histone H2B

Overview
Namehistone H2B (AGS78026.1)
Smed IDSMED30009514
Length (bp)624
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of histone H2B (SMED30009514) t-SNE clustered cells

Violin plots show distribution of expression levels for histone H2B (SMED30009514) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of histone H2B (SMED30009514) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for histone H2B (SMED30009514) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30009514

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 17

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymaSMED30009514SMESG000067931.1 DN290330ncbi_smed_estsPMID:22439894
Solana et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymaSMED30009514SMESG000067931.1 DN290330ncbi_smed_estsPMID:22439894
Solana et al., 2012
whole organism asexual adult fluorescence in situ hybridization evidence
X2 cellSMED30009514SMESG000067931.1 SmedASXL_018991SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
protonephridiaSMED30009514SMESG000067931.1 dd_Smed_v4_2520_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30009514SMESG000067931.1 dd_Smed_v4_2520_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30009514SMESG000067931.1 dd_Smed_v4_2520_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30009514SMESG000067931.1 dd_Smed_v4_2520_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neoblastSMED30009514SMESG000067931.1 DN298006ncbi_smed_estsPMID:21566185
Wagner et al., 2011
whole organism asexual adult fluorescence in situ hybridization evidence
neoblastSMED30009514SMESG000067931.1 DN298006ncbi_smed_estsPMID:28976975
Su et al., 2017
whole organism asexual adult fluorescence in situ hybridization evidence
neoblastSMED30009514SMESG000067931.1 DN298006ncbi_smed_estsPMID:24523458
Lin et al., 2014
whole organism asexual adult fluorescence in situ hybridization evidence
ovarySMED30009514SMESG000067931.1 PL05013B1G03ncbi_smed_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
testisSMED30009514SMESG000067931.1 PL05013B1G03ncbi_smed_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
vitelline glandSMED30009514SMESG000067931.1 PL05013B1G03ncbi_smed_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
epidermisSMED30009514SMESG000067931.1 dd_Smed_v4_2520_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
neoblastSMED30009514SMESG000067931.1 KC916781smed_ncbi_20200123PMID:24903754
Rouhana et al., 2014
whole organism asexual adult fluorescence in situ hybridization evidence
chromatoid bodySMED30009514SMESG000067931.1 KC916781smed_ncbi_20200123PMID:24903754
Rouhana et al., 2014
whole organism asexual adult fluorescence in situ hybridization evidence
neoblastSMED30009514SMESG000067931.1 DN290330ncbi_smed_estsPMID:16890156
Guo et al., 2006
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of histone H2B vs. Ensembl Human
Match: H2BC13 (H2B clustered histone 13 [Source:HGNC Symbol;Acc:HGNC:4748])

HSP 1 Score: 169.088 bits (427), Expect = 1.347e-53
Identity = 79/91 (86.81%), Postives = 86/91 (94.51%), Query Frame = 3
Query:  162 ESYGIYIYKVLRQVHPDTGISGKAMSIMNSFVNDVFERIASEASKLATYNKKSTITSREIQTAVRLILPGELAKHAVSEGTKAVTKYTGSK 434
            ESY +Y+YKVL+QVHPDTGIS KAM IMNSFVND+FERIASEAS+LA YNK+STITSREIQTAVRL+LPGELAKHAVSEGTKAVTKYT SK
Sbjct:   36 ESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIASEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK 126          
BLAST of histone H2B vs. Ensembl Human
Match: H2BU1 (H2B.U histone 1 [Source:HGNC Symbol;Acc:HGNC:20514])

HSP 1 Score: 168.318 bits (425), Expect = 2.482e-53
Identity = 79/91 (86.81%), Postives = 86/91 (94.51%), Query Frame = 3
Query:  162 ESYGIYIYKVLRQVHPDTGISGKAMSIMNSFVNDVFERIASEASKLATYNKKSTITSREIQTAVRLILPGELAKHAVSEGTKAVTKYTGSK 434
            ESY IY+YKVL+QVHPDTGIS KAM IMNSFVND+FERIASEAS+LA YNK+STITSRE+QTAVRL+LPGELAKHAVSEGTKAVTKYT SK
Sbjct:   36 ESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIASEASRLAHYNKRSTITSREVQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK 126          
BLAST of histone H2B vs. Ensembl Human
Match: H2BU1 (H2B.U histone 1 [Source:HGNC Symbol;Acc:HGNC:20514])

HSP 1 Score: 168.318 bits (425), Expect = 2.482e-53
Identity = 79/91 (86.81%), Postives = 86/91 (94.51%), Query Frame = 3
Query:  162 ESYGIYIYKVLRQVHPDTGISGKAMSIMNSFVNDVFERIASEASKLATYNKKSTITSREIQTAVRLILPGELAKHAVSEGTKAVTKYTGSK 434
            ESY IY+YKVL+QVHPDTGIS KAM IMNSFVND+FERIASEAS+LA YNK+STITSRE+QTAVRL+LPGELAKHAVSEGTKAVTKYT SK
Sbjct:   36 ESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIASEASRLAHYNKRSTITSREVQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK 126          
BLAST of histone H2B vs. Ensembl Human
Match: H2BC17 (H2B clustered histone 17 [Source:HGNC Symbol;Acc:HGNC:4758])

HSP 1 Score: 167.162 bits (422), Expect = 7.310e-53
Identity = 79/91 (86.81%), Postives = 85/91 (93.41%), Query Frame = 3
Query:  162 ESYGIYIYKVLRQVHPDTGISGKAMSIMNSFVNDVFERIASEASKLATYNKKSTITSREIQTAVRLILPGELAKHAVSEGTKAVTKYTGSK 434
            ESY IY+YKVL+QVHPDTGIS KAM IMNSFVND+FERIA EAS+LA YNK+STITSREIQTAVRL+LPGELAKHAVSEGTKAVTKYT SK
Sbjct:   36 ESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK 126          
BLAST of histone H2B vs. Ensembl Human
Match: H2BC3 (H2B clustered histone 3 [Source:HGNC Symbol;Acc:HGNC:4751])

HSP 1 Score: 167.162 bits (422), Expect = 7.805e-53
Identity = 79/91 (86.81%), Postives = 85/91 (93.41%), Query Frame = 3
Query:  162 ESYGIYIYKVLRQVHPDTGISGKAMSIMNSFVNDVFERIASEASKLATYNKKSTITSREIQTAVRLILPGELAKHAVSEGTKAVTKYTGSK 434
            ESY IY+YKVL+QVHPDTGIS KAM IMNSFVND+FERIA EAS+LA YNK+STITSREIQTAVRL+LPGELAKHAVSEGTKAVTKYT SK
Sbjct:   36 ESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK 126          
BLAST of histone H2B vs. Ensembl Celegans
Match: his-41 (Probable histone H2B 3 [Source:UniProtKB/Swiss-Prot;Acc:Q27484])

HSP 1 Score: 169.859 bits (429), Expect = 2.650e-54
Identity = 80/91 (87.91%), Postives = 87/91 (95.60%), Query Frame = 3
Query:  162 ESYGIYIYKVLRQVHPDTGISGKAMSIMNSFVNDVFERIASEASKLATYNKKSTITSREIQTAVRLILPGELAKHAVSEGTKAVTKYTGSK 434
            ESY +YIY+VL+QVHPDTG+S KAMSIMNSFVNDVFERIASEAS+LA YNK+STI+SREIQTAVRLILPGELAKHAVSEGTKAVTKYT SK
Sbjct:   33 ESYSVYIYRVLKQVHPDTGVSSKAMSIMNSFVNDVFERIASEASRLAHYNKRSTISSREIQTAVRLILPGELAKHAVSEGTKAVTKYTSSK 123          
BLAST of histone H2B vs. Ensembl Celegans
Match: his-66 (Probable histone H2B 4 [Source:UniProtKB/Swiss-Prot;Acc:Q27876])

HSP 1 Score: 169.474 bits (428), Expect = 3.226e-54
Identity = 80/91 (87.91%), Postives = 87/91 (95.60%), Query Frame = 3
Query:  162 ESYGIYIYKVLRQVHPDTGISGKAMSIMNSFVNDVFERIASEASKLATYNKKSTITSREIQTAVRLILPGELAKHAVSEGTKAVTKYTGSK 434
            ESY +YIY+VL+QVHPDTG+S KAMSIMNSFVNDVFERIASEAS+LA YNK+STI+SREIQTAVRLILPGELAKHAVSEGTKAVTKYT SK
Sbjct:   33 ESYSVYIYRVLKQVHPDTGVSSKAMSIMNSFVNDVFERIASEASRLAHYNKRSTISSREIQTAVRLILPGELAKHAVSEGTKAVTKYTSSK 123          
BLAST of histone H2B vs. Ensembl Celegans
Match: his-62 (Probable histone H2B 4 [Source:UniProtKB/Swiss-Prot;Acc:Q27876])

HSP 1 Score: 169.474 bits (428), Expect = 3.226e-54
Identity = 80/91 (87.91%), Postives = 87/91 (95.60%), Query Frame = 3
Query:  162 ESYGIYIYKVLRQVHPDTGISGKAMSIMNSFVNDVFERIASEASKLATYNKKSTITSREIQTAVRLILPGELAKHAVSEGTKAVTKYTGSK 434
            ESY +YIY+VL+QVHPDTG+S KAMSIMNSFVNDVFERIASEAS+LA YNK+STI+SREIQTAVRLILPGELAKHAVSEGTKAVTKYT SK
Sbjct:   33 ESYSVYIYRVLKQVHPDTGVSSKAMSIMNSFVNDVFERIASEASRLAHYNKRSTISSREIQTAVRLILPGELAKHAVSEGTKAVTKYTSSK 123          
BLAST of histone H2B vs. Ensembl Celegans
Match: his-58 (Probable histone H2B 4 [Source:UniProtKB/Swiss-Prot;Acc:Q27876])

