Zinc finger BED domain-containing protein 5

Overview
NameZinc finger BED domain-containing protein 5
Smed IDSMED30009521
Length (bp)3795
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Zinc finger BED domain-containing protein 5 (SMED30009521) t-SNE clustered cells

Violin plots show distribution of expression levels for Zinc finger BED domain-containing protein 5 (SMED30009521) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Zinc finger BED domain-containing protein 5 (SMED30009521) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Zinc finger BED domain-containing protein 5 (SMED30009521) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30009521

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30009521SMESG000002129.1 dd_Smed_v4_13531_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30009521 dd_Smed_v4_66508_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30009521SMESG000002129.1 dd_Smed_v6_13531_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30009521SMESG000002129.1 dd_Smed_v4_13531_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30009521SMESG000002129.1 dd_Smed_v4_13531_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult colorimetric in situ hybridization evidence
dorsal region of the epidermisSMED30009521SMESG000002129.1 dd_Smed_v4_13531_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
whole organismSMED30009521SMESG000002129.1 dd_Smed_v4_13531_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Zinc finger BED domain-containing protein 5 vs. Ensembl Human
Match: ZBED9 (zinc finger BED-type containing 9 [Source:HGNC Symbol;Acc:HGNC:13851])

HSP 1 Score: 160.614 bits (405), Expect = 8.715e-46
Identity = 125/393 (31.81%), Postives = 210/393 (53.44%), Query Frame = 2
Query: 2393 SNFNRKKDKSREFSKDEEPELXXXXXAWIRKYETKYMKYEF-AMKSGKETEPILQCVICFECLSNGS------KKQLF*KGIYIAN-----IRM*KTELSIFSKENFLSNLVVVQTLIV*EH---HIARCGKPHTIGETLLMPTTIDIVVSVLGEKAAKEIDKVSLSNNTVKQRIDEMASQIEDILIQRL*TSLFFP------SDWMKVLIFPIRRNYSH-------MFFLIS----TIXXXXXXXSANH*LQK-QLRTKYLK*LMIMLLQITSVGSNMCEFYTDGARAMTGKLSGVVTKIKEMAQQCKYIHCIIHPQALATKNMPVNFKYLLDESVEMVNFTKSRALNSRLFSILCGEMGSVHATLLLHTGDRGLSRGQVLSQLFQLRDGVV 3472
            S+ N++   +R +   EE + K+   ++ RKY+  Y+++ F A+  G+  +P  QC+IC + L+N +      K+ L+ K   I++          +EL    K+ F  + + +  L         +A+   P+TI ETL+     ++ + +LGE AAK++ +V LSN+T+ +RI E+A+ +ED LI+++  + +F        D   ++I  +   + H        FF  S    T   +      N+ + K  L  K+             VG  +C   +DGA +MTGK S VVT+IKE+A +CK  HC IH ++LA K +      +L++ V++VN+ KS +LNSRLFS+LC  M + H  LLLH   R LSRG+VLS++F++R+ ++
Sbjct:  557 SSSNKRNVNNRSYP--EEGKTKRVHASFTRKYDPSYIEFGFVAVIDGEVLKP--QCIICGDVLANEAMKPSKLKRHLYSKHKEISSQPKEFFERKSSELKSQPKQVFNVSHINISALRASYKVALPVAKSKTPYTIAETLVKDCIKEVCLEMLGESAAKKVAQVPLSNDTIARRIQELANDMEDQLIEQIKLAKYFSLQLDECRDIANMIILLVYVRFEHDDDIKEEFFFSASLPTNTTSSELYEAVKNYIVNKCGLEFKFC------------VG--VC---SDGAASMTGKHSEVVTQIKELAPECKTTHCFIHRESLAMKKISAELNSVLNDIVKIVNYIKSNSLNSRLFSLLCDNMEADHKQLLLHAEIRWLSRGKVLSRMFEIRNELL 928          

HSP 2 Score: 45.8246 bits (107), Expect = 8.715e-46
Identity = 21/41 (51.22%), Postives = 26/41 (63.41%), Query Frame = 1
Query: 3520 DEYWLCKLAYLSEYFSRFNDLNLSLEGVNNSVFDFYDKVRS 3642
            D  W  +LAYLS+ FS FNDLN S++G N + F   DKV  
Sbjct:  944 DVNWTARLAYLSDIFSIFNDLNASMQGKNATYFSMADKVEG 984          
BLAST of Zinc finger BED domain-containing protein 5 vs. Ensembl Human
Match: ZBED9 (zinc finger BED-type containing 9 [Source:HGNC Symbol;Acc:HGNC:13851])

HSP 1 Score: 160.229 bits (404), Expect = 1.284e-45
Identity = 120/395 (30.38%), Postives = 206/395 (52.15%), Query Frame = 2
Query: 2393 SNFNRKKDKSREFSKDEEPELXXXXXAWIRKYETKYMKYEF-AMKSGKETEPILQCVICFECLSNGS------KKQLF*KGIYIAN-----IRM*KTELSIFSKENFLSNLVVVQTLIV*EH---HIARCGKPHTIGETLLMPTTIDIVVSVLGEKAAKEIDKVSLSNNTVKQRIDEMASQIEDILIQRL*TSLFFP------SDWMKVLIFPIRRNYSH------MFFLISTIXXXXXXXSANH*LQKQLRTKYLK*LMIMLLQITSVGSNMC--EFY------TDGARAMTGKLSGVVTKIKEMAQQCKYIHCIIHPQALATKNMPVNFKYLLDESVEMVNFTKSRALNSRLFSILCGEMGSVHATLLLHTGDRGLSRGQVLSQLFQLRDGVV 3472
            S+ N++   +R +   EE + K+   ++ RKY+  Y+++ F A+  G+  +P  QC+IC + L+N +      K+ L+ K   I++          +EL    K+ F  + + +  L         +A+   P+TI ETL+     ++ + +LGE AAK++ +V LSN+T+ +RI E+A+ +ED LI+++  + +F        D   ++I  +   + H       FF  +++                           +   + +   N C  EF       +DGA +MTGK S VVT+IKE+A +CK  HC IH ++LA K +      +L++ V++VN+ KS +LNSRLFS+LC  M + H  LLLH   R LSRG+VLS++F++R+ ++
Sbjct:  708 SSSNKRNVNNRSYP--EEGKTKRVHASFTRKYDPSYIEFGFVAVIDGEVLKP--QCIICGDVLANEAMKPSKLKRHLYSKHKEISSQPKEFFERKSSELKSQPKQVFNVSHINISALRASYKVALPVAKSKTPYTIAETLVKDCIKEVCLEMLGESAAKKVAQVPLSNDTIARRIQELANDMEDQLIEQIKLAKYFSLQLDECRDIANMIILLVYVRFEHDDDIKEEFFFSASLPTNTTSSE-------------------LYEAVKNYIVNKCGLEFKFCVGVCSDGAASMTGKHSEVVTQIKELAPECKTTHCFIHRESLAMKKISAELNSVLNDIVKIVNYIKSNSLNSRLFSLLCDNMEADHKQLLLHAEIRWLSRGKVLSRMFEIRNELL 1079          

HSP 2 Score: 45.8246 bits (107), Expect = 1.284e-45
Identity = 21/41 (51.22%), Postives = 26/41 (63.41%), Query Frame = 1
Query: 3520 DEYWLCKLAYLSEYFSRFNDLNLSLEGVNNSVFDFYDKVRS 3642
            D  W  +LAYLS+ FS FNDLN S++G N + F   DKV  
Sbjct: 1095 DVNWTARLAYLSDIFSIFNDLNASMQGKNATYFSMADKVEG 1135          
BLAST of Zinc finger BED domain-containing protein 5 vs. Ensembl Human
Match: ZMYM6 (zinc finger MYM-type containing 6 [Source:HGNC Symbol;Acc:HGNC:13050])

HSP 1 Score: 138.658 bits (348), Expect = 4.755e-40
Identity = 112/383 (29.24%), Postives = 186/383 (48.56%), Query Frame = 2
Query: 2441 EEPELXXXXXAWIRKYETKYMKYEFAMKSG-KETEPILQCVICFECLSNGSKK-------------QLF*KGIYIANIRM*KTELSIFS-KENFLSNLVVVQTLIV*EHHIARCGKPHTIGETLLMPTTIDIVVSVLGEKAAKEIDKVSLSNNTVKQRIDEMASQIEDILIQRL*TSLFFPSD---------------WMKVLIFPIRRNYSHMFFLISTIXXXXXXXSANH*LQKQLRTKYLK*LMIMLLQITSVGSNMC-EFYTDGARAMTGKLSGVVTKIKEMA-QQCKYIHCIIHPQALATKNMPVNFKYLLDESVEMVNFTKSRALNSRLFSILCGEMGSVHATLLLHTGDRGLSRGQVLSQLFQLRDGVVYMFLAMQ 3493
            + P  KK +  + + Y+T+Y+K  F +  G KE+ P  QCVIC E LS+ + K             +L  K +     +  + E    S K+  L    +V+   +     A   KP +I E L+ P  +++   VLG  A  ++  + LSN T++ RIDE+++ IED LIQ++  S +F                  +++ + +  R     + F I               +  Q+    +  L+   +   S+    C    TDGA +MTG+ SG+  KI+E+A     + HC IH + L  + +      +L +S ++++F KS ALNSR+ +ILC EMGS H +L LH   R +SRG++L +LF+LR   + +FL+ +
Sbjct:  729 DSPPSKKKRLGFFQTYDTEYLKVGFIICPGSKESSPRPQCVICGEILSSENMKPANLSHHLKTKHSELENKPVDFFEQKSLEMECQNSSLKKCLLVEKSLVKASYLIAFQTAASKKPFSIAEELIKPYLVEMCSEVLGSSAGDKMKTIPLSNVTIQHRIDELSADIEDQLIQKVRESKWFALQIDESSEISNITLLLCYIRFIDYDCRDVKEELLFCIE--------------MPTQITGFEIFELINKYIDSKSLNWKHCVGLCTDGAASMTGRYSGLKAKIQEVAMNTAAFTHCFIHRERLVAEKLSPCLHKILLQSAQILSFIKSNALNSRMLTILCEEMGSEHVSLPLHAEVRWISRGRMLKRLFELRHE-IEIFLSQK 1096          

HSP 2 Score: 46.9802 bits (110), Expect = 4.755e-40
Identity = 24/49 (48.98%), Postives = 33/49 (67.35%), Query Frame = 1
Query: 3490 AKYFNGDRLIDEYWLCKLAYLSEYFSRFNDLNLSLEGVNNSVFDFYDKV 3636
            AKYF+     DE W+ KLAYLS+ FS  N+LNLSL+G   + F+  +K+
Sbjct: 1101 AKYFH-----DEEWVGKLAYLSDIFSLINELNLSLQGTLTTFFNLCNKI 1144          

HSP 3 Score: 21.557 bits (44), Expect = 4.755e-40
Identity = 9/36 (25.00%), Postives = 18/36 (50.00%), Query Frame = 3
Query: 3639 FMRKLHLMQQQIEKQTFNMLPFLCNFVEENNLRLKD 3746
            F RKL +  ++ ++  ++M P    F   + L + D
Sbjct: 1147 FKRKLKMWLKRTQENDYDMFPSFSEFSNSSGLNMTD 1182          

HSP 4 Score: 52.7582 bits (125), Expect = 5.025e-6
Identity = 25/65 (38.46%), Postives = 46/65 (70.77%), Query Frame = 1
Query: 2932 FSLRLDESTDISNSAQLLAYVLF-DFNNK-IQEKILFCKPLTAKTTSHEIFKIINDYVITNHISW 3120
            F+L++DES++ISN   LL Y+ F D++ + ++E++LFC  +  + T  EIF++IN Y+ +  ++W
Sbjct:  908 FALQIDESSEISNITLLLCYIRFIDYDCRDVKEELLFCIEMPTQITGFEIFELINKYIDSKSLNW 972          
BLAST of Zinc finger BED domain-containing protein 5 vs. Ensembl Human
Match: FAM200A (family with sequence similarity 200 member A [Source:HGNC Symbol;Acc:HGNC:25401])

HSP 1 Score: 90.1225 bits (222), Expect = 5.070e-37
Identity = 48/116 (41.38%), Postives = 70/116 (60.34%), Query Frame = 2
Query: 3143 TDGARAMTGKLSGVVTKIKEMAQQ-CKYIHCIIHPQALATKNMPVNFKYLLDESVEMVNFTKSRALNSRLFSILCGEMGSVHATLLLHTGDRGLSRGQVLSQLFQLRDGVVYMFLA 3487
            +DG   MTGK S +  K+ E       + HC IH +AL +K +  +   +L  +V+ VNF K  +LNSRL  I C E+G  H  LL HT  R LS+G+VLS++++LR+  +Y+FL 
Sbjct:  211 SDGTANMTGKHSRLTEKLLEATHNNAVWNHCFIHREALVSKEISPSLMDVLKNAVKTVNFIKGSSLNSRLLEIFCSEIGVNHTHLLFHTEVRWLSQGKVLSRVYELRNE-IYIFLV 325          

HSP 2 Score: 49.6766 bits (117), Expect = 5.070e-37
Identity = 22/72 (30.56%), Postives = 45/72 (62.50%), Query Frame = 2
Query: 2720 HHIARCGKPHTIGETLLMPTTIDIVVSVLGEKAAKEIDKVSLSNNTVKQRIDEMASQIEDILIQRL*TSLFF 2935
            + +A+    HT  E +++P  +D+V ++  +K+A ++  + LS+NT+ +RI  +A  +E +LI RL + + F
Sbjct:   69 YRVAKEKMAHTAAEKIILPACMDMVRTIFDDKSADKLRTIPLSDNTISRRICTIAKHLEAMLITRLQSGIDF 140          

HSP 3 Score: 42.3578 bits (98), Expect = 5.070e-37
Identity = 16/39 (41.03%), Postives = 27/39 (69.23%), Query Frame = 1
Query: 3520 DEYWLCKLAYLSEYFSRFNDLNLSLEGVNNSVFDFYDKV 3636
            D+ W+ KLAYLS+ F   N+L+L ++G NN +F + + +
Sbjct:  337 DDIWVTKLAYLSDIFGILNELSLKMQGKNNDIFQYLEHI 375          

HSP 4 Score: 35.4242 bits (80), Expect = 5.070e-37
Identity = 18/49 (36.73%), Postives = 30/49 (61.22%), Query Frame = 1
Query: 2932 FSLRLDESTDISNSAQLLAYVLFDFNNKIQEKILFCKPLTAKTTSHEIF 3078
            F+++LDESTDI++   LL YV + + +   E +L C  L +  T  ++F
Sbjct:  140 FAIQLDESTDIASCPTLLVYVRYVWQDDFVEDLLCCLNLNSHITGLDLF 188          
BLAST of Zinc finger BED domain-containing protein 5 vs. Ensembl Human
Match: FAM200A (family with sequence similarity 200 member A [Source:HGNC Symbol;Acc:HGNC:25401])

HSP 1 Score: 89.7373 bits (221), Expect = 5.268e-37
Identity = 48/115 (41.74%), Postives = 70/115 (60.87%), Query Frame = 2
Query: 3143 TDGARAMTGKLSGVVTKIKEMAQQ-CKYIHCIIHPQALATKNMPVNFKYLLDESVEMVNFTKSRALNSRLFSILCGEMGSVHATLLLHTGDRGLSRGQVLSQLFQLRDGVVYMFL 3484
            +DG   MTGK S +  K+ E       + HC IH +AL +K +  +   +L  +V+ VNF K  +LNSRL  I C E+G  H  LL HT  R LS+G+VLS++++LR+  +Y+FL
Sbjct:  211 SDGTANMTGKHSRLTEKLLEATHNNAVWNHCFIHREALVSKEISPSLMDVLKNAVKTVNFIKGSSLNSRLLEIFCSEIGVNHTHLLFHTEVRWLSQGKVLSRVYELRNE-IYIFL 324          

HSP 2 Score: 49.6766 bits (117), Expect = 5.268e-37
Identity = 22/72 (30.56%), Postives = 45/72 (62.50%), Query Frame = 2
Query: 2720 HHIARCGKPHTIGETLLMPTTIDIVVSVLGEKAAKEIDKVSLSNNTVKQRIDEMASQIEDILIQRL*TSLFF 2935
            + +A+    HT  E +++P  +D+V ++  +K+A ++  + LS+NT+ +RI  +A  +E +LI RL + + F
Sbjct:   69 YRVAKEKMAHTAAEKIILPACMDMVRTIFDDKSADKLRTIPLSDNTISRRICTIAKHLEAMLITRLQSGIDF 140          

HSP 3 Score: 42.3578 bits (98), Expect = 5.268e-37
Identity = 16/39 (41.03%), Postives = 27/39 (69.23%), Query Frame = 1
Query: 3520 DEYWLCKLAYLSEYFSRFNDLNLSLEGVNNSVFDFYDKV 3636
            D+ W+ KLAYLS+ F   N+L+L ++G NN +F + + +
Sbjct:  337 DDIWVTKLAYLSDIFGILNELSLKMQGKNNDIFQYLEHI 375          

