + P L        ++L  L      E    PE       NE T     P+ PK E    Y        F  GW+ Y+  N+  AG+++A LYMTVLGFD +T GYA +QG+S S+LS     +AI+GI G + F  I KK  +I TG I+   QL  L+ C+ SV+APGS FDL+ +                    NL+++   +V P        S +S+ LLF G+I +R+GLW FDLT++QL+ E V+E  RG +NGVQNS+N L +++ F +V++ P P  FG+LV++SV  + + + +Y  +A
Sbjct:  166 RLADMNATVRIIDQLTNILAPMLVGQIMTFGSHFVGCGFISGWNLCSMCVEYALLWKVYQKTPALAEKAGQKEQELKQLGPSRDVENGQSPEESSQPLMNE-TAVVTSPDSPKKE-GCCYQVAEPMRTFKAGWVAYYNQNIFLAGMSLAFLYMTVLGFDCITTGYAYTQGLSGSVLSLLMGASAISGICGTVAFTWIRKKCGLIRTGFISGVAQLSCLMLCIASVFAPGSVFDLSISPFQDLYTHLMGEQSLPEADHNLISLNVTTVAPAEEMPPLQSYMSVSLLFAGVIAARVGLWSFDLTVTQLIQENVIESERGVINGVQNSMNYLLDLLHFVMVILAPNPEAFGLLVIISVSFVALGHLMYFRFA 532          
BLAST of slc40a-1 vs. Ensembl Medaka
Match: si:ch211-254p10.2 (solute carrier family 40 member 1-like [Source:NCBI gene;Acc:101158134])

HSP 1 Score: 145.976 bits (367), Expect = 1.386e-39
Identity = 127/384 (33.07%), Postives = 198/384 (51.56%), Query Frame = 3
Query:   54 MTSRFRLLDLCSKIVAPVIIGQIIYFAGKPIAAIVFSIQXXXXXXXXXXXXKIIYNRMPRLHYR---EDLSNLMRKATDETAPLPENEVTGSTNIPELPKVEIPSSYYSWY--KCLIFFEGWIVYFQGNLKFAGLAMALLYMTVLGFDAVTIGYAISQGVSESMLSYFNXXXXXXXXXXXXXFPKIMKKTNIIFTGIIALSLQLIGLIPCLISVWAPGSPFDLN-------YNGT-----------------------------NLVNVTDGSVL-----PIAXXXXXXXXXXXXXXXXXXRIGLWMFDLTISQLLVEVVLEINRGKVNGVQNSLNMLFEMIKFTLVLVFPLPYQFGILVLLSVGAIGISNALYLVYAISQKCK 1067
            M +  R +D  + I+AP+ +GQ++  A   +         L++L +  F L  +Y  +P L  +   ++   +  K   +   L E     S +  ++ KV +    + W    C    +GW+ Y+   +  AG+ +A LY TVLGFD +T GYA +QG+S S+LS     +A+ G++G ++F ++ K   +I TGII+  L L  L+ C+ SV+APGSP DL+       YN +                             + ++ T+ +VL     P     S ISIILLF G+I +RI LW FDLT++QLL E + E  RG VNGVQ+S+N L +++ F +V+  P P  FGILV++SV  I   + +Y +YA   K K
Sbjct:    1 MNATMRRIDQVTNILAPLAVGQVMTLASNVVGCGFILGWNLLSLIVEFFFLSRVYRIVPALSVKPPTDEDDQVCFKLVGQPQALTEGNCNLSVHSKDITKVPLCFRRFRWLVSTCK---DGWMAYYHQPVFLAGMGLAFLYTTVLGFDCITTGYAYTQGISGSLLSLLMGVSAVAGLMGTIMFTRLRKTYGLINTGIISSCLHLGCLLFCVCSVFAPGSPVDLSLLMPYFTYNSSAEPGGMASQSQKHTYPLTGGNNQPLLPDRSSIHWTNNTVLFDNVPPGTAPESYISIILLFLGVITARI-LWSFDLTVTQLLQETICESERGVVNGVQSSMNYLMDLLHFIMVISAPQPEHFGILVIISVLFITTGHTMYFMYAYKAKRK 380          
BLAST of slc40a-1 vs. Planmine SMEST
Match: SMESG000016854.1 (SMESG000016854.1)

HSP 1 Score: 550.821 bits (1418), Expect = 0.000e+0
Identity = 328/346 (94.80%), Postives = 328/346 (94.80%), Query Frame = 3
Query:   45 FSAMTSRFRLLDLCSKIVAPVIIGQIIYFAGKPIAAIVFSIQXXXXXXXXXXXXKIIYNRMPRLHYREDLSNLMRKATDETAPLPENEVTGSTNIPELPKVEIPSSYYSWYKCLIFFEGWIVYFQGNLKFAGLAMALLYMTVLGFDAVTIGYAISQGVSESMLSYFNXXXXXXXXXXXXXFPKIMKKTNIIFTGIIALSLQLIGLIPCLISVWAPGSPFDLNYNGTNLVNVTDGSVLPIAXXXXXXXXXXXXXXXXXXRIGLWMFDLTISQLLVEVVLEINRGKVNGVQNSLNMLFEMIKFTLVLVFPLPYQFGILVLLSVGAIGISNALYLVYAISQKCKIDSQL 1082