HSP 1 Score: 169.474 bits (428), Expect = 3.226e-54
Identity = 80/91 (87.91%), Postives = 87/91 (95.60%), Query Frame = 3
Query:  162 ESYGIYIYKVLRQVHPDTGISGKAMSIMNSFVNDVFERIASEASKLATYNKKSTITSREIQTAVRLILPGELAKHAVSEGTKAVTKYTGSK 434
            ESY +YIY+VL+QVHPDTG+S KAMSIMNSFVNDVFERIASEAS+LA YNK+STI+SREIQTAVRLILPGELAKHAVSEGTKAVTKYT SK
Sbjct:   33 ESYSVYIYRVLKQVHPDTGVSSKAMSIMNSFVNDVFERIASEASRLAHYNKRSTISSREIQTAVRLILPGELAKHAVSEGTKAVTKYTSSK 123          
BLAST of histone H2B vs. Ensembl Celegans
Match: his-48 (Probable histone H2B 4 [Source:UniProtKB/Swiss-Prot;Acc:Q27876])

HSP 1 Score: 169.474 bits (428), Expect = 3.226e-54
Identity = 80/91 (87.91%), Postives = 87/91 (95.60%), Query Frame = 3
Query:  162 ESYGIYIYKVLRQVHPDTGISGKAMSIMNSFVNDVFERIASEASKLATYNKKSTITSREIQTAVRLILPGELAKHAVSEGTKAVTKYTGSK 434
            ESY +YIY+VL+QVHPDTG+S KAMSIMNSFVNDVFERIASEAS+LA YNK+STI+SREIQTAVRLILPGELAKHAVSEGTKAVTKYT SK
Sbjct:   33 ESYSVYIYRVLKQVHPDTGVSSKAMSIMNSFVNDVFERIASEASRLAHYNKRSTISSREIQTAVRLILPGELAKHAVSEGTKAVTKYTSSK 123          
BLAST of histone H2B vs. Ensembl Fly
Match: His2B:CG33888 (gene:FBgn0053888 transcript:FBtr0091892)

HSP 1 Score: 170.629 bits (431), Expect = 1.404e-54
Identity = 81/91 (89.01%), Postives = 87/91 (95.60%), Query Frame = 3
Query:  162 ESYGIYIYKVLRQVHPDTGISGKAMSIMNSFVNDVFERIASEASKLATYNKKSTITSREIQTAVRLILPGELAKHAVSEGTKAVTKYTGSK 434
            ESY IYIYKVL+QVHPDTGIS KAMSIMNSFVND+FERIA+EAS+LA YNK+STITSREIQTAVRL+LPGELAKHAVSEGTKAVTKYT SK
Sbjct:   33 ESYAIYIYKVLKQVHPDTGISSKAMSIMNSFVNDIFERIAAEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK 123          
BLAST of histone H2B vs. Ensembl Fly
Match: His2B:CG33904 (gene:FBgn0053904 transcript:FBtr0091908)

HSP 1 Score: 170.629 bits (431), Expect = 1.404e-54
Identity = 81/91 (89.01%), Postives = 87/91 (95.60%), Query Frame = 3
Query:  162 ESYGIYIYKVLRQVHPDTGISGKAMSIMNSFVNDVFERIASEASKLATYNKKSTITSREIQTAVRLILPGELAKHAVSEGTKAVTKYTGSK 434
            ESY IYIYKVL+QVHPDTGIS KAMSIMNSFVND+FERIA+EAS+LA YNK+STITSREIQTAVRL+LPGELAKHAVSEGTKAVTKYT SK
Sbjct:   33 ESYAIYIYKVLKQVHPDTGISSKAMSIMNSFVNDIFERIAAEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK 123          
BLAST of histone H2B vs. Ensembl Fly
Match: His2B:CG33900 (gene:FBgn0053900 transcript:FBtr0091904)

HSP 1 Score: 170.629 bits (431), Expect = 1.404e-54
Identity = 81/91 (89.01%), Postives = 87/91 (95.60%), Query Frame = 3
Query:  162 ESYGIYIYKVLRQVHPDTGISGKAMSIMNSFVNDVFERIASEASKLATYNKKSTITSREIQTAVRLILPGELAKHAVSEGTKAVTKYTGSK 434
            ESY IYIYKVL+QVHPDTGIS KAMSIMNSFVND+FERIA+EAS+LA YNK+STITSREIQTAVRL+LPGELAKHAVSEGTKAVTKYT SK
Sbjct:   33 ESYAIYIYKVLKQVHPDTGISSKAMSIMNSFVNDIFERIAAEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK 123          
BLAST of histone H2B vs. Ensembl Fly
Match: His2B:CG33892 (gene:FBgn0053892 transcript:FBtr0091896)

HSP 1 Score: 170.629 bits (431), Expect = 1.404e-54
Identity = 81/91 (89.01%), Postives = 87/91 (95.60%), Query Frame = 3
Query:  162 ESYGIYIYKVLRQVHPDTGISGKAMSIMNSFVNDVFERIASEASKLATYNKKSTITSREIQTAVRLILPGELAKHAVSEGTKAVTKYTGSK 434
            ESY IYIYKVL+QVHPDTGIS KAMSIMNSFVND+FERIA+EAS+LA YNK+STITSREIQTAVRL+LPGELAKHAVSEGTKAVTKYT SK
Sbjct:   33 ESYAIYIYKVLKQVHPDTGISSKAMSIMNSFVNDIFERIAAEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK 123          
BLAST of histone H2B vs. Ensembl Fly
Match: His2B:CG33908 (gene:FBgn0053908 transcript:FBtr0091912)

HSP 1 Score: 170.629 bits (431), Expect = 1.404e-54
Identity = 81/91 (89.01%), Postives = 87/91 (95.60%), Query Frame = 3
Query:  162 ESYGIYIYKVLRQVHPDTGISGKAMSIMNSFVNDVFERIASEASKLATYNKKSTITSREIQTAVRLILPGELAKHAVSEGTKAVTKYTGSK 434
            ESY IYIYKVL+QVHPDTGIS KAMSIMNSFVND+FERIA+EAS+LA YNK+STITSREIQTAVRL+LPGELAKHAVSEGTKAVTKYT SK
Sbjct:   33 ESYAIYIYKVLKQVHPDTGISSKAMSIMNSFVNDIFERIAAEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK 123          
BLAST of histone H2B vs. Ensembl Zebrafish
Match: zgc:194989 (zgc:194989 [Source:ZFIN;Acc:ZDB-GENE-080723-3])

HSP 1 Score: 167.548 bits (423), Expect = 3.510e-53
Identity = 79/91 (86.81%), Postives = 85/91 (93.41%), Query Frame = 3
Query:  162 ESYGIYIYKVLRQVHPDTGISGKAMSIMNSFVNDVFERIASEASKLATYNKKSTITSREIQTAVRLILPGELAKHAVSEGTKAVTKYTGSK 434
            ESY IY+YKVL+QVHPDTGIS KAM IMNSFVND+FERIA EAS+LA YNK+STITSREIQTAVRL+LPGELAKHAVSEGTKAVTKYT SK
Sbjct:   34 ESYAIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK 124          
BLAST of histone H2B vs. Ensembl Zebrafish
Match: si:ch211-190p8.2 (si:ch211-190p8.2 [Source:ZFIN;Acc:ZDB-GENE-070424-145])

HSP 1 Score: 167.162 bits (422), Expect = 3.536e-53
Identity = 78/91 (85.71%), Postives = 87/91 (95.60%), Query Frame = 3
Query:  162 ESYGIYIYKVLRQVHPDTGISGKAMSIMNSFVNDVFERIASEASKLATYNKKSTITSREIQTAVRLILPGELAKHAVSEGTKAVTKYTGSK 434
            E+Y +YIYKVL+QVHPDTGIS +AMSIMNSFVNDVFERIA+EAS+LA YNK+STITSRE+QTAVRL+LPGELAKHAVSEGTKAVTKYT SK
Sbjct:   28 ETYAVYIYKVLKQVHPDTGISSRAMSIMNSFVNDVFERIATEASRLAHYNKRSTITSREVQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK 118          
BLAST of histone H2B vs. Ensembl Zebrafish
Match: hist2h2l (histone 2, H2, like [Source:NCBI gene;Acc:386920])

HSP 1 Score: 167.548 bits (423), Expect = 3.821e-53
Identity = 79/91 (86.81%), Postives = 85/91 (93.41%), Query Frame = 3
Query:  162 ESYGIYIYKVLRQVHPDTGISGKAMSIMNSFVNDVFERIASEASKLATYNKKSTITSREIQTAVRLILPGELAKHAVSEGTKAVTKYTGSK 434
            ESY IY+YKVL+QVHPDTGIS KAM IMNSFVND+FERIA EAS+LA YNK+STITSREIQTAVRL+LPGELAKHAVSEGTKAVTKYT SK
Sbjct:   36 ESYAIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK 126          
BLAST of histone H2B vs. Ensembl Zebrafish
Match: hist2h2l (histone 2, H2, like [Source:NCBI gene;Acc:386920])