HSP 4 Score: 35.4242 bits (80), Expect = 5.268e-37
Identity = 18/49 (36.73%), Postives = 30/49 (61.22%), Query Frame = 1
Query: 2932 FSLRLDESTDISNSAQLLAYVLFDFNNKIQEKILFCKPLTAKTTSHEIF 3078
            F+++LDESTDI++   LL YV + + +   E +L C  L +  T  ++F
Sbjct:  140 FAIQLDESTDIASCPTLLVYVRYVWQDDFVEDLLCCLNLNSHITGLDLF 188          
BLAST of Zinc finger BED domain-containing protein 5 vs. Ensembl Zebrafish
Match: AL928808.1 (pep chromosome:GRCz11:20:17257101:17259573:-1 gene:ENSDARG00000101333.2 transcript:ENSDART00000166397.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:AL928808.1)

HSP 1 Score: 76.2554 bits (186), Expect = 7.589e-16
Identity = 74/268 (27.61%), Postives = 129/268 (48.13%), Query Frame = 2
Query: 2723 HIARCGKPHTIGETLLMPTTIDIVVSVL---GEKAAKEIDKVSLSNNTVKQRIDEMASQIEDILIQRL*TSLFFPSDWMKVLIFPIRRNYSHMFFLIS---TIXXXXXXXSANH*LQKQLRTKYLK*LMIMLLQITSVG-SNMCEFYTDGARAMTGKLSGVV--TKIKEMAQQCKYIHCIIHPQALATKNMPVNFKYLLDESVEMVNFTKSRALNSRLFSILCGEMG-SVHATLLLHTGDRGLSRGQVLSQLFQLRDGVVYMFLAMQN 3496
            +IAR  KP+  GE   +   +   V++L    E   + +  + LS +TV+QRI ++ + +E  L+  L    +F     +      +  ++     +S   TI+ +         L+ + R   LK  ++ +++  ++  S +    TDGA AM G   G+V   K  +        HCIIH +   +K +  N  +++   +E+VNF ++ ALN R F  L  E+   + + LL H   R LSRG VLS+ F+L +  V +FLA ++
Sbjct:  114 NIARAKKPYLEGE--FVKKCLSDAVAILCPENENLKRSVKDLQLSRHTVEQRISDIDNSVETHLLSDLQKCQYFSIALDESCDVQDKPQFAIFVRFVSEDCTIREELLDIVP---LKDRTRGIDLKETLMTVVEKANLQLSKLTAIVTDGAPAMLGSERGLVGLCKADDRFPAFWTFHCIIHQEHWVSKKL--NLDHIMKPVLEIVNFVRTHALNHRQFKNLIDELDEDLPSDLLFHCAVRWLSRGHVLSRFFELLNP-VKLFLAEKH 373          

HSP 2 Score: 28.8758 bits (63), Expect = 7.589e-16
Identity = 16/49 (32.65%), Postives = 25/49 (51.02%), Query Frame = 1
Query: 3514 LIDEYWLCKLAYLSEYFSRFNDLNLSLEG-------VNNSVFDFYDKVR 3639
            L D  W+  LA+L +     N LN+ L+G       +  SVF F +K++
Sbjct:  379 LHDPQWISDLAFLVDVLHYLNGLNVDLQGKLKMLPDLVQSVFAFVNKLK 427          
BLAST of Zinc finger BED domain-containing protein 5 vs. Ensembl Zebrafish
Match: CR392001.3 (pep chromosome:GRCz11:8:38963323:38965260:-1 gene:ENSDARG00000117159.1 transcript:ENSDART00000181495.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CR392001.3)

HSP 1 Score: 66.2402 bits (160), Expect = 2.060e-10
Identity = 38/103 (36.89%), Postives = 57/103 (55.34%), Query Frame = 2
Query: 3143 TDGARAMTGKLSGVVTKI-KEMAQQCKYIHCIIHPQALATKNMPVNFKYLLDESVEMVNFTKSRALNSRLFSILCGEMGSVHATLLLHTGDRGLSRGQVLSQL 3448
            TDGA +M G   G VT + K + +     HCI+H +AL  +  P     +++  +EMVN   ++ALN R F  L  E+ S ++ LLLH   R LS+ +VL + 
Sbjct:  249 TDGAPSMRGSKRGFVTLLQKALDRNLLAFHCILHQEALCAQTFPSECMVVMNLVIEMVNKIIAKALNHRQFRALLDEVDSEYSDLLLHNKVRWLSKDEVLRRF 351          
BLAST of Zinc finger BED domain-containing protein 5 vs. Ensembl Xenopus
Match: spag1 (sperm associated antigen 1 [Source:Xenbase;Acc:XB-GENE-853609])

HSP 1 Score: 65.0846 bits (157), Expect = 3.162e-12
Identity = 70/285 (24.56%), Postives = 125/285 (43.86%), Query Frame = 2
Query: 2654 SIFSKENFLSNLVVVQTLIV*EHHIARCGKPHTIGETLLMPTTIDIVVSVLGEKAAKEIDKVSLSNNTVKQRIDEMASQIEDILIQRL*TSLFFP---------SDWMKVLIFPIRRNYSHMFFLISTIXXXXXXXSANH*LQKQLRTKYLK*LMIMLLQITSVG--SNMCEFYTDGARAMTGKLSGVVTKIKEMAQQCKYIHCIIHPQALATKNMPVNFKYLLDESVEMVNFTK--SRALNSRLFSILCGEMGSVHATLLLHTGDRGLSRGQVLSQLFQLRDGV 3469
            +IFS         V  + +V E  IA+   P + G TL+    + +  +   E  AK ++ +SLS+ TV + I  +   + D L   L ++ +F          +D  +++IF   R+    F +   +      + +         TK       +   +T  G  S+     TDGARAM G+  G+  ++++    C   HCI+H + L   ++ +    ++D   ++ N  +  +R+L  R F     E+ + +  LLLHT  R LS G+ L + F LR  +
Sbjct:   97 NIFSAVTTTQKAAVKASFLVAEE-IAKRKYPFSSG-TLVKTCALKMAEAFGNETMAKTVESISLSHQTVARHICTINQHLTDKLQNILRSAPYFSIALDESTDITDTCQLVIFV--RSVDQEFHISEELLEIVPLHGS---------TKGEDIYNAVKATVTKYGGFSSCTCIVTDGARAMVGRNQGLAGRLRKEGIDCHMFHCIVHQEVLCGTSLKM--ADIMDVVTKVTNLIRGGNRSLTHRRFKNFLEELDAAYGDLLLHTNVRWLSAGKCLVRFFALRKEI 366          

HSP 2 Score: 28.4906 bits (62), Expect = 3.162e-12
Identity = 15/48 (31.25%), Postives = 26/48 (54.17%), Query Frame = 1
Query: 3508 DRLIDEYWLCKLAYLSEYFSRFNDLNLSLEGVNNSVFDFYDKVRS*EN 3651
            + L D  +L  LA+L++     N LNL+L+G + +V   Y  + +  N
Sbjct:  381 EHLTDVSFLTALAFLTDITQFLNSLNLNLQGRDQNVSQLYSHIAAFRN 428          
BLAST of Zinc finger BED domain-containing protein 5 vs. Ensembl Xenopus
Match: ENSXETT00000016563.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:4:37379994:37381838:-1 gene:ENSXETG00000009412.1 transcript:ENSXETT00000016563.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 64.6994 bits (156), Expect = 4.166e-12
Identity = 70/285 (24.56%), Postives = 125/285 (43.86%), Query Frame = 2
Query: 2654 SIFSKENFLSNLVVVQTLIV*EHHIARCGKPHTIGETLLMPTTIDIVVSVLGEKAAKEIDKVSLSNNTVKQRIDEMASQIEDILIQRL*TSLFFP---------SDWMKVLIFPIRRNYSHMFFLISTIXXXXXXXSANH*LQKQLRTKYLK*LMIMLLQITSVG--SNMCEFYTDGARAMTGKLSGVVTKIKEMAQQCKYIHCIIHPQALATKNMPVNFKYLLDESVEMVNFTK--SRALNSRLFSILCGEMGSVHATLLLHTGDRGLSRGQVLSQLFQLRDGV 3469
            +IFS         V  + +V E  IA+   P + G TL+    + +  +   E  AK ++ +SLS+ TV + I  +   + D L   L ++ +F          +D  +++IF   R+    F +   +      + +         TK       +   +T  G  S+     TDGARAM G+  G+  ++++    C   HCI+H + L   ++ +    ++D   ++ N  +  +R+L  R F     E+ + +  LLLHT  R LS G+ L + F LR  +
Sbjct:   97 NIFSAVTTTQKAAVKASFLVAEE-IAKRKYPFSSG-TLVKTCALKMAEAFGNETMAKTVESISLSHQTVARHICTINQHLTDKLQNILRSAPYFSIALDESTDITDTCQLVIFV--RSVDQEFHISEELLEIVPLHGS---------TKGEDIYNAVKATVTKYGGFSSCTCIVTDGARAMVGRNQGLAGRLRKEGIDCHMFHCIVHQEVLCGTSLKM--ADIMDVVTKVTNLIRGGNRSLTHRRFKNFLEELDAAYGDLLLHTNVRWLSAGKCLVRFFALRKEI 366          

HSP 2 Score: 28.4906 bits (62), Expect = 4.166e-12
Identity = 15/48 (31.25%), Postives = 26/48 (54.17%), Query Frame = 1
Query: 3508 DRLIDEYWLCKLAYLSEYFSRFNDLNLSLEGVNNSVFDFYDKVRS*EN 3651
            + L D  +L  LA+L++     N LNL+L+G + +V   Y  + +  N
Sbjct:  381 EHLTDVSFLTALAFLTDITQFLNSLNLNLQGRDQNVSQLYSHIAAFRN 428          
BLAST of Zinc finger BED domain-containing protein 5 vs. Ensembl Mouse
Match: Zmym6 (zinc finger, MYM-type 6 [Source:MGI Symbol;Acc:MGI:106505])

HSP 1 Score: 108.997 bits (271), Expect = 3.608e-32
Identity = 78/260 (30.00%), Postives = 136/260 (52.31%), Query Frame = 2
Query: 2723 HIARCGKPHTIGETLLMPTTIDIVVSVLGEKAAKEIDKVSLSNNTVKQRIDEMASQIEDILIQRL*TSLFFP--------SDWMKVLIFPIRR-NYSHMFFLISTIXXXXXXXSANH*LQKQLRTKYLK*LMIMLLQITSVGSNMCE-FYTDGARAMTGKLSGVVTKIKEMAQQ-CKYIHCIIHPQALATKNMPVNFKYLLDESVEMVNFTKSRALNSRLFSILCGEMGSVHATLLLHTGDRGLSRGQVLSQLFQLRDGV 3469
             IA   KP +I E L+ P  +++   VLG  A +++  + LSN+T+  RI +++  IED L+Q++  S +F         +  + +L+  +R  +Y         +   +    +      +L  KY+           S+  N C  F TDGA +MT +   + +KI+E+A+    + HC IH + LA K +      +L +S ++++F K+ A +S++ +ILC EMGS H  L L+   R LSRG++L++LF+LR  +
Sbjct:  762 QIAARNKPFSIAEELIKPYLVEMCSEVLGSSAGEKMKTIPLSNSTIGCRIKKLSDDIEDQLLQKVRESRWFALQVDESSEATEVPLLLCYVRFIDYDRGDVKEELLFCTEMPSPSTDLEVFELINKYI--------DSRSLNWNHCVGFCTDGAASMTDRYFRLRSKIQEIAKNTVTFTHCFIHREHLAAKKLSPCLHEILLQSSQILSFVKNSASDSQMLTILCEEMGSEHVNLPLNAEVRWLSRGRILTRLFELRHEI 1013          

HSP 2 Score: 46.9802 bits (110), Expect = 3.608e-32
Identity = 23/49 (46.94%), Postives = 32/49 (65.31%), Query Frame = 1
Query: 3490 AKYFNGDRLIDEYWLCKLAYLSEYFSRFNDLNLSLEGVNNSVFDFYDKV 3636
            A+YF+     DE W+ KLAYL++ FS  N LN SL+G   + F+ Y+KV
Sbjct: 1025 ARYFH-----DEEWIAKLAYLADIFSLINKLNSSLQGTMTTFFNLYNKV 1068          

HSP 3 Score: 24.2534 bits (51), Expect = 3.608e-32
Identity = 10/33 (30.30%), Postives = 21/33 (63.64%), Query Frame = 1
Query: 2605 LKRHLYSKHSNVKDRTLYFFKGKFFVKPCSSTN 2703
            L  HL +KHS+++++ + FF+ K     C +++
Sbjct:  709 LSNHLKAKHSDLENKPVDFFEEKSLEMECQNSS 741          
BLAST of Zinc finger BED domain-containing protein 5 vs. Ensembl Mouse
Match: Zmym6 (zinc finger, MYM-type 6 [Source:MGI Symbol;Acc:MGI:106505])

HSP 1 Score: 108.997 bits (271), Expect = 4.361e-32
Identity = 78/260 (30.00%), Postives = 136/260 (52.31%), Query Frame = 2
Query: 2723 HIARCGKPHTIGETLLMPTTIDIVVSVLGEKAAKEIDKVSLSNNTVKQRIDEMASQIEDILIQRL*TSLFFP--------SDWMKVLIFPIRR-NYSHMFFLISTIXXXXXXXSANH*LQKQLRTKYLK*LMIMLLQITSVGSNMCE-FYTDGARAMTGKLSGVVTKIKEMAQQ-CKYIHCIIHPQALATKNMPVNFKYLLDESVEMVNFTKSRALNSRLFSILCGEMGSVHATLLLHTGDRGLSRGQVLSQLFQLRDGV 3469
             IA   KP +I E L+ P  +++   VLG  A +++  + LSN+T+  RI +++  IED L+Q++  S +F         +  + +L+  +R  +Y         +   +    +      +L  KY+           S+  N C  F TDGA +MT +   + +KI+E+A+    + HC IH + LA K +      +L +S ++++F K+ A +S++ +ILC EMGS H  L L+   R LSRG++L++LF+LR  +
Sbjct:  670 QIAARNKPFSIAEELIKPYLVEMCSEVLGSSAGEKMKTIPLSNSTIGCRIKKLSDDIEDQLLQKVRESRWFALQVDESSEATEVPLLLCYVRFIDYDRGDVKEELLFCTEMPSPSTDLEVFELINKYI--------DSRSLNWNHCVGFCTDGAASMTDRYFRLRSKIQEIAKNTVTFTHCFIHREHLAAKKLSPCLHEILLQSSQILSFVKNSASDSQMLTILCEEMGSEHVNLPLNAEVRWLSRGRILTRLFELRHEI 921          

HSP 2 Score: 46.595 bits (109), Expect = 4.361e-32
Identity = 23/49 (46.94%), Postives = 32/49 (65.31%), Query Frame = 1
Query: 3490 AKYFNGDRLIDEYWLCKLAYLSEYFSRFNDLNLSLEGVNNSVFDFYDKV 3636
            A+YF+     DE W+ KLAYL++ FS  N LN SL+G   + F+ Y+KV
Sbjct:  933 ARYFH-----DEEWIAKLAYLADIFSLINKLNSSLQGTMTTFFNLYNKV 976          

HSP 3 Score: 24.2534 bits (51), Expect = 4.361e-32
Identity = 10/33 (30.30%), Postives = 21/33 (63.64%), Query Frame = 1
Query: 2605 LKRHLYSKHSNVKDRTLYFFKGKFFVKPCSSTN 2703
            L  HL +KHS+++++ + FF+ K     C +++
Sbjct:  617 LSNHLKAKHSDLENKPVDFFEEKSLEMECQNSS 649          
BLAST of Zinc finger BED domain-containing protein 5 vs. Ensembl Mouse
Match: Zbed5 (zinc finger, BED type containing 5 [Source:MGI Symbol;Acc:MGI:1919220])