             S MTSRFRLLDLCSKIVAPVIIGQIIYFAGKPIAAIVFSIQVLVTLGLFTFLLKIIYNRMPRLHYREDLSNLMRKATDETAPLPENEVTGSTNIPELPKVEIPS              WIVYFQGNLKFAGLAMALLYMTVLGFDAVTIGYAISQGVSESMLSYFNAGAAITGIIGALIFPKIMKKTNIIFTGIIALSLQLIGLIPCLISVWAPGSPFDLNYNGTNLVNVTDGSVLPIAG SSSISIILLFTGIIGSRIGLWMFDLTISQLLVEVVLEINRGKVNGVQNSLNMLFEMIKFTLVLVFPLPYQFGILVLLSVGAIGI NALYLVYAISQKCKIDSQL
Sbjct:  175 LSTMTSRFRLLDLCSKIVAPVIIGQIIYFAGKPIAAIVFSIQVLVTLGLFTFLLKIIYNRMPRLHYREDLSNLMRKATDETAPLPENEVTGSTNIPELPKVEIPSR-------------WIVYFQGNLKFAGLAMALLYMTVLGFDAVTIGYAISQGVSESMLSYFNAGAAITGIIGALIFPKIMKKTNIIFTGIIALSLQLIGLIPCLISVWAPGSPFDLNYNGTNLVNVTDGSVLPIAGNSSSISIILLFTGIIGSRIGLWMFDLTISQLLVEVVLEINRGKVNGVQNSLNMLFEMIKFTLVLVFPLPYQFGILVLLSVGAIGIGNALYLVYAISQKCKIDSQL 507          
The following BLAST results are available for this feature:
BLAST of slc40a-1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 1
Match NameE-valueIdentityDescription
SLC40A11.943e-4535.26solute carrier family 40 member 1 [Source:HGNC Sym... [more]
back to top
BLAST of slc40a-1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
fpn-1.23.914e-2224.52Solute carrier family 40 protein [Source:UniProtK... [more]
fpn-1.11.774e-1429.43Solute carrier family 40 protein [Source:UniProtK... [more]
fpn-1.11.774e-1429.43Solute carrier family 40 protein [Source:UniProtK... [more]
back to top
BLAST of slc40a-1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of slc40a-1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
slc40a11.021e-4334.32solute carrier family 40 member 1 [Source:NCBI gen... [more]
si:ch211-254p10.22.024e-2231.05si:ch211-254p10.2 [Source:ZFIN;Acc:ZDB-GENE-100922... [more]
si:ch211-254p10.29.416e-2231.56si:ch211-254p10.2 [Source:ZFIN;Acc:ZDB-GENE-100922... [more]
back to top
BLAST of slc40a-1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc40a19.335e-4032.64solute carrier family 40 (iron-regulated transport... [more]
ENSXETT00000025371.11.000e-3833.33pep primary_assembly:Xenopus_tropicalis_v9.1:9:395... [more]
ENSXETT00000025368.11.179e-3833.33pep primary_assembly:Xenopus_tropicalis_v9.1:9:395... [more]
cul4a4.707e-3833.79cullin 4A [Source:Xenbase;Acc:XB-GENE-1014775][more]
cul4a2.821e-3735.29cullin 4A [Source:Xenbase;Acc:XB-GENE-1014775][more]
back to top
BLAST of slc40a-1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Slc40a16.160e-4534.75solute carrier family 40 (iron-regulated transport... [more]
back to top