HSP 1 Score: 167.548 bits (423), Expect = 3.821e-53
Identity = 79/91 (86.81%), Postives = 85/91 (93.41%), Query Frame = 3
Query:  162 ESYGIYIYKVLRQVHPDTGISGKAMSIMNSFVNDVFERIASEASKLATYNKKSTITSREIQTAVRLILPGELAKHAVSEGTKAVTKYTGSK 434
            ESY IY+YKVL+QVHPDTGIS KAM IMNSFVND+FERIA EAS+LA YNK+STITSREIQTAVRL+LPGELAKHAVSEGTKAVTKYT SK
Sbjct:   36 ESYAIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK 126          
BLAST of histone H2B vs. Ensembl Zebrafish
Match: zgc:171759 (zgc:171759 [Source:ZFIN;Acc:ZDB-GENE-071004-32])

HSP 1 Score: 166.777 bits (421), Expect = 5.551e-53
Identity = 79/91 (86.81%), Postives = 85/91 (93.41%), Query Frame = 3
Query:  162 ESYGIYIYKVLRQVHPDTGISGKAMSIMNSFVNDVFERIASEASKLATYNKKSTITSREIQTAVRLILPGELAKHAVSEGTKAVTKYTGSK 434
            ESY IY+YKVL+QVHPDTGIS KAM IMNSFVND+FERIA EAS+LA YNK+STITSREIQTAVRL+LPGELAKHAVSEGTKAVTKYT SK
Sbjct:   34 ESYAIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK 124          
BLAST of histone H2B vs. Ensembl Xenopus
Match: abcb11.2 (ATP binding cassette subfamily B member 11, gene 2 [Source:Xenbase;Acc:XB-GENE-988819])

HSP 1 Score: 169.088 bits (427), Expect = 1.083e-53
Identity = 80/91 (87.91%), Postives = 86/91 (94.51%), Query Frame = 3
Query:  162 ESYGIYIYKVLRQVHPDTGISGKAMSIMNSFVNDVFERIASEASKLATYNKKSTITSREIQTAVRLILPGELAKHAVSEGTKAVTKYTGSK 434
            ESY IY+YKVL+QVHPDTGIS KAMSIMNSFVNDVFERIA EAS+LA YNK+STITSREIQTAVRL+LPGELAKHAVSEGTKAVTKYT +K
Sbjct:   36 ESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK 126          
BLAST of histone H2B vs. Ensembl Xenopus
Match: ENSXETT00000016353.1 (histone H2B 1.1-like [Source:NCBI gene;Acc:100485134])

HSP 1 Score: 169.088 bits (427), Expect = 1.083e-53
Identity = 80/91 (87.91%), Postives = 86/91 (94.51%), Query Frame = 3
Query:  162 ESYGIYIYKVLRQVHPDTGISGKAMSIMNSFVNDVFERIASEASKLATYNKKSTITSREIQTAVRLILPGELAKHAVSEGTKAVTKYTGSK 434
            ESY IY+YKVL+QVHPDTGIS KAMSIMNSFVNDVFERIA EAS+LA YNK+STITSREIQTAVRL+LPGELAKHAVSEGTKAVTKYT +K
Sbjct:   36 ESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK 126          
BLAST of histone H2B vs. Ensembl Xenopus
Match: phc2 (polyhomeotic homolog 2 [Source:Xenbase;Acc:XB-GENE-996998])

HSP 1 Score: 169.088 bits (427), Expect = 1.083e-53
Identity = 80/91 (87.91%), Postives = 86/91 (94.51%), Query Frame = 3
Query:  162 ESYGIYIYKVLRQVHPDTGISGKAMSIMNSFVNDVFERIASEASKLATYNKKSTITSREIQTAVRLILPGELAKHAVSEGTKAVTKYTGSK 434
            ESY IY+YKVL+QVHPDTGIS KAMSIMNSFVNDVFERIA EAS+LA YNK+STITSREIQTAVRL+LPGELAKHAVSEGTKAVTKYT +K
Sbjct:   36 ESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK 126          
BLAST of histone H2B vs. Ensembl Xenopus
Match: ENSXETT00000016546.1 (histone H2B 1.1-like [Source:NCBI gene;Acc:100485134])

HSP 1 Score: 169.088 bits (427), Expect = 1.083e-53
Identity = 80/91 (87.91%), Postives = 86/91 (94.51%), Query Frame = 3
Query:  162 ESYGIYIYKVLRQVHPDTGISGKAMSIMNSFVNDVFERIASEASKLATYNKKSTITSREIQTAVRLILPGELAKHAVSEGTKAVTKYTGSK 434
            ESY IY+YKVL+QVHPDTGIS KAMSIMNSFVNDVFERIA EAS+LA YNK+STITSREIQTAVRL+LPGELAKHAVSEGTKAVTKYT +K
Sbjct:   36 ESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK 126          
BLAST of histone H2B vs. Ensembl Xenopus
Match: h2bc11 (H2B clustered histone 11 [Source:NCBI gene;Acc:550005])

HSP 1 Score: 169.088 bits (427), Expect = 1.107e-53
Identity = 80/91 (87.91%), Postives = 86/91 (94.51%), Query Frame = 3
Query:  162 ESYGIYIYKVLRQVHPDTGISGKAMSIMNSFVNDVFERIASEASKLATYNKKSTITSREIQTAVRLILPGELAKHAVSEGTKAVTKYTGSK 434
            ESY IY+YKVL+QVHPDTGIS KAMSIMNSFVNDVFERIA EAS+LA YNK+STITSREIQTAVRL+LPGELAKHAVSEGTKAVTKYT +K
Sbjct:   36 ESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK 126          
BLAST of histone H2B vs. Ensembl Mouse
Match: H2bc1 (H2B clustered histone 1 [Source:MGI Symbol;Acc:MGI:2448375])

HSP 1 Score: 169.088 bits (427), Expect = 7.841e-54
Identity = 81/91 (89.01%), Postives = 86/91 (94.51%), Query Frame = 3
Query:  162 ESYGIYIYKVLRQVHPDTGISGKAMSIMNSFVNDVFERIASEASKLATYNKKSTITSREIQTAVRLILPGELAKHAVSEGTKAVTKYTGSK 434
            ESY IYIYKVL+QVHPDTGIS KAMSIMNSFV D+FERIASEAS+LA YNK+STITSREIQTAVRL+LPGELAKHAVSEGTKAVTKYT SK
Sbjct:   37 ESYSIYIYKVLKQVHPDTGISSKAMSIMNSFVTDIFERIASEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK 127          
BLAST of histone H2B vs. Ensembl Mouse
Match: H2bc11 (H2B clustered histone 11 [Source:MGI Symbol;Acc:MGI:2448388])

HSP 1 Score: 168.703 bits (426), Expect = 1.101e-53
Identity = 79/91 (86.81%), Postives = 86/91 (94.51%), Query Frame = 3
Query:  162 ESYGIYIYKVLRQVHPDTGISGKAMSIMNSFVNDVFERIASEASKLATYNKKSTITSREIQTAVRLILPGELAKHAVSEGTKAVTKYTGSK 434
            ESY +Y+YKVL+QVHPDTGIS KAM IMNSFVND+FERIASEAS+LA YNK+STITSREIQTAVRL+LPGELAKHAVSEGTKAVTKYT SK
Sbjct:   36 ESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIASEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK 126          
BLAST of histone H2B vs. Ensembl Mouse
Match: Hist1h2br (histone cluster 1 H2br [Source:MGI Symbol;Acc:MGI:3710645])

HSP 1 Score: 168.703 bits (426), Expect = 1.101e-53
Identity = 79/91 (86.81%), Postives = 86/91 (94.51%), Query Frame = 3
Query:  162 ESYGIYIYKVLRQVHPDTGISGKAMSIMNSFVNDVFERIASEASKLATYNKKSTITSREIQTAVRLILPGELAKHAVSEGTKAVTKYTGSK 434
            ESY +Y+YKVL+QVHPDTGIS KAM IMNSFVND+FERIASEAS+LA YNK+STITSREIQTAVRL+LPGELAKHAVSEGTKAVTKYT SK
Sbjct:   36 ESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIASEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK 126          
BLAST of histone H2B vs. Ensembl Mouse
Match: Hist1h2br (histone cluster 1 H2br [Source:MGI Symbol;Acc:MGI:3710645])

HSP 1 Score: 168.703 bits (426), Expect = 1.101e-53
Identity = 79/91 (86.81%), Postives = 86/91 (94.51%), Query Frame = 3
Query:  162 ESYGIYIYKVLRQVHPDTGISGKAMSIMNSFVNDVFERIASEASKLATYNKKSTITSREIQTAVRLILPGELAKHAVSEGTKAVTKYTGSK 434
            ESY +Y+YKVL+QVHPDTGIS KAM IMNSFVND+FERIASEAS+LA YNK+STITSREIQTAVRL+LPGELAKHAVSEGTKAVTKYT SK
Sbjct:   36 ESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIASEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK 126          
BLAST of histone H2B vs. Ensembl Mouse
Match: Hist1h2bq (histone cluster 1, H2bq [Source:MGI Symbol;Acc:MGI:3702051])

HSP 1 Score: 168.703 bits (426), Expect = 1.101e-53
Identity = 79/91 (86.81%), Postives = 86/91 (94.51%), Query Frame = 3
Query:  162 ESYGIYIYKVLRQVHPDTGISGKAMSIMNSFVNDVFERIASEASKLATYNKKSTITSREIQTAVRLILPGELAKHAVSEGTKAVTKYTGSK 434
            ESY +Y+YKVL+QVHPDTGIS KAM IMNSFVND+FERIASEAS+LA YNK+STITSREIQTAVRL+LPGELAKHAVSEGTKAVTKYT SK
Sbjct:   36 ESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIASEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK 126          
BLAST of histone H2B vs. UniProt/SwissProt
Match: sp|P35069|H2B3_TIGCA (Histone H2B.3 OS=Tigriopus californicus OX=6832 PE=3 SV=2)