HSP 1 Score: 119.783 bits (299), Expect = 1.354e-31
Identity = 106/368 (28.80%), Postives = 167/368 (45.38%), Query Frame = 2
Query: 2480 RKYETKYMKYEFA--MKSGKETEPILQCVICFECLS------NGSKKQLF*KGIYIANIR----------M*KTELSIFSKENFLSNLVVVQTLIV*EHHIARCGKPHTIGETLLMPTTIDIVVSVLGEKAAKEIDKVSLSNNTVKQRIDEMASQIEDILIQRL*TSLFFP------------SDWMKVLIFPIRR----NYSHMFFLISTIXXXXXXXSANH*LQKQLRTKYLK*LMIMLLQITSVGSNMCEFYTDGARAMTGKLSGVVTKIKEMAQQCKYIHCIIHPQALATKNMPVNFKYLLDESVEMVNFTKSRALNSRLFSILCGEMGSVHATLLLHTGDRGLSRGQVLSQLFQLRDGVVYMF 3481
            RKY   +++Y F   +  G E     QCVIC   LS      N  K+    K    A             + K      SK N   N+  V+T  +    IAR  KPHT  E LL P   D V  ++G++   ++  VSLSN+TV++RI +M++ I D ++Q +  S   P            ++ ++++++ +R     ++   F     ++           +   LR   +               ++C   TDGA A  G  SG    +   + +    HC++H Q LA K +P +F+ ++   +  VNF K+ +LNSRLF  LC ++     TLLLHT  R LSRG+VL ++F+LRD +   F
Sbjct:  167 RKYNEGFLQYGFTSTITVGIERP---QCVICGVVLSAESMKPNKLKRHFESKHSSFAGKDTNYFRSKADGLKKARPDTGSKSN-KQNVAAVETSYLVALRIARDMKPHTFAEHLLFPVAKDRVRVMIGDEFVTKLSAVSLSNDTVRRRIHDMSADILDQVVQEI-KSAPLPICSIQLDESTDVANCLQLMVY-VRYINDGDFKDEFLCCKPLERTATALDVFEAVDSFLRQHEIS------------WKSICGVCTDGAPATLGCQSGFQRLVLNESPKAIGAHCMLHLQTLAMKTLPQDFQEVMKSVLSSVNFVKASSLNSRLFLQLCSDLDEPSKTLLLHTEGRWLSRGKVLKRIFELRDELKMFF 516          

HSP 2 Score: 38.5058 bits (88), Expect = 1.354e-31
Identity = 18/41 (43.90%), Postives = 27/41 (65.85%), Query Frame = 1
Query: 3520 DEYWLCKLAYLSEYFSRFNDLNLSLEGVNNSVFDFYDKVRS 3642
            D   L K+AYL + F+  N+LNLSL+G N++  D  +K+ S
Sbjct:  530 DNSALQKVAYLVDIFTILNELNLSLQGPNSTCLDLSEKIHS 570          

HSP 3 Score: 57.7658 bits (138), Expect = 1.057e-7
Identity = 24/65 (36.92%), Postives = 43/65 (66.15%), Query Frame = 1
Query: 2926 PIFSLRLDESTDISNSAQLLAYVLFDFNNKIQEKILFCKPLTAKTTSHEIFKIINDYVITNHISW 3120
            PI S++LDESTD++N  QL+ YV +  +   +++ L CKPL    T+ ++F+ ++ ++  + ISW
Sbjct:  332 PICSIQLDESTDVANCLQLMVYVRYINDGDFKDEFLCCKPLERTATALDVFEAVDSFLRQHEISW 396          
BLAST of Zinc finger BED domain-containing protein 5 vs. Ensembl Mouse
Match: Gtf2ird2 (GTF2I repeat domain containing 2 [Source:MGI Symbol;Acc:MGI:2149780])

HSP 1 Score: 66.6254 bits (161), Expect = 6.459e-13
Identity = 46/134 (34.33%), Postives = 67/134 (50.00%), Query Frame = 2
Query: 3071 KYLK*LMIMLLQITSVGSNMCEFYTDGARAMTGKLSGVVTKIKEMAQQC------KYIHCIIHPQALATKNMPVNFKYLLDESVEMVNFTKSRALNSRLFSILCGEMGSVHATLLLHTGDRGLSRGQVLSQLFQ 3454
            K LK   I   ++ SV S        G  AM    SG+VTK++  A  C      K + CIIHP+ L  + +     +++D  V+ VN+  SR LN   F+ L  E+ S + +LL HT  + L RG VL + F+
Sbjct:  595 KSLKKFSIDWSKLVSVAST-------GTPAMMDANSGLVTKLRARAASCCKGADLKSVRCIIHPEWLCAQKL--RMGHVMDVVVDSVNWICSRGLNHGDFTTLLYELDSQYGSLLYHTALKWLGRGLVLRRFFE 719          

HSP 2 Score: 28.4906 bits (62), Expect = 6.459e-13
Identity = 13/38 (34.21%), Postives = 22/38 (57.89%), Query Frame = 1
Query: 3529 WLCKLAYLSEYFSRFNDLNLSLEGVNNSVFDFYDKVRS 3642
            W+  LA+L +  +  N L+ SL+G +  V   YD +R+
Sbjct:  743 WILDLAFLVDMTTHLNTLDASLQGHSQIVTQMYDFIRA 780          
BLAST of Zinc finger BED domain-containing protein 5 vs. UniProt/SwissProt
Match: sp|Q6R2W3|SCND3_HUMAN (SCAN domain-containing protein 3 OS=Homo sapiens OX=9606 GN=ZBED9 PE=2 SV=1)

HSP 1 Score: 160.229 bits (404), Expect = 5.686e-45
Identity = 120/395 (30.38%), Postives = 206/395 (52.15%), Query Frame = 2
Query: 2393 SNFNRKKDKSREFSKDEEPELXXXXXAWIRKYETKYMKYEF-AMKSGKETEPILQCVICFECLSNGS------KKQLF*KGIYIAN-----IRM*KTELSIFSKENFLSNLVVVQTLIV*EH---HIARCGKPHTIGETLLMPTTIDIVVSVLGEKAAKEIDKVSLSNNTVKQRIDEMASQIEDILIQRL*TSLFFP------SDWMKVLIFPIRRNYSH------MFFLISTIXXXXXXXSANH*LQKQLRTKYLK*LMIMLLQITSVGSNMC--EFY------TDGARAMTGKLSGVVTKIKEMAQQCKYIHCIIHPQALATKNMPVNFKYLLDESVEMVNFTKSRALNSRLFSILCGEMGSVHATLLLHTGDRGLSRGQVLSQLFQLRDGVV 3472
            S+ N++   +R +   EE + K+   ++ RKY+  Y+++ F A+  G+  +P  QC+IC + L+N +      K+ L+ K   I++          +EL    K+ F  + + +  L         +A+   P+TI ETL+     ++ + +LGE AAK++ +V LSN+T+ +RI E+A+ +ED LI+++  + +F        D   ++I  +   + H       FF  +++                           +   + +   N C  EF       +DGA +MTGK S VVT+IKE+A +CK  HC IH ++LA K +      +L++ V++VN+ KS +LNSRLFS+LC  M + H  LLLH   R LSRG+VLS++F++R+ ++
Sbjct:  708 SSSNKRNVNNRSYP--EEGKTKRVHASFTRKYDPSYIEFGFVAVIDGEVLKP--QCIICGDVLANEAMKPSKLKRHLYSKHKEISSQPKEFFERKSSELKSQPKQVFNVSHINISALRASYKVALPVAKSKTPYTIAETLVKDCIKEVCLEMLGESAAKKVAQVPLSNDTIARRIQELANDMEDQLIEQIKLAKYFSLQLDECRDIANMIILLVYVRFEHDDDIKEEFFFSASLPTNTTSSE-------------------LYEAVKNYIVNKCGLEFKFCVGVCSDGAASMTGKHSEVVTQIKELAPECKTTHCFIHRESLAMKKISAELNSVLNDIVKIVNYIKSNSLNSRLFSLLCDNMEADHKQLLLHAEIRWLSRGKVLSRMFEIRNELL 1079          

HSP 2 Score: 45.8246 bits (107), Expect = 5.686e-45
Identity = 21/41 (51.22%), Postives = 26/41 (63.41%), Query Frame = 1
Query: 3520 DEYWLCKLAYLSEYFSRFNDLNLSLEGVNNSVFDFYDKVRS 3642
            D  W  +LAYLS+ FS FNDLN S++G N + F   DKV  
Sbjct: 1095 DVNWTARLAYLSDIFSIFNDLNASMQGKNATYFSMADKVEG 1135          
BLAST of Zinc finger BED domain-containing protein 5 vs. UniProt/SwissProt
Match: sp|O95789|ZMYM6_HUMAN (Zinc finger MYM-type protein 6 OS=Homo sapiens OX=9606 GN=ZMYM6 PE=1 SV=2)

HSP 1 Score: 138.658 bits (348), Expect = 2.105e-39
Identity = 112/383 (29.24%), Postives = 186/383 (48.56%), Query Frame = 2
Query: 2441 EEPELXXXXXAWIRKYETKYMKYEFAMKSG-KETEPILQCVICFECLSNGSKK-------------QLF*KGIYIANIRM*KTELSIFS-KENFLSNLVVVQTLIV*EHHIARCGKPHTIGETLLMPTTIDIVVSVLGEKAAKEIDKVSLSNNTVKQRIDEMASQIEDILIQRL*TSLFFPSD---------------WMKVLIFPIRRNYSHMFFLISTIXXXXXXXSANH*LQKQLRTKYLK*LMIMLLQITSVGSNMC-EFYTDGARAMTGKLSGVVTKIKEMA-QQCKYIHCIIHPQALATKNMPVNFKYLLDESVEMVNFTKSRALNSRLFSILCGEMGSVHATLLLHTGDRGLSRGQVLSQLFQLRDGVVYMFLAMQ 3493
            + P  KK +  + + Y+T+Y+K  F +  G KE+ P  QCVIC E LS+ + K             +L  K +     +  + E    S K+  L    +V+   +     A   KP +I E L+ P  +++   VLG  A  ++  + LSN T++ RIDE+++ IED LIQ++  S +F                  +++ + +  R     + F I               +  Q+    +  L+   +   S+    C    TDGA +MTG+ SG+  KI+E+A     + HC IH + L  + +      +L +S ++++F KS ALNSR+ +ILC EMGS H +L LH   R +SRG++L +LF+LR   + +FL+ +
Sbjct:  729 DSPPSKKKRLGFFQTYDTEYLKVGFIICPGSKESSPRPQCVICGEILSSENMKPANLSHHLKTKHSELENKPVDFFEQKSLEMECQNSSLKKCLLVEKSLVKASYLIAFQTAASKKPFSIAEELIKPYLVEMCSEVLGSSAGDKMKTIPLSNVTIQHRIDELSADIEDQLIQKVRESKWFALQIDESSEISNITLLLCYIRFIDYDCRDVKEELLFCIE--------------MPTQITGFEIFELINKYIDSKSLNWKHCVGLCTDGAASMTGRYSGLKAKIQEVAMNTAAFTHCFIHRERLVAEKLSPCLHKILLQSAQILSFIKSNALNSRMLTILCEEMGSEHVSLPLHAEVRWISRGRMLKRLFELRHE-IEIFLSQK 1096          

HSP 2 Score: 46.9802 bits (110), Expect = 2.105e-39
Identity = 24/49 (48.98%), Postives = 33/49 (67.35%), Query Frame = 1
Query: 3490 AKYFNGDRLIDEYWLCKLAYLSEYFSRFNDLNLSLEGVNNSVFDFYDKV 3636
            AKYF+     DE W+ KLAYLS+ FS  N+LNLSL+G   + F+  +K+
Sbjct: 1101 AKYFH-----DEEWVGKLAYLSDIFSLINELNLSLQGTLTTFFNLCNKI 1144          

HSP 3 Score: 21.557 bits (44), Expect = 2.105e-39
Identity = 9/36 (25.00%), Postives = 18/36 (50.00%), Query Frame = 3
Query: 3639 FMRKLHLMQQQIEKQTFNMLPFLCNFVEENNLRLKD 3746
            F RKL +  ++ ++  ++M P    F   + L + D
Sbjct: 1147 FKRKLKMWLKRTQENDYDMFPSFSEFSNSSGLNMTD 1182          
BLAST of Zinc finger BED domain-containing protein 5 vs. UniProt/SwissProt
Match: sp|Q4R6P1|F200A_MACFA (Protein FAM200A OS=Macaca fascicularis OX=9541 GN=FAM200A PE=2 SV=1)

HSP 1 Score: 93.9745 bits (232), Expect = 8.024e-38
Identity = 50/115 (43.48%), Postives = 74/115 (64.35%), Query Frame = 2
Query: 3143 TDGARAMTGKLSGVVTKIKEMAQQ-CKYIHCIIHPQALATKNMPVNFKYLLDESVEMVNFTKSRALNSRLFSILCGEMGSVHATLLLHTGDRGLSRGQVLSQLFQLRDGVVYMFL 3484
            +DGA  MTGK S +  K+ E       + HC IH +AL +K +  +   +L ++V++VNF K  +LNSRL  ILC E+G  H  LL HT  R LS+G+VLS++++LR+  +Y+FL
Sbjct:  211 SDGAANMTGKHSRLTEKLLEATHNNALWNHCFIHREALVSKEISPSLMDVLKKAVKIVNFIKGSSLNSRLLEILCSEIGVNHTHLLFHTEVRWLSQGKVLSRVYELRNE-IYIFL 324          

HSP 2 Score: 49.6766 bits (117), Expect = 8.024e-38
Identity = 22/72 (30.56%), Postives = 45/72 (62.50%), Query Frame = 2
Query: 2720 HHIARCGKPHTIGETLLMPTTIDIVVSVLGEKAAKEIDKVSLSNNTVKQRIDEMASQIEDILIQRL*TSLFF 2935
            + +A+    HT  E +++P  +D+V ++  +K+A ++  + LS+NT+ +RI  +A  +E +LI RL + + F
Sbjct:   69 YRVAKEKMAHTAAEKIILPACMDMVRTIFDDKSADKLRTIPLSDNTISRRICTIAKHLEAMLITRLQSGIDF 140          

HSP 3 Score: 42.3578 bits (98), Expect = 8.024e-38
Identity = 16/39 (41.03%), Postives = 27/39 (69.23%), Query Frame = 1
Query: 3520 DEYWLCKLAYLSEYFSRFNDLNLSLEGVNNSVFDFYDKV 3636
            ++ W+ KLAYLS+ F   N+LNL ++G NN +F + + +
Sbjct:  337 NDIWVTKLAYLSDIFGILNELNLKIQGKNNDIFQYLEHI 375          

HSP 4 Score: 36.1946 bits (82), Expect = 8.024e-38
Identity = 18/57 (31.58%), Postives = 34/57 (59.65%), Query Frame = 1
Query: 2932 FSLRLDESTDISNSAQLLAYVLFDFNNKIQEKILFCKPLTAKTTSHEIFKIINDYVI 3102
            F+++LDESTDI++   LL YV + + +   E +L C  L +  T  ++F  + + ++
Sbjct:  140 FAIQLDESTDIASCPTLLVYVRYVWQDDFVEDLLCCLNLNSHITGLDLFTELENCIV 196          
BLAST of Zinc finger BED domain-containing protein 5 vs. UniProt/SwissProt
Match: sp|Q8TCP9|F200A_HUMAN (Protein FAM200A OS=Homo sapiens OX=9606 GN=FAM200A PE=1 SV=1)

HSP 1 Score: 89.7373 bits (221), Expect = 2.334e-36
Identity = 48/115 (41.74%), Postives = 70/115 (60.87%), Query Frame = 2
Query: 3143 TDGARAMTGKLSGVVTKIKEMAQQ-CKYIHCIIHPQALATKNMPVNFKYLLDESVEMVNFTKSRALNSRLFSILCGEMGSVHATLLLHTGDRGLSRGQVLSQLFQLRDGVVYMFL 3484
            +DG   MTGK S +  K+ E       + HC IH +AL +K +  +   +L  +V+ VNF K  +LNSRL  I C E+G  H  LL HT  R LS+G+VLS++++LR+  +Y+FL
Sbjct:  211 SDGTANMTGKHSRLTEKLLEATHNNAVWNHCFIHREALVSKEISPSLMDVLKNAVKTVNFIKGSSLNSRLLEIFCSEIGVNHTHLLFHTEVRWLSQGKVLSRVYELRNE-IYIFL 324          

HSP 2 Score: 49.6766 bits (117), Expect = 2.334e-36
Identity = 22/72 (30.56%), Postives = 45/72 (62.50%), Query Frame = 2
Query: 2720 HHIARCGKPHTIGETLLMPTTIDIVVSVLGEKAAKEIDKVSLSNNTVKQRIDEMASQIEDILIQRL*TSLFF 2935
            + +A+    HT  E +++P  +D+V ++  +K+A ++  + LS+NT+ +RI  +A  +E +LI RL + + F
Sbjct:   69 YRVAKEKMAHTAAEKIILPACMDMVRTIFDDKSADKLRTIPLSDNTISRRICTIAKHLEAMLITRLQSGIDF 140          

HSP 3 Score: 42.3578 bits (98), Expect = 2.334e-36
Identity = 16/39 (41.03%), Postives = 27/39 (69.23%), Query Frame = 1
Query: 3520 DEYWLCKLAYLSEYFSRFNDLNLSLEGVNNSVFDFYDKV 3636
            D+ W+ KLAYLS+ F   N+L+L ++G NN +F + + +
Sbjct:  337 DDIWVTKLAYLSDIFGILNELSLKMQGKNNDIFQYLEHI 375          