BLAST of slc40a-1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9NP59|S40A1_HUMAN9.333e-4535.26Solute carrier family 40 member 1 OS=Homo sapiens ... [more]
sp|Q9JHI9|S40A1_MOUSE4.309e-4434.75Solute carrier family 40 member 1 OS=Mus musculus ... [more]
sp|Q9I9R3|S40A1_DANRE4.935e-4434.05Solute carrier family 40 member 1 OS=Danio rerio O... [more]
sp|Q923U9|S40A1_RAT2.962e-4234.58Solute carrier family 40 member 1 OS=Rattus norveg... [more]
sp|O80905|S40A1_ARATH3.036e-1825.44Solute carrier family 40 member 1 OS=Arabidopsis t... [more]
back to top
BLAST of slc40a-1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0H3YJL20.000e+099.71Solute carrier family 40 protein (Fragment) OS=Sch... [more]
A0A2C9K7393.476e-4635.73Solute carrier family 40 protein OS=Biomphalaria g... [more]
A0A2C9K7803.576e-4635.73Solute carrier family 40 protein OS=Biomphalaria g... [more]
A0A2C9K7414.512e-4635.73Solute carrier family 40 protein OS=Biomphalaria g... [more]
T1JCZ33.778e-4537.97Solute carrier family 40 protein OS=Strigamia mari... [more]
back to top
BLAST of slc40a-1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
slc40a16.416e-4432.80solute carrier family 40 member 1 [Source:NCBI gen... [more]
back to top
BLAST of slc40a-1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
slc40a11.269e-4634.57solute carrier family 40 member 1 [Source:NCBI gen... [more]
ENSPMAT00000004589.11.856e-2235.68pep scaffold:Pmarinus_7.0:GL476518:262388:271296:1... [more]
back to top
BLAST of slc40a-1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of slc40a-1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO436541.799e-2028.80Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of slc40a-1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
slc40a14.993e-4634.96solute carrier family 40 member 1 [Source:NCBI gen... [more]
si:ch211-254p10.21.386e-3933.07solute carrier family 40 member 1-like [Source:NCB... [more]
back to top
BLAST of slc40a-1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000016854.10.000e+094.80SMESG000016854.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30009534
GenBankAKN21679.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30009534 ID=SMED30009534|Name=slc40a-1|organism=Schmidtea mediterranea sexual|type=transcript|length=1173bp
CTAGAATATAAATGAAAATAATAATACAATTATTATTTATAAAATTTTCA
GCAATGACTTCGAGATTTCGACTGCTAGATTTGTGTTCAAAAATAGTTGC
CCCAGTCATCATTGGTCAAATCATTTATTTTGCCGGAAAGCCGATAGCGG
CAATTGTTTTTTCAATACAAGTTCTCGTTACGCTTGGATTGTTCACGTTC
TTGTTGAAAATTATTTACAACCGAATGCCTCGGCTACATTATCGGGAAGA
TTTAAGTAATTTGATGAGAAAAGCAACAGATGAAACTGCGCCCTTACCGG