HSP 1 Score: 171.785 bits (434), Expect = 5.270e-54
Identity = 82/91 (90.11%), Postives = 87/91 (95.60%), Query Frame = 3
Query:  162 ESYGIYIYKVLRQVHPDTGISGKAMSIMNSFVNDVFERIASEASKLATYNKKSTITSREIQTAVRLILPGELAKHAVSEGTKAVTKYTGSK 434
            ESY IYIYKVL+QVHPDTGIS KAMSIMNSFVND+FERIASEAS+LA YNK+STITSREIQTAVRL+LPGELAKHAVSEGTKAVTKYT SK
Sbjct:   33 ESYAIYIYKVLKQVHPDTGISSKAMSIMNSFVNDIFERIASEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK 123          
BLAST of histone H2B vs. UniProt/SwissProt
Match: sp|P16889|H2BL3_STRPU (Late histone H2B.L3 OS=Strongylocentrotus purpuratus OX=7668 PE=1 SV=3)

HSP 1 Score: 171.785 bits (434), Expect = 5.751e-54
Identity = 82/91 (90.11%), Postives = 88/91 (96.70%), Query Frame = 3
Query:  162 ESYGIYIYKVLRQVHPDTGISGKAMSIMNSFVNDVFERIASEASKLATYNKKSTITSREIQTAVRLILPGELAKHAVSEGTKAVTKYTGSK 434
            ESYGIYIYKVL+QVHPDTGIS +AMSIMNSFVNDVFERIA+EAS+LA YNKKSTITSRE+QTAVRL+LPGELAKHAVSEGTKAVTKYT SK
Sbjct:   33 ESYGIYIYKVLKQVHPDTGISSRAMSIMNSFVNDVFERIAAEASRLAHYNKKSTITSREVQTAVRLLLPGELAKHAVSEGTKAVTKYTTSK 123          
BLAST of histone H2B vs. UniProt/SwissProt
Match: sp|P35068|H2B1_TIGCA (Histone H2B.1/H2B.2 OS=Tigriopus californicus OX=6832 PE=3 SV=2)

HSP 1 Score: 171.785 bits (434), Expect = 5.878e-54
Identity = 82/91 (90.11%), Postives = 87/91 (95.60%), Query Frame = 3
Query:  162 ESYGIYIYKVLRQVHPDTGISGKAMSIMNSFVNDVFERIASEASKLATYNKKSTITSREIQTAVRLILPGELAKHAVSEGTKAVTKYTGSK 434
            ESY IYIYKVL+QVHPDTGIS KAMSIMNSFVND+FERIASEAS+LA YNK+STITSREIQTAVRL+LPGELAKHAVSEGTKAVTKYT SK
Sbjct:   33 ESYAIYIYKVLKQVHPDTGISSKAMSIMNSFVNDIFERIASEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK 123          
BLAST of histone H2B vs. UniProt/SwissProt
Match: sp|Q7M4G7|H2B_PATPE (Histone H2B OS=Patiria pectinifera OX=7594 PE=1 SV=2)

HSP 1 Score: 171.014 bits (432), Expect = 8.254e-54
Identity = 81/91 (89.01%), Postives = 88/91 (96.70%), Query Frame = 3
Query:  162 ESYGIYIYKVLRQVHPDTGISGKAMSIMNSFVNDVFERIASEASKLATYNKKSTITSREIQTAVRLILPGELAKHAVSEGTKAVTKYTGSK 434
            ESYGIYIYKV++QVHPDTGIS KAMSIMNSFVND+FERIA+EAS+LA YNKKSTITSRE+QTAVRL+LPGELAKHAVSEGTKAVTKYT SK
Sbjct:   32 ESYGIYIYKVMKQVHPDTGISSKAMSIMNSFVNDIFERIAAEASRLAHYNKKSTITSREVQTAVRLLLPGELAKHAVSEGTKAVTKYTTSK 122          
BLAST of histone H2B vs. UniProt/SwissProt
Match: sp|P07794|H2BL1_PSAMI (Late histone H2B.2.1 OS=Psammechinus miliaris OX=7660 PE=3 SV=2)

HSP 1 Score: 171.014 bits (432), Expect = 1.036e-53
Identity = 82/91 (90.11%), Postives = 87/91 (95.60%), Query Frame = 3
Query:  162 ESYGIYIYKVLRQVHPDTGISGKAMSIMNSFVNDVFERIASEASKLATYNKKSTITSREIQTAVRLILPGELAKHAVSEGTKAVTKYTGSK 434
            ESYGIYIYKVL+QVHPDTGIS KAMSIMNSFVNDVFERIA EAS+LA YNKKSTI+SRE+QTAVRL+LPGELAKHAVSEGTKAVTKYT SK
Sbjct:   34 ESYGIYIYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKKSTISSREVQTAVRLLLPGELAKHAVSEGTKAVTKYTTSK 124          
BLAST of histone H2B vs. TrEMBL
Match: S5VDL5 (Histone H2B (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 189.504 bits (480), Expect = 1.555e-58
Identity = 106/107 (99.07%), Postives = 106/107 (99.07%), Query Frame = 3
Query:  114 EVAPXXXXXXXXXXXXESYGIYIYKVLRQVHPDTGISGKAMSIMNSFVNDVFERIASEASKLATYNKKSTITSREIQTAVRLILPGELAKHAVSEGTKAVTKYTGSK 434
            EV PKTDKKKRIHKRKESYGIYIYKVLRQVHPDTGISGKAMSIMNSFVNDVFERIASEASKLATYNKKSTITSREIQTAVRLILPGELAKHAVSEGTKAVTKYTGSK
Sbjct:   13 EVTPKTDKKKRIHKRKESYGIYIYKVLRQVHPDTGISGKAMSIMNSFVNDVFERIASEASKLATYNKKSTITSREIQTAVRLILPGELAKHAVSEGTKAVTKYTGSK 119          
BLAST of histone H2B vs. TrEMBL
Match: I1ZIK6 (Histone H2B (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 187.963 bits (476), Expect = 5.947e-58
Identity = 105/107 (98.13%), Postives = 106/107 (99.07%), Query Frame = 3
Query:  114 EVAPXXXXXXXXXXXXESYGIYIYKVLRQVHPDTGISGKAMSIMNSFVNDVFERIASEASKLATYNKKSTITSREIQTAVRLILPGELAKHAVSEGTKAVTKYTGSK 434
            EV PKTDKKKRIHKRKESYGIYIYKVLRQVHPDTGISGKAMSIMNSFVNDVFERIASEASKLATYNKKSTI+SREIQTAVRLILPGELAKHAVSEGTKAVTKYTGSK
Sbjct:   18 EVVPKTDKKKRIHKRKESYGIYIYKVLRQVHPDTGISGKAMSIMNSFVNDVFERIASEASKLATYNKKSTISSREIQTAVRLILPGELAKHAVSEGTKAVTKYTGSK 124          
BLAST of histone H2B vs. TrEMBL
Match: F8WLE6 (Histone H2B (Fragment) OS=Dugesia japonica OX=6161 GN=DjhistonH2B PE=2 SV=1)

HSP 1 Score: 179.874 bits (455), Expect = 6.205e-55
Identity = 86/91 (94.51%), Postives = 90/91 (98.90%), Query Frame = 3
Query:  162 ESYGIYIYKVLRQVHPDTGISGKAMSIMNSFVNDVFERIASEASKLATYNKKSTITSREIQTAVRLILPGELAKHAVSEGTKAVTKYTGSK 434
            ESYGIYIYKVLRQVHPDTGISGKAMSIMNSFVNDVFERIASEASKLA YNK+STI+SREIQT+VRLILPGEL+KHAVSEGTKAVTKYTGSK
Sbjct:   22 ESYGIYIYKVLRQVHPDTGISGKAMSIMNSFVNDVFERIASEASKLAAYNKRSTISSREIQTSVRLILPGELSKHAVSEGTKAVTKYTGSK 112          
BLAST of histone H2B vs. TrEMBL
Match: A0A0R3W3H9 (Histone H2B OS=Taenia asiatica OX=60517 GN=TASK_LOCUS4475 PE=3 SV=1)

HSP 1 Score: 174.481 bits (441), Expect = 1.089e-52
Identity = 83/91 (91.21%), Postives = 88/91 (96.70%), Query Frame = 3
Query:  162 ESYGIYIYKVLRQVHPDTGISGKAMSIMNSFVNDVFERIASEASKLATYNKKSTITSREIQTAVRLILPGELAKHAVSEGTKAVTKYTGSK 434
            ESY IYIYKVLRQVHPDTGIS KAMSIMNSFVND+FERIA+E+S+LA YNKKSTITSREIQTAVRL+LPGELAKHAVSEGTKAVTKYTGSK
Sbjct:   32 ESYAIYIYKVLRQVHPDTGISSKAMSIMNSFVNDIFERIAAESSRLAHYNKKSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTGSK 122          
BLAST of histone H2B vs. TrEMBL
Match: U6HME5 (Histone H2B OS=Echinococcus multilocularis OX=6211 GN=EmuJ_000336500 PE=3 SV=1)