HSP 4 Score: 35.4242 bits (80), Expect = 2.334e-36
Identity = 18/49 (36.73%), Postives = 30/49 (61.22%), Query Frame = 1
Query: 2932 FSLRLDESTDISNSAQLLAYVLFDFNNKIQEKILFCKPLTAKTTSHEIF 3078
            F+++LDESTDI++   LL YV + + +   E +L C  L +  T  ++F
Sbjct:  140 FAIQLDESTDIASCPTLLVYVRYVWQDDFVEDLLCCLNLNSHITGLDLF 188          
BLAST of Zinc finger BED domain-containing protein 5 vs. UniProt/SwissProt
Match: sp|A4Z943|ZBED5_BOVIN (Zinc finger BED domain-containing protein 5 OS=Bos taurus OX=9913 GN=ZBED5 PE=4 SV=1)

HSP 1 Score: 107.842 bits (268), Expect = 7.069e-30
Identity = 53/113 (46.90%), Postives = 79/113 (69.91%), Query Frame = 2
Query: 3143 TDGARAMTGKLSGVVTKIKEMAQQCKYIHCIIHPQALATKNMPVNFKYLLDESVEMVNFTKSRALNSRLFSILCGEMGSVHATLLLHTGDRGLSRGQVLSQLFQL-RDGVVYM 3478
            +D +RAM GK++  VT IK +A +    HC+++  ALA K MP + K +LD++V+++N+ K+R   SRL  ILC EMG+ H  LLL+T  R LSRG+VL +LF+L R+ +V+M
Sbjct:  344 SDASRAMDGKIAEAVTLIKYVAPESTSSHCLLYRHALAVKTMPTSLKNVLDQAVQIINYIKARPHQSRLLKILCEEMGAQHTALLLNTEVRWLSRGKVLVRLFELRRELLVFM 456          

HSP 2 Score: 47.3654 bits (111), Expect = 7.069e-30
Identity = 20/46 (43.48%), Postives = 33/46 (71.74%), Query Frame = 1
Query: 3505 GDRLIDEYWLCKLAYLSEYFSRFNDLNLSLEGVNNSVFDFYDKVRS 3642
             D L +  WL +LAYL++ F++ N++NLS++G N +VF  +DK+ S
Sbjct:  463 SDCLTNSSWLLRLAYLADIFTKLNEVNLSMQGKNVTVFTVFDKMSS 508          

HSP 3 Score: 72.4034 bits (176), Expect = 4.717e-24
Identity = 52/161 (32.30%), Postives = 79/161 (49.07%), Query Frame = 2
Query: 2480 RKYETKYMKYEFAMKSGKETEPILQCVICFECLSNGS-KKQLF*KGIYIANIRM*KTELSIF-----SKENF---------LSNLVVVQTLIV*EHHIARCGKPHTIGETLLMPTTIDIVVSVLGEKAAKEIDKVSLSNNTVKQRIDEMASQIEDILIQRL 2917
            RKY+  Y+ + F    G    P  QCV+C + LSN S       + +   +      ++S F     S EN            N    +      +HIA  G+ HTIGE L+ P   D+V+ +  E+ +K+ID V LSN+TV +RI ++A+ IE+ L+ RL
Sbjct:  109 RKYDESYLSFGFTY-FGNRDAPHAQCVLCKKILSNSSLAPSKLRRHLETKHAAYKDKDISFFKQHLDSPENNKPPTPKIVNTDNESATEASYNVSYHIALSGEAHTIGELLIKPCAKDVVMRMFDEQYSKKIDAVQLSNSTVARRIKDLAADIEEELVCRL 268          

HSP 4 Score: 63.1586 bits (152), Expect = 4.717e-24
Identity = 34/81 (41.98%), Postives = 45/81 (55.56%), Query Frame = 1
Query: 2932 FSLRLDESTDISNSAQLLAYVLFDFNNKIQEKILFCKPLTAKTTSHEIFKIINDYVITNHISWLKYV*VLYRRCSCDDWKI 3174
            FSL+LDES D+S  A LL +V + FN  I+E +L C+ L +  T  EIF  IN ++  + I W K V V        D KI
Sbjct:  274 FSLQLDESADVSGLAVLLVFVRYRFNKSIEEDLLLCESLQSNATGEEIFNCINSFMQKHEIEWEKCVDVCSDASRAMDGKI 354          
BLAST of Zinc finger BED domain-containing protein 5 vs. TrEMBL
Match: A0A3P9BBW8 (Uncharacterized protein OS=Maylandia zebra OX=106582 PE=4 SV=1)

HSP 1 Score: 139.043 bits (349), Expect = 8.607e-63
Identity = 65/113 (57.52%), Postives = 84/113 (74.34%), Query Frame = 2
Query: 3143 TDGARAMTGKLSGVVTKIKEMAQQCKYIHCIIHPQALATKNMPVNFKYLLDESVEMVNFTKSRALNSRLFSILCGEMGSVHATLLLHTGDRGLSRGQVLSQLFQLRDGVVYMF 3481
            TDGARAMTG+  GVV++++ +A    ++HC IH +ALA K +PV  K++LD SV+MVNF K+R LNSRLF+ LC EMGS H TLLLHT  R LSRG+VL+  F+LRD +   F
Sbjct:  334 TDGARAMTGRHGGVVSRVQAVAPDASWVHCSIHREALAAKGIPVRLKHVLDTSVKMVNFVKARPLNSRLFAALCNEMGSEHETLLLHTEIRWLSRGKVLTCFFELRDELKVFF 446          

HSP 2 Score: 64.6994 bits (156), Expect = 8.607e-63
Identity = 50/163 (30.67%), Postives = 79/163 (48.47%), Query Frame = 2
Query: 2480 RKYETKYMKYEFA-MKSGKETEPILQCVICFECLSNGS-KKQLF*KGIYIANIRM*KTELSIFSKENFLSNLVVVQTLI---------------V*EHHIARCGKPHTIGETLLMPTTIDIVVSVLGEKAAKEIDKVSLSNNTVKQRIDEMASQIEDILIQRL 2917
            RKY+  Y+   F  +  G    P  QCVIC + LS  S K  L  + +   +  +       F ++  L +L   +T I               +  + +A+  KPHTI E L++P  +D+V ++LGEKA K I  +  SNNTV +RI+ M+  +   L+ R+
Sbjct:  100 RKYDDNYISLGFTCINIGGFPRP--QCVICAKVLSQNSMKPSLLRRHLETNHPHLKNKPREYFERQ--LKSLSTSKTCIQVPDLMNKNRLQASYMVSYRVAKNNKPHTIVEDLILPAALDMVGTMLGEKAKKTIQSIPSSNNTVLRRINAMSENVLQQLLLRI 258          

HSP 3 Score: 61.6178 bits (148), Expect = 8.607e-63
Identity = 27/74 (36.49%), Postives = 49/74 (66.22%), Query Frame = 1
Query: 2911 KIINKPIFSLRLDESTDISNSAQLLAYVLFDFNNKIQEKILFCKPLTAKTTSHEIFKIINDYVITNHISWLKYV 3132
            +I +   ++++LDESTD++  A LL YV +     I+E +LFCKPL  +TT+ +IF+ ++ ++ T+ + W + V
Sbjct:  257 RIRHSECYAIQLDESTDVAGLAHLLVYVRYIHEGTIKEDMLFCKPLEQRTTAADIFQKLDTFMNTHGLVWDRCV 330          

HSP 4 Score: 49.6766 bits (117), Expect = 8.607e-63
Identity = 24/53 (45.28%), Postives = 35/53 (66.04%), Query Frame = 1
Query: 3484 SNAKYFNGDRLIDEYWLCKLAYLSEYFSRFNDLNLSLEGVNNSVFDFYDKVRS 3642
            SN  +   + L DE +L  LAYL + FSR N+LNL L+GV+ ++F+  DKV +
Sbjct:  447 SNHPFELSEHLHDEEYLTCLAYLCDIFSRLNELNLGLQGVSATIFNVQDKVEA 499          
BLAST of Zinc finger BED domain-containing protein 5 vs. TrEMBL
Match: A0A2S2R108 (Zinc finger BED domain-containing protein 5 OS=Sipha flava OX=143950 GN=ZBED5_19 PE=4 SV=1)

HSP 1 Score: 118.242 bits (295), Expect = 3.054e-60
Identity = 53/114 (46.49%), Postives = 80/114 (70.18%), Query Frame = 2
Query: 3143 TDGARAMTGKLSGVVTKIKEMAQQCKYIHCIIHPQALATKNMPVNFKYLLDESVEMVNFTKSRALNSRLFSILCGEMGSVHATLLLHTGDRGLSRGQVLSQLFQLRDGVVYMFL 3484
            TDGARAM+G  SG+  ++K +     + HC IH +ALA KNMP     +L + V++VN  K+R+LNSR+F+++C +MGS+H  LLLH   R LSRG+V+S++F+L++G+   F 
Sbjct:  270 TDGARAMSGTRSGLQARLKTINSSIIWHHCCIHREALAAKNMPEKLNEVLRDIVQVVNLIKARSLNSRIFNLICEDMGSIHKQLLLHAEVRWLSRGKVVSRVFELKNGIRMFFF 383          

HSP 2 Score: 78.1814 bits (191), Expect = 3.054e-60
Identity = 59/173 (34.10%), Postives = 89/173 (51.45%), Query Frame = 2
Query: 2480 RKYETKYMKYEFA-MKSGKETEPILQCVICFECLSNGSKKQLF*KGIYIANIRM*KTELSIFSKENFLSNL--------VVVQTLIV*EHH------------IARCGKPHTIGETLLMPTTIDIVVSVLGEKAAKEIDKVSLSNNTVKQRIDEMASQIEDILIQRL*TSLFF 2935
            RK+  +Y+ + F  +    E  P  QCVIC+E LSN S K          +++   T+    SK+ F S          ++ +T I   +             +A+ GKPHTI E L++P    +V ++LG+KA+ E+  VSLSNNTVK RI EM+  I++ LI  + TS F+
Sbjct:   34 RKFSEEYITFGFTNINVNNEERP--QCVICYEILSNKSMK----PAKLRRHLQTRHTDYLTKSKQFFESKAAELEQSKKLIKKTAIGTNNERAVTASYQVPLLVAKSGKPHTIVEELILPAAKIMVSAMLGDKASNELSTVSLSNNTVKNRIVEMSENIKEQLISNIKTSKFY 200          

HSP 3 Score: 66.6254 bits (161), Expect = 3.054e-60
Identity = 32/63 (50.79%), Postives = 43/63 (68.25%), Query Frame = 1
Query: 2932 FSLRLDESTDISNSAQLLAYVLFDFNNKIQEKILFCKPLTAKTTSHEIFKIINDYVITNHISW 3120
            +SL+LDESTDI N A LLAYV ++ +N I E  LFC  L + TT   IF I+N ++I++ I W
Sbjct:  200 YSLQLDESTDICNDANLLAYVRYENHNTITEDFLFCISLPSNTTGEAIFNILNSFIISHDIKW 262          

HSP 4 Score: 40.0466 bits (92), Expect = 3.054e-60
Identity = 20/59 (33.90%), Postives = 34/59 (57.63%), Query Frame = 1
Query: 3466 SSLHVSSNAKYFNGDRLIDEYWLCKLAYLSEYFSRFNDLNLSLEGVNNSVFDFYDKVRS 3642
            +S+ V+  A  FN        WLC +AYL++ F+  N LN+SL+G  +++F   D + +
Sbjct:  385 NSMEVTKYANLFNNFE-----WLCTVAYLADIFNSLNSLNISLQGKEDNIFHTEDNIEA 438          

HSP 5 Score: 23.8682 bits (50), Expect = 3.054e-60
Identity = 13/47 (27.66%), Postives = 24/47 (51.06%), Query Frame = 3
Query: 3636 AFMRKLHLMQQQIEKQTFNMLPFLCNFVEENNLRLKDDAMSDIKKYL 3776
            A ++KL L +++  +  FN  P L  F+E ++     D    I ++L
Sbjct:  438 AMLKKLELWRKRALQNNFNHFPTLYAFIESSDEVFPQDTKDIIIEHL 484          
BLAST of Zinc finger BED domain-containing protein 5 vs. TrEMBL
Match: A0A498L9Z1 (Zinc finger BED domain-containing 5-like protein OS=Labeo rohita OX=84645 GN=ROHU_034106 PE=4 SV=1)

HSP 1 Score: 126.716 bits (317), Expect = 1.262e-59
Identity = 58/122 (47.54%), Postives = 87/122 (71.31%), Query Frame = 2
Query: 3143 TDGARAMTGKLSGVVTKIKEMAQQCKYIHCIIHPQALATKNMPVNFKYLLDESVEMVNFTKSRALNSRLFSILCGEMGSVHATLLLHTGDRGLSRGQVLSQLFQLRDGVVYMFLAMQNILTE 3508
            TDGA+AMTG+  G+  +++++A   K+ HC++H +ALA K MPV F  +L++SV+M+N  KSR LN+RL  +LC EMGS H  LLLHT  R LSRG+VL +L++LR+ V +    +++ L +
Sbjct:  253 TDGAQAMTGRERGLAARVQQVAPLVKWTHCMVHREALAAKKMPVLFDSVLNQSVKMINLIKSRPLNTRLLGVLCQEMGSGHEQLLLHTEVRWLSRGRVLQRLYELREEVKWFLTEIKSDLAK 374          

HSP 2 Score: 68.9366 bits (167), Expect = 1.262e-59
Identity = 28/69 (40.58%), Postives = 46/69 (66.67%), Query Frame = 1
Query: 2914 IINKPIFSLRLDESTDISNSAQLLAYVLFDFNNKIQEKILFCKPLTAKTTSHEIFKIINDYVITNHISW 3120
            +   P ++L+LDESTDI+  AQLL YV +  +  I+E +LFC+PL + TT   IF +++ ++  N ++W
Sbjct:  177 VKKSPYYALQLDESTDIAGQAQLLTYVRYLRDKAIEEDVLFCRPLQSHTTGEAIFNVLDIFIRENGLAW 245          

HSP 3 Score: 68.5514 bits (166), Expect = 1.262e-59
Identity = 52/174 (29.89%), Postives = 86/174 (49.43%), Query Frame = 2
Query: 2477 IRKYETKYMKYEFAMKSGKETEPILQCVICFECLSNGSKKQLF*K--------GIYIANIRM*KTEL-------------SIFSKENFLSNLVVVQTLIV*EHHIARCGKPHTIGETLLMPTTIDIVVSVLGEKAAKEIDKVSLSNNTVKQRIDEMASQIEDILIQRL*TSLFF 2935
            +R+Y+  Y+++ F   +  +  P  QCV+C E L+N S K    K        GI        K +L             S  SK+   ++ VV +        I + GKPHTI ETL++P   D+   ++G+ AA ++  V LSN+TV +RI +M++ I + LI+ +  S ++
Sbjct:   21 LRRYDEAYLQFGFTATA--DLRP--QCVVCAEVLANDSMKPCKLKRHLETKHAGIKNKPTEYFKRKLDGLHQQQATISVHSTVSKQCLEASYVVAK-------RIGKLGKPHTITETLILPAAQDMCRIMIGDSAAAKLGAVPLSNDTVARRIVDMSNDIREQLIEFVKKSPYY 183          

HSP 4 Score: 40.4318 bits (93), Expect = 1.262e-59
Identity = 19/43 (44.19%), Postives = 24/43 (55.81%), Query Frame = 1
Query: 3514 LIDEYWLCKLAYLSEYFSRFNDLNLSLEGVNNSVFDFYDKVRS 3642
            L D  WL  L+YL + F R N LNLSL+G    +    DKV +
Sbjct:  376 LDDTMWLASLSYLVDIFDRLNGLNLSLQGRETHILLLADKVHA 418          
BLAST of Zinc finger BED domain-containing protein 5 vs. TrEMBL
Match: A0A4C1ZGT4 (Zinc finger BED domain-containing protein 5 OS=Eumeta variegata OX=151549 GN=ZBED5 PE=4 SV=1)

HSP 1 Score: 112.849 bits (281), Expect = 6.415e-58
Identity = 57/122 (46.72%), Postives = 84/122 (68.85%), Query Frame = 2
Query: 3143 TDGARAMTGKLSGVVTKIKEMAQQCKYIHCIIHPQALATKNMPVNFKYLLDESVEMVNFTKSRALNSRLFSILCGEMGSVHATLLLHTGDRGLSRGQVLSQLFQLRDGVVYMFLAMQNILTE 3508
            TDGARAM GK S +VT+I E +    + HC +H +AL +K +  +FK +L+ +V++VN+ K+R L +RLF  LC EMGS+H +LL HT  R LSRG+VL++L +LR  V+ ++L  +   TE
Sbjct:  291 TDGARAMCGKNSSMVTRILEQSPYASWTHCSLHIEALVSKALSDDFKTVLNTAVKIVNYIKTRPLQARLFQKLCEEMGSLHTSLLFHTEVRWLSRGKVLTRLVELRHEVL-IYLEGKTEYTE 411          