AAAATGAGGTAACGGGTTCCACTAATATCCCCGAACTTCCAAAAGTAGAG
ATTCCATCAAGTTATTATTCCTGGTATAAATGTCTTATTTTCTTTGAAGG
ATGGATTGTCTATTTTCAAGGAAACTTAAAATTTGCTGGATTGGCAATGG
CCTTACTTTATATGACTGTCCTTGGATTTGATGCAGTTACTATCGGATAC
GCAATATCTCAAGGGGTCTCGGAATCTATGCTTAGCTATTTTAATGCTGG
AGCCGCTATAACGGGAATAATTGGAGCATTAATATTTCCAAAAATCATGA
AAAAGACAAATATAATTTTCACCGGTATCATAGCCCTGAGTTTGCAACTT
ATTGGACTTATCCCTTGTTTAATATCAGTATGGGCACCGGGTTCTCCATT
TGACTTGAATTATAATGGAACAAATTTAGTTAATGTGACGGATGGATCAG
TCCTCCCAATTGCTGGCACTTCTAGTTCCATCTCAATTATTCTGTTGTTT
ACTGGGATTATTGGGTCACGGATAGGTTTATGGATGTTTGACTTGACTAT
CTCTCAACTACTGGTCGAAGTGGTTCTGGAGATTAACAGAGGGAAAGTAA
ATGGAGTTCAGAATTCTCTCAACATGCTGTTTGAAATGATTAAATTTACC
TTAGTTTTGGTCTTTCCATTACCGTATCAATTTGGAATCCTTGTATTGCT
GAGTGTTGGAGCCATCGGAATTAGTAATGCGTTGTATTTGGTGTACGCAA
TCAGTCAGAAGTGCAAAATAGACAGCCAACTTTGACCCTCTCTAATAAAT
TATGCTAAAAAAATGAACTATGAAAACATTTTTTTTTGATAATTATAATC
TGCAAACTTTCTTGGGAAAACAA
back to top

protein sequence of SMED30009534-orf-1

>SMED30009534-orf-1 ID=SMED30009534-orf-1|Name=SMED30009534-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=358bp
MKIIIQLLFIKFSAMTSRFRLLDLCSKIVAPVIIGQIIYFAGKPIAAIVF
SIQVLVTLGLFTFLLKIIYNRMPRLHYREDLSNLMRKATDETAPLPENEV
TGSTNIPELPKVEIPSSYYSWYKCLIFFEGWIVYFQGNLKFAGLAMALLY
MTVLGFDAVTIGYAISQGVSESMLSYFNAGAAITGIIGALIFPKIMKKTN
IIFTGIIALSLQLIGLIPCLISVWAPGSPFDLNYNGTNLVNVTDGSVLPI
AGTSSSISIILLFTGIIGSRIGLWMFDLTISQLLVEVVLEINRGKVNGVQ
NSLNMLFEMIKFTLVLVFPLPYQFGILVLLSVGAIGISNALYLVYAISQK
CKIDSQL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0006811ion transport
GO:0034755iron ion transmembrane transport
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036259MFS_trans_sf
IPR009716Ferroportin-1
IPR020846MFS_dom
Vocabulary: molecular function
TermDefinition
GO:0005381iron ion transmembrane transporter activity
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR009716Ferroportin-1PFAMPF06963FPN1coord: 11..335
e-value: 1.8E-73
score: 247.6
IPR009716Ferroportin-1PANTHERPTHR11660FAMILY NOT NAMEDcoord: 14..348
NoneNo IPR availablePANTHERPTHR11660:SF57FERROPORTINcoord: 14..348
NoneNo IPR availableCDDcd17480MFS_SLC40A1_likecoord: 15..345
e-value: 6.05328E-56
score: 185.495
NoneNo IPR availableTMHMMTMhelixcoord: 45..67
NoneNo IPR availableTMHMMTMhelixcoord: 173..192
NoneNo IPR availableTMHMMTMhelixcoord: 247..269
NoneNo IPR availableTMHMMTMhelixcoord: 303..320
NoneNo IPR availableTMHMMTMhelixcoord: 205..227
NoneNo IPR availableTMHMMTMhelixcoord: 21..40
NoneNo IPR availableTMHMMTMhelixcoord: 141..163
NoneNo IPR availableTMHMMTMhelixcoord: 324..346
IPR036259MFS transporter superfamilySUPERFAMILYSSF103473MFS general substrate transportercoord: 15..345