HSP 1 Score: 175.252 bits (443), Expect = 1.416e-52
Identity = 83/91 (91.21%), Postives = 88/91 (96.70%), Query Frame = 3
Query:  162 ESYGIYIYKVLRQVHPDTGISGKAMSIMNSFVNDVFERIASEASKLATYNKKSTITSREIQTAVRLILPGELAKHAVSEGTKAVTKYTGSK 434
            ESY IYIYKVLRQVHPDTGIS KAMSIMNSFVND+FERIA+E+S+LA YNKKSTITSREIQTAVRL+LPGELAKHAVSEGTKAVTKYTGSK
Sbjct:   55 ESYAIYIYKVLRQVHPDTGISSKAMSIMNSFVNDIFERIAAESSRLAHYNKKSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTGSK 145          
BLAST of histone H2B vs. Ensembl Cavefish
Match: hist2h2l (histone 2, H2, like [Source:NCBI gene;Acc:386920])

HSP 1 Score: 167.548 bits (423), Expect = 6.628e-53
Identity = 79/91 (86.81%), Postives = 85/91 (93.41%), Query Frame = 3
Query:  162 ESYGIYIYKVLRQVHPDTGISGKAMSIMNSFVNDVFERIASEASKLATYNKKSTITSREIQTAVRLILPGELAKHAVSEGTKAVTKYTGSK 434
            ESY IY+YKVL+QVHPDTGIS KAM IMNSFVND+FERIA EAS+LA YNK+STITSREIQTAVRL+LPGELAKHAVSEGTKAVTKYT SK
Sbjct:   36 ESYAIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK 126          
BLAST of histone H2B vs. Ensembl Cavefish
Match: ENSAMXT00000025763.2 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000081.1:1681215:1683989:-1 gene:ENSAMXG00000033961.1 transcript:ENSAMXT00000025763.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 166.007 bits (419), Expect = 8.937e-53
Identity = 78/91 (85.71%), Postives = 85/91 (93.41%), Query Frame = 3
Query:  162 ESYGIYIYKVLRQVHPDTGISGKAMSIMNSFVNDVFERIASEASKLATYNKKSTITSREIQTAVRLILPGELAKHAVSEGTKAVTKYTGSK 434
            ESY IY+YKVL+QVHPDTGIS KAM IMNSFVND+FERIA E+S+LA YNK+STITSREIQTAVRL+LPGELAKHAVSEGTKAVTKYT SK
Sbjct:   27 ESYAIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGESSRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK 117          
BLAST of histone H2B vs. Ensembl Cavefish
Match: si:ch211-190p8.2 (late histone H2B.L4-like [Source:NCBI gene;Acc:103022800])

HSP 1 Score: 165.622 bits (418), Expect = 1.136e-52
Identity = 76/91 (83.52%), Postives = 86/91 (94.51%), Query Frame = 3
Query:  162 ESYGIYIYKVLRQVHPDTGISGKAMSIMNSFVNDVFERIASEASKLATYNKKSTITSREIQTAVRLILPGELAKHAVSEGTKAVTKYTGSK 434
            E+Y +YIYKVL+QVHPDTGIS +AMSIMNSFVNDVF+RIA+EAS+L  YNK+STITSRE+QTAVRL+LPGELAKHAVSEGTKAVTKYT SK
Sbjct:   27 ETYAVYIYKVLKQVHPDTGISSRAMSIMNSFVNDVFDRIATEASRLTQYNKRSTITSREVQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK 117          
BLAST of histone H2B vs. Ensembl Cavefish
Match: ENSAMXT00000018389.2 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02002305.1:122420:122920:1 gene:ENSAMXG00000040093.1 transcript:ENSAMXT00000018389.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 165.622 bits (418), Expect = 1.228e-52
Identity = 78/91 (85.71%), Postives = 85/91 (93.41%), Query Frame = 3
Query:  162 ESYGIYIYKVLRQVHPDTGISGKAMSIMNSFVNDVFERIASEASKLATYNKKSTITSREIQTAVRLILPGELAKHAVSEGTKAVTKYTGSK 434
            ESY IY+YKVL+QVHPDTGIS KAM IMNSFVND+FERIA E+S+LA YNK+STITSREIQTAVRL+LPGELAKHAVSEGTKAVTKYT SK
Sbjct:   26 ESYAIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGESSRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK 116          
BLAST of histone H2B vs. Ensembl Cavefish
Match: ENSAMXT00000026773.2 (pep primary_assembly:Astyanax_mexicanus-2.0:21:10103882:10104382:1 gene:ENSAMXG00000043772.1 transcript:ENSAMXT00000026773.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 165.622 bits (418), Expect = 1.228e-52
Identity = 78/91 (85.71%), Postives = 85/91 (93.41%), Query Frame = 3
Query:  162 ESYGIYIYKVLRQVHPDTGISGKAMSIMNSFVNDVFERIASEASKLATYNKKSTITSREIQTAVRLILPGELAKHAVSEGTKAVTKYTGSK 434
            ESY IY+YKVL+QVHPDTGIS KAM IMNSFVND+FERIA E+S+LA YNK+STITSREIQTAVRL+LPGELAKHAVSEGTKAVTKYT SK
Sbjct:   26 ESYAIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGESSRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK 116          
BLAST of histone H2B vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005327.1 (pep scaffold:Pmarinus_7.0:GL476820:705043:705550:-1 gene:ENSPMAG00000004856.1 transcript:ENSPMAT00000005327.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 171.4 bits (433), Expect = 2.731e-55
Identity = 81/91 (89.01%), Postives = 87/91 (95.60%), Query Frame = 3
Query:  162 ESYGIYIYKVLRQVHPDTGISGKAMSIMNSFVNDVFERIASEASKLATYNKKSTITSREIQTAVRLILPGELAKHAVSEGTKAVTKYTGSK 434
            ESY IYIYKV++QVHPDTGIS KAMSIMNSFVND+FERIASEAS+LA YNK+STITSREIQTAVRL+LPGELAKHAVSEGTKAVTKYT SK
Sbjct:   43 ESYAIYIYKVMKQVHPDTGISSKAMSIMNSFVNDIFERIASEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK 133          
BLAST of histone H2B vs. Ensembl Sea Lamprey
Match: ENSPMAT00000011164.1 (pep scaffold:Pmarinus_7.0:GL476820:1014653:1015054:1 gene:ENSPMAG00000010137.1 transcript:ENSPMAT00000011164.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 171.014 bits (432), Expect = 2.753e-55
Identity = 81/91 (89.01%), Postives = 87/91 (95.60%), Query Frame = 3
Query:  162 ESYGIYIYKVLRQVHPDTGISGKAMSIMNSFVNDVFERIASEASKLATYNKKSTITSREIQTAVRLILPGELAKHAVSEGTKAVTKYTGSK 434
            ESY IYIYKV++QVHPDTGIS KAMSIMNSFVND+FERIASEAS+LA YNK+STITSREIQTAVRL+LPGELAKHAVSEGTKAVTKYT SK
Sbjct:   43 ESYAIYIYKVMKQVHPDTGISSKAMSIMNSFVNDIFERIASEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK 133          
BLAST of histone H2B vs. Ensembl Sea Lamprey
Match: ENSPMAT00000011062.1 (pep scaffold:Pmarinus_7.0:GL476925:226546:226947:1 gene:ENSPMAG00000010034.1 transcript:ENSPMAT00000011062.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 171.014 bits (432), Expect = 2.753e-55
Identity = 81/91 (89.01%), Postives = 87/91 (95.60%), Query Frame = 3
Query:  162 ESYGIYIYKVLRQVHPDTGISGKAMSIMNSFVNDVFERIASEASKLATYNKKSTITSREIQTAVRLILPGELAKHAVSEGTKAVTKYTGSK 434
            ESY IYIYKV++QVHPDTGIS KAMSIMNSFVND+FERIASEAS+LA YNK+STITSREIQTAVRL+LPGELAKHAVSEGTKAVTKYT SK
Sbjct:   43 ESYAIYIYKVMKQVHPDTGISSKAMSIMNSFVNDIFERIASEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK 133          
BLAST of histone H2B vs. Ensembl Sea Lamprey
Match: ENSPMAT00000011057.1 (pep scaffold:Pmarinus_7.0:GL476925:216848:217249:1 gene:ENSPMAG00000010030.1 transcript:ENSPMAT00000011057.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 171.014 bits (432), Expect = 2.753e-55
Identity = 81/91 (89.01%), Postives = 87/91 (95.60%), Query Frame = 3
Query:  162 ESYGIYIYKVLRQVHPDTGISGKAMSIMNSFVNDVFERIASEASKLATYNKKSTITSREIQTAVRLILPGELAKHAVSEGTKAVTKYTGSK 434
            ESY IYIYKV++QVHPDTGIS KAMSIMNSFVND+FERIASEAS+LA YNK+STITSREIQTAVRL+LPGELAKHAVSEGTKAVTKYT SK
Sbjct:   43 ESYAIYIYKVMKQVHPDTGISSKAMSIMNSFVNDIFERIASEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK 133          
BLAST of histone H2B vs. Ensembl Sea Lamprey
Match: ENSPMAT00000011052.1 (pep scaffold:Pmarinus_7.0:GL476925:200969:201370:1 gene:ENSPMAG00000010022.1 transcript:ENSPMAT00000011052.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 171.014 bits (432), Expect = 2.753e-55
Identity = 81/91 (89.01%), Postives = 87/91 (95.60%), Query Frame = 3
Query:  162 ESYGIYIYKVLRQVHPDTGISGKAMSIMNSFVNDVFERIASEASKLATYNKKSTITSREIQTAVRLILPGELAKHAVSEGTKAVTKYTGSK 434
            ESY IYIYKV++QVHPDTGIS KAMSIMNSFVND+FERIASEAS+LA YNK+STITSREIQTAVRL+LPGELAKHAVSEGTKAVTKYT SK
Sbjct:   43 ESYAIYIYKVMKQVHPDTGISSKAMSIMNSFVNDIFERIASEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK 133          
BLAST of histone H2B vs. Ensembl Yeast
Match: HTB1 (Histone H2B; core histone protein required for chromatin assembly and chromosome function; nearly identical to HTB2; Rad6p-Bre1p-Lge1p mediated ubiquitination regulates reassembly after DNA replication, transcriptional activation, meiotic DSB formation and H3 methylation [Source:SGD;Acc:S000002632])