HSP 2 Score: 105.145 bits (261), Expect = 6.415e-58
Identity = 66/167 (39.52%), Postives = 95/167 (56.89%), Query Frame = 2
Query: 2477 IRKYETKYMKYEFAMKSGKETEPILQCVICFECLSNGS------KKQLF*KGIYIANIRM*---KTELSIFSKENFLSNLVVVQTLIV*EHH-----IARCGKPHTIGETLLMPTTIDIVVSVLGEKAAKEIDKVSLSNNTVKQRIDEMASQIEDILIQRL*TSLFF 2935
            +RKY+ +Y+K  F       T+P  QCVIC+E L+N S       + +  K  +  N  +    K  L I S +N +S+ + +    V   +     IAR GKPHTIGE L++P+  D V ++ GEK  KEI+++ LSNNTV +RIDEMA   ED LIQR+  S ++
Sbjct:   57 VRKYDPEYLKLGFTWNHDT-TDPRPQCVICYEILANESMRPSKLTRHIETKHSHSINKPVDFSQKKLLEIQSSKNIVSHFININENAVYASYLISLRIARVGKPHTIGEDLVLPSIKDAVGAMFGEKEVKEIERIPLSNNTVARRIDEMAEWTEDELIQRIINSKYY 222          

HSP 3 Score: 59.6918 bits (143), Expect = 6.415e-58
Identity = 27/70 (38.57%), Postives = 44/70 (62.86%), Query Frame = 1
Query: 2911 KIINKPIFSLRLDESTDISNSAQLLAYVLFDFNNKIQEKILFCKPLTAKTTSHEIFKIINDYVITNHISW 3120
            +IIN   ++L+LDESTD+   +QL+ +V + +   + E ILFCKP+  + T+  IF +I+ Y+    I W
Sbjct:  215 RIINSKYYALQLDESTDVQGLSQLIVFVRYIWQEDVHEDILFCKPII-RGTAEVIFNVIDSYIKGKGIQW 283          
BLAST of Zinc finger BED domain-containing protein 5 vs. TrEMBL
Match: A0A4Y2V7M4 (Zinc finger BED domain-containing protein 5 OS=Araneus ventricosus OX=182803 GN=ZBED5_235 PE=4 SV=1)

HSP 1 Score: 126.331 bits (316), Expect = 6.859e-58
Identity = 58/117 (49.57%), Postives = 84/117 (71.79%), Query Frame = 2
Query: 3134 EFYTDGARAMTGKLSGVVTKIKEMAQQCKYIHCIIHPQALATKNMPVNFKYLLDESVEMVNFTKSRALNSRLFSILCGEMGSVHATLLLHTGDRGLSRGQVLSQLFQLRDGVVYMFL 3484
            E  +DGA+AM GK+ GVV +IK +A+ C   HCI+H  AL TK +   FK +LDE+V+++NF KS+ L SR+F  +C +MGS+H TLLLHT  R LSRG++L ++F+LR  ++  F+
Sbjct:  215 EVCSDGAKAMAGKVRGVVARIKNVAKSCNSTHCILHRYALVTKRISATFKSVLDEAVKIINFIKSKPLQSRIFKAMCEDMGSLHTTLLLHTEVRWLSRGKMLVRIFELRMELMAYFI 331          

HSP 2 Score: 63.929 bits (154), Expect = 6.859e-58
Identity = 33/66 (50.00%), Postives = 46/66 (69.70%), Query Frame = 2
Query: 2720 HHIARCGKPHTIGETLLMPTTIDIVVSVLGEKAAKEIDKVSLSNNTVKQRIDEMASQIEDILIQRL 2917
            + IA  G+ + IGE+L+     DIV  VLGE  +K+++ VSLSNNTVK+RI+++A  IE  LI RL
Sbjct:   77 YRIALAGEAYVIGESLIKLCVQDIVSCVLGESYSKQVESVSLSNNTVKKRINDIADDIELELISRL 142          

HSP 3 Score: 63.929 bits (154), Expect = 6.859e-58
Identity = 28/67 (41.79%), Postives = 46/67 (68.66%), Query Frame = 1
Query: 2932 FSLRLDESTDISNSAQLLAYVLFDFNNKIQEKILFCKPLTAKTTSHEIFKIINDYVITNHISWLKYV 3132
            ++L+LDESTD++  A LL +V +DFN KI+E +L C+ +   TT   IF  I++++ T+ I+W K +
Sbjct:  148 YALQLDESTDVAGLAILLVFVRYDFNKKIEEDLLLCESVNINTTGENIFNCIDNFMTTHEINWGKCI 214          

HSP 4 Score: 37.3502 bits (85), Expect = 6.859e-58
Identity = 17/43 (39.53%), Postives = 27/43 (62.79%), Query Frame = 1
Query: 3508 DRLIDEYWLCKLAYLSEYFSRFNDLNLSLEGVNNSVFDFYDKV 3636
            DRL +  WL  LAYL++ F + N+L L+L+G   ++    DK+
Sbjct:  339 DRLNNMAWLSTLAYLADIFGKLNELCLALQGKQVNILQAKDKL 381          

HSP 5 Score: 26.9498 bits (58), Expect = 6.859e-58
Identity = 15/49 (30.61%), Postives = 24/49 (48.98%), Query Frame = 3
Query: 3636 AFMRKLHLMQQQIEKQTFNMLPFLCNFVEENNLRLKDDAMSDIKKYLTS 3782
            AF RK+      +E+  F     L +F+EE  + L  +    IK +L+S
Sbjct:  383 AFSRKIQYWISAVEQNNFECFQTLSDFLEEPEVDLDMEIRDGIKTHLSS 431          
BLAST of Zinc finger BED domain-containing protein 5 vs. Ensembl Cavefish
Match: ENSAMXT00000044261.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000070.1:2279767:2281653:1 gene:ENSAMXG00000037161.1 transcript:ENSAMXT00000044261.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 181.03 bits (458), Expect = 1.132e-51
Identity = 131/366 (35.79%), Postives = 191/366 (52.19%), Query Frame = 2
Query: 2480 RKYETKYMKYEFAMKSGKETEPILQCVICFECLSNGS------KKQLF*KGIYIAN--IRM*KTELSIFSKENFLSNLV--------VVQTLIV*EHHIARCGKPHTIGETLLMPTTIDIVVSVLGEKAAKEIDKVSLSNNTVKQRIDEMASQIEDILIQRL*TSLFFP---------SDWMKVLIFPIRRNYSHMFFLISTIXXXXXXXSANH*LQKQLRTKYLK*LMIMLLQITSVGSNMCEFY------TDGARAMTGKLSGVVTKIKEMAQQCKYIHCIIHPQALATKNMPVNFKYLLDESVEMVNFTKSRALNSRLFSILCGEMGSVHATLLLHTGDRGLSRGQVLSQLFQLRDGVVYMFL 3484
            RKY ++Y+   F   +G E EP+  CV+C E L+N +      ++ L  K    A+  +   + +L  +        L          V+        IA+ GKPHTIGE+L++P   ++V  +LGEK  K+++ +SLS+NTV++RI+EMA  +   LI+R+  S F+          ++   +L F +R  Y H   +   I              K L TK     +  +L    V SN  E+       TDGARAM G+ SGV+  +K +A     +HC +H +ALA K M  + K +LDE+V++VNF KSR L SRLF +LC EM S H  LLLHT  R LS G+VL++LF+LRD V    L
Sbjct:   40 RKYSSEYLALGFTC-TGTENEPLPLCVVCSEVLANEALKTTKLRRHLETKHSEYASKPVEFFENKLKEYQSRKKTLELACSGTDHAKAVEASYRVAQLIAKAGKPHTIGESLILPAAKEMVSVMLGEKPCKQLNLISLSDNTVERRINEMAHDVTQQLIKRVRESRFYAIQLDESTDIANLSNLLAF-VR--YEHNREIFEDIL-----------FCKPLPTKTTAEAIFDVLNALIV-SNGIEWSKCVGVSTDGARAMMGQRSGVIASVKAVAPLATSVHCSLHREALAAKRMSRDLKIVLDEAVKIVNFIKSRPLQSRLFRVLCEEMASSHVQLLLHTEVRWLSHGKVLARLFELRDEVRIFLL 389          

HSP 2 Score: 44.2838 bits (103), Expect = 1.132e-51
Identity = 20/46 (43.48%), Postives = 29/46 (63.04%), Query Frame = 1
Query: 3505 GDRLIDEYWLCKLAYLSEYFSRFNDLNLSLEGVNNSVFDFYDKVRS 3642
             DR  D  WL KL+YLS+ F+  N LNLSL+G + + F   +K+ +
Sbjct:  396 SDRFTDFEWLAKLSYLSDIFTHLNGLNLSLQGKSVTAFHVQNKIEA 441          

HSP 3 Score: 73.9442 bits (180), Expect = 7.642e-13
Identity = 33/67 (49.25%), Postives = 49/67 (73.13%), Query Frame = 1
Query: 2932 FSLRLDESTDISNSAQLLAYVLFDFNNKIQEKILFCKPLTAKTTSHEIFKIINDYVITNHISWLKYV 3132
            ++++LDESTDI+N + LLA+V ++ N +I E ILFCKPL  KTT+  IF ++N  +++N I W K V
Sbjct:  206 YAIQLDESTDIANLSNLLAFVRYEHNREIFEDILFCKPLPTKTTAEAIFDVLNALIVSNGIEWSKCV 272          
BLAST of Zinc finger BED domain-containing protein 5 vs. Ensembl Cavefish
Match: ENSAMXT00000051422.1 (pep primary_assembly:Astyanax_mexicanus-2.0:15:35461191:35465166:-1 gene:ENSAMXG00000032672.1 transcript:ENSAMXT00000051422.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 181.8 bits (460), Expect = 1.438e-51
Identity = 133/364 (36.54%), Postives = 196/364 (53.85%), Query Frame = 2
Query: 2486 YETKYMKYEFAMKSGKETEPILQCVICFECLSNGS------KKQLF*KGIYIAN--IRM*KTELSIF-SKENFLS-------NLVVVQTLIV*EHHIARCGKPHTIGETLLMPTTIDIVVSVLGEKAAKEIDKVSLSNNTVKQRIDEMASQIEDILIQRL*TSLFFP---------SDWMKVLIFPIRRNYSHMFFLISTIXXXXXXXSANH*LQKQLRTKYLK*LMIMLLQITSVGSNMCEFY------TDGARAMTGKLSGVVTKIKEMAQQCKYIHCIIHPQALATKNMPVNFKYLLDESVEMVNFTKSRALNSRLFSILCGEMGSVHATLLLHTGDRGLSRGQVLSQLFQLRDGVVYMFL 3484
            Y ++Y+   F   +G E EP+  CV+C E L+N +      ++ L  K    A+  +   + +L  + S++  L        N   V+        IA+ GKPHTIGE+L++P   ++V  +LGEK  K+++ +SLS+NTV++RI+EMA  +   LI+R+  S F+          ++   +L F +R  Y H   +   I              K L TK     +  +L    V SN  E+       TDGARAM G+ SGV+ ++K +A     +HC +H +ALA K M  + K +LDE+V++VNF KSR L SRLF +LC EMGS H  LLLHT  R LSRG+VL++LF+LRD V    L
Sbjct:   85 YCSEYLALGFTC-TGTENEPLPLCVVCSEVLANEALKPTKLRRHLETKHSEYASKPVEFFENKLKEYQSRKKTLELACSGTDNAKAVEASYRVAQLIAKAGKPHTIGESLILPAAKEMVSVMLGEKPCKQLNLISLSDNTVERRINEMAHDVTQQLIKRVRESRFYAIQLDESTDIANLSNLLAF-VR--YEHNREIFEDIL-----------FCKPLPTKTTAVAIFDVLNAFIV-SNGIEWSKCVGVSTDGARAMMGQRSGVIARVKAVAPLATSVHCSLHREALAAKRMSRDLKIVLDEAVKIVNFIKSRPLQSRLFRVLCEEMGSSHVQLLLHTEVRWLSRGKVLARLFELRDEVRIFLL 432          

HSP 2 Score: 43.1282 bits (100), Expect = 1.438e-51
Identity = 19/46 (41.30%), Postives = 29/46 (63.04%), Query Frame = 1
Query: 3505 GDRLIDEYWLCKLAYLSEYFSRFNDLNLSLEGVNNSVFDFYDKVRS 3642
             DR  D  WL KL+YLS+ F+  N LN+SL+G + + F   +K+ +
Sbjct:  439 SDRFTDFEWLAKLSYLSDIFTHLNGLNISLQGKSVTAFHVQNKIEA 484          

HSP 3 Score: 73.9442 bits (180), Expect = 8.181e-13
Identity = 33/67 (49.25%), Postives = 50/67 (74.63%), Query Frame = 1
Query: 2932 FSLRLDESTDISNSAQLLAYVLFDFNNKIQEKILFCKPLTAKTTSHEIFKIINDYVITNHISWLKYV 3132
            ++++LDESTDI+N + LLA+V ++ N +I E ILFCKPL  KTT+  IF ++N ++++N I W K V
Sbjct:  249 YAIQLDESTDIANLSNLLAFVRYEHNREIFEDILFCKPLPTKTTAVAIFDVLNAFIVSNGIEWSKCV 315          
BLAST of Zinc finger BED domain-containing protein 5 vs. Ensembl Cavefish
Match: ENSAMXT00000057314.1 (pep primary_assembly:Astyanax_mexicanus-2.0:1:4224188:4227217:-1 gene:ENSAMXG00000029268.1 transcript:ENSAMXT00000057314.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 125.946 bits (315), Expect = 1.476e-29
Identity = 92/251 (36.65%), Postives = 131/251 (52.19%), Query Frame = 2
Query: 2726 IARCGKPHTIGETLLMPTTIDIVVSVLGEKAAKEIDKVSLSNNTVKQRIDEMASQIEDILIQRL*TSLFFP--SDWMKVLIFPIRRNYSHMFFLISTIXXXXXXXSANH*LQKQLRTKYLK*LMIMLLQITSVG---SNMCEFYTDGARAMTGKLSGVVTKIKEMAQQCKYIHCIIHPQALATKNMPVNFKYLLDESVEMVNFTKSRALNSRLFSILCGEMGSVHATLLLHTGDRGLSRGQVLSQLFQLRD 3463
            IA+  KPHTIGETL+ P  I +   + G + A +   V LSNNTVK RID MA  +E+ L+++L TS F     +   V    I   Y+   ++  T   +    S N  L+   R + +     +   ITS      N+    TDGA +M GK  G  +++KE A  C   HC++H  ALA K++  +    L   V++VNF K+R +N R+F+ LC +    H TLLLHT  R LSRG+ L +   L D
Sbjct:  104 IAKDKKPHTIGETLIKPACIKMAERMCGPQVANKFKIVPLSNNTVKDRIDRMAGNVENTLVEKLKTSPFSIQLDETTTVAEEAILIVYAQ--YIEGTEVKQDILMSVN--LKSTTRGEDI--FSAVDTYITSHNIPYKNIVACCTDGAASMMGKNKGFNSRLKEKAPHCLVFHCMVHRHALAGKHLCEDLNETLKTVVKIVNFIKARPVNRRIFAQLCED--ETHQTLLLHTEVRWLSRGKFLIKTAYLAD 346          
BLAST of Zinc finger BED domain-containing protein 5 vs. Ensembl Cavefish
Match: ENSAMXT00000030525.1 (pep primary_assembly:Astyanax_mexicanus-2.0:1:12992682:12994541:1 gene:ENSAMXG00000035573.1 transcript:ENSAMXT00000030525.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 71.2478 bits (173), Expect = 3.166e-27
Identity = 48/138 (34.78%), Postives = 73/138 (52.90%), Query Frame = 2
Query: 3143 TDGARAMTGKLSGVVTKIKEMAQQCKYIHCIIHPQALATKNMPVNFKYLLDESVEMVNFTKSRALNSRLFSILCGEMGSVHATLLLHTGDRGLSRGQVLSQLFQLR---------DGVVYMFLAMQNILTEID*LMSI 3529
            TDGA +MTG+ +G+    +E  ++   +HCIIH QAL +K +   F  ++   V+ +N  +SR+L  R F  L  EM S +  +L  T  R LSRG +L + F+LR         DGV    L+    L ++  L+ I
Sbjct:  302 TDGAPSMTGRKNGLE---EESVEEAIALHCIIHQQALCSKCL--KFDNVMSVVVKCINQIRSRSLKHRRFRALLEEMESEYGDVLYFTEVRWLSRGNILKRFFELRAEVKAFMEKDGVAVTVLSDPKWLMDLAFLVDI 434          

HSP 2 Score: 50.8322 bits (120), Expect = 3.166e-27
Identity = 26/69 (37.68%), Postives = 44/69 (63.77%), Query Frame = 1
Query: 2929 IFSLRLDESTDISNSAQLLAYVL-FDFNNKIQEKILFCKPLTAKTTSHEIFKIINDYVITNHISWLKYV 3132
            ++S+ LDESTDI+++AQL  YV   D N ++ E++L   P+  +TT+ EIF  + D +    + W ++V
Sbjct:  230 VYSVALDESTDITDTAQLAIYVRGVDDNFEVTEELLTVIPMHGQTTAQEIFHQLCDAIENAGLPWKRFV 298          

HSP 3 Score: 41.2022 bits (95), Expect = 3.166e-27
Identity = 29/98 (29.59%), Postives = 47/98 (47.96%), Query Frame = 2
Query: 2621 IANIRM*KTELSIFSKENFLSNLVVVQTLIV*EHHIARCGKPHTIGETLLMPTTIDIVVSVLGEKAAKEIDKVSLSNNTVKQRIDEMASQIEDILIQR 2914
            +AN++        F K+    N   V+   V    IA+ GKP T GE   +   I    S++  +   +   +SLS NTV +RI +++S I D L ++
Sbjct:  129 VANLKTCLLRQQDFFKKATKENDAAVEASYVVSEMIAKAGKPFTEGE--FVKKCILQAASIVCPEKKGQFSNISLSANTVAERISDLSSDIYDQLCEK 224          
BLAST of Zinc finger BED domain-containing protein 5 vs. Ensembl Cavefish
Match: ENSAMXT00000039226.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000099.1:564912:568121:1 gene:ENSAMXG00000042173.1 transcript:ENSAMXT00000039226.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 66.2402 bits (160), Expect = 1.603e-21
Identity = 39/111 (35.14%), Postives = 64/111 (57.66%), Query Frame = 2
Query: 3146 DGARAMTGKLSGVVTKIKEMAQQCKYI--HCIIHPQALATKNMPVNFKYLLDESVEMVNFTKSRALNSRLFSILCGEMGSVHATLLLHTGDRGLSRGQVLSQLFQLRDGVV 3472
            DGA AM G  +G +   ++      ++  HC+IH QALA+K   V+F +++   V++VN  +++AL  RLF  L  E+ + +  L+LH   R LSRG+VL +   L   ++
Sbjct:  249 DGAPAMCGIHAGFIALCRKDPIFPAFVSYHCVIHQQALASK--VVDFSHVMTVVVKIVNSIRAKALQHRLFKSLLDELDAEYGDLILHADVRWLSRGKVLQRFINLLPEII 357          

HSP 2 Score: 45.4394 bits (106), Expect = 1.603e-21
Identity = 23/68 (33.82%), Postives = 39/68 (57.35%), Query Frame = 1
Query: 2932 FSLRLDESTDISNSAQLLAYVLFDFNN-KIQEKILFCKPLTAKTTSHEIFKIINDYVITNHISWLKYV 3132
            FSL+ DES DI+++AQL+ +V   F++  ++E  L   PL  +T   +I++    Y   N + + K V
Sbjct:  177 FSLQFDESVDITDTAQLVVFVRMTFSDASVKEDFLTLLPLNERTRGEDIYRAFRTYATENDLPFQKLV 244          

HSP 3 Score: 32.3426 bits (72), Expect = 1.603e-21
Identity = 14/34 (41.18%), Postives = 22/34 (64.71%), Query Frame = 1
Query: 3514 LIDEYWLCKLAYLSEYFSRFNDLNLSLEGVNNSV 3615
            L D+ WL  LA+L++  S+ N+LN  L+G +  V
Sbjct:  370 LADDTWLLDLAFLTDLTSKLNELNCELQGKDCDV 403          
BLAST of Zinc finger BED domain-containing protein 5 vs. Ensembl Medaka
Match: ENSORLT00000028620.1 (pep primary_assembly:ASM223467v1:3:35179252:35181570:1 gene:ENSORLG00000028714.1 transcript:ENSORLT00000028620.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 99.7525 bits (247), Expect = 6.829e-55
Identity = 49/114 (42.98%), Postives = 73/114 (64.04%), Query Frame = 2
Query: 3143 TDGARAMTGKLSGVVTKIKEMAQQCKYIHCIIHPQALATKNMPVNFKYLLDESVEMVNFTKSRALNSRLFSILCGEMGSVHATLLLHTGDRGLSRGQVLSQLFQLRDGVVYMFL 3484
            +DGA +MTG+  GV+ +I ++A + K+ HC +H + LA K M   F   +D +V+ +NF KS A+NSR F+ LC  M + H  LL H+  R LSRG V +++F+LR   V+ FL
Sbjct:  293 SDGAASMTGRHRGVIKQILDLAPEAKWTHCFLHRENLAAKKMSPEFHEAMDVTVKTINFIKSNAVNSRCFAQLCEGMEADHVKLLYHSEVRWLSRGLVFTRIFELRKE-VFSFL 405          

HSP 2 Score: 70.4774 bits (171), Expect = 6.829e-55
Identity = 29/70 (41.43%), Postives = 47/70 (67.14%), Query Frame = 1
Query: 2911 KIINKPIFSLRLDESTDISNSAQLLAYVLFDFNNKIQEKILFCKPLTAKTTSHEIFKIINDYVITNHISW 3120
            +I   P FSL+LDESTD++N+A LL +V + +++ +QE ILFC  L  + T+ E F+ +++Y   N + W
Sbjct:  216 RIRKSPFFSLQLDESTDVTNAALLLVFVRYRWDSSLQEDILFCGELPTRATAEECFRCMDNYFTENGLDW 285          

HSP 3 Score: 67.3958 bits (163), Expect = 6.829e-55
Identity = 58/203 (28.57%), Postives = 94/203 (46.31%), Query Frame = 2
Query: 2375 LEESVTSNFNRKKDKSREFSKDEEPELXXXXXAWIRKYETKYMKYEFAMKSGKETEPILQCVICFECLSNGS-KKQLF*KGIYIANIRM*KTELSIFSKENFLSNLVVVQTLIV*EHHIARCG---------------KPHTIGETLLMPTTIDIVVSVLGEKAAKEIDKVSLSNNTVKQRIDEMASQIEDILIQRL*TSLFF 2935
            ++++VT N  +   +  E      P     K  +IRKY   ++K+ F +  G E EP  QCV C   LSN + K     + +     ++    +  F +++    L + +  IV     A+C                K  TI E L++P  +D+   ++GE AAK++  + LSN+ V  RI +MAS IE  L+ R+  S FF
Sbjct:   27 VKKTVTENMEKFLKRKNEVQSYASP---SSKAKFIRKYNPDFIKFGF-VNGGSEAEPRAQCVECGLTLSNEALKPSKLKRHLETKYPKLIGKPVDYFKRKD--DGLQMQRRSIVSLTGDAKCALKASYLVARRVALNKKAFTIAEELVLPAAVDMCREMIGEAAAKKLKTIPLSNDIVSHRIADMASDIEQQLLGRIRKSPFF 223          

HSP 4 Score: 39.6614 bits (91), Expect = 6.829e-55
Identity = 19/36 (52.78%), Postives = 27/36 (75.00%), Query Frame = 1
Query: 3529 WLCKLAYLSEYFSRFNDLNLSLEGVNNSVFDFYDKV 3636
            ++ KLAYLS+ FS  N LN+SL+G N+++F   DKV
Sbjct:  421 FIAKLAYLSDIFSLLNQLNISLQGRNSNIFFVADKV 456          
BLAST of Zinc finger BED domain-containing protein 5 vs. Ensembl Medaka
Match: ENSORLT00000032459.1 (pep primary_assembly:ASM223467v1:8:14240678:14247355:1 gene:ENSORLG00000024991.1 transcript:ENSORLT00000032459.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 97.8265 bits (242), Expect = 6.206e-54
Identity = 49/114 (42.98%), Postives = 76/114 (66.67%), Query Frame = 2
Query: 3143 TDGARAMTGKLSGVVTKIKEMAQQCKYIHCIIHPQALATKNMPVNFKYLLDESVEMVNFTKSRALNSRLFSILCGEMGSVHATLLLHTGDRGLSRGQVLSQLFQLRDGVVYMFL 3484
            +DGA +MTG+  GV+ +I ++A + K+ HC +H + LA K  P  F  ++D +V+ +NF KS A+NSR F+ LC  M + H  LL H+  R LSRG VL+++F+LR+  ++ FL
Sbjct:  247 SDGAASMTGRHRGVIKQILDLAPEAKWTHCFLHRENLAKKMSP-EFHEVMDVTVKTINFIKSNAVNSRCFAQLCEGMEADHVQLLYHSEVRWLSRGLVLTRIFELRNE-IFSFL 358          

HSP 2 Score: 70.4774 bits (171), Expect = 6.206e-54
Identity = 29/70 (41.43%), Postives = 47/70 (67.14%), Query Frame = 1
Query: 2911 KIINKPIFSLRLDESTDISNSAQLLAYVLFDFNNKIQEKILFCKPLTAKTTSHEIFKIINDYVITNHISW 3120
            +I   P FSL+LDESTD++N+A LL +V + +++ +QE ILFC  L  + T+ E F+ +++Y   N + W
Sbjct:  170 RIRKSPFFSLQLDESTDVTNAALLLVFVRYRWDSSLQEDILFCGELPTRATAEECFRCMDNYFTENGLDW 239          

HSP 3 Score: 65.0846 bits (157), Expect = 6.206e-54
Identity = 50/170 (29.41%), Postives = 82/170 (48.24%), Query Frame = 2
Query: 2474 WIRKYETKYMKYEFAMKSGKETEPILQCVICFECLSNGS-KKQLF*KGIYIANIRM*KTELSIFSKENFLSNLVVVQTLIV*EHHIARCG---------------KPHTIGETLLMPTTIDIVVSVLGEKAAKEIDKVSLSNNTVKQRIDEMASQIEDILIQRL*TSLFF 2935
            +IRKY    + + F +  G E EP  QCV C   LSN + K     + +   + ++    +  F +++    L + +  IV     A+C                K  TI E L++P  +D+   ++GE AAK++  + LSN+ V  RI ++AS IE  L++R+  S FF
Sbjct:   11 FIRKYNPDLINFGF-VNGGSEAEPRAQCVECGLTLSNEALKPSKLKRHLETKHPKLIGKPVDYFKRKD--DGLQMQRRSIVSLTGDAKCALKASYLVARRVAQSKKAFTIAEELVLPAAVDMCREMIGEAAAKKLKTIPLSNDIVSHRIADIASDIEQQLLERIRKSPFF 177          

HSP 4 Score: 40.817 bits (94), Expect = 6.206e-54
Identity = 19/38 (50.00%), Postives = 29/38 (76.32%), Query Frame = 1
Query: 3529 WLCKLAYLSEYFSRFNDLNLSLEGVNNSVFDFYDKVRS 3642
            ++ KLAYLS+ FS  N LN+SL+G N+++F   DKV++
Sbjct:  374 FIAKLAYLSDIFSLLNQLNISLQGRNSNIFFVADKVQA 411          
BLAST of Zinc finger BED domain-containing protein 5 vs. Ensembl Medaka
Match: ENSORLT00000030244.1 (pep primary_assembly:ASM223467v1:13:28104458:28106771:-1 gene:ENSORLG00000022768.1 transcript:ENSORLT00000030244.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 102.064 bits (253), Expect = 1.300e-47
Identity = 50/114 (43.86%), Postives = 75/114 (65.79%), Query Frame = 2
Query: 3143 TDGARAMTGKLSGVVTKIKEMAQQCKYIHCIIHPQALATKNMPVNFKYLLDESVEMVNFTKSRALNSRLFSILCGEMGSVHATLLLHTGDRGLSRGQVLSQLFQLRDGVVYMFL 3484
            +DGA +MTG+  GV+ +I ++A + K+ HC +H + LA K M   F  ++D +V+ +NF KS A+NSR F+ LC  M + H  LL H+  R LSRG VL+++F+LR   V+ FL
Sbjct:  117 SDGAASMTGRHRGVIKQILDLAPEAKWTHCFLHRENLAAKKMSPEFHEVMDVTVKTINFIKSNAVNSRCFAQLCEGMEADHVKLLYHSEVRWLSRGLVLTRIFELRKE-VFSFL 229          

HSP 2 Score: 67.781 bits (164), Expect = 1.300e-47
Identity = 28/70 (40.00%), Postives = 45/70 (64.29%), Query Frame = 1
Query: 2911 KIINKPIFSLRLDESTDISNSAQLLAYVLFDFNNKIQEKILFCKPLTAKTTSHEIFKIINDYVITNHISW 3120
            +I   P FSL+LDESTD+  +A LL +V + +++ +QE ILFC  L  + T+ E F+ ++ Y+  N + W
Sbjct:   40 RIRKSPFFSLQLDESTDVKKAALLLVFVRYRWDSSLQEDILFCGELPTRATAEECFRCMDHYLTENGLDW 109          

HSP 3 Score: 42.3578 bits (98), Expect = 1.300e-47
Identity = 21/45 (46.67%), Postives = 30/45 (66.67%), Query Frame = 2
Query: 2801 VLGEKAAKEIDKVSLSNNTVKQRIDEMASQIEDILIQRL*TSLFF 2935
            ++GE AAK++  + LSN+ V  RI +MAS IE  L+ R+  S FF
Sbjct:    3 MIGEAAAKKLKTIPLSNDIVSHRIADMASDIEQQLLGRIRKSPFF 47          

HSP 4 Score: 40.817 bits (94), Expect = 1.300e-47
Identity = 19/37 (51.35%), Postives = 28/37 (75.68%), Query Frame = 1
Query: 3532 LCKLAYLSEYFSRFNDLNLSLEGVNNSVFDFYDKVRS 3642
            + KLAYLS+ FS  N LN+SL+G N+++F   DKV++
Sbjct:  246 IAKLAYLSDIFSLLNQLNISLQGRNSNIFFVADKVQA 282          
BLAST of Zinc finger BED domain-containing protein 5 vs. Ensembl Medaka
Match: ENSORLT00000035574.1 (pep primary_assembly:ASM223467v1:10:5595259:5596581:-1 gene:ENSORLG00000022539.1 transcript:ENSORLT00000035574.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 110.923 bits (276), Expect = 1.347e-45
Identity = 56/121 (46.28%), Postives = 81/121 (66.94%), Query Frame = 2
Query: 3122 SNMCEFYTDGARAMTGKLSGVVTKIKEMAQQCKYIHCIIHPQALATKNMPVNFKYLLDESVEMVNFTKSRALNSRLFSILCGEMGSVHATLLLHTGDRGLSRGQVLSQLFQLRDGVVYMFL 3484
            S++C   TD A +MTG   G++ +IK+     K+ HC+IH +ALA+K M      +L++S++++NF +SR LN+RLF  LC   G+ H  LLLHT  R LSRG+VLS+LF+LR   V+ FL
Sbjct:   83 SSVC---TDAAASMTGSAKGLIARIKKENPDIKWTHCVIHREALASKKMSPVLHDVLNDSIKVINFIRSRPLNARLFRSLCENTGAEHTELLLHTEVRWLSRGRVLSRLFELR-AEVHTFL 199          

HSP 2 Score: 67.781 bits (164), Expect = 1.347e-45
Identity = 31/63 (49.21%), Postives = 43/63 (68.25%), Query Frame = 1
Query: 2932 FSLRLDESTDISNSAQLLAYVLFDFNNKIQEKILFCKPLTAKTTSHEIFKIINDYVITNHISW 3120
            FSL+LDESTD+S  AQL+A+V +   + I E ILFCK +  +TT  +IF ++N +   N ISW
Sbjct:   17 FSLQLDESTDVSGHAQLVAFVRYTDTDDICEHILFCKEMEGRTTGEDIFNVVNMFFTRNAISW 79          

HSP 3 Score: 46.9802 bits (110), Expect = 1.347e-45
Identity = 24/55 (43.64%), Postives = 34/55 (61.82%), Query Frame = 1
Query: 3475 HVSSNAKYF-NGDRLIDEYWLCKLAYLSEYFSRFNDLNLSLEGVNNSVFDFYDKV 3636
            H S +A  F N D      WL KL YL++ F + N+LN+SL+G + S+ + YDKV
Sbjct:  202 HGSPHATMFENTD------WLAKLCYLADIFRKLNELNMSLQGKDTSILNLYDKV 250          
BLAST of Zinc finger BED domain-containing protein 5 vs. Ensembl Medaka
Match: ENSORLT00000031208.1 (pep primary_assembly:ASM223467v1:14:26692610:26696672:-1 gene:ENSORLG00000026199.1 transcript:ENSORLT00000031208.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 109.383 bits (272), Expect = 3.923e-45
Identity = 55/121 (45.45%), Postives = 81/121 (66.94%), Query Frame = 2
Query: 3122 SNMCEFYTDGARAMTGKLSGVVTKIKEMAQQCKYIHCIIHPQALATKNMPVNFKYLLDESVEMVNFTKSRALNSRLFSILCGEMGSVHATLLLHTGDRGLSRGQVLSQLFQLRDGVVYMFL 3484
            S++C   TD A +MTG   G++ +IK+     K+ HC+IH +ALA+K M    + +L++S++++NF +SR LN+RLF  LC   G+ H  LLLH   R LSRG+VLS+LF+LR   V+ FL
Sbjct:  247 SSVC---TDVAASMTGSAKGLIARIKKENPDIKWTHCVIHREALASKKMSPALQDVLNDSIKVINFIRSRPLNARLFRSLCENTGAEHTELLLHPEVRWLSRGRVLSRLFELR-AEVHTFL 363          