HSP 1 Score: 160.999 bits (406), Expect = 1.576e-51
Identity = 74/90 (82.22%), Postives = 84/90 (93.33%), Query Frame = 3
Query:  162 ESYGIYIYKVLRQVHPDTGISGKAMSIMNSFVNDVFERIASEASKLATYNKKSTITSREIQTAVRLILPGELAKHAVSEGTKAVTKYTGS 431
            E+Y  YIYKVL+Q HPDTGIS K+MSI+NSFVND+FERIA+EASKLA YNKKSTI++REIQTAVRLILPGELAKHAVSEGT+AVTKY+ S
Sbjct:   39 ETYSSYIYKVLKQTHPDTGISQKSMSILNSFVNDIFERIATEASKLAAYNKKSTISAREIQTAVRLILPGELAKHAVSEGTRAVTKYSSS 128          
BLAST of histone H2B vs. Ensembl Yeast
Match: HTB2 (Histone H2B; core histone protein required for chromatin assembly and chromosome function; nearly identical to HTB1; Rad6p-Bre1p-Lge1p mediated ubiquitination regulates reassembly after DNA replication, transcriptional activation, meiotic DSB formation and H3 methylation [Source:SGD;Acc:S000000098])

HSP 1 Score: 160.999 bits (406), Expect = 1.665e-51
Identity = 74/90 (82.22%), Postives = 84/90 (93.33%), Query Frame = 3
Query:  162 ESYGIYIYKVLRQVHPDTGISGKAMSIMNSFVNDVFERIASEASKLATYNKKSTITSREIQTAVRLILPGELAKHAVSEGTKAVTKYTGS 431
            E+Y  YIYKVL+Q HPDTGIS K+MSI+NSFVND+FERIA+EASKLA YNKKSTI++REIQTAVRLILPGELAKHAVSEGT+AVTKY+ S
Sbjct:   39 ETYSSYIYKVLKQTHPDTGISQKSMSILNSFVNDIFERIATEASKLAAYNKKSTISAREIQTAVRLILPGELAKHAVSEGTRAVTKYSSS 128          
BLAST of histone H2B vs. Ensembl Nematostella
Match: EDO46401 (Histone H2B [Source:UniProtKB/TrEMBL;Acc:A7RPY4])

HSP 1 Score: 166.392 bits (420), Expect = 3.203e-53
Identity = 80/91 (87.91%), Postives = 84/91 (92.31%), Query Frame = 3
Query:  162 ESYGIYIYKVLRQVHPDTGISGKAMSIMNSFVNDVFERIASEASKLATYNKKSTITSREIQTAVRLILPGELAKHAVSEGTKAVTKYTGSK 434
            ESY IYIYKVL+QVHPDTGIS KAM IMN FVND+FERIA EAS+LA YNKKSTITSREIQTAVRL+LPGELAKHAVSEGTKAVTKYT SK
Sbjct:   33 ESYAIYIYKVLKQVHPDTGISSKAMGIMNCFVNDIFERIAGEASRLAHYNKKSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK 123          
BLAST of histone H2B vs. Ensembl Nematostella
Match: EDO48412 (Histone H2B [Source:UniProtKB/TrEMBL;Acc:A7RJP4])

HSP 1 Score: 166.007 bits (419), Expect = 3.612e-53
Identity = 80/90 (88.89%), Postives = 84/90 (93.33%), Query Frame = 3
Query:  165 SYGIYIYKVLRQVHPDTGISGKAMSIMNSFVNDVFERIASEASKLATYNKKSTITSREIQTAVRLILPGELAKHAVSEGTKAVTKYTGSK 434
            SY IYIYKVL+QVHPDTGIS KAM IMNSFVND+FERIA EAS+LA YNKKSTITSREIQTAVRL+LPGELAKHAVSEGTKAVTKYT SK
Sbjct:   34 SYAIYIYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKKSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK 123          
BLAST of histone H2B vs. Ensembl Nematostella
Match: EDO48413 (Histone H2B [Source:UniProtKB/TrEMBL;Acc:A7RJP4])

HSP 1 Score: 166.007 bits (419), Expect = 3.612e-53
Identity = 80/90 (88.89%), Postives = 84/90 (93.33%), Query Frame = 3
Query:  165 SYGIYIYKVLRQVHPDTGISGKAMSIMNSFVNDVFERIASEASKLATYNKKSTITSREIQTAVRLILPGELAKHAVSEGTKAVTKYTGSK 434
            SY IYIYKVL+QVHPDTGIS KAM IMNSFVND+FERIA EAS+LA YNKKSTITSREIQTAVRL+LPGELAKHAVSEGTKAVTKYT SK
Sbjct:   34 SYAIYIYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKKSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK 123          
BLAST of histone H2B vs. Ensembl Nematostella
Match: EDO46280 (Histone H2B [Source:UniProtKB/TrEMBL;Acc:A7RQF6])

HSP 1 Score: 165.622 bits (418), Expect = 5.267e-53
Identity = 79/91 (86.81%), Postives = 84/91 (92.31%), Query Frame = 3
Query:  162 ESYGIYIYKVLRQVHPDTGISGKAMSIMNSFVNDVFERIASEASKLATYNKKSTITSREIQTAVRLILPGELAKHAVSEGTKAVTKYTGSK 434
            ESY IYIYKVLRQVHPDTGIS KAM IMNSFVND+FERIA EAS+LA YNKK TI+SRE+QTAVRL+LPGELAKHAVSEGTKAVTKYT SK
Sbjct:   28 ESYAIYIYKVLRQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKKHTISSREVQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK 118          
BLAST of histone H2B vs. Ensembl Nematostella
Match: EDO34626 (Histone H2B [Source:UniProtKB/TrEMBL;Acc:A7SNU9])

HSP 1 Score: 165.236 bits (417), Expect = 5.563e-53
Identity = 79/91 (86.81%), Postives = 84/91 (92.31%), Query Frame = 3
Query:  162 ESYGIYIYKVLRQVHPDTGISGKAMSIMNSFVNDVFERIASEASKLATYNKKSTITSREIQTAVRLILPGELAKHAVSEGTKAVTKYTGSK 434
            ESY IYIYKVLRQVHPDTGIS KAM IMNSFVND+FERIA EAS+LA YNKK TI+SRE+QTAVRL+LPGELAKHAVSEGTKAVTKYT SK
Sbjct:   28 ESYAIYIYKVLRQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKKHTISSREVQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK 118          
BLAST of histone H2B vs. Ensembl Medaka
Match: ENSORLT00000036814.1 (histone H2B 1/2 [Source:NCBI gene;Acc:101159064])

HSP 1 Score: 171.4 bits (433), Expect = 9.392e-55
Identity = 81/91 (89.01%), Postives = 87/91 (95.60%), Query Frame = 3
Query:  162 ESYGIYIYKVLRQVHPDTGISGKAMSIMNSFVNDVFERIASEASKLATYNKKSTITSREIQTAVRLILPGELAKHAVSEGTKAVTKYTGSK 434
            ESY IY+YKVL+QVHPDTGIS KAMSIMNSFVND+FERIASEAS+LA YNK+STITSREIQTAVRL+LPGELAKHAVSEGTKAVTKYT SK
Sbjct:   34 ESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDIFERIASEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK 124          
BLAST of histone H2B vs. Ensembl Medaka
Match: ENSORLT00000034562.1 (histone H2B 1/2 [Source:NCBI gene;Acc:101167975])

HSP 1 Score: 171.4 bits (433), Expect = 9.392e-55
Identity = 81/91 (89.01%), Postives = 87/91 (95.60%), Query Frame = 3
Query:  162 ESYGIYIYKVLRQVHPDTGISGKAMSIMNSFVNDVFERIASEASKLATYNKKSTITSREIQTAVRLILPGELAKHAVSEGTKAVTKYTGSK 434
            ESY IY+YKVL+QVHPDTGIS KAMSIMNSFVND+FERIASEAS+LA YNK+STITSREIQTAVRL+LPGELAKHAVSEGTKAVTKYT SK
Sbjct:   34 ESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDIFERIASEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK 124          
BLAST of histone H2B vs. Ensembl Medaka
Match: ENSORLT00000044844.1 (histone H2B 1/2 [Source:NCBI gene;Acc:111947380])

HSP 1 Score: 171.4 bits (433), Expect = 9.392e-55
Identity = 81/91 (89.01%), Postives = 87/91 (95.60%), Query Frame = 3
Query:  162 ESYGIYIYKVLRQVHPDTGISGKAMSIMNSFVNDVFERIASEASKLATYNKKSTITSREIQTAVRLILPGELAKHAVSEGTKAVTKYTGSK 434
            ESY IY+YKVL+QVHPDTGIS KAMSIMNSFVND+FERIASEAS+LA YNK+STITSREIQTAVRL+LPGELAKHAVSEGTKAVTKYT SK
Sbjct:   34 ESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDIFERIASEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK 124          
BLAST of histone H2B vs. Ensembl Medaka
Match: ENSORLT00000030260.1 (histone H2B 1/2 [Source:NCBI gene;Acc:101172789])