HSP 2 Score: 67.3958 bits (163), Expect = 3.923e-45
Identity = 31/63 (49.21%), Postives = 43/63 (68.25%), Query Frame = 1
Query: 2932 FSLRLDESTDISNSAQLLAYVLFDFNNKIQEKILFCKPLTAKTTSHEIFKIINDYVITNHISW 3120
            FSL+LDESTD+S  AQL+A+V +   + I E ILFCK +  +TT  +IF ++N +   N ISW
Sbjct:  181 FSLQLDESTDVSGHAQLVAFVRYIDTDDICEHILFCKEMEGRTTGEDIFNVVNTFFTRNAISW 243          

HSP 3 Score: 46.9802 bits (110), Expect = 3.923e-45
Identity = 24/55 (43.64%), Postives = 34/55 (61.82%), Query Frame = 1
Query: 3475 HVSSNAKYF-NGDRLIDEYWLCKLAYLSEYFSRFNDLNLSLEGVNNSVFDFYDKV 3636
            H S +A  F N D      WL KL YL++ F + N+LN+SL+G + S+ + YDKV
Sbjct:  366 HGSPHATMFENTD------WLAKLCYLADIFRKLNELNMSLQGKDTSILNLYDKV 414          
BLAST of Zinc finger BED domain-containing protein 5 vs. Planmine SMEST
Match: SMESG000002129.1 (SMESG000002129.1)

HSP 1 Score: 871.692 bits (2251), Expect = 0.000e+0
Identity = 499/499 (100.00%), Postives = 499/499 (100.00%), Query Frame = 3
Query:  192 EGSSNLDFQSTSQALSEPERAAAPFKLEILNGVLNLFSLTYLSFALIIITGRTISTFDIRPVPAGEDQWLVSVXXXXXXXXXXXXXXXXXXXXXXRKVERENQMRNYSLFCFMLTPLMTFSIIYVGITWLDILRMPLENIYTVFYFTTXXXXXXXXXXXXXXNTMQFTSLNVQDPMKKVVHKFVSRLTTYVCVFHFFYYFIDMMTSLFIHYLDQIYHFNASSSSRIIERYVGSIWWLLGQGIFMYSLLSLINLFAWQSIGKNSLKPRSSSQSINKITVFPITIMGLILLVGLIPFPMILSIDGDYGFIQNKGIYITILVIGTSISLLGIFGCCVQIKEMKNWRKIPNLNFKHQILDRIFIWLGMLGKTLGFLSYLGYYXXXXXXXXXXXXLYLFYLFYEIVILLQTVFQTVLLEIAIERDWKKPARLTLAGKLCPSFMXXXXXXXXXXXXXYKSFLMFKELEKSPVKIYHVASMTIGGSLSFVQTLHATLYFIYMHKVL 1688
            EGSSNLDFQSTSQALSEPERAAAPFKLEILNGVLNLFSLTYLSFALIIITGRTISTFDIRPVPAGEDQWLVSVLIMNVLNFIIFLLILYNHFINNRKVERENQMRNYSLFCFMLTPLMTFSIIYVGITWLDILRMPLENIYTVFYFTTILLLVGILIHLHDINTMQFTSLNVQDPMKKVVHKFVSRLTTYVCVFHFFYYFIDMMTSLFIHYLDQIYHFNASSSSRIIERYVGSIWWLLGQGIFMYSLLSLINLFAWQSIGKNSLKPRSSSQSINKITVFPITIMGLILLVGLIPFPMILSIDGDYGFIQNKGIYITILVIGTSISLLGIFGCCVQIKEMKNWRKIPNLNFKHQILDRIFIWLGMLGKTLGFLSYLGYYSEISRETSSISILYLFYLFYEIVILLQTVFQTVLLEIAIERDWKKPARLTLAGKLCPSFMLIGININNLILALYKSFLMFKELEKSPVKIYHVASMTIGGSLSFVQTLHATLYFIYMHKVL
Sbjct:    4 EGSSNLDFQSTSQALSEPERAAAPFKLEILNGVLNLFSLTYLSFALIIITGRTISTFDIRPVPAGEDQWLVSVLIMNVLNFIIFLLILYNHFINNRKVERENQMRNYSLFCFMLTPLMTFSIIYVGITWLDILRMPLENIYTVFYFTTILLLVGILIHLHDINTMQFTSLNVQDPMKKVVHKFVSRLTTYVCVFHFFYYFIDMMTSLFIHYLDQIYHFNASSSSRIIERYVGSIWWLLGQGIFMYSLLSLINLFAWQSIGKNSLKPRSSSQSINKITVFPITIMGLILLVGLIPFPMILSIDGDYGFIQNKGIYITILVIGTSISLLGIFGCCVQIKEMKNWRKIPNLNFKHQILDRIFIWLGMLGKTLGFLSYLGYYSEISRETSSISILYLFYLFYEIVILLQTVFQTVLLEIAIERDWKKPARLTLAGKLCPSFMLIGININNLILALYKSFLMFKELEKSPVKIYHVASMTIGGSLSFVQTLHATLYFIYMHKVL 502          
BLAST of Zinc finger BED domain-containing protein 5 vs. Planmine SMEST
Match: SMESG000044394.1 (SMESG000044394.1)

HSP 1 Score: 421.394 bits (1082), Expect = 1.341e-134
Identity = 276/483 (57.14%), Postives = 359/483 (74.33%), Query Frame = 3
Query:  240 EPERAAAPFKLEILNGVLNLFSLTYLSFALIIITGRTISTFDIRPVPAGEDQWLVSVXXXXXXXXXXXXXXXXXXXXXXRKVERENQMRNYSLFCFMLTPLMTFSIIYVGITWLDILRMPLENIYTVFYFTTXXXXXXXXXXXXXXNTMQFTSLNVQDPMKKVVHKFVSRLTTYVCVFHFFYYFIDMMTSLFIHYLDQIYHFNASSSSRIIERYVGSIWWLLGQGIFMYSLLSLINLFAWQSIGKNSLKPRSSSQSINKITVFPITIMGLILLVGLIPFPMILSIDGDYGFIQNKGIYITILVIGTSISLLGIFGCCVQIKEMKNWRKIPNLNFKHQILDRIFIWLGMLGKTLGFLSYLGYYXXXXXXXXXXXXLYLFYLFYEIVILLQTVFQTVLLEIAIERDWKKPARLTLAGKLCPSFMXXXXXXXXXXXXXYKSFLMFKELEKSPVKIYHVASMTIGGSLSFVQTLHATLYFIYMHKVL 1688
            EPER    FK +I+N +L+L SLTYLSFA+III GR IS  D +PV   E QW VSVLI N +NFI+F LILYN F+NN+ ++RE QMRNYS+F F+++P++  SI ++GI W+DILR PL+N YTV YF+   LLVG+LIHLHDIN+M F S  +Q  +KKV+H FV RLTT VC+F   YYFI+MMTS F  YL+Q+++   SS+S   + Y G+ WW+L Q I ++ ++SLINLFAW+SIG+ S K  SSS S+ +I VFPIT  GLILL+ LIP PM++SI+ DY F  N   Y  I++IG  +SL+GI  C VQI+EMKNW+K+ NL+FKHQ++DRI IWLG++GKT+G LS L Y  +   ET  I I+Y FYL YEI +L QT+ QT+LLEIAI+R+WK P+R +LA K+CP  +LIGINI++++L LYK FLMFKE     + +Y V S  IGG LSF+Q+LHA +YFIYMHKVL
Sbjct:   20 EPERVEVSFKFQIINSLLSLISLTYLSFAIIIIIGRIISILDYKPVEKEEAQWHVSVLINNFINFILFFLILYNRFVNNKGIKREIQMRNYSIFSFIISPMLPLSICFIGICWIDILRSPLKNFYTVPYFSMGFLLVGMLIHLHDINSMNFDSFKIQQEIKKVLHNFVHRLTTNVCIFLLLYYFIEMMTSFFFQYLNQVHNLTISSNSASAQDYFGTYWWILNQSIIIFLMVSLINLFAWKSIGRLSKKSDSSSISVKRIPVFPITAFGLILLLSLIPLPMLISINSDYKFSSNPMTYSAIMIIGIFVSLVGILSCYVQIREMKNWKKLKNLDFKHQLIDRIIIWLGLMGKTIGVLSNLDYNIQGPPETLKIKIMYSFYLVYEIAVLFQTISQTILLEIAIDREWKLPSRPSLAKKICPHLILIGINIDHIVLGLYKCFLMFKEYRNQTLMMYQVTSNIIGGCLSFLQSLHAIIYFIYMHKVL 502          
BLAST of Zinc finger BED domain-containing protein 5 vs. Planmine SMEST
Match: SMESG000044396.1 (SMESG000044396.1)

HSP 1 Score: 370.933 bits (951), Expect = 4.319e-114
Identity = 253/454 (55.73%), Postives = 333/454 (73.35%), Query Frame = 3
Query:  240 EPERAAAPFKLEILNGVLNLFSLTYLSFALIIITGRTISTFDIRPVPAGEDQWLVSVXXXXXXXXXXXXXXXXXXXXXXRKVERENQMRNYSLFCFMLTPLMTFSIIYVGITWLDILRMPLENIYTVFYFTTXXXXXXXXXXXXXXNTMQFTSLNVQDPMKKVVHKFVSRLTTYVCVFHFFYYFIDMMTSLFIHYLDQIYHFNASSSSRIIERYVGSIWWLLGQGIFMYSLLSLINLFAWQSIGKNSLKPRSSSQSINKITVFPITIMGLILLVGLIPFPMILSIDGDYGFIQNKGIYITILVIGTSISLLGIFGCCVQIKEMKNWRKIPNLNFKHQILDRIFIWLGMLGKTLGFLSYLGYYXXXXXXXXXXXXLYLFYLFYEIVILLQTVFQTVLLEIAIERDWKKPARLTLAGKLCPSFMXXXXXXXXXXXXXYKSFLMFKELEKSPVKIYH 1601
            EPER    FK +I+N +L+L SLTYLSFA+III GR IS  D +PV   E QW VSVLI N +NFI+F LILYN F+NN+ ++RE QMRNYS+F F+++P++  SI ++GI W+DILR PL+N YTV YF+   LLVG+LIHLHDIN+M F S  ++  +KKV+H FV RLTT VC+F   YYFI+MMTS F  YL+Q+++   SS S   + Y G+ WW+L Q I ++ ++SLINLFAW+SIG+ S K  SSS S+ +I VFPIT  GLILL+ LIP PM++SI+ DY F  N   Y  I++IG  +SL+GI  C VQI+EMKN  K+ NL+FKHQ++DRI IWLG++GKT+G LSYL Y  +   ET  + I+Y FYL YEI +L QT+ QT+LLEIAI+R+WK P+R +LA K+CP  +LIGINI++++L LYK FLMFKE     + +Y 
Sbjct:   20 EPERVEVSFKFQIINSLLSLISLTYLSFAIIIIIGRIISILDYKPVEKEEAQWHVSVLINNFINFILFFLILYNRFVNNKGIKREIQMRNYSIFSFIISPMLPLSICFIGICWIDILRSPLKNFYTVPYFSMGFLLVGVLIHLHDINSMNFDSFKIKQEIKKVLHNFVHRLTTNVCIFLLLYYFIEMMTSFFFQYLNQVHNLTISSHSISTQDYFGTYWWILNQSIIIFLMVSLINLFAWKSIGRLSKKSDSSSISVKRIPVFPITAFGLILLLSLIPLPMLISINSDYKFSSNPMTYSAIMIIGIFVSLVGILSCYVQIREMKNRIKLKNLDFKHQLIDRIIIWLGLMGKTIGVLSYLDYNIQGPPETLKLKIMYSFYLVYEIAVLFQTISQTILLEIAIDREWKLPSRPSLANKICPHLILIGINIDHIVLGLYKCFLMFKEYRNQTLMMYQ 473          
BLAST of Zinc finger BED domain-containing protein 5 vs. Planmine SMEST
Match: SMESG000073961.1 (SMESG000073961.1)

HSP 1 Score: 143.28 bits (360), Expect = 8.580e-38
Identity = 108/366 (29.51%), Postives = 170/366 (46.45%), Query Frame = 2
Query: 2480 RKYETKYMKYEFAMKSGKETEPILQCVICFECLSNGSKKQLF*KGIYIANIRM*KTELSIFSKENFLSNLVVVQTLIV*E----------HHIARCGKPHTIGETLLMPTTIDIVVSVLGEKAAKEIDKVSLSNNTVKQRIDEMASQIEDILIQRL*TSLFFPSDWMKVLIFPIRRNYSHMFFLISTIXXXXXXXSANH*LQKQLRTKYLK*LMIMLLQITSVGSNMCEFYTDGARAMTGKLSGVVTKIKEMAQQCKYIHCIIHPQALATKNMPVNFKYLLDESVEMVNFTKSRALNSRLFSILCGEMGSVHATLLLHTGDRGLSRGQVLSQLFQLRDGVVYMFLAMQN-----ILTEID*LMSIG 3532
            RKY  +Y+ Y F      E E  L+ V           +Q F            +++L  + K+     LV   TL V E          + IARC KPHTIGE L++P  I+IV ++ GE  AK++  + LSN+TV + +  MA  ++  L  +L   LF                         +I+  +   +     Q+   T     L   + +      N     TDGAR+M+G+   + T +K+ + QC + H +I+ +ALA+K M      +L   V +VN+ K+R L SR+FS LC  MGSVH  LL +   R LSRG+ L ++F+ R+ +  +FL  +N     +  +I+ +M +G
Sbjct:  183 RKYCAEYLNYGFTRTEVNEEERPLEYV--------NKSRQFF------------ESKLKSYEKQK----LVFKNTLSVNEKALLASYKVSYQIARCKKPHTIGEELILPAAIEIVETMFGENFAKKLKSIPLSNDTVARHVGGMAEDVQHQLFAKLRRKLF-------------------------SIQLDEAIDNNKDAHQRATLTALFTILDNFINEANIEWENCVGICTDGARSMSGRFKSMQTLVKQKSSQCIWTHYMIYREALASKEMSTGLNIVLSTVVTVVNYIKTRPLKSRMFSELCKGMGSVHTALLFYCEARWLSRGKFLKRVFESREEIC-IFLEEENRQEAVMFRDIEFIMKLG 498          

HSP 2 Score: 35.039 bits (79), Expect = 8.580e-38
Identity = 16/39 (41.03%), Postives = 23/39 (58.97%), Query Frame = 1
Query: 3520 DEYWLCKLAYLSEYFSRFNDLNLSLEGVNNSVFDFYDKV 3636
            D  ++ KL YL + F + N LNL L+G N  + +  DKV
Sbjct:  490 DIEFIMKLGYLVDIFEKLNVLNLQLQGTNTYILETNDKV 528          

HSP 3 Score: 20.4014 bits (41), Expect = 8.580e-38
Identity = 10/30 (33.33%), Postives = 17/30 (56.67%), Query Frame = 3
Query: 3633 SAFMRKLHLMQQQIEKQTFNMLPFLCNFVE 3722
            +AF RKL L  + ++++   M P    FV+
Sbjct:  529 NAFCRKLDLWLRNLKEKKLEMFPSKNEFVK 558          
BLAST of Zinc finger BED domain-containing protein 5 vs. Planmine SMEST
Match: SMESG000019238.1 (SMESG000019238.1)

HSP 1 Score: 125.946 bits (315), Expect = 4.890e-31
Identity = 87/267 (32.58%), Postives = 134/267 (50.19%), Query Frame = 2
Query: 2720 HHIARCGKPHTIGETLLMPTTIDIVVSVLGEKAAKEIDKVSLSNNTVKQRIDEMASQIEDILIQRL*TSLFFPSDWMKVLIFPIRRN-------YSHMFFLISTIXXXXXXXSANH*LQKQLRTKYLK*LMIMLLQITSVGSNMCE-FYTDGARAMTGKLSGVVTKIKEMAQQCKYIHCIIHPQALATKNMPVNFKYLLDESVEMVNFTKSRALNSRLFSILCGEMGSVHATLLLHTGDRGLSRGQVLSQLFQLRDGVVYMFLAMQN 3496
            + I+RC KPHTIGE L++P  I        E  AK++  + LSN+TV  R+  MA  ++  L  RL   LF        L   I  N       Y H    +S ++    + S    +Q++  +  L  ++   +   ++    C    TDGAR+M+G+   + T +K+ + QC + HC+IH +ALA+K M      +L             +L SR+FS LC +MGSVH  LL H   R LSRG+ L ++F+LR+ +  +FL  +N
Sbjct:   25 YQISRCKKPHTIGEELILPAAI--------ENFAKKLKSIPLSNDTVAPRVGGMAEDVQHQLFARLCEKLFSIQ-----LDETIDNNKDAHLIAYVHFCDGVSAVEELLFWKS----IQQRATSPALFTILDNFINEANIEWENCVGICTDGARSMSGRFQSMQTLVKQKSSQCIWTHCMIHKEALASKEMSTGLNIVL-------------SLKSRMFSELCKDMGSVHTALLFHYEARWLSRGKFLKRVFELREEIC-IFLEEEN 260          