HSP 1 Score: 171.4 bits (433), Expect = 9.392e-55
Identity = 81/91 (89.01%), Postives = 87/91 (95.60%), Query Frame = 3
Query:  162 ESYGIYIYKVLRQVHPDTGISGKAMSIMNSFVNDVFERIASEASKLATYNKKSTITSREIQTAVRLILPGELAKHAVSEGTKAVTKYTGSK 434
            ESY IY+YKVL+QVHPDTGIS KAMSIMNSFVND+FERIASEAS+LA YNK+STITSREIQTAVRL+LPGELAKHAVSEGTKAVTKYT SK
Sbjct:   34 ESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDIFERIASEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK 124          
BLAST of histone H2B vs. Ensembl Medaka
Match: ENSORLT00000032861.1 (pep primary_assembly:ASM223467v1:1:1206779:1243811:-1 gene:ENSORLG00000023088.1 transcript:ENSORLT00000032861.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 171.4 bits (433), Expect = 7.205e-54
Identity = 81/91 (89.01%), Postives = 87/91 (95.60%), Query Frame = 3
Query:  162 ESYGIYIYKVLRQVHPDTGISGKAMSIMNSFVNDVFERIASEASKLATYNKKSTITSREIQTAVRLILPGELAKHAVSEGTKAVTKYTGSK 434
            ESY IY+YKVL+QVHPDTGIS KAMSIMNSFVND+FERIASEAS+LA YNK+STITSREIQTAVRL+LPGELAKHAVSEGTKAVTKYT SK
Sbjct:  109 ESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDIFERIASEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK 199          

HSP 2 Score: 119.013 bits (297), Expect = 2.417e-33
Identity = 55/63 (87.30%), Postives = 60/63 (95.24%), Query Frame = 3
Query:  162 ESYGIYIYKVLRQVHPDTGISGKAMSIMNSFVNDVFERIASEASKLATYNKKSTITSREIQTA 350
            ESY IY+YKVL+QVHPDTGIS KAMSIMNSFVND+FERIASEAS+LA YNK+STITSREIQTA
Sbjct:   34 ESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDIFERIASEASRLAHYNKRSTITSREIQTA 96          
BLAST of histone H2B vs. Planmine SMEST
Match: SMESG000067931.1 (SMESG000067931.1)

HSP 1 Score: 191.045 bits (484), Expect = 1.030e-62
Identity = 107/107 (100.00%), Postives = 107/107 (100.00%), Query Frame = 3
Query:  114 EVAPXXXXXXXXXXXXESYGIYIYKVLRQVHPDTGISGKAMSIMNSFVNDVFERIASEASKLATYNKKSTITSREIQTAVRLILPGELAKHAVSEGTKAVTKYTGSK 434
            EVAPKTDKKKRIHKRKESYGIYIYKVLRQVHPDTGISGKAMSIMNSFVNDVFERIASEASKLATYNKKSTITSREIQTAVRLILPGELAKHAVSEGTKAVTKYTGSK
Sbjct:   18 EVAPKTDKKKRIHKRKESYGIYIYKVLRQVHPDTGISGKAMSIMNSFVNDVFERIASEASKLATYNKKSTITSREIQTAVRLILPGELAKHAVSEGTKAVTKYTGSK 124          
BLAST of histone H2B vs. Planmine SMEST
Match: SMESG000067899.1 (SMESG000067899.1)

HSP 1 Score: 187.963 bits (476), Expect = 1.654e-61
Identity = 105/107 (98.13%), Postives = 106/107 (99.07%), Query Frame = 3
Query:  114 EVAPXXXXXXXXXXXXESYGIYIYKVLRQVHPDTGISGKAMSIMNSFVNDVFERIASEASKLATYNKKSTITSREIQTAVRLILPGELAKHAVSEGTKAVTKYTGSK 434
            EV PKTDKKKRIHKRKESYGIYIYKVLRQVHPDTGISGKAMSIMNSFVNDVFERIASEASKLATYNKKSTI+SREIQTAVRLILPGELAKHAVSEGTKAVTKYTGSK
Sbjct:   18 EVVPKTDKKKRIHKRKESYGIYIYKVLRQVHPDTGISGKAMSIMNSFVNDVFERIASEASKLATYNKKSTISSREIQTAVRLILPGELAKHAVSEGTKAVTKYTGSK 124          
BLAST of histone H2B vs. Planmine SMEST
Match: SMESG000067906.1 (SMESG000067906.1)

HSP 1 Score: 186.808 bits (473), Expect = 4.471e-61
Identity = 91/91 (100.00%), Postives = 91/91 (100.00%), Query Frame = 3
Query:  162 ESYGIYIYKVLRQVHPDTGISGKAMSIMNSFVNDVFERIASEASKLATYNKKSTITSREIQTAVRLILPGELAKHAVSEGTKAVTKYTGSK 434
            ESYGIYIYKVLRQVHPDTGISGKAMSIMNSFVNDVFERIASEASKLATYNKKSTITSREIQTAVRLILPGELAKHAVSEGTKAVTKYTGSK
Sbjct:   34 ESYGIYIYKVLRQVHPDTGISGKAMSIMNSFVNDVFERIASEASKLATYNKKSTITSREIQTAVRLILPGELAKHAVSEGTKAVTKYTGSK 124          
BLAST of histone H2B vs. Planmine SMEST
Match: SMESG000052748.1 (SMESG000052748.1)

HSP 1 Score: 184.882 bits (468), Expect = 2.964e-60
Identity = 89/91 (97.80%), Postives = 91/91 (100.00%), Query Frame = 3
Query:  162 ESYGIYIYKVLRQVHPDTGISGKAMSIMNSFVNDVFERIASEASKLATYNKKSTITSREIQTAVRLILPGELAKHAVSEGTKAVTKYTGSK 434
            ESYGIYIYKVLRQVHPDTGISGKAMSIMNSFVNDVFERIA+EASKLATYNKKSTI+SREIQTAVRLILPGELAKHAVSEGTKAVTKYTGSK
Sbjct:   33 ESYGIYIYKVLRQVHPDTGISGKAMSIMNSFVNDVFERIATEASKLATYNKKSTISSREIQTAVRLILPGELAKHAVSEGTKAVTKYTGSK 123          
BLAST of histone H2B vs. Planmine SMEST
Match: SMESG000052758.1 (SMESG000052758.1)

HSP 1 Score: 184.882 bits (468), Expect = 3.199e-60
Identity = 89/91 (97.80%), Postives = 91/91 (100.00%), Query Frame = 3
Query:  162 ESYGIYIYKVLRQVHPDTGISGKAMSIMNSFVNDVFERIASEASKLATYNKKSTITSREIQTAVRLILPGELAKHAVSEGTKAVTKYTGSK 434
            ESYGIYIYKVLRQVHPDTGISGKAMSIMNSFVNDVFERIA+EASKLATYNKKSTI+SREIQTAVRLILPGELAKHAVSEGTKAVTKYTGSK
Sbjct:   33 ESYGIYIYKVLRQVHPDTGISGKAMSIMNSFVNDVFERIATEASKLATYNKKSTISSREIQTAVRLILPGELAKHAVSEGTKAVTKYTGSK 123          
The following BLAST results are available for this feature:
BLAST of histone H2B vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
H2BC131.347e-5386.81H2B clustered histone 13 [Source:HGNC Symbol;Acc:H... [more]
H2BU12.482e-5386.81H2B.U histone 1 [Source:HGNC Symbol;Acc:HGNC:20514... [more]
H2BU12.482e-5386.81H2B.U histone 1 [Source:HGNC Symbol;Acc:HGNC:20514... [more]
H2BC177.310e-5386.81H2B clustered histone 17 [Source:HGNC Symbol;Acc:H... [more]
H2BC37.805e-5386.81H2B clustered histone 3 [Source:HGNC Symbol;Acc:HG... [more]
back to top
BLAST of histone H2B vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
his-412.650e-5487.91Probable histone H2B 3 [Source:UniProtKB/Swiss-Pr... [more]
his-663.226e-5487.91Probable histone H2B 4 [Source:UniProtKB/Swiss-Pr... [more]
his-623.226e-5487.91Probable histone H2B 4 [Source:UniProtKB/Swiss-Pr... [more]
his-583.226e-5487.91Probable histone H2B 4 [Source:UniProtKB/Swiss-Pr... [more]
his-483.226e-5487.91Probable histone H2B 4 [Source:UniProtKB/Swiss-Pr... [more]
back to top
BLAST of histone H2B vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
His2B:CG338881.404e-5489.01gene:FBgn0053888 transcript:FBtr0091892[more]
His2B:CG339041.404e-5489.01gene:FBgn0053904 transcript:FBtr0091908[more]
His2B:CG339001.404e-5489.01gene:FBgn0053900 transcript:FBtr0091904[more]
His2B:CG338921.404e-5489.01gene:FBgn0053892 transcript:FBtr0091896[more]
His2B:CG339081.404e-5489.01gene:FBgn0053908 transcript:FBtr0091912[more]
back to top
BLAST of histone H2B vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
zgc:1949893.510e-5386.81zgc:194989 [Source:ZFIN;Acc:ZDB-GENE-080723-3][more]
si:ch211-190p8.23.536e-5385.71si:ch211-190p8.2 [Source:ZFIN;Acc:ZDB-GENE-070424-... [more]
hist2h2l3.821e-5386.81histone 2, H2, like [Source:NCBI gene;Acc:386920][more]
hist2h2l3.821e-5386.81histone 2, H2, like [Source:NCBI gene;Acc:386920][more]
zgc:1717595.551e-5386.81zgc:171759 [Source:ZFIN;Acc:ZDB-GENE-071004-32][more]
back to top
BLAST of histone H2B vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
abcb11.21.083e-5387.91ATP binding cassette subfamily B member 11, gene 2... [more]
ENSXETT00000016353.11.083e-5387.91histone H2B 1.1-like [Source:NCBI gene;Acc:1004851... [more]
phc21.083e-5387.91polyhomeotic homolog 2 [Source:Xenbase;Acc:XB-GENE... [more]
ENSXETT00000016546.11.083e-5387.91histone H2B 1.1-like [Source:NCBI gene;Acc:1004851... [more]
h2bc111.107e-5387.91H2B clustered histone 11 [Source:NCBI gene;Acc:550... [more]
back to top
BLAST of histone H2B vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
H2bc17.841e-5489.01H2B clustered histone 1 [Source:MGI Symbol;Acc:MGI... [more]
H2bc111.101e-5386.81H2B clustered histone 11 [Source:MGI Symbol;Acc:MG... [more]
Hist1h2br1.101e-5386.81histone cluster 1 H2br [Source:MGI Symbol;Acc:MGI:... [more]
Hist1h2br1.101e-5386.81histone cluster 1 H2br [Source:MGI Symbol;Acc:MGI:... [more]
Hist1h2bq1.101e-5386.81histone cluster 1, H2bq [Source:MGI Symbol;Acc:MGI... [more]
back to top
BLAST of histone H2B vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P35069|H2B3_TIGCA5.270e-5490.11Histone H2B.3 OS=Tigriopus californicus OX=6832 PE... [more]
sp|P16889|H2BL3_STRPU5.751e-5490.11Late histone H2B.L3 OS=Strongylocentrotus purpurat... [more]
sp|P35068|H2B1_TIGCA5.878e-5490.11Histone H2B.1/H2B.2 OS=Tigriopus californicus OX=6... [more]
sp|Q7M4G7|H2B_PATPE8.254e-5489.01Histone H2B OS=Patiria pectinifera OX=7594 PE=1 SV... [more]
sp|P07794|H2BL1_PSAMI1.036e-5390.11Late histone H2B.2.1 OS=Psammechinus miliaris OX=7... [more]
back to top
BLAST of histone H2B vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
S5VDL51.555e-5899.07Histone H2B (Fragment) OS=Schmidtea mediterranea O... [more]
I1ZIK65.947e-5898.13Histone H2B (Fragment) OS=Schmidtea mediterranea O... [more]
F8WLE66.205e-5594.51Histone H2B (Fragment) OS=Dugesia japonica OX=6161... [more]
A0A0R3W3H91.089e-5291.21Histone H2B OS=Taenia asiatica OX=60517 GN=TASK_LO... [more]
U6HME51.416e-5291.21Histone H2B OS=Echinococcus multilocularis OX=6211... [more]
back to top
BLAST of histone H2B vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hist2h2l6.628e-5386.81histone 2, H2, like [Source:NCBI gene;Acc:386920][more]
ENSAMXT00000025763.28.937e-5385.71pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
si:ch211-190p8.21.136e-5283.52late histone H2B.L4-like [Source:NCBI gene;Acc:103... [more]
ENSAMXT00000018389.21.228e-5285.71pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000026773.21.228e-5285.71pep primary_assembly:Astyanax_mexicanus-2.0:21:101... [more]
back to top
BLAST of histone H2B vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000005327.12.731e-5589.01pep scaffold:Pmarinus_7.0:GL476820:705043:705550:-... [more]
ENSPMAT00000011164.12.753e-5589.01pep scaffold:Pmarinus_7.0:GL476820:1014653:1015054... [more]
ENSPMAT00000011062.12.753e-5589.01pep scaffold:Pmarinus_7.0:GL476925:226546:226947:1... [more]
ENSPMAT00000011057.12.753e-5589.01pep scaffold:Pmarinus_7.0:GL476925:216848:217249:1... [more]
ENSPMAT00000011052.12.753e-5589.01pep scaffold:Pmarinus_7.0:GL476925:200969:201370:1... [more]
back to top
BLAST of histone H2B vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
HTB11.576e-5182.22Histone H2B; core histone protein required for chr... [more]
HTB21.665e-5182.22Histone H2B; core histone protein required for chr... [more]
back to top
BLAST of histone H2B vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO464013.203e-5387.91Histone H2B [Source:UniProtKB/TrEMBL;Acc:A7RPY4][more]
EDO484123.612e-5388.89Histone H2B [Source:UniProtKB/TrEMBL;Acc:A7RJP4][more]
EDO484133.612e-5388.89Histone H2B [Source:UniProtKB/TrEMBL;Acc:A7RJP4][more]
EDO462805.267e-5386.81Histone H2B [Source:UniProtKB/TrEMBL;Acc:A7RQF6][more]
EDO346265.563e-5386.81Histone H2B [Source:UniProtKB/TrEMBL;Acc:A7SNU9][more]
back to top
BLAST of histone H2B vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000036814.19.392e-5589.01histone H2B 1/2 [Source:NCBI gene;Acc:101159064][more]
ENSORLT00000034562.19.392e-5589.01histone H2B 1/2 [Source:NCBI gene;Acc:101167975][more]
ENSORLT00000044844.19.392e-5589.01histone H2B 1/2 [Source:NCBI gene;Acc:111947380][more]
ENSORLT00000030260.19.392e-5589.01histone H2B 1/2 [Source:NCBI gene;Acc:101172789][more]
ENSORLT00000032861.17.205e-5489.01pep primary_assembly:ASM223467v1:1:1206779:1243811... [more]
back to top
BLAST of histone H2B vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000067931.11.030e-62100.00SMESG000067931.1[more]
SMESG000067899.11.654e-6198.13SMESG000067899.1[more]
SMESG000067906.14.471e-61100.00SMESG000067906.1[more]
SMESG000052748.12.964e-6097.80SMESG000052748.1[more]
SMESG000052758.13.199e-6097.80SMESG000052758.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30009514
GenBankAGS78026.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30009514 ID=SMED30009514|Name=histone H2B|organism=Schmidtea mediterranea sexual|type=transcript|length=624bp
AATAAATTAAAATTTGAAAGTCTGTTTAAATATATTAATTTTGTGAAAAT
TTGAATTTTAAAATGGCAATTAAAGGTAAGATCGCTGCTAAGTCTGTTAA
GAAGATTTCAAAGGAAGTTGCTCCTAAAACAGACAAAAAGAAAAGGATAC
ATAAACGCAAAGAAAGTTATGGTATTTACATCTACAAAGTGTTGAGACAA
GTTCATCCAGATACTGGAATTTCTGGCAAAGCAATGTCTATTATGAATAG
CTTTGTCAACGATGTTTTCGAAAGAATCGCTTCGGAGGCTAGCAAGTTGG
CAACTTATAATAAGAAATCAACCATAACCAGCAGAGAGATTCAAACTGCA
GTCAGGTTAATTTTACCAGGAGAATTGGCTAAACACGCAGTTAGTGAAGG
AACCAAAGCTGTTACAAAATACACAGGATCCAAATAAAAACTATCAATAA
AGAGAAAGTTGAACGGCCCTCTTTAGGGCCACAATTCTTGATTGTTTTAA
TGTCACTAGTTATACTATGTATTGATAATGTTCTGAACTTTTAAAACGTC
GTTGAAGTACGTATTATCTTTTATCTTATGTCACGTTTATTAATGTAAAT
AAATGTTTGTATTTCTAAAAAAAA
back to top

protein sequence of SMED30009514-orf-1

>SMED30009514-orf-1 ID=SMED30009514-orf-1|Name=SMED30009514-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=125bp
MAIKGKIAAKSVKKISKEVAPKTDKKKRIHKRKESYGIYIYKVLRQVHPD
TGISGKAMSIMNSFVNDVFERIASEASKLATYNKKSTITSREIQTAVRLI
LPGELAKHAVSEGTKAVTKYTGSK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000204ovary
PLANA:0000208testis
PLANA:0000231vitelline gland
PLANA:0000429neoblast
PLANA:0002020chromatoid body
PLANA:0002032epidermal cell
PLANA:0002111X2 cell
PLANA:0002142parenchyma
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR000558Histone_H2B
IPR009072Histone-fold
IPR007125Histone_H2A/H2B/H3
Vocabulary: molecular function
TermDefinition
GO:0003677DNA binding
GO:0046982protein heterodimerization activity
Vocabulary: cellular component
TermDefinition
GO:0000786nucleosome
GO:0005634nucleus
GO:0005694chromosome
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000558Histone H2BPRINTSPR00621HISTONEH2Bcoord: 77..94
score: 77.67
coord: 36..54
score: 81.25
coord: 94..107
score: 91.63
coord: 107..120
score: 95.85
coord: 55..75
score: 78.68
IPR000558Histone H2BSMARTSM00427h2b3coord: 26..122
e-value: 5.4E-73
score: 258.5
IPR000558Histone H2BPANTHERPTHR23428HISTONE H2Bcoord: 6..124
IPR000558Histone H2BPROSITEPS00357HISTONE_H2Bcoord: 91..113
IPR007125Histone H2A/H2B/H3PFAMPF00125Histonecoord: 5..99
e-value: 1.0E-22
score: 80.9
IPR009072Histone-foldGENE3DG3DSA:1.10.20.10coord: 2..124
e-value: 6.6E-60
score: 202.6
IPR009072Histone-foldSUPERFAMILYSSF47113Histone-foldcoord: 15..124
NoneNo IPR availablePANTHERPTHR23428:SF125HISTONE H2B 3-RELATEDcoord: 6..124