HSP 2 Score: 29.6462 bits (65), Expect = 4.890e-31
Identity = 13/35 (37.14%), Postives = 20/35 (57.14%), Query Frame = 1
Query: 3538 KLAYLSEYFSRFNDLNLSLEGVNNSVFDFYDKVRS 3642
            KL Y+ + F + N LNL L+G N  + +  D V +
Sbjct:  275 KLGYIVDIFEKLNVLNLQLQGTNTYILETNDTVNA 309          
The following BLAST results are available for this feature:
BLAST of Zinc finger BED domain-containing protein 5 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ZBED98.715e-4631.81zinc finger BED-type containing 9 [Source:HGNC Sym... [more]
ZBED91.284e-4530.38zinc finger BED-type containing 9 [Source:HGNC Sym... [more]
ZMYM64.755e-4029.24zinc finger MYM-type containing 6 [Source:HGNC Sym... [more]
FAM200A5.070e-3741.38family with sequence similarity 200 member A [Sour... [more]
FAM200A5.268e-3741.74family with sequence similarity 200 member A [Sour... [more]
back to top
BLAST of Zinc finger BED domain-containing protein 5 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Zinc finger BED domain-containing protein 5 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Zinc finger BED domain-containing protein 5 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
AL928808.17.589e-1627.61pep chromosome:GRCz11:20:17257101:17259573:-1 gene... [more]
CR392001.32.060e-1036.89pep chromosome:GRCz11:8:38963323:38965260:-1 gene:... [more]
back to top
BLAST of Zinc finger BED domain-containing protein 5 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
spag13.162e-1224.56sperm associated antigen 1 [Source:Xenbase;Acc:XB-... [more]
ENSXETT00000016563.14.166e-1224.56pep primary_assembly:Xenopus_tropicalis_v9.1:4:373... [more]
back to top
BLAST of Zinc finger BED domain-containing protein 5 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Zmym63.608e-3230.00zinc finger, MYM-type 6 [Source:MGI Symbol;Acc:MGI... [more]
Zmym64.361e-3230.00zinc finger, MYM-type 6 [Source:MGI Symbol;Acc:MGI... [more]
Zbed51.354e-3128.80zinc finger, BED type containing 5 [Source:MGI Sym... [more]
Gtf2ird26.459e-1334.33GTF2I repeat domain containing 2 [Source:MGI Symbo... [more]
back to top
BLAST of Zinc finger BED domain-containing protein 5 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6R2W3|SCND3_HUMAN5.686e-4530.38SCAN domain-containing protein 3 OS=Homo sapiens O... [more]
sp|O95789|ZMYM6_HUMAN2.105e-3929.24Zinc finger MYM-type protein 6 OS=Homo sapiens OX=... [more]
sp|Q4R6P1|F200A_MACFA8.024e-3843.48Protein FAM200A OS=Macaca fascicularis OX=9541 GN=... [more]
sp|Q8TCP9|F200A_HUMAN2.334e-3641.74Protein FAM200A OS=Homo sapiens OX=9606 GN=FAM200A... [more]
sp|A4Z943|ZBED5_BOVIN7.069e-3046.90Zinc finger BED domain-containing protein 5 OS=Bos... [more]
back to top
BLAST of Zinc finger BED domain-containing protein 5 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3P9BBW88.607e-6357.52Uncharacterized protein OS=Maylandia zebra OX=1065... [more]
A0A2S2R1083.054e-6046.49Zinc finger BED domain-containing protein 5 OS=Sip... [more]
A0A498L9Z11.262e-5947.54Zinc finger BED domain-containing 5-like protein O... [more]
A0A4C1ZGT46.415e-5846.72Zinc finger BED domain-containing protein 5 OS=Eum... [more]
A0A4Y2V7M46.859e-5849.57Zinc finger BED domain-containing protein 5 OS=Ara... [more]
back to top
BLAST of Zinc finger BED domain-containing protein 5 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000044261.11.132e-5135.79pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000051422.11.438e-5136.54pep primary_assembly:Astyanax_mexicanus-2.0:15:354... [more]
ENSAMXT00000057314.11.476e-2936.65pep primary_assembly:Astyanax_mexicanus-2.0:1:4224... [more]
ENSAMXT00000030525.13.166e-2734.78pep primary_assembly:Astyanax_mexicanus-2.0:1:1299... [more]
ENSAMXT00000039226.11.603e-2135.14pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
back to top
BLAST of Zinc finger BED domain-containing protein 5 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Zinc finger BED domain-containing protein 5 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Zinc finger BED domain-containing protein 5 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Zinc finger BED domain-containing protein 5 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000028620.16.829e-5542.98pep primary_assembly:ASM223467v1:3:35179252:351815... [more]
ENSORLT00000032459.16.206e-5442.98pep primary_assembly:ASM223467v1:8:14240678:142473... [more]
ENSORLT00000030244.11.300e-4743.86pep primary_assembly:ASM223467v1:13:28104458:28106... [more]
ENSORLT00000035574.11.347e-4546.28pep primary_assembly:ASM223467v1:10:5595259:559658... [more]
ENSORLT00000031208.13.923e-4545.45pep primary_assembly:ASM223467v1:14:26692610:26696... [more]
back to top
BLAST of Zinc finger BED domain-containing protein 5 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000002129.10.000e+0100.00SMESG000002129.1[more]
SMESG000044394.11.341e-13457.14SMESG000044394.1[more]
SMESG000044396.14.319e-11455.73SMESG000044396.1[more]
SMESG000073961.18.580e-3829.51SMESG000073961.1[more]
SMESG000019238.14.890e-3132.58SMESG000019238.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30009521 ID=SMED30009521|Name=Zinc finger BED domain-containing protein 5|organism=Schmidtea mediterranea sexual|type=transcript|length=3795bp
TGAACATCACTTTGAATTGAAAAATGCTGTGTATGAAGTCTGTATGAGTA
AATTGATTGTGCTGTGCTGAGTTGTGCTGAATATTGATTGAGTAAAACAA
AAAATTTAAAAATGAAAAGGTTATGTCTTAATTCATAGTATTGTCGGACT
CATTGTTGTTAAACTAAGTTAATATTTCAATTATGTCGTCGGAAGGATCG
TCCAATCTAGATTTTCAGTCTACTTCACAGGCTTTATCTGAACCTGAAAG
AGCTGCCGCTCCTTTCAAACTAGAAATTCTTAATGGGGTTTTGAATTTAT
TCTCATTGACATATTTATCATTTGCTTTAATTATTATCACTGGCCGGACG
ATTTCAACGTTTGATATTAGACCTGTACCAGCGGGGGAGGACCAGTGGTT
GGTATCGGTACTTATTATGAATGTCCTCAACTTCATAATATTTCTCCTGA
TCCTCTACAATCATTTCATTAACAATAGAAAAGTCGAGAGAGAAAATCAA
ATGAGAAATTATTCACTTTTCTGTTTTATGCTAACTCCATTGATGACGTT
TTCGATAATTTACGTTGGGATAACTTGGCTGGATATTCTAAGGATGCCGT
TGGAAAACATTTATACGGTCTTCTATTTCACCACGATCTTACTATTGGTG
GGGATTTTGATCCACTTGCACGACATAAACACCATGCAATTTACCTCTTT
AAATGTGCAAGACCCCATGAAAAAGGTCGTCCATAAATTCGTCAGTCGAC
TTACAACTTACGTTTGTGTATTTCACTTTTTCTATTACTTTATTGACATG
ATGACAAGTCTGTTCATTCACTACCTGGATCAGATCTATCATTTCAACGC
TTCTTCAAGTTCACGAATAATTGAACGTTATGTTGGATCCATATGGTGGC
TGCTCGGTCAAGGCATTTTTATGTATTCATTATTATCCTTGATAAATCTA
TTTGCCTGGCAGTCTATTGGAAAAAATTCCTTAAAACCAAGGTCATCCTC
CCAATCCATAAACAAAATCACAGTATTCCCCATTACAATAATGGGACTTA
TTTTACTGGTTGGCCTGATCCCTTTTCCTATGATCTTGAGCATTGATGGA
GATTACGGATTTATCCAGAACAAAGGCATATATATTACCATTTTGGTAAT
CGGGACTTCCATTTCACTGTTAGGGATCTTTGGTTGTTGTGTTCAAATAA
AGGAAATGAAAAACTGGAGGAAAATCCCCAATCTAAACTTTAAACACCAA
ATCCTGGATCGGATATTTATTTGGCTTGGAATGCTAGGGAAAACCTTAGG
GTTTTTGAGTTATTTGGGTTATTATTCAGAGATTTCAAGAGAAACTTCAT
CAATATCAATATTGTATTTGTTTTATCTTTTCTATGAGATTGTCATTCTA
CTTCAAACAGTCTTCCAAACAGTCCTATTGGAAATCGCAATTGAAAGAGA
TTGGAAGAAACCGGCTCGGTTGACTTTGGCCGGCAAACTTTGTCCGTCTT
TCATGTTAATCGGTATTAATATAAACAATCTTATTTTGGCTTTGTATAAG
TCGTTTCTCATGTTTAAGGAACTTGAAAAAAGTCCAGTGAAGATTTATCA
CGTAGCCTCAATGACAATAGGTGGTAGCTTATCTTTTGTCCAAACGCTCC
ACGCGACTCTTTATTTTATATATATGCATAAGGTGTTGTTTAATTAAATT
CGGATAGCAAATTTTATTTACTATTAAATATTTTATTTTTTAAATAAAGT
GGTAGCAGATGCGGCTCATTCTCAGTGGCATTTTATGAAACTTGAAGCTT
TGTGCTAATTTTGAGGTTCCATCTTCTCAACTTTAGACACTTATATAAAT
AAACAAAGATAACTCGGATTTAAAAATTTGTTGATCTAAATAAAATGTTT
TACAAAAATCAATTTACCTTCACCAAAAGCTTTATGTCAATTTAACTGAT
TTAGTGTAATTTTGTTACCGAATGCGTATATGAATTATAAACGACTTCAT
GTCAACATATCAACTAATTCCTGACCATAAATTTTCATAAGTGATAAATT
ATTATGAGGTTTAATCTAATCAAATGAAATGGACTATAAAATGTTTATGA
GTGCTAAATCATGAATAAGCGAATTACTTTACTATATAAATCAAATATTT
ATTAAAATCTGTTTTATGAAAAAAAACATGCCTACAATAATCCATATATT
TTAATATTTTACAATTTCTTAGGATATATTCACAAATAATGTTTAATAAA
TTTATTCTAATAATGGAAAATATAAAAACAATGTAATATGTATTAAATTC
GATAACTTTAATGTTTTTGTAACATTCTACTTATTATTTTTACAATATAG
CACATCGATACAATGGATAGATTTTTAGAGGAGTCTGTAACTTCTAATTT
CAACAGAAAAAAAGATAAATCACGAGAATTTAGCAAAGACGAAGAACCAG
AATTAAAAAAGTAGAAGTGAGCTTGGATCAGGAAGTATGAAACTAAATAT
ATGAAGTATGAGTTCGCCATGAAATCCGGAAAAGAAACTGAACCTATTCT
ACAGTGCGTGATTTGTTTTGAGTGCTTATCAAATGGGAGTAAGAAGCAGC
TCTTTTGAAAAGGCATTTATATAGCAAACATTCGAATGTAAAAGACAGAA
CTCTCTATTTTTTCAAAGGAAAATTTTTTGTCAAACCTTGTAGTAGTACA
AACACTAATTGTGTGAGAGCATCATATAGCTAGGTGCGGGAAACCACATA
CAATTGGTGAAACATTGTTGATGCCTACAACAATAGATATAGTTGTATCT
GTTCTTGGAGAGAAAGCGGCTAAAGAAATTGACAAAGTATCATTGTCTAA
TAATACTGTCAAGCAGCGAATCGATGAGATGGCATCACAGATTGAAGATA
TTTTAATCCAAAGATTATAAACAAGCCTATTTTTTCCCTCCGATTGGATG
AAAGTACTGATATTTCCAATTCGGCGCAACTACTCGCATATGTTCTTTTT
GATTTCAACAATAAAATACAAGAAAAAATATTATTCTGCAAACCATTAAC
TGCAAAAACAACTTCGCACGAAATATTTAAAATAATTAATGATTATGTTA
TTACAAATCACATCAGTTGGCTCAAATATGTGTGAGTTTTATACCGACGG
TGCTCGTGCGATGACTGGAAAATTATCAGGGGTGGTAACTAAAATTAAAG
AAATGGCACAACAATGCAAATATATTCACTGCATCATTCATCCTCAAGCT
TTGGCCACAAAAAATATGCCAGTGAATTTCAAATATTTATTAGATGAGTC
TGTAGAGATGGTTAATTTTACCAAATCTCGAGCGCTTAATTCGCGTTTAT
TTTCTATTTTGTGTGGTGAAATGGGAAGTGTTCATGCCACACTTTTACTT
CACACGGGAGACCGGGGGTTGTCACGTGGTCAAGTCCTCAGTCAATTGTT
TCAGTTGCGCGATGGAGTAGTTTACATGTTTCTAGCAATGCAAAATATTT
TAACGGAGATAGATTGATTGATGAGTATTGGTTGTGTAAACTAGCATACC
TCTCAGAATATTTTTCAAGGTTCAATGATCTAAATTTAAGTTTGGAAGGA
GTTAACAACTCTGTATTTGACTTCTATGACAAAGTGCGTTCATGAGAAAA
TTGCACCTCATGCAACAGCAAATTGAAAAGCAAACTTTTAACATGCTTCC
TTTCCTCTGCAACTTTGTCGAAGAAAATAATTTGCGATTAAAAGACGACG
CGATGAGCGACATCAAAAAATATCTAACATCAACTTTTGAATATT
back to top

protein sequence of SMED30009521-orf-1

>SMED30009521-orf-1 ID=SMED30009521-orf-1|Name=SMED30009521-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=143bp
MIMLLQITSVGSNMCEFYTDGARAMTGKLSGVVTKIKEMAQQCKYIHCII
HPQALATKNMPVNFKYLLDESVEMVNFTKSRALNSRLFSILCGEMGSVHA
TLLLHTGDRGLSRGQVLSQLFQLRDGVVYMFLAMQNILTEID*
back to top

protein sequence of SMED30009521-orf-2

>SMED30009521-orf-2 ID=SMED30009521-orf-2|Name=SMED30009521-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=505bp
MSSEGSSNLDFQSTSQALSEPERAAAPFKLEILNGVLNLFSLTYLSFALI
IITGRTISTFDIRPVPAGEDQWLVSVLIMNVLNFIIFLLILYNHFINNRK
VERENQMRNYSLFCFMLTPLMTFSIIYVGITWLDILRMPLENIYTVFYFT
TILLLVGILIHLHDINTMQFTSLNVQDPMKKVVHKFVSRLTTYVCVFHFF
YYFIDMMTSLFIHYLDQIYHFNASSSSRIIERYVGSIWWLLGQGIFMYSL
LSLINLFAWQSIGKNSLKPRSSSQSINKITVFPITIMGLILLVGLIPFPM
ILSIDGDYGFIQNKGIYITILVIGTSISLLGIFGCCVQIKEMKNWRKIPN
LNFKHQILDRIFIWLGMLGKTLGFLSYLGYYSEISRETSSISILYLFYLF
YEIVILLQTVFQTVLLEIAIERDWKKPARLTLAGKLCPSFMLIGININNL
ILALYKSFLMFKELEKSPVKIYHVASMTIGGSLSFVQTLHATLYFIYMHK
VLFN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0046983protein dimerization activity
GO:0003676nucleic acid binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0000136whole organism
PLANA:0000418head
PLANA:0003116parenchymal cell
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableTMHMMTMhelixcoord: 72..91
NoneNo IPR availableTMHMMTMhelixcoord: 35..57
NoneNo IPR availableTMHMMTMhelixcoord: 397..419
NoneNo IPR availableTMHMMTMhelixcoord: 190..212
NoneNo IPR availableTMHMMTMhelixcoord: 143..162
NoneNo IPR availableTMHMMTMhelixcoord: 317..339
NoneNo IPR availableTMHMMTMhelixcoord: 474..496
NoneNo IPR availableTMHMMTMhelixcoord: 432..454
NoneNo IPR availableTMHMMTMhelixcoord: 237..259
NoneNo IPR availableTMHMMTMhelixcoord: 360..382
NoneNo IPR availableTMHMMTMhelixcoord: 280..302
NoneNo IPR availableTMHMMTMhelixcoord: 111